5KAFU

Rt xfel structure of photosystem ii in the dark state at 3.0 a resolution
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
97
structure length
97
Chain Sequence
ELVNVVDEKLGTAYGEKIDLNNTNIAAFIQYRGLYPTLAKLIVKNAPYESVEDVLNIPGLTERQKQILRENLEHFTVTEVETALVEGGDRYNNGLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 24
structure length 97
sequence length 97
chains with identical sequence u
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF06514 PsbU Photosystem II 12 kDa extrinsic protein (PsbU)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.320 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Photosystem II 12 kDa extrinsic protein 5kafU01
2DUYA 5B66U 5B5EU 3KZIU 5H2FU 1S5LU 4UB6U 2AXTU 5KAFU 5GTHU 3A0HU 3WU2U 4UB8U 4IL6U 5KAIU 5GTIU 5E79U 5TISU 4PJ0U 3A0BU
chains in the Genus database with same CATH superfamily
9ICXA 3F2CA 3PV8A 3DEEA 4OJLA 1ZQMA 3K1RB 3RJJA 3RRGA 3RJIA 2ZIXA 3D2NA 2NYVA 3I1YA 3C5GA 4J9KA 4I28A 1B22A 3QU2A 5EE9A 4F4WA 2R8JA 3H40A 4I2EA 4NY8A 1XO1A 2KMDA 2E3TA 1OXJA 2KK0A 4NL9C 2XO7A 2IBKA 1ED1A 4J9SA 1N62A 4J9OA 5CR0A 9ICQA 2AJQA 1SV0C 2VANA 1C20A 3E58A 1T4GA 4Y2XA 3WK6A 1ZOLA 4JWMA 3Q8SB 4XA5A 2DGZA 2JGAA 3Q8RB 9ICAA 4Q43A 4PZNA 1IG6A 3ZDEA 4J03A 5J0UA 4FBUA 3C2MA 5J2AA 2WFAA 1AQ6A 3BQ0A 5AK5A 5KNIA 4OD0A 5DB7A 2XICA 9ICJA 1NJZA 4UB5A 2BCUA 4OJ5A 5KFZA 2UVRA 3GIIA 1TK5A 4J9NA 4EYIB 4BJQA 1HUOA 2QB1A 1SWWA 3SAFA 1NK9A 2BKEA 4CDGA 1XC9A 2DWQA 1NK7A 3IN5A 3EYZA 1JROA 1JX4A 2ASJA 4U6PA 4KLQA 1JMSA 2GOLA 4NLKA 2W54A 1F5SA 4NXZA 4ED7A 4MHVA 4I27A 3JPSA 9ICBA 1HEKA 1V97A 4P0PA 2ZXIA 2XGQA 5EWFA 4F5NA 5DBBA 5J0PA 5ALIA 3RBEA 4RQ8A 5CRXA 1WCLA 2BHNA 3M6KA 1QSSA 3H7IA 1BPYA 3ORYA 3ZDBA 4NJ8A 1Q3VA 1SB3C 4NLGA 3QXGA 1V38A 1XS9D 2W43A 1A0PA 5KFFA 3BZCA 5AI5A 3IHQB 2XY6A 9ICMA 1RDFA 1S5LU 4B9UA 1Z19A 1L3VA 3RJEA 1FFUA 4CCHA 4BWMA 3SR6A 2O6KA 3EPGA 3ZI4A 3TARA 3WK4A 2FLLA 5DQHA 3MR3A 3GQCA 2RHFA 7ICEA 8ICGA 4CF5A 2JZBA 2Y0SF 4PPXA 5L1MA 3WKEA 4F50A 4B9LA 3QNMA 1SKWA 4QZCA 4J9MA 3TQ1A 1ZQXA 3MDCA 4F4ZA 1F44A 1QQ5A 3UQ2A 4NL9A 2H3QA 4ECZA 4O5CA 4F5OA 5DKWA 5ALFA 4I2GA 3D2SA 1JI7A 5KTQA 2DFLA 1SV0A 4PZOA 3MGIA 2WF9A 1A76A 1ZJNA 2LBOA 2V4RA 4YVZA 4IL6U 4K4GA 4QZBA 9ICHA 3RF9A 2F3NA 3KD3A 5A0LA 5ALSA 1ZJMA 3TFRA 1V9PA 2P35A 3F53A 4Y2TA 5EWGA 2BQRA 1PZNA 4US8A 2KKPA 2K60A 4EENA 2KV2A 4ECQA 5ALDA 2UVVA 1VLBA 2XY5A 1U48A 3NVZA 4KMOB 1RQLA 2ZIXB 4DS4A 3M1YA 3E0FA 1ZQYA 2OXOA 4Q45A 3IDWA 1IM4A 2W03A 7ICMA 5KFIA 3M9MB 5HR6A 2C2DA 5L1KA 4F3OA 1RXWA 4ED1A 1QSLA 7ICFA 3HWTA 1PK1A 5L1LA 4QZIA 3QU5A 1VDVA 4CF4A 3RJHA 1KBUA 3L3FX 4MEXA 4NLNA 4TUSA 9ICLA 3V72A 4IS7A 1LKYB 4ACOA 4WJ3B 1A77A 2WB1C 3FDSA 5J2JA 3LDAA 1P7DA 1PK3A 5ALQA 2CRXA 4IRKA 2KVSA 1TAMA 2KJ9A 4DSLA 4M47A 4PL1A 4YD1A 2DKXA 4RUCA 2G08A 8ICIA 3FM9A 1KL9A 2H3IA 2HI0A 5C0YA 3HKZF 1ZQKA 4EYHB 4ELTA 5KFPA 2B21A 4Q8EA 2UVUA 4ICAA 2J6UA 1Z00B 4TUPA 4PGXA 1RYUA 5ALNA 1NK5A 5KG1A 1D8YA 1SXEA 3NGDA 3V6JA 4OJPA 8ICVA 1MSWD 3SAHA 3RH4A 4O3RA 1WYGA 2KJ5A 2B6GA 2QB0B 3PVXA 1N63A 2LM4A 3Q8LA 4LZDA 4QIWF 4YR0A 4DWIA 2YMPA 4Y2SA 5ALEA 4ZOHC 4YR3A 5AM0A 1S8OA 4KTQA 1ZQ1C 3RB4A 2EAMA 4AYBC 3MBYA 1JRPA 3HP6A 2FJ6A 3BJYA 2LYHA 3BDPA 4ECSA 2LM1A 1SIJA 1QQ7A 4IQUA 2KIWA 3KHRA 1DK3A 4DLEA 2AU0A 2NRWA 4R65A 2MSNA 2RQ5A 2WHEA 3BQTA 1Q8KA 2AQ4A 5J0SA 4Y2PA 3GIKA 4GXJA 1MN8A 4OJOA 2A1AA 5AM4A 4I29A 4F93B 4KX5A 1BGXT 1X66A 2HMXA 7ICKA 1FEZA 3M8SA 4R8UB 4J9QA 4ED2A 3WKBA 2JHDA 5AM2A 1UHUA 4KLMA 2BPCA 1T8EA 3PR4A 2PI4A 4UBBA 1ZD2P 4O0IA 1Z4OA 4PJ0U 8ICEA 3MR5A 5ALWA 1YZ6A 5HHIA 5J2IA 5FP0A 1X6JA 2ES6A 2E1EA 1L7MA 4O5EA 5F9NA 2FPLA 1TK0A 4RNMA 1SKRA 4DL7A 2HCFA 7ICTA 5KG4A 2BCVA 3ZDCA 7ICOA 4LZGA 2YTUA 1X9MA 3B9JA 3RJFA 1X40A 5CB1A 5DLGA 3V6KA 2I1QA 3PMLA 4Z6FA 1CI4A 1OUQA 1TE2A 4I2AA 5EE3A 1T7PA 3D2QA 4DL4A 4HAIA 5EOZA 4KLGA 4QWCA 1KN5A 4PHPA 4PGYA 2C22A 4ECRA 4BDPA 4EEKA 5KT7A 2Y1JA 5KFOA 3PW4A 1EXNA 3IV6A 3BS5B 1ZRMA 3V7LA 4QWBA 4DOCA 1H38A 5H2FU 2W3SA 3PW7A 1Z1BA 1ZQUA 2LMRA 3G6YA 5J0TA 2IA6A 5DG9A 4NWIA 5KFWA 4RQ7A 3H4BA 1K5OA 2ZTEA 5TISU 8ICWA 1IIPA 9ICFA 2JV3A 1L3UA 2Y9TA 7ICPA 5J2FA 2V9WA 3C2LA 3BQ2A 1KEJA 4X5VA 3HW8A 2BQ3A 5DB8A 2K4PA 2AGQA 8ICNA 2EANA 8ICAA 5KT3A 2KN7A 1ZQQA 2KSOB 5E79U 2NRTA 4UW9A 4DF4A 5L1IA 4B9NA 1CRXA 2NO5A 9ICSA 3L4PA 5KFUA 3HT3A 8ICMA 5KFJA 5J29A 1TFRA 2F44A 2HOFA 2FMSA 2WTFA 5DG8A 1KW4A 2LYBA 4M9JA 1DRGA 2C2RA 3G6VA 4RQ5A 5KFAA 5KFHA 2Z7JA 3V7KA 3UXNA 4FS1A 2KHVA 2GWSA 5ALZA 4TQRA 3F2BA 3NVVA 4BX9C 5KFQA 1DOQA 5KFGA 2HVIA 4R64A 7ICGA 3S6JA 1KLNA 4GIBA 2KFNA 3H8SA 1UT5A 4O3MA 1RYRA 1N60A 3ZD8A 4IR1A 3HRDD 2NRXA 4RQ3A 1VJ5A 3N4MB 5DQIA 1BPBA 5HMMA 4UB1A 3RJKA 5DB9A 4F5QA 2MA1A 3WKCA 4RU9A 4RQNA 1L7OA 2WAQF 1ZD5A 2R8GA 4DFKA 4F5RA 3QEAZ 3AMZA 5HR7A 4E0DA 4YMNA 2W3RA 2BCRA 1ZQBA 3GDXA 3RBDA 5ALTA 1D9DA 3RJGA 3OPXA 5J8YA 1N2XA 1D8LA 5KFTA 4CF3A 3D6JA 2FMPA 1ZQJA 2HHXA 4DS5A 4OJ6A 3UPQA 1S77D 9ICOA 4DEZA 5ALJA 4FZNA 1J2NA 4OO1J 2KTQA 3QX7A 1DGJA 2KD1A 2IHNA 5JU5A 2FMQA 2ZTCA 2K4HA 5HHHA 5AKJA 4EZ9A 1LKYA 1PVPA 4Q8FA 1N61A 5AKZA 3HPOA 4IQTA 4UAUA 2OH2A 1MA7A 3OGUA 5AI6A 1XSNA 2H3FA 4DSFA 3GV5B 2WF7A 5GTHU 1NK4A 3K75D 2F8LA 2KZZA 4KN7A 3QUCA 4Y2VA 2QKQA 5ALKA 1JIHA 2F76X 4DFPA 4M9GA 5B66U 2DPIA 3MR6A 2OWOA 1Z00A 3JPQA 1UPHA 1M6YA 2HHTA 3PY8A 4DL2A 4M9LA 1JUDA 3RH5A 3QE9Y 4CE6A 1QCKA 1HIWA 2QB0A 4F4KA 2WB1F 2LYAA 2NRZA 4KLSA 5AKHA 1RXVA 5B5EU 4ECWA 3ISDA 3C5FA 2H3ZA 3MGHA 2HBMA 3M6ZA 3J81j 5AKEA 5KG5A 2MUTB 3H8WA 1BNPA 2LI6A 1ZQWA 3HILA 2NO4A 4XQ8A 9ICGA 1KKXA 4LVSA 4JMUA 4B6JA 5AI9A 1NKBA 4ED8A 4KX3A 3PW5A 2MU2A 3F5AA 4KLUA 8ICPA 4EELA 2HOIA 3GU3A 4DQIA 4NLBA 5AM1A 1JALA 2G06A 2PMZF 4ED0A 1T3NA 5KG0A 3T5JA 2G5HB 3TI0A 3BQ1A 3N7RC 5DGBA 5DQGA 3LWLA 5J0XA 4FO6A 3UMCA 9ICKA 3B0YA 2R8HA 3KOOA 1X9SA 1SXDA 4AYBF 5J2EA 2BDUA 5AKXA 1OW5A 2PXIA 2ZJ5A 4R8UA 3WKDA 4JV1A 4PL2A 2YX8A 4DF8A 5CWRA 5KFSA 1UA1A 2WF6A 1ZQPA 3ETRA 2HOQA 5IIOA 3C29A 2P66A 1ZQTA 5DDMA 3MGVA 4DOAA 2W11A 5IIKA 2RP5A 5J2DA 4KLEA 3NVYA 4YN4A 4QZEA 2MRLA 4DSJA 2BQUA 3PNCA 3RR7A 4HYKA 1ZRNA 3RB3A 1BPDA 4QNLA 1COKA 1FIQA 1LB2B 4DL6A 2PKEA 4B9SA 3HJEA 2M0NA 2EH9A 1TAUA 3N97B 2P6UA 2ZIUB 4TUQA 2DKZA 4FS2A 4KN4A 1RQNA 2VA3A 3QEBZ 2CN1A 2XI9A 4P4MA 3OSNA 4UAYA 3CNHA 3BQ7A 2KFZA 3TAPA 2H3VA 3KKAC 4QWDA 5JRTA 3AQEA 2PFNA 3SD7A 4G9BA 3GFKB 2B0CA 4KLJA 2D8CA 3LVWA 4QWEA 5J2CA 3BS5A 2HHVA 3I28A 2ALZA 1X42A 1N5WA 4OCZA 3PW0A 1TV9A 3UMGA 3F5EA 4F8RA 2KZMA 4M6WB 1XSLA 1RYSA 4B9TA 3UXPA 2BR0A 5KFDA 2IOFK 2LKYA 4KMUA 4RPXA 1ZQIA 1L3SA 3C21A 8ICCA 2GLEA 3KZXA 1WWVA 1X9WA 2XIDA 2OEHA 2W9BB 7ICJA 5J0YA 5KFXA 3C1YA 1L7NA 2KKVA 1XWLA 4DFMA 2RLTA 3WU2U 4B9VA 2VA2A 3QU4A 3B0XA 2PFOA 1NKEA 2KSOA 4UAWA 2OHFA 3C2KA 5HP4A 4FZLA 3A0BU 4RNNA 3LYSA 5BOLA 5IILA 3CRXA 2DQNB 5J0WA 4YR2A 4JV2A 5DGAA 2XC9A 2LHTA 4QZFA 2A1JB 4TQSA 1ZETA 3VCBA 1ZQZA 1B43A 3ETLA 5AKKA 2ZJAA 7ICVA 4CNQA 4P4PA 1RZTA 4O3NA 4UASA 2AGOA 2ZUBA 4DO9A 2BPGA 3QU9A 8ICJA 2YQEA 3SI8A 1NK8A 1Z3EB 5ALPA 8ICQA 4DFJA 4J9RA 3GILA 1ZQAA 4DL3A 3FAHA 2KVCA 1QTMA 2EAOA 2WF8A 4BWJA 1KRPA 4GXIA 3GZFA 2G0AA 5ALLA 3ISBA 3KBBA 4F72A 2PI5A 1ZQEA 1ZQGA 3EWAA 4GC7A 4FZMA 4UAZA 5D4BA 1DGSA 4MFFA 4I2IA 4UBCA 1U4BA 1J97A 3PO5A 4EZ6A 4R63A 2P6RA 2NRVA 3R9KA 2JR5A 2FLPA 5D49A 5KFRA 5ALGA 5IINA 3SMVA 4XRHA 1COOA 5AIAA 2KHQA 1AROP 4YFKA 2XVTA 5J2BA 3KKAA 3KHGA 2Q4TA 2W04A 5KAFU 1XU4A 2G09A 3ALRA 5BOMA 1URJA 5L9XA 3SEIA 4M9HA 5AK6A 9ICUA 5DBCA 5G5GA 4KLLA 4BGDA 5C5JA 4K4IA 3QUQA 2YY6A 4O3PA 3VC8A 2QLTA 3ZDAA 1S0VA 4QW9A 3OJSA 2K8BB 3PSIA 2E8MA 5KL8B 1RPLA 7ICLA 1UT8A 1ZQLA 2HHSA 1CEZA 5KT2A 3QUTA 1N56A 4IC9A 2JH7A 4NM2A 2I9GA 2E5SA 3H0MB 2RRDA 3KFUF 2AXTU 4JV0A 2PFQA 1ZD4A 4USAA 3C1ZA 4ECXA 3T79A 2IHMA 4I2DA 4PGQA 3BS7A 5ALUA 4ELVA 4DQSA 3JPOA 3Q8PB 3OJUA 3WK9A 2ZJ8A 3MABA 2MUTA 5J2KA 3WKAA 1S10A 3SQIA 3T5KA 1N5XA 1TKDA 2ODGA 1XO0A 5J0QA 4I2BA 5KFKA 1UQVA 2E8PA 1YZ7A 2A19A 2E1FA 2GO7A 4PHAA 2HSZA 2ZIWB 1UA0A 1NJWA 4C8LA 4KLTA 2BZFA 4C80A 2BCQA 1B4FA 2EDUA 3H0LB 4IR9A 4ECVA 4Y2QA 2ATLA 3GV7B 5KT6A 4C8MA 9ICEA 2FPMA 5KFYA 1FFVA 3LWMA 1HJPA 4RQ4A 3EUB2 2F1JA 4FE3A 5KG6A 3EW9A 2VKQA 3OSPA 1KSPA 8ICRA 2W9AA 4QIWC 2GH1A 1K1QA 1ZXIA 4MFAA 3C23A 1D8BA 9ICWA 4BXOA 4DFDA 2XY7A 4O3OA 1ZQVA 3CP8A 3AL0B 5KFVA 3IP4B 5HNKA 4DCCA 4NV0A 2FLNA 3PMNA 2VJ4A 3TKAA 5TZVA 5AKGA 4P0QB 5AHXA 3NRWA 3ZD9A 2R8KA 4BUGA 4B9MA 3K4GA 1N48A 4K4HA 4DQRA 4PHDA 4RQ0A 9ICPA 5AIBA 3ED5A 2ZIUA 4RT3A 1U47A 2BCSA 5ALYA 2IMWP 1IXRA 2E8NA 1BNOA 9ICNA 2IOHA 1NOMA 8ICSA 2EQYA 5KFBA 4EEYA 1RM6C 3ZDDA 1ZQNA 3RAQA 4F2SA 7ICQA 4RT2A 1PVRA 3NUQA 3T3FA 1QQ6A 1ZQHA 1ZQCA 3WK7A 2XGPA 2JEFA 2JEGA 8ICTA 2KE7A 2FE9A 3H0RB 2OCEA 3RTVA 1TVAA 3OHAA 2AHOB 3KZIU 1V85A 1X6IA 1RG6A 1F0MA 4J9PA 3PX0A 2JEJA 4M6WA 1S0NA 7ICNA 2ZIVB 8ICXA 1TK8A 3TADC 3FC4A 5KFEA 4F2RA 3UXOA 3QZ8A 4UB3A 3AM9A 2JXJA 2DUYA 3PO4A 2W9BA 3PZPA 1S0MA 2J6TA 9ICVA 5KFCA 2CPRA 4RQ6A 1D9FA 1ZD3A 3GIJA 3I76A 1J2MA 1UCVA 5ALHA 4M0AA 5KT5A 2ISOA 2XCAA 2WF5A 3NVWA 2YMMA 3PR5B 3SV4A 1NI3A 2C28A 5AK4A 2UVWA 1PUZA 5ALRA 2QARB 4CRXA 3TFSA 2VJ5A 3PSPA 2IOFA 4P4OA 2W8LA 3QU7A 2A3VA 1T94A 2KP7A 7ICRA 4PHEA 3L5KA 4MFCA 3WK5A 2A1JA 5KFLA 4KLDA 3Q8KA 5KG3A 4EBCA 3H8JA 4U7CA 5IIJA 2DL0A 3LK9A 2ZG6A 4C8NA 2JRZA 2F77X 5IIMA 1BVSA 5AM5A 9ICTA 4NLCA 5ALMA 4DLGA 3PW2A 1TAQA 5J0RA 1O08A 5EE0A 3FYHA 4Y2JA 1QLNA 5ALXA 1A6SA 2HW3A 4AP9A 2AGPA 4YG2A 3TANA 2CXYA 1NZBA 2F1IA 4C0ZA 4Z6DA 4QZDA 4I2FA 4G3IA 3MDAA 3SENA 2M9NA 4J9LA 2ZXHA 1L5UA 5AKIA 9ICIA 1SL2A 4F5PA 4ECTA 4EX6A 4RQ2A 3RB0A 1SZHA 3UMBA 5AI8A 5DB6A 5CJ7A 4O9MA 4Y2UA 3AQFA 9ICCA 1ECWA 5AI0A 5J0OA 4IRCA 8ICFA 1K1SA 4UQGA 1JXLA 3PSFA 1DXSA 1MQ3A 2ISPA 2E8OA 3AU6A 5DBAA 3M7DA 4M2YA 5EE1A 1ZQRA 5K4LA 4C4SA 1NJYA 5JTIA 8ICYA 3GIMA 4NLZA 2YN4A 2R8IA 1ZQOA 1HUZA 1IV8A 2DBYA 2Y9UA 1Q46A 1KFTA 3NASA 2YB4A 5KG2A 3OTQA 4Y2YA 2KIVA 4BXOB 2HDOA 2MAXA 3PX6A 8ICBA 2Q0ZX 2F8KA 2VA8A 4CGZA 3NRZA 5AK3A 4DOBA 3O0FA 2EAPA 4I2JA 3TADA 2WAQC 4C4RA 3BZKA 4LJXA 5GTIU 2HHQA 3H4DA 3RB6A 3N7SC 4UATA 2EZZA 3IG8A 7ICIA 2H5XA 5CP2A 4JK1A 2J6SA 4QW8A 2HBKA 1BPZA 4QZ8A 3PSTA 1S76D 1KQQA 3SAGA 2R18A 2W9CB 2DPJA 2ZTDA 3N7PD 4UB8U 3SV3A 4DSEA 1B0XA 4QZGA 4KLIA 1KTQA 4ZH4A 3TAQA 3C28A 4C8OA 8ICOA 1Z4NA 3ICXA 3RRHA 3KTQA 5KFMA 2K89A 4Z6EA 4O3QA 8ICHA 3A0HU 3JPPA 5IIIA 5AKLA 2K4EA 2EZXA 4ELUA 1NK6A 5EWEA 3Q8MA 4TURA 4ECUA 2DF4B 2ZIWA 4ECYA 1ZQFA 3NTUA 3EZ5A 1BPEA 4RQMA 2F1HA 4MF8A 4DQPA 5ALVA 1LVHA 3MR2A 2W9MA 3KHLA 2ESEA 4EBDA 7ICSA 5KG7A 4JUZA 3RH6A 4C4TA 4F92B 1Y88A 1SKSA 5J2HA 2L5YA 2BGWA 3TACB 2I5HA 2HBJA 3U26A 1KFDA 3QYPA 3LVVA 4O5KA 4YMMA 3MFIA 2BPFA 2JEIA 4KLHA 3CYMA 2FI1A 1QSYA 5AKYA 4DSIA 1U45A 4GFJA 2G07A 1NNLA 1X2IA 1SZPA 1JN3A 3MFHA 3ISCA 3ONNA 1ZQSA 4YMOA 2K8CB 2ASLA 7ICUA 3K1ZA 2PFPA 2VIXA 4YXJA 4Z6CA 3AN1A 4P0QA 4M04A 4F4XA 1ZYQA 5J2GA 4I2HA 1XNSA 2YMQA 3JPTA 1T3QA 4IRDA 5T14A 3HX0A 3QUBA 4YXMA 2PMZC 2KEYA 1FO4A 2C2EA 1U49A 3KHHA 4RPYA 1DK2A 1L8OA 3UM9A 4DL5A 1S0OA 4KITB 4P0PB 4FBTA 5CA7A 2KNJA 2HBLA 3M9OB 2RDIA 4QJFB 1WCNA 4UAVA 1SL0A 4IQWA 5KFNA 4RPZA 1SGGA 4YD2A 4YQWA 1QH9A 2RDJA 4RNOA 2Y0SC 2AH5A 1MQ2A 3M9NB 4MF2A 2YMLA 1KDHA 4ED6A 1SWVA 5CHGA 8ICZA 1X9XA 4UB6U 4GXKA 4EX7A 2W8KA 4RUAA 1NZPA 1WWUA 2G5IB 2ZIVA 2JH1A 5BPCA 5F9LA 5DDYA 1PVQA 5JUMA 3V6HA 2LPEA 1BPXA 2FPKA 3IM1A 1L6NA 1LV5A 4C7YA 2K8AA 4US9A 3PX4A 3OHBA 2HHWA 3N28A 5DG7A 2N1RA 2JZBB 4RZRA 2HHUA 2AQ0A 3JPNA 4F4YA 7ICHA 2QARA 1SV4A 1KFSA 4ED3A 4KLFA 2F2AB 2FDRA 1S97A 3THVA 4C8KA 4QZHA 2I6XA 1XSPA 3SYZA 2KZ3A 4QWAA 3SZ2A 1SL1A 1WG8A 3EPIA 4YP3A 1CUKA 5AI4A 5KAIU 3RFAA 2EZYA 2KICA 3V7JA 8ICUA 4UB2A 5HMLA 3E2EA 9ICRA 4UB4A 4Q44A 2BDPA 5J8YC 3JPRA 4M9NA 3DDHA 4R66A 5CEHA 4JB3A 1U9LA 5KL1B 4JWNA 5AICA 4DQQA 4EBEA 2OYYA 2JMGA 3CW2C 4Y2RA 4NM1A 4P2HA 1Q3UA 3MC1A 2D6FC 4A8EA 3H8MA 4GLXA 2D3DA 4C7ZA 2KOBA 2Y1IA 4YCXA 4KLOA 2NV3A 3DV9A 4QZAA 5AM3A 3HKZC 3WK8A 1S9FA 1ZQDA 1L8LA 1PK1B 2W55A 2KJ8A 1MC8A 4MEYA 5F3XB 3Q8QB 3F2DA 3AU2A 8ICKA 2KG5A 3AUOA 3T5LA 3RR8A 5G5HA 2V4QA 2HVHA 1L7PA 5ALOA 2OM6A 2ZUCA 4FFDA 3NS1A 3IRUA 1YT3A 4I2CA 3IG5A 2YB1A 4RQ1A 4GC6A 4DSKA 2ASDA 4IQVA 2W7OA 5D46A 5L1JA 1GO3F 1O03A 1NK0A 4F91B 4PH5A 2K4IA 1JXEA 1Z1VA 4O3SA 1NKCA 3GV8B 3UQ0A 2ZUDA 1NJXA 2XCPA 4XUSA 2W9CA 4F71A 5KT4A 8ICLA 3T5HA 1L3TA 4UARA 1WUDA 3QZ7A 3RAXA 3AEVA 2W7PA 5DLFA 4QZ9A 3M8RA 3G6XA 1C7YA
chains in the Genus database with same CATH topology
2DUYA 5B66U 5B5EU 3KZIU 5H2FU 1S5LU 4UB6U 2AXTU 5KAFU 5GTHU 3A0HU 3WU2U 4UB8U 4IL6U 5KAIU 5GTIU 5E79U 5TISU 4PJ0U 3A0BU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DUY A;  5B66 U;  5B5E U;  3KZI U;  5H2F U;  1S5L U;  4UB6 U;  2AXT U;  5KAF U;  5GTH U;  3A0H U;  3WU2 U;  4UB8 U;  4IL6 U;  5KAI U;  5GTI U;  5E79 U;  5TIS U;  4PJ0 U;  3A0B U; 
#chains in the Genus database with same CATH topology
 9ICX A;  3F2C A;  3PV8 A;  3DEE A;  4OJL A;  1ZQM A;  3K1R B;  3RJJ A;  3RRG A;  3RJI A;  2ZIX A;  3D2N A;  2NYV A;  3I1Y A;  3C5G A;  4J9K A;  4I28 A;  1B22 A;  3QU2 A;  5EE9 A;  4F4W A;  2R8J A;  3H40 A;  4I2E A;  4NY8 A;  1XO1 A;  2KMD A;  2E3T A;  1OXJ A;  2KK0 A;  4NL9 C;  2XO7 A;  2IBK A;  1ED1 A;  4J9S A;  1N62 A;  4J9O A;  5CR0 A;  9ICQ A;  2AJQ A;  1SV0 C;  2VAN A;  1C20 A;  3E58 A;  1T4G A;  4Y2X A;  3WK6 A;  1ZOL A;  4JWM A;  3Q8S B;  4XA5 A;  2DGZ A;  2JGA A;  3Q8R B;  9ICA A;  4Q43 A;  4PZN A;  1IG6 A;  3ZDE A;  4J03 A;  5J0U A;  4FBU A;  3C2M A;  5J2A A;  2WFA A;  1AQ6 A;  3BQ0 A;  5AK5 A;  5KNI A;  4OD0 A;  5DB7 A;  2XIC A;  9ICJ A;  1NJZ A;  4UB5 A;  2BCU A;  4OJ5 A;  5KFZ A;  2UVR A;  3GII A;  1TK5 A;  4J9N A;  4EYI B;  4BJQ A;  1HUO A;  2QB1 A;  1SWW A;  3SAF A;  1NK9 A;  2BKE A;  4CDG A;  1XC9 A;  2DWQ A;  1NK7 A;  3IN5 A;  3EYZ A;  1JRO A;  1JX4 A;  2ASJ A;  4U6P A;  4KLQ A;  1JMS A;  2GOL A;  4NLK A;  2W54 A;  1F5S A;  4NXZ A;  4ED7 A;  4MHV A;  4I27 A;  3JPS A;  9ICB A;  1HEK A;  1V97 A;  4P0P A;  2ZXI A;  2XGQ A;  5EWF A;  4F5N A;  5DBB A;  5J0P A;  5ALI A;  3RBE A;  4RQ8 A;  5CRX A;  1WCL A;  2BHN A;  3M6K A;  1QSS A;  3H7I A;  1BPY A;  3ORY A;  3ZDB A;  4NJ8 A;  1Q3V A;  1SB3 C;  4NLG A;  3QXG A;  1V38 A;  1XS9 D;  2W43 A;  1A0P A;  5KFF A;  3BZC A;  5AI5 A;  3IHQ B;  2XY6 A;  9ICM A;  1RDF A;  1S5L U;  4B9U A;  1Z19 A;  1L3V A;  3RJE A;  1FFU A;  4CCH A;  4BWM A;  3SR6 A;  2O6K A;  3EPG A;  3ZI4 A;  3TAR A;  3WK4 A;  2FLL A;  5DQH A;  3MR3 A;  3GQC A;  2RHF A;  7ICE A;  8ICG A;  4CF5 A;  2JZB A;  2Y0S F;  4PPX A;  5L1M A;  3WKE A;  4F50 A;  4B9L A;  3QNM A;  1SKW A;  4QZC A;  4J9M A;  3TQ1 A;  1ZQX A;  3MDC A;  4F4Z A;  1F44 A;  1QQ5 A;  3UQ2 A;  4NL9 A;  2H3Q A;  4ECZ A;  4O5C A;  4F5O A;  5DKW A;  5ALF A;  4I2G A;  3D2S A;  1JI7 A;  5KTQ A;  2DFL A;  1SV0 A;  4PZO A;  3MGI A;  2WF9 A;  1A76 A;  1ZJN A;  2LBO A;  2V4R A;  4YVZ A;  4IL6 U;  4K4G A;  4QZB A;  9ICH A;  3RF9 A;  2F3N A;  3KD3 A;  5A0L A;  5ALS A;  1ZJM A;  3TFR A;  1V9P A;  2P35 A;  3F53 A;  4Y2T A;  5EWG A;  2BQR A;  1PZN A;  4US8 A;  2KKP A;  2K60 A;  4EEN A;  2KV2 A;  4ECQ A;  5ALD A;  2UVV A;  1VLB A;  2XY5 A;  1U48 A;  3NVZ A;  4KMO B;  1RQL A;  2ZIX B;  4DS4 A;  3M1Y A;  3E0F A;  1ZQY A;  2OXO A;  4Q45 A;  3IDW A;  1IM4 A;  2W03 A;  7ICM A;  5KFI A;  3M9M B;  5HR6 A;  2C2D A;  5L1K A;  4F3O A;  1RXW A;  4ED1 A;  1QSL A;  7ICF A;  3HWT A;  1PK1 A;  5L1L A;  4QZI A;  3QU5 A;  1VDV A;  4CF4 A;  3RJH A;  1KBU A;  3L3F X;  4MEX A;  4NLN A;  4TUS A;  9ICL A;  3V72 A;  4IS7 A;  1LKY B;  4ACO A;  4WJ3 B;  1A77 A;  2WB1 C;  3FDS A;  5J2J A;  3LDA A;  1P7D A;  1PK3 A;  5ALQ A;  2CRX A;  4IRK A;  2KVS A;  1TAM A;  2KJ9 A;  4DSL A;  4M47 A;  4PL1 A;  4YD1 A;  2DKX A;  4RUC A;  2G08 A;  8ICI A;  3FM9 A;  1KL9 A;  2H3I A;  2HI0 A;  5C0Y A;  3HKZ F;  1ZQK A;  4EYH B;  4ELT A;  5KFP A;  2B21 A;  4Q8E A;  2UVU A;  4ICA A;  2J6U A;  1Z00 B;  4TUP A;  4PGX A;  1RYU A;  5ALN A;  1NK5 A;  5KG1 A;  1D8Y A;  1SXE A;  3NGD A;  3V6J A;  4OJP A;  8ICV A;  1MSW D;  3SAH A;  3RH4 A;  4O3R A;  1WYG A;  2KJ5 A;  2B6G A;  2QB0 B;  3PVX A;  1N63 A;  2LM4 A;  3Q8L A;  4LZD A;  4QIW F;  4YR0 A;  4DWI A;  2YMP A;  4Y2S A;  5ALE A;  4ZOH C;  4YR3 A;  5AM0 A;  1S8O A;  4KTQ A;  1ZQ1 C;  3RB4 A;  2EAM A;  4AYB C;  3MBY A;  1JRP A;  3HP6 A;  2FJ6 A;  3BJY A;  2LYH A;  3BDP A;  4ECS A;  2LM1 A;  1SIJ A;  1QQ7 A;  4IQU A;  2KIW A;  3KHR A;  1DK3 A;  4DLE A;  2AU0 A;  2NRW A;  4R65 A;  2MSN A;  2RQ5 A;  2WHE A;  3BQT A;  1Q8K A;  2AQ4 A;  5J0S A;  4Y2P A;  3GIK A;  4GXJ A;  1MN8 A;  4OJO A;  2A1A A;  5AM4 A;  4I29 A;  4F93 B;  4KX5 A;  1BGX T;  1X66 A;  2HMX A;  7ICK A;  1FEZ A;  3M8S A;  4R8U B;  4J9Q A;  4ED2 A;  3WKB A;  2JHD A;  5AM2 A;  1UHU A;  4KLM A;  2BPC A;  1T8E A;  3PR4 A;  2PI4 A;  4UBB A;  1ZD2 P;  4O0I A;  1Z4O A;  4PJ0 U;  8ICE A;  3MR5 A;  5ALW A;  1YZ6 A;  5HHI A;  5J2I A;  5FP0 A;  1X6J A;  2ES6 A;  2E1E A;  1L7M A;  4O5E A;  5F9N A;  2FPL A;  1TK0 A;  4RNM A;  1SKR A;  4DL7 A;  2HCF A;  7ICT A;  5KG4 A;  2BCV A;  3ZDC A;  7ICO A;  4LZG A;  2YTU A;  1X9M A;  3B9J A;  3RJF A;  1X40 A;  5CB1 A;  5DLG A;  3V6K A;  2I1Q A;  3PML A;  4Z6F A;  1CI4 A;  1OUQ A;  1TE2 A;  4I2A A;  5EE3 A;  1T7P A;  3D2Q A;  4DL4 A;  4HAI A;  5EOZ A;  4KLG A;  4QWC A;  1KN5 A;  4PHP A;  4PGY A;  2C22 A;  4ECR A;  4BDP A;  4EEK A;  5KT7 A;  2Y1J A;  5KFO A;  3PW4 A;  1EXN A;  3IV6 A;  3BS5 B;  1ZRM A;  3V7L A;  4QWB A;  4DOC A;  1H38 A;  5H2F U;  2W3S A;  3PW7 A;  1Z1B A;  1ZQU A;  2LMR A;  3G6Y A;  5J0T A;  2IA6 A;  5DG9 A;  4NWI A;  5KFW A;  4RQ7 A;  3H4B A;  1K5O A;  2ZTE A;  5TIS U;  8ICW A;  1IIP A;  9ICF A;  2JV3 A;  1L3U A;  2Y9T A;  7ICP A;  5J2F A;  2V9W A;  3C2L A;  3BQ2 A;  1KEJ A;  4X5V A;  3HW8 A;  2BQ3 A;  5DB8 A;  2K4P A;  2AGQ A;  8ICN A;  2EAN A;  8ICA A;  5KT3 A;  2KN7 A;  1ZQQ A;  2KSO B;  5E79 U;  2NRT A;  4UW9 A;  4DF4 A;  5L1I A;  4B9N A;  1CRX A;  2NO5 A;  9ICS A;  3L4P A;  5KFU A;  3HT3 A;  8ICM A;  5KFJ A;  5J29 A;  1TFR A;  2F44 A;  2HOF A;  2FMS A;  2WTF A;  5DG8 A;  1KW4 A;  2LYB A;  4M9J A;  1DRG A;  2C2R A;  3G6V A;  4RQ5 A;  5KFA A;  5KFH A;  2Z7J A;  3V7K A;  3UXN A;  4FS1 A;  2KHV A;  2GWS A;  5ALZ A;  4TQR A;  3F2B A;  3NVV A;  4BX9 C;  5KFQ A;  1DOQ A;  5KFG A;  2HVI A;  4R64 A;  7ICG A;  3S6J A;  1KLN A;  4GIB A;  2KFN A;  3H8S A;  1UT5 A;  4O3M A;  1RYR A;  1N60 A;  3ZD8 A;  4IR1 A;  3HRD D;  2NRX A;  4RQ3 A;  1VJ5 A;  3N4M B;  5DQI A;  1BPB A;  5HMM A;  4UB1 A;  3RJK A;  5DB9 A;  4F5Q A;  2MA1 A;  3WKC A;  4RU9 A;  4RQN A;  1L7O A;  2WAQ F;  1ZD5 A;  2R8G A;  4DFK A;  4F5R A;  3QEA Z;  3AMZ A;  5HR7 A;  4E0D A;  4YMN A;  2W3R A;  2BCR A;  1ZQB A;  3GDX A;  3RBD A;  5ALT A;  1D9D A;  3RJG A;  3OPX A;  5J8Y A;  1N2X A;  1D8L A;  5KFT A;  4CF3 A;  3D6J A;  2FMP A;  1ZQJ A;  2HHX A;  4DS5 A;  4OJ6 A;  3UPQ A;  1S77 D;  9ICO A;  4DEZ A;  5ALJ A;  4FZN A;  1J2N A;  4OO1 J;  2KTQ A;  3QX7 A;  1DGJ A;  2KD1 A;  2IHN A;  5JU5 A;  2FMQ A;  2ZTC A;  2K4H A;  5HHH A;  5AKJ A;  4EZ9 A;  1LKY A;  1PVP A;  4Q8F A;  1N61 A;  5AKZ A;  3HPO A;  4IQT A;  4UAU A;  2OH2 A;  1MA7 A;  3OGU A;  5AI6 A;  1XSN A;  2H3F A;  4DSF A;  3GV5 B;  2WF7 A;  5GTH U;  1NK4 A;  3K75 D;  2F8L A;  2KZZ A;  4KN7 A;  3QUC A;  4Y2V A;  2QKQ A;  5ALK A;  1JIH A;  2F76 X;  4DFP A;  4M9G A;  5B66 U;  2DPI A;  3MR6 A;  2OWO A;  1Z00 A;  3JPQ A;  1UPH A;  1M6Y A;  2HHT A;  3PY8 A;  4DL2 A;  4M9L A;  1JUD A;  3RH5 A;  3QE9 Y;  4CE6 A;  1QCK A;  1HIW A;  2QB0 A;  4F4K A;  2WB1 F;  2LYA A;  2NRZ A;  4KLS A;  5AKH A;  1RXV A;  5B5E U;  4ECW A;  3ISD A;  3C5F A;  2H3Z A;  3MGH A;  2HBM A;  3M6Z A;  3J81 j;  5AKE A;  5KG5 A;  2MUT B;  3H8W A;  1BNP A;  2LI6 A;  1ZQW A;  3HIL A;  2NO4 A;  4XQ8 A;  9ICG A;  1KKX A;  4LVS A;  4JMU A;  4B6J A;  5AI9 A;  1NKB A;  4ED8 A;  4KX3 A;  3PW5 A;  2MU2 A;  3F5A A;  4KLU A;  8ICP A;  4EEL A;  2HOI A;  3GU3 A;  4DQI A;  4NLB A;  5AM1 A;  1JAL A;  2G06 A;  2PMZ F;  4ED0 A;  1T3N A;  5KG0 A;  3T5J A;  2G5H B;  3TI0 A;  3BQ1 A;  3N7R C;  5DGB A;  5DQG A;  3LWL A;  5J0X A;  4FO6 A;  3UMC A;  9ICK A;  3B0Y A;  2R8H A;  3KOO A;  1X9S A;  1SXD A;  4AYB F;  5J2E A;  2BDU A;  5AKX A;  1OW5 A;  2PXI A;  2ZJ5 A;  4R8U A;  3WKD A;  4JV1 A;  4PL2 A;  2YX8 A;  4DF8 A;  5CWR A;  5KFS A;  1UA1 A;  2WF6 A;  1ZQP A;  3ETR A;  2HOQ A;  5IIO A;  3C29 A;  2P66 A;  1ZQT A;  5DDM A;  3MGV A;  4DOA A;  2W11 A;  5IIK A;  2RP5 A;  5J2D A;  4KLE A;  3NVY A;  4YN4 A;  4QZE A;  2MRL A;  4DSJ A;  2BQU A;  3PNC A;  3RR7 A;  4HYK A;  1ZRN A;  3RB3 A;  1BPD A;  4QNL A;  1COK A;  1FIQ A;  1LB2 B;  4DL6 A;  2PKE A;  4B9S A;  3HJE A;  2M0N A;  2EH9 A;  1TAU A;  3N97 B;  2P6U A;  2ZIU B;  4TUQ A;  2DKZ A;  4FS2 A;  4KN4 A;  1RQN A;  2VA3 A;  3QEB Z;  2CN1 A;  2XI9 A;  4P4M A;  3OSN A;  4UAY A;  3CNH A;  3BQ7 A;  2KFZ A;  3TAP A;  2H3V A;  3KKA C;  4QWD A;  5JRT A;  3AQE A;  2PFN A;  3SD7 A;  4G9B A;  3GFK B;  2B0C A;  4KLJ A;  2D8C A;  3LVW A;  4QWE A;  5J2C A;  3BS5 A;  2HHV A;  3I28 A;  2ALZ A;  1X42 A;  1N5W A;  4OCZ A;  3PW0 A;  1TV9 A;  3UMG A;  3F5E A;  4F8R A;  2KZM A;  4M6W B;  1XSL A;  1RYS A;  4B9T A;  3UXP A;  2BR0 A;  5KFD A;  2IOF K;  2LKY A;  4KMU A;  4RPX A;  1ZQI A;  1L3S A;  3C21 A;  8ICC A;  2GLE A;  3KZX A;  1WWV A;  1X9W A;  2XID A;  2OEH A;  2W9B B;  7ICJ A;  5J0Y A;  5KFX A;  3C1Y A;  1L7N A;  2KKV A;  1XWL A;  4DFM A;  2RLT A;  3WU2 U;  4B9V A;  2VA2 A;  3QU4 A;  3B0X A;  2PFO A;  1NKE A;  2KSO A;  4UAW A;  2OHF A;  3C2K A;  5HP4 A;  4FZL A;  3A0B U;  4RNN A;  3LYS A;  5BOL A;  5IIL A;  3CRX A;  2DQN B;  5J0W A;  4YR2 A;  4JV2 A;  5DGA A;  2XC9 A;  2LHT A;  4QZF A;  2A1J B;  4TQS A;  1ZET A;  3VCB A;  1ZQZ A;  1B43 A;  3ETL A;  5AKK A;  2ZJA A;  7ICV A;  4CNQ A;  4P4P A;  1RZT A;  4O3N A;  4UAS A;  2AGO A;  2ZUB A;  4DO9 A;  2BPG A;  3QU9 A;  8ICJ A;  2YQE A;  3SI8 A;  1NK8 A;  1Z3E B;  5ALP A;  8ICQ A;  4DFJ A;  4J9R A;  3GIL A;  1ZQA A;  4DL3 A;  3FAH A;  2KVC A;  1QTM A;  2EAO A;  2WF8 A;  4BWJ A;  1KRP A;  4GXI A;  3GZF A;  2G0A A;  5ALL A;  3ISB A;  3KBB A;  4F72 A;  2PI5 A;  1ZQE A;  1ZQG A;  3EWA A;  4GC7 A;  4FZM A;  4UAZ A;  5D4B A;  1DGS A;  4MFF A;  4I2I A;  4UBC A;  1U4B A;  1J97 A;  3PO5 A;  4EZ6 A;  4R63 A;  2P6R A;  2NRV A;  3R9K A;  2JR5 A;  2FLP A;  5D49 A;  5KFR A;  5ALG A;  5IIN A;  3SMV A;  4XRH A;  1COO A;  5AIA A;  2KHQ A;  1ARO P;  4YFK A;  2XVT A;  5J2B A;  3KKA A;  3KHG A;  2Q4T A;  2W04 A;  5KAF U;  1XU4 A;  2G09 A;  3ALR A;  5BOM A;  1URJ A;  5L9X A;  3SEI A;  4M9H A;  5AK6 A;  9ICU A;  5DBC A;  5G5G A;  4KLL A;  4BGD A;  5C5J A;  4K4I A;  3QUQ A;  2YY6 A;  4O3P A;  3VC8 A;  2QLT A;  3ZDA A;  1S0V A;  4QW9 A;  3OJS A;  2K8B B;  3PSI A;  2E8M A;  5KL8 B;  1RPL A;  7ICL A;  1UT8 A;  1ZQL A;  2HHS A;  1CEZ A;  5KT2 A;  3QUT A;  1N56 A;  4IC9 A;  2JH7 A;  4NM2 A;  2I9G A;  2E5S A;  3H0M B;  2RRD A;  3KFU F;  2AXT U;  4JV0 A;  2PFQ A;  1ZD4 A;  4USA A;  3C1Z A;  4ECX A;  3T79 A;  2IHM A;  4I2D A;  4PGQ A;  3BS7 A;  5ALU A;  4ELV A;  4DQS A;  3JPO A;  3Q8P B;  3OJU A;  3WK9 A;  2ZJ8 A;  3MAB A;  2MUT A;  5J2K A;  3WKA A;  1S10 A;  3SQI A;  3T5K A;  1N5X A;  1TKD A;  2ODG A;  1XO0 A;  5J0Q A;  4I2B A;  5KFK A;  1UQV A;  2E8P A;  1YZ7 A;  2A19 A;  2E1F A;  2GO7 A;  4PHA A;  2HSZ A;  2ZIW B;  1UA0 A;  1NJW A;  4C8L A;  4KLT A;  2BZF A;  4C80 A;  2BCQ A;  1B4F A;  2EDU A;  3H0L B;  4IR9 A;  4ECV A;  4Y2Q A;  2ATL A;  3GV7 B;  5KT6 A;  4C8M A;  9ICE A;  2FPM A;  5KFY A;  1FFV A;  3LWM A;  1HJP A;  4RQ4 A;  3EUB 2;  2F1J A;  4FE3 A;  5KG6 A;  3EW9 A;  2VKQ A;  3OSP A;  1KSP A;  8ICR A;  2W9A A;  4QIW C;  2GH1 A;  1K1Q A;  1ZXI A;  4MFA A;  3C23 A;  1D8B A;  9ICW A;  4BXO A;  4DFD A;  2XY7 A;  4O3O A;  1ZQV A;  3CP8 A;  3AL0 B;  5KFV A;  3IP4 B;  5HNK A;  4DCC A;  4NV0 A;  2FLN A;  3PMN A;  2VJ4 A;  3TKA A;  5TZV A;  5AKG A;  4P0Q B;  5AHX A;  3NRW A;  3ZD9 A;  2R8K A;  4BUG A;  4B9M A;  3K4G A;  1N48 A;  4K4H A;  4DQR A;  4PHD A;  4RQ0 A;  9ICP A;  5AIB A;  3ED5 A;  2ZIU A;  4RT3 A;  1U47 A;  2BCS A;  5ALY A;  2IMW P;  1IXR A;  2E8N A;  1BNO A;  9ICN A;  2IOH A;  1NOM A;  8ICS A;  2EQY A;  5KFB A;  4EEY A;  1RM6 C;  3ZDD A;  1ZQN A;  3RAQ A;  4F2S A;  7ICQ A;  4RT2 A;  1PVR A;  3NUQ A;  3T3F A;  1QQ6 A;  1ZQH A;  1ZQC A;  3WK7 A;  2XGP A;  2JEF A;  2JEG A;  8ICT A;  2KE7 A;  2FE9 A;  3H0R B;  2OCE A;  3RTV A;  1TVA A;  3OHA A;  2AHO B;  3KZI U;  1V85 A;  1X6I A;  1RG6 A;  1F0M A;  4J9P A;  3PX0 A;  2JEJ A;  4M6W A;  1S0N A;  7ICN A;  2ZIV B;  8ICX A;  1TK8 A;  3TAD C;  3FC4 A;  5KFE A;  4F2R A;  3UXO A;  3QZ8 A;  4UB3 A;  3AM9 A;  2JXJ A;  2DUY A;  3PO4 A;  2W9B A;  3PZP A;  1S0M A;  2J6T A;  9ICV A;  5KFC A;  2CPR A;  4RQ6 A;  1D9F A;  1ZD3 A;  3GIJ A;  3I76 A;  1J2M A;  1UCV A;  5ALH A;  4M0A A;  5KT5 A;  2ISO A;  2XCA A;  2WF5 A;  3NVW A;  2YMM A;  3PR5 B;  3SV4 A;  1NI3 A;  2C28 A;  5AK4 A;  2UVW A;  1PUZ A;  5ALR A;  2QAR B;  4CRX A;  3TFS A;  2VJ5 A;  3PSP A;  2IOF A;  4P4O A;  2W8L A;  3QU7 A;  2A3V A;  1T94 A;  2KP7 A;  7ICR A;  4PHE A;  3L5K A;  4MFC A;  3WK5 A;  2A1J A;  5KFL A;  4KLD A;  3Q8K A;  5KG3 A;  4EBC A;  3H8J A;  4U7C A;  5IIJ A;  2DL0 A;  3LK9 A;  2ZG6 A;  4C8N A;  2JRZ A;  2F77 X;  5IIM A;  1BVS A;  5AM5 A;  9ICT A;  4NLC A;  5ALM A;  4DLG A;  3PW2 A;  1TAQ A;  5J0R A;  1O08 A;  5EE0 A;  3FYH A;  4Y2J A;  1QLN A;  5ALX A;  1A6S A;  2HW3 A;  4AP9 A;  2AGP A;  4YG2 A;  3TAN A;  2CXY A;  1NZB A;  2F1I A;  4C0Z A;  4Z6D A;  4QZD A;  4I2F A;  4G3I A;  3MDA A;  3SEN A;  2M9N A;  4J9L A;  2ZXH A;  1L5U A;  5AKI A;  9ICI A;  1SL2 A;  4F5P A;  4ECT A;  4EX6 A;  4RQ2 A;  3RB0 A;  1SZH A;  3UMB A;  5AI8 A;  5DB6 A;  5CJ7 A;  4O9M A;  4Y2U A;  3AQF A;  9ICC A;  1ECW A;  5AI0 A;  5J0O A;  4IRC A;  8ICF A;  1K1S A;  4UQG A;  1JXL A;  3PSF A;  1DXS A;  1MQ3 A;  2ISP A;  2E8O A;  3AU6 A;  5DBA A;  3M7D A;  4M2Y A;  5EE1 A;  1ZQR A;  5K4L A;  4C4S A;  1NJY A;  5JTI A;  8ICY A;  3GIM A;  4NLZ A;  2YN4 A;  2R8I A;  1ZQO A;  1HUZ A;  1IV8 A;  2DBY A;  2Y9U A;  1Q46 A;  1KFT A;  3NAS A;  2YB4 A;  5KG2 A;  3OTQ A;  4Y2Y A;  2KIV A;  4BXO B;  2HDO A;  2MAX A;  3PX6 A;  8ICB A;  2Q0Z X;  2F8K A;  2VA8 A;  4CGZ A;  3NRZ A;  5AK3 A;  4DOB A;  3O0F A;  2EAP A;  4I2J A;  3TAD A;  2WAQ C;  4C4R A;  3BZK A;  4LJX A;  5GTI U;  2HHQ A;  3H4D A;  3RB6 A;  3N7S C;  4UAT A;  2EZZ A;  3IG8 A;  7ICI A;  2H5X A;  5CP2 A;  4JK1 A;  2J6S A;  4QW8 A;  2HBK A;  1BPZ A;  4QZ8 A;  3PST A;  1S76 D;  1KQQ A;  3SAG A;  2R18 A;  2W9C B;  2DPJ A;  2ZTD A;  3N7P D;  4UB8 U;  3SV3 A;  4DSE A;  1B0X A;  4QZG A;  4KLI A;  1KTQ A;  4ZH4 A;  3TAQ A;  3C28 A;  4C8O A;  8ICO A;  1Z4N A;  3ICX A;  3RRH A;  3KTQ A;  5KFM A;  2K89 A;  4Z6E A;  4O3Q A;  8ICH A;  3A0H U;  3JPP A;  5III A;  5AKL A;  2K4E A;  2EZX A;  4ELU A;  1NK6 A;  5EWE A;  3Q8M A;  4TUR A;  4ECU A;  2DF4 B;  2ZIW A;  4ECY A;  1ZQF A;  3NTU A;  3EZ5 A;  1BPE A;  4RQM A;  2F1H A;  4MF8 A;  4DQP A;  5ALV A;  1LVH A;  3MR2 A;  2W9M A;  3KHL A;  2ESE A;  4EBD A;  7ICS A;  5KG7 A;  4JUZ A;  3RH6 A;  4C4T A;  4F92 B;  1Y88 A;  1SKS A;  5J2H A;  2L5Y A;  2BGW A;  3TAC B;  2I5H A;  2HBJ A;  3U26 A;  1KFD A;  3QYP A;  3LVV A;  4O5K A;  4YMM A;  3MFI A;  2BPF A;  2JEI A;  4KLH A;  3CYM A;  2FI1 A;  1QSY A;  5AKY A;  4DSI A;  1U45 A;  4GFJ A;  2G07 A;  1NNL A;  1X2I A;  1SZP A;  1JN3 A;  3MFH A;  3ISC A;  3ONN A;  1ZQS A;  4YMO A;  2K8C B;  2ASL A;  7ICU A;  3K1Z A;  2PFP A;  2VIX A;  4YXJ A;  4Z6C A;  3AN1 A;  4P0Q A;  4M04 A;  4F4X A;  1ZYQ A;  5J2G A;  4I2H A;  1XNS A;  2YMQ A;  3JPT A;  1T3Q A;  4IRD A;  5T14 A;  3HX0 A;  3QUB A;  4YXM A;  2PMZ C;  2KEY A;  1FO4 A;  2C2E A;  1U49 A;  3KHH A;  4RPY A;  1DK2 A;  1L8O A;  3UM9 A;  4DL5 A;  1S0O A;  4KIT B;  4P0P B;  4FBT A;  5CA7 A;  2KNJ A;  2HBL A;  3M9O B;  2RDI A;  4QJF B;  1WCN A;  4UAV A;  1SL0 A;  4IQW A;  5KFN A;  4RPZ A;  1SGG A;  4YD2 A;  4YQW A;  1QH9 A;  2RDJ A;  4RNO A;  2Y0S C;  2AH5 A;  1MQ2 A;  3M9N B;  4MF2 A;  2YML A;  1KDH A;  4ED6 A;  1SWV A;  5CHG A;  8ICZ A;  1X9X A;  4UB6 U;  4GXK A;  4EX7 A;  2W8K A;  4RUA A;  1NZP A;  1WWU A;  2G5I B;  2ZIV A;  2JH1 A;  5BPC A;  5F9L A;  5DDY A;  1PVQ A;  5JUM A;  3V6H A;  2LPE A;  1BPX A;  2FPK A;  3IM1 A;  1L6N A;  1LV5 A;  4C7Y A;  2K8A A;  4US9 A;  3PX4 A;  3OHB A;  2HHW A;  3N28 A;  5DG7 A;  2N1R A;  2JZB B;  4RZR A;  2HHU A;  2AQ0 A;  3JPN A;  4F4Y A;  7ICH A;  2QAR A;  1SV4 A;  1KFS A;  4ED3 A;  4KLF A;  2F2A B;  2FDR A;  1S97 A;  3THV A;  4C8K A;  4QZH A;  2I6X A;  1XSP A;  3SYZ A;  2KZ3 A;  4QWA A;  3SZ2 A;  1SL1 A;  1WG8 A;  3EPI A;  4YP3 A;  1CUK A;  5AI4 A;  5KAI U;  3RFA A;  2EZY A;  2KIC A;  3V7J A;  8ICU A;  4UB2 A;  5HML A;  3E2E A;  9ICR A;  4UB4 A;  4Q44 A;  2BDP A;  5J8Y C;  3JPR A;  4M9N A;  3DDH A;  4R66 A;  5CEH A;  4JB3 A;  1U9L A;  5KL1 B;  4JWN A;  5AIC A;  4DQQ A;  4EBE A;  2OYY A;  2JMG A;  3CW2 C;  4Y2R A;  4NM1 A;  4P2H A;  1Q3U A;  3MC1 A;  2D6F C;  4A8E A;  3H8M A;  4GLX A;  2D3D A;  4C7Z A;  2KOB A;  2Y1I A;  4YCX A;  4KLO A;  2NV3 A;  3DV9 A;  4QZA A;  5AM3 A;  3HKZ C;  3WK8 A;  1S9F A;  1ZQD A;  1L8L A;  1PK1 B;  2W55 A;  2KJ8 A;  1MC8 A;  4MEY A;  5F3X B;  3Q8Q B;  3F2D A;  3AU2 A;  8ICK A;  2KG5 A;  3AUO A;  3T5L A;  3RR8 A;  5G5H A;  2V4Q A;  2HVH A;  1L7P A;  5ALO A;  2OM6 A;  2ZUC A;  4FFD A;  3NS1 A;  3IRU A;  1YT3 A;  4I2C A;  3IG5 A;  2YB1 A;  4RQ1 A;  4GC6 A;  4DSK A;  2ASD A;  4IQV A;  2W7O A;  5D46 A;  5L1J A;  1GO3 F;  1O03 A;  1NK0 A;  4F91 B;  4PH5 A;  2K4I A;  1JXE A;  1Z1V A;  4O3S A;  1NKC A;  3GV8 B;  3UQ0 A;  2ZUD A;  1NJX A;  2XCP A;  4XUS A;  2W9C A;  4F71 A;  5KT4 A;  8ICL A;  3T5H A;  1L3T A;  4UAR A;  1WUD A;  3QZ7 A;  3RAX A;  3AEV A;  2W7P A;  5DLF A;  4QZ9 A;  3M8R A;  3G6X A;  1C7Y A; 
#chains in the Genus database with same CATH homology
 2DUY A;  5B66 U;  5B5E U;  3KZI U;  5H2F U;  1S5L U;  4UB6 U;  2AXT U;  5KAF U;  5GTH U;  3A0H U;  3WU2 U;  4UB8 U;  4IL6 U;  5KAI U;  5GTI U;  5E79 U;  5TIS U;  4PJ0 U;  3A0B U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...