5KAIE

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
81
structure length
81
Chain Sequence
TTGERPFSDIITSVRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDSYYAQEQRSIPLVTDRFEAKQQVETFLEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 18
structure length 81
sequence length 81
chains with identical sequence e
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00283 Cytochrom_B559 Cytochrome b559, alpha (gene psbE) and beta (gene psbF)subunits
E PF00284 Cytochrom_B559a Lumenal portion of Cytochrome b559, alpha (gene psbE) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.860 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II cytochrome b559, alpha subunit 5kaiE00
5B5EE 3KZIE 4PJ0E 1W5CE 5H2FE 4UB8E 4UB6E 3A0HE 5KAFE 3JCUE 3WU2E 5B66E 2AXTE 5TISE 5KAIE 4IL6E 1S5LE 3A0BE 5GTIE 5GTHE 5E79E
chains in the Genus database with same CATH superfamily
1BSNA 1E79H 4WBAA 1SQXJ 4Y28J 3CWBG 1GK4A 1RE3C 4IFMA 1HGVA 2KS1A 2LXBA 2GM4A 2PAJA 2CK3H 2OYHB 2ZT9D 1IFMA 1E5WA 1JY2N 1LWUB 1NAYA 4A7PA 4DZOA 1FBMA 5AW8B 2Y0DA 1GZLA 2FYUD 1EDJA 2E76B 4WY4B 1LTJC 1SFCD 1BE3J 2SPZA 3H1IJ 4JBZA 3A0HE 5AVTB 2YIUB 2I8DA 1NTZJ 2E74D 2KLVA 1DIPA 1YI2P 1YITP 3N4XA 5KLIC 1LT9A 1AJYA 1YIJP 1H88A 2C9NY 3LW5H 1JY2P 2W8ZA 3HE5A 2BCCD 4I6MC 1ZXGA 5KAFH 4RESB 2OYIC 5AVYB 2WSSH 1SFCC 1S4XA 2QIWA 1FDMA 2KP8A 2E74C 4UB6E 3ABVC 1D7MA 3H25A 3HUSC 3L70E 3JC22 1NTKD 3L71J 1U57A 4C46A 3L72J 1LGHB 1NTMJ 1L0NK 4H44D 1S1CX 2Q7CA 2A06D 5TISH 1GL2D 3TGUD 4L75A 1R5SA 1LTJB 4U3FJ 3CCQP 1KQLA 2RKLA 1X8YA 3S4RA 2ZVNB 3V6IA 1PPJD 1Z56A 4D6TG 3FGAD 2XKMA 3S1KA 1J2JB 2JDIH 4GKGA 4ZMDA 1HJBA 5EFWB 2XZRA 1L0LK 2KOGA 1H0TA 1OVVA 3CXHH 4H44C 5AVQB 1S2EA 3FXEA 1SQBG 1IC2A 2WSCH 1LTBC 2NPSA 4W7ZA 4ASWA 5H2FE 1BGYE 1YHQP 3HUSB 1RY3A 1Q7YQ 1FZBA 1AQ5A 1ZRTE 3CX5I 4ZKPA 1IFPA 5CBNA 4HJGH 3JSVC 1EC5A 3RK2D 1LP1B 2KSEA 2AEMA 3H1KG 2GA1A 2WSFJ 3CC2P 1QGKB 1L0NJ 4GIFA 2OTKE 5AVRB 2E5YA 2M8RA 3G3ZA 3EFFK 2O01N 1RE4A 1S5LX 3TNUB 2QJKC 3BCCG 2WSEH 4U7JA 3SWYA 3BRVB 1SQXD 4YXWH 3D6ZA 1M1JB 2FXMA 2YNYA 2MJZA 1LT9C 3BATA 3RK2C 4PD4H 2R5BA 2FY8A 2L5GB 1L0LJ 3USSA 2QJPC 3L70J 2HPCB 3H1HG 1BCCG 1URQB 1HTLC 2AEFA 2BEQD 1PGQA 1JEKA 1BE3D 1ZLLA 2JWDA 2ZAEB 3H1ID 4IL6E 1NTZD 3PJSK 3HTKB 1FZCA 4R4MA 2K9YA 1NVOA 1DEBA 1G1JA 1AVYA 3HE4A 1YJ9P 4Y99B 2W83C 1NTKE 1IO4A 2IBZE 5KTBA 1LTIC 3GLMA 1EZVD 3AE7C 3LIEA 2IBZI 2NPSD 3TGUE 3L74E 1DH3A 1W5CE 4HB1A 2IYOA 1LNQA 3RBXA 3V2PA 1JY3O 4H0LD 1PPJE 2PRRA 4OWFA 3L71D 1USDA 1N7SD 2D2CD 1NTMD 2JWAA 4JQ0D 3HRNA 3H32A 1BGYJ 4IFDK 1RH5B 4UB8E 2YO3A 1RF1B 3AE4C 3H1JG 2B87B 3P8MC 4U3FD 1EQ7A 3C8VA 3CC7P 3WMM0 1KYOH 1YQ4C 5AVWB 2AXTH 3RK3D 4K3AA 2NZ2A 1AQTA 1L4AB 3KZIE 1KN7A 2N9YB 1LTGC 4H0LC 2C9LY 1WT6A 1ZR4A 1HVVA 5KJ7A 2D2CC 3C1LA 2ZXEB 4OH8B 1PP9G 2OGUA 3H6PA 3BASA 5KAIH 1IFIA 3L75J 4M3LA 1Y9BA 1MFZA 1GD2E 3MZWB 4JPZB 1RE4C 3V4WA 4GT1A 1R5LA 2R5DA 1FZAA 3D6YA 2RH0A 4DOJA 4GDOA 2XU6A 1VQ5P 5CBOA 5AW0B 1QVFO 4XFJA 3TK1A 1K04A 5CCGD 2FFDB 2KB7P 1OW7A 5AVVB 1DD4A 1HF9A 5E79E 1L0ND 2FYNB 1JOCA 4LC1A 1HH0A 2WT7B 4JYCA 2UWJE 1JMMA 1FZCC 2G3AA 1SQBK 1NTZE 1PGJA 3L74J 1IFJA 5CCHD 2Z5HA 3GF7A 3D70A 1SQQG 1VF5B 2AXCA 4EOTA 1L0LD 2K3RA 4C7NB 5B66E 3L70D 3AEEC 2W90A 1A02F 1KB9E 4RKUJ 1EZVE 3G9RA 5APYA 3WUTA 4IL6H 1KB9I 3T97B 1VQ4P 1GDTA 1CI6B 4H13D 2W27A 1T6AA 2P2UA 5KJ7D 4WY4D 1VQ9P 5AVXB 1G1IA 2E43A 3OAKA 3FWNA 3L71E 4OVNF 3L72E 2I1JA 1G2CB 1KFNA 5TJHA 5AW6B 1Q81Q 1KILB 2HODA 2P67A 2N1TC 5C39A 4U3FE 3L35A 3M9HA 3H1LE 4QMAA 1NOHA 3Q2YA 2QJYB 2QG4A 3A0BE 3RK3E 3EQ2A 3VMZA 4H13C 1L2PA 4YXDC 1GW3A 4OGQD 1BGYD 1J1DC 4EDFA 4EI2A 3CX5D 1SQBJ 3V4QA 3WU2H 2M5AA 4PV1B 1ZRTD 3CCVP 4N3YB 4XA4A 5GTIE 1W2EA 3VN0A 2FYUG 4TLFA 1T8ZA 2CPBA 2J59M 1AFOA 2A45H 1KTMA 2PFXA 3EFGA 3I5CA 3KZIH 3JCUE 1LJ2A 1NYHA 4MN4C 3HD7B 2KIKA 2XNXA 1ZMEC 2BASA 5KLVE 1LT1A 2WWWA 4OGQC 2Z4EA 2HG5D 1IJDB 1KV4A 3WUVA 1T3JA 3AE5C 2V4HA 3L75D 1JB0J 3BRTB 2BCCG 1BDDA 1DD3A 1QX8A 1N73C 2PP6A 3UIAA 5APVA 3BCCJ 4AUWA 3SFDC 1L0NE 2I1KA 4EYYQ 2ZT9C 3R4YA 4I7ZC 5KLVK 3AEBC 2A06G 1VQMP 5APTA 4WWIA 3MD0A 4HH2A 3H1HJ 5B5EE 1BCCJ 3M9QA 5KKZC 1JY3N 1L0LE 5AVUB 2M3BA 1GMJA 1IFDA 1BSHA 2IFNA 1PPJG 3AE3C 2P1JA 2IBZD 2Z5IA 3GMAA 4L74A 3PH0A 1MV8A 3IN6A 4BRYA 1NKZB 3L74D 1X9VA 4ASVA 3H1LJ 1JTHA 5DJTB 1JY3P 3L73E 2A45G 2IYPA 1QLED 5KLIB 5M1BA 2K9JA 5AW3B 2ZT9B 4JYBA 4ZNCA 1H8AA 1OMIA 2YXQB 1URQD 4O9BA 3AE8C 2IZ1A 1GL2C 2OYIB 1YTZT 3VP9A 2C0XA 2Q6QA 1KMIZ 1SFCB 1XTCC 4YPCA 3TDKA 4NPFX 5KKZB 2IX7C 5AW4B 1EDIA 2E74B 3V2RA 1KQSO 1IZNB 1FU1A 1YQ3C 3CX5E 1YTZI 5KLVJ 4C7RA 3IAOA 4AQRD 2E5TA 1JUNA 3AEAC 2KUBA 1N7SA 1KFMA 4BWNA 1FE6A 3KYQA 3B5NA 2O1KA 1CZQA 3BVHA 5BU8B 1SQXG 5GTHH 4L76A 1SLQA 3LIDA 1SQVE 3B71A 1YJNP 1PP9J 4K35A 1MFTA 2RMZA 1NGMB 1WMKA 1SQBD 3RL0D 1KZUB 2PGDA 3GF3A 5K5GB 2O01J 2YKQA 3GHGA 3L75E 2ZVOB 4H44B 1FZGA 1BE3G 3H1IG 3VP8A 1PGPA 1PZQA 1Y47A 1SQPE 2WQYC 3CMEP 3MUDA 2LKMA 4I1LA 1N86A 1A02J 2XNDH 2JKVA 5CHXA 3CWBE 1X22A 1L4AD 2B89A 1SQVK 3RL0C 3SWFA 3NFQA 3Q5PA 3A0HH 3N7NA 2BEZF 2E75D 1VQ6P 2LXCB 2Y9ZA 2WVRA 4HYTB 3BCCD 5BVZA 2WSFH 1G2CA 1Q90D 3U59A 2R3CA 1K9MQ 1KORA 5AVSB 2RN0A 1SQPK 1EXJA 3L73J 1ZW0A 2K88A 3P7KA 1S5LE 1KB9D 2FYUK 5CCGA 3MIWA 2ZYDA 2WPSA 1NTMG 1FOSF 1P84E 2QJKB 1JMBA 5AW2B 2DW3A 3H1HD 3AEDC 1BCCD 1U7JA 1P84I 3KPEA 3CCSP 2E75C 1LT9B 4UB6H 3RK2B 1RHZB 3L37A 3ITKA 3L72D 1FAVA 3OJAB 4XE5B 3O6QA 5CCHA 3B5ND 4YTPC 3HE5B 1HWTC 2QJPB 1IK7A 3CCJP 3A3YB 2KK7A 2GUVA 3H1LD 2NPSC 3P8CE 1NU1G 2OYHA 1LWUA 1KQFB 1SQVJ 1HJ0A 4W80A 1YBKA 1N7SC 4WY4A 3MTUE 4D6TE 3SWKA 2H43A 3G6EP 4PJ0E 2H8PD 3MHVA 1EDKA 3OW2O 3E7KA 1VQPP 2OYOA 1FS0E 1SQPJ 1KD1Q 5H2FH 2MKVA 4NPDA 3RK3C 4R4LA 1OZHA 2FYUJ 1IK9A 5KLVD 1SQBE 1Q86Q 3GHGC 1H0TB 1J1EC 4WVZA 3CWBJ 1T2KD 1N8RQ 1K8AQ 1M7LA 1GU5A 3U1AA 1YJWP 3MUDC 1KILD 1CSBA 2J58A 2NPSB 3IF4A 1GK6A 1PP9D 2KLUA 2H89C 4H0LB 2QRXA 2C0WA 5KAFE 3L70G 2IFMA 3H1KE 1FDIA 2E42A 2D2CB 1LTJA 1S9KE 1NAFA 1S72P 1ZP0C 2M3EA 3W68A 1ZOYC 4KHXA 1Q2NA 3BCCE 1OXZA 2LR2A 1NWQA 1JCCA 5CCGC 4Z1MH 2QE7H 3RK3B 5TISE 1BDCA 1SP4A 2FBWC 5CJ0A 1QEXA 2WMMA 2V7QH 5APXA 2YMKA 3H1HE 1BCCE 1RQUA 2ITAA 3CCMP 1NJIQ 3FXDA 2E76D 4IFFA 3HUSA 2KSJA 5CCHC 4CPGA 3M9BA 3L73D 1GW4A 2QEXP 3A7OA 3CXHE 3CD6P 3NMDA 1BGYG 1SS1A 2YO2A 3A2AA 1RF0A 4N78D 4N6JA 3CXHI 2ZYAA 3D71A 4D6TJ 1FZCB 1LP1A 2OYHC 1PL5A 3V2NA 1LWUC 3WUUA 3HE4B 3SFEC 2KXPB 2JP3A 2ZXXA 5KJ7C 4WY4C 3B8EB 2WTYA 2JJLA 1VQLP 3TNUA 4UB8H 1DX7A 1LTTC 1ZR2A 5APQA 1M1JA 3AEGC 4EIJA 1GTWA 1NH4A 2B9BA 5DJUB 3H1JE 3AE6C 3W67A 1SQVD 2HPCA 3H32B 3LW5J 1NTMK 3G4SP 1URQA 2FXOA 2O3JA 2KNCB 1VQ8P 4BXLA 1HUCA 3QH9A 3H1KJ 3HTKA 3E1IA 4PJ0H 1PIXA 1OX3A 1GU4A 2N1TB 2R32A 1KILE 4PD4E 1VQKP 1SQPD 3II6A 4PD4I 2L91A 1PP9E 2KZIA 4H13B 1M8OB 2IPPA 5CMZA 3QWOC 3NXSA 4KJMA 1M1KQ 4I2LC 3A5TA 2QM8A 3CWBD 2P58A 1J1DB 1NKNA 3PHLA 1NTKG 3IR9A 2IBZG 3P32A 1JNMA 2K1AA 1NU1K 3TGUG 3L74G 3CPWO 2OTLP 1PV3A 2Y0EA 5E79H 3RGUA 4LLHA 2FKWB 3Q3DA 1RF1A 2B87A 1NHLA 4OGQB 3CCUP 1M56D 1R8EA 1TU3F 1P84D 1ZN5A 4TT3H 2WSCJ 2XDJA 1L4AA 3KQGA 2QM7A 1N73B 1DEEG 3CCLP 1Q82Q 1N2DC 2QA4P 5B66H 1OVUA 1RF0C 1KB9H 3F89A 1SQQE 1QL1A 1YYCA 2Q3EA 2M0BA 1KQGB 5AW5B 4N78E 1KYOE 2ZJSE 5AW1B 4I7ZB 2YKOA 2AXTE 2FYZA 1AV1A 3FX0A 1UIXA 1KYOI 2N9BA 5APSA 1FZEA 3P8CD 2QSIA 3H1JJ 3AEFC 5AVZB 1M1JC 1K73Q 1EDLA 2WSEJ 5KAIE 1NU1J 4D6TD 1SQQK 2NRGA 2FFDA 2WPQA 3VMXA 2H7HA 3CL3D 3A0BH 3M0AA 1URQC 2IDBA 2YMYA 2Q3IA 1FDOA 2WT7A 1PFIA 5AW7B 2Y0CA 1W2BO 2Q1KA 3PP5A 2HODB 2Q9IA 2W6BA 4IL6X 3B4SA 5GTIH 1HBWA 1S3JA 2WPRA 4Y99C 3PRJA 4B86A 1GL2B 1NTZG 4C7NA 3JCUH 2POHA 1N7LA 2IZ0A 2FYUE 2O1JA 4GOFA 2M5AB 3S9OA 1KC8Q 3T97A 3L4FA 1USEA 3H1KD 1SVFA 2YKPA 1S9KD 1CI6A 1EZVG 2JR8A 2KZJA 1JY2O 2OTJP 2KS1B 2ZYGA 1LTAC 3V2QA 1IFNA 4GODA 2KYVA 1RF1C 2FXPA 1Y8AA 2BCCE 4RO0A 1H89A 1JM0A 2HR3A 1KILA 2W6JH 1T3UA 3AE2C 5CJ4A 2O01H 3L71G 3CLQA 2Q5UA 3L72G 3MGNA 1SQQJ 3MP7B 3O8ZA 5AW9B 3KXDA 1L4AC 1MKMA 3L36A 1VDFA 5B5EH 4U3FG 4DJGA 3H1LG 2A06E 4LGDE 1QL2A 3CXHD 2B88A 3PTZA 1OFCX 1MUUA 1AVOA 1U7MA 3RL0B 3K5BA 3VMYA 3FWLA 2J5UA 3KHUA 3CI9A 3HD7A 1PGOA 1VQ7P 2KNCA 1X79B 3TYYA 3GG2A 3V5BA 3CMAP 1OW6A 1NTKK 3M0DA 4DCKA 3WU2E 4BRYB 1VF5D 1CW5A 1MZ9A 3Q5SA 1OIPA 2R3SA 2CPSA 1FC2C 2FFDC 5KLVG 3CCEP 1K05A 2N1TA 3B5NC 3NTNA 1AA0A 2FYNC 3I55P 2JO1A 1JTHB 4GOEA 2A45I 3H1JD 2Y9YA 3C9IA 3VMAA 2E75B 3PLNA 3VOPA 2R44A 2ZFCA 1RQVA 2K9JB 2K37A 2W6AA 3IFMA 3CX5H 1NU1D 1L0NG 3RBZA 1XTGB 1M57D 3VYIA 3G71P 4W7YA 3ZDMA 1VF5C 2AEJA 3RL0g 1VPCA 4PD4D 1RE3A 3M91A 5BU5A 2G8YA 2VRSA 1L0LG 1OVRA 2BCCJ 1SQXE 2H88C 2YXRB 1HGZA 2V7QJ 1UIIA 1WRGA 3KDPB 4HKZH 1N7SB 2JEEA 3Q5RA 3B5NB 1NO4A 1T2KC 1N73A 3R2PA 1VL2A 4WB4A 4PV1D 1NTKJ 1KILC 5APWA 1M90Q 3OA7A 1BE3E 3H1IE 1FOSE 1FJPA 3AE9C 3I56P 2KI7B 2QJYC 3TGUJ 3GW6A 3F5HA 3L73G 4NPEA 4DT0A 3HD7D 1X0TA 3GHGB 3TSIA 1J1EB 2OYIA 4AYCA 1SQXK 2OQQA 1SFCA 1OW8A 3TF5A 4RJTA 4JF7A 2N1TD 4PV1C 3M06A 4ZKUA 1EZVI 2WITA 3EWKA 4IOIH 3Q1MA 1S5LH 2QVAA 1SQQD 1JO5A 1EXIA 2P7JA 1P84H 1JCDA 1KYOD 1NTZK 3HD7C 3CCRP 1NTME 3M0DC 1QVGO 2HFED 1VQNP 2E76C 2HYNA 3AE1C 4L73A 2YIUC 3CC4P 1SQVG 1VQOP 1FZFA 2HLOA 2XV5A 2OARA 5L8RJ 3E1RA 2WZ7A 2WPVB 2GUSA 3SSUA 5APUA 1OWAA 5GTHE 1GL2A 2P10A 1ZV8A 3U1CA 3L75G 3AECC 3VTPC 1SQPG 1FJKA 3O6QB 4KT0J 1NU1E 1LTSC
chains in the Genus database with same CATH topology
5B5EE 3KZIE 4PJ0E 1W5CE 5H2FE 4UB8E 4UB6E 3A0HE 5KAFE 3JCUE 3WU2E 5B66E 2AXTE 5TISE 5KAIE 4IL6E 1S5LE 3A0BE 5GTIE 5GTHE 5E79E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B5E E;  3KZI E;  4PJ0 E;  1W5C E;  5H2F E;  4UB8 E;  4UB6 E;  3A0H E;  5KAF E;  3JCU E;  3WU2 E;  5B66 E;  2AXT E;  5TIS E;  5KAI E;  4IL6 E;  1S5L E;  3A0B E;  5GTI E;  5GTH E;  5E79 E; 
#chains in the Genus database with same CATH topology
 1BSN A;  1E79 H;  4WBA A;  1SQX J;  4Y28 J;  3CWB G;  1GK4 A;  1RE3 C;  4IFM A;  1HGV A;  2KS1 A;  2LXB A;  2GM4 A;  2PAJ A;  2CK3 H;  2OYH B;  2ZT9 D;  1IFM A;  1E5W A;  1JY2 N;  1LWU B;  1NAY A;  4A7P A;  4DZO A;  1FBM A;  5AW8 B;  2Y0D A;  1GZL A;  2FYU D;  1EDJ A;  2E76 B;  4WY4 B;  1LTJ C;  1SFC D;  1BE3 J;  2SPZ A;  3H1I J;  4JBZ A;  3A0H E;  5AVT B;  2YIU B;  2I8D A;  1NTZ J;  2E74 D;  2KLV A;  1DIP A;  1YI2 P;  1YIT P;  3N4X A;  5KLI C;  1LT9 A;  1AJY A;  1YIJ P;  1H88 A;  2C9N Y;  3LW5 H;  1JY2 P;  2W8Z A;  3HE5 A;  2BCC D;  4I6M C;  1ZXG A;  5KAF H;  4RES B;  2OYI C;  5AVY B;  2WSS H;  1SFC C;  1S4X A;  2QIW A;  1FDM A;  2KP8 A;  2E74 C;  4UB6 E;  3ABV C;  1D7M A;  3H25 A;  3HUS C;  3L70 E;  3JC2 2;  1NTK D;  3L71 J;  1U57 A;  4C46 A;  3L72 J;  1LGH B;  1NTM J;  1L0N K;  4H44 D;  1S1C X;  2Q7C A;  2A06 D;  5TIS H;  1GL2 D;  3TGU D;  4L75 A;  1R5S A;  1LTJ B;  4U3F J;  3CCQ P;  1KQL A;  2RKL A;  1X8Y A;  3S4R A;  2ZVN B;  3V6I A;  1PPJ D;  1Z56 A;  4D6T G;  3FGA D;  2XKM A;  3S1K A;  1J2J B;  2JDI H;  4GKG A;  4ZMD A;  1HJB A;  5EFW B;  2XZR A;  1L0L K;  2KOG A;  1H0T A;  1OVV A;  3CXH H;  4H44 C;  5AVQ B;  1S2E A;  3FXE A;  1SQB G;  1IC2 A;  2WSC H;  1LTB C;  2NPS A;  4W7Z A;  4ASW A;  5H2F E;  1BGY E;  1YHQ P;  3HUS B;  1RY3 A;  1Q7Y Q;  1FZB A;  1AQ5 A;  1ZRT E;  3CX5 I;  4ZKP A;  1IFP A;  5CBN A;  4HJG H;  3JSV C;  1EC5 A;  3RK2 D;  1LP1 B;  2KSE A;  2AEM A;  3H1K G;  2GA1 A;  2WSF J;  3CC2 P;  1QGK B;  1L0N J;  4GIF A;  2OTK E;  5AVR B;  2E5Y A;  2M8R A;  3G3Z A;  3EFF K;  2O01 N;  1RE4 A;  1S5L X;  3TNU B;  2QJK C;  3BCC G;  2WSE H;  4U7J A;  3SWY A;  3BRV B;  1SQX D;  4YXW H;  3D6Z A;  1M1J B;  2FXM A;  2YNY A;  2MJZ A;  1LT9 C;  3BAT A;  3RK2 C;  4PD4 H;  2R5B A;  2FY8 A;  2L5G B;  1L0L J;  3USS A;  2QJP C;  3L70 J;  2HPC B;  3H1H G;  1BCC G;  1URQ B;  1HTL C;  2AEF A;  2BEQ D;  1PGQ A;  1JEK A;  1BE3 D;  1ZLL A;  2JWD A;  2ZAE B;  3H1I D;  4IL6 E;  1NTZ D;  3PJS K;  3HTK B;  1FZC A;  4R4M A;  2K9Y A;  1NVO A;  1DEB A;  1G1J A;  1AVY A;  3HE4 A;  1YJ9 P;  4Y99 B;  2W83 C;  1NTK E;  1IO4 A;  2IBZ E;  5KTB A;  1LTI C;  3GLM A;  1EZV D;  3AE7 C;  3LIE A;  2IBZ I;  2NPS D;  3TGU E;  3L74 E;  1DH3 A;  1W5C E;  4HB1 A;  2IYO A;  1LNQ A;  3RBX A;  3V2P A;  1JY3 O;  4H0L D;  1PPJ E;  2PRR A;  4OWF A;  3L71 D;  1USD A;  1N7S D;  2D2C D;  1NTM D;  2JWA A;  4JQ0 D;  3HRN A;  3H32 A;  1BGY J;  4IFD K;  1RH5 B;  4UB8 E;  2YO3 A;  1RF1 B;  3AE4 C;  3H1J G;  2B87 B;  3P8M C;  4U3F D;  1EQ7 A;  3C8V A;  3CC7 P;  3WMM 0;  1KYO H;  1YQ4 C;  5AVW B;  2AXT H;  3RK3 D;  4K3A A;  2NZ2 A;  1AQT A;  1L4A B;  3KZI E;  1KN7 A;  2N9Y B;  1LTG C;  4H0L C;  2C9L Y;  1WT6 A;  1ZR4 A;  1HVV A;  5KJ7 A;  2D2C C;  3C1L A;  2ZXE B;  4OH8 B;  1PP9 G;  2OGU A;  3H6P A;  3BAS A;  5KAI H;  1IFI A;  3L75 J;  4M3L A;  1Y9B A;  1MFZ A;  1GD2 E;  3MZW B;  4JPZ B;  1RE4 C;  3V4W A;  4GT1 A;  1R5L A;  2R5D A;  1FZA A;  3D6Y A;  2RH0 A;  4DOJ A;  4GDO A;  2XU6 A;  1VQ5 P;  5CBO A;  5AW0 B;  1QVF O;  4XFJ A;  3TK1 A;  1K04 A;  5CCG D;  2FFD B;  2KB7 P;  1OW7 A;  5AVV B;  1DD4 A;  1HF9 A;  5E79 E;  1L0N D;  2FYN B;  1JOC A;  4LC1 A;  1HH0 A;  2WT7 B;  4JYC A;  2UWJ E;  1JMM A;  1FZC C;  2G3A A;  1SQB K;  1NTZ E;  1PGJ A;  3L74 J;  1IFJ A;  5CCH D;  2Z5H A;  3GF7 A;  3D70 A;  1SQQ G;  1VF5 B;  2AXC A;  4EOT A;  1L0L D;  2K3R A;  4C7N B;  5B66 E;  3L70 D;  3AEE C;  2W90 A;  1A02 F;  1KB9 E;  4RKU J;  1EZV E;  3G9R A;  5APY A;  3WUT A;  4IL6 H;  1KB9 I;  3T97 B;  1VQ4 P;  1GDT A;  1CI6 B;  4H13 D;  2W27 A;  1T6A A;  2P2U A;  5KJ7 D;  4WY4 D;  1VQ9 P;  5AVX B;  1G1I A;  2E43 A;  3OAK A;  3FWN A;  3L71 E;  4OVN F;  3L72 E;  2I1J A;  1G2C B;  1KFN A;  5TJH A;  5AW6 B;  1Q81 Q;  1KIL B;  2HOD A;  2P67 A;  2N1T C;  5C39 A;  4U3F E;  3L35 A;  3M9H A;  3H1L E;  4QMA A;  1NOH A;  3Q2Y A;  2QJY B;  2QG4 A;  3A0B E;  3RK3 E;  3EQ2 A;  3VMZ A;  4H13 C;  1L2P A;  4YXD C;  1GW3 A;  4OGQ D;  1BGY D;  1J1D C;  4EDF A;  4EI2 A;  3CX5 D;  1SQB J;  3V4Q A;  3WU2 H;  2M5A A;  4PV1 B;  1ZRT D;  3CCV P;  4N3Y B;  4XA4 A;  5GTI E;  1W2E A;  3VN0 A;  2FYU G;  4TLF A;  1T8Z A;  2CPB A;  2J59 M;  1AFO A;  2A45 H;  1KTM A;  2PFX A;  3EFG A;  3I5C A;  3KZI H;  3JCU E;  1LJ2 A;  1NYH A;  4MN4 C;  3HD7 B;  2KIK A;  2XNX A;  1ZME C;  2BAS A;  5KLV E;  1LT1 A;  2WWW A;  4OGQ C;  2Z4E A;  2HG5 D;  1IJD B;  1KV4 A;  3WUV A;  1T3J A;  3AE5 C;  2V4H A;  3L75 D;  1JB0 J;  3BRT B;  2BCC G;  1BDD A;  1DD3 A;  1QX8 A;  1N73 C;  2PP6 A;  3UIA A;  5APV A;  3BCC J;  4AUW A;  3SFD C;  1L0N E;  2I1K A;  4EYY Q;  2ZT9 C;  3R4Y A;  4I7Z C;  5KLV K;  3AEB C;  2A06 G;  1VQM P;  5APT A;  4WWI A;  3MD0 A;  4HH2 A;  3H1H J;  5B5E E;  1BCC J;  3M9Q A;  5KKZ C;  1JY3 N;  1L0L E;  5AVU B;  2M3B A;  1GMJ A;  1IFD A;  1BSH A;  2IFN A;  1PPJ G;  3AE3 C;  2P1J A;  2IBZ D;  2Z5I A;  3GMA A;  4L74 A;  3PH0 A;  1MV8 A;  3IN6 A;  4BRY A;  1NKZ B;  3L74 D;  1X9V A;  4ASV A;  3H1L J;  1JTH A;  5DJT B;  1JY3 P;  3L73 E;  2A45 G;  2IYP A;  1QLE D;  5KLI B;  5M1B A;  2K9J A;  5AW3 B;  2ZT9 B;  4JYB A;  4ZNC A;  1H8A A;  1OMI A;  2YXQ B;  1URQ D;  4O9B A;  3AE8 C;  2IZ1 A;  1GL2 C;  2OYI B;  1YTZ T;  3VP9 A;  2C0X A;  2Q6Q A;  1KMI Z;  1SFC B;  1XTC C;  4YPC A;  3TDK A;  4NPF X;  5KKZ B;  2IX7 C;  5AW4 B;  1EDI A;  2E74 B;  3V2R A;  1KQS O;  1IZN B;  1FU1 A;  1YQ3 C;  3CX5 E;  1YTZ I;  5KLV J;  4C7R A;  3IAO A;  4AQR D;  2E5T A;  1JUN A;  3AEA C;  2KUB A;  1N7S A;  1KFM A;  4BWN A;  1FE6 A;  3KYQ A;  3B5N A;  2O1K A;  1CZQ A;  3BVH A;  5BU8 B;  1SQX G;  5GTH H;  4L76 A;  1SLQ A;  3LID A;  1SQV E;  3B71 A;  1YJN P;  1PP9 J;  4K35 A;  1MFT A;  2RMZ A;  1NGM B;  1WMK A;  1SQB D;  3RL0 D;  1KZU B;  2PGD A;  3GF3 A;  5K5G B;  2O01 J;  2YKQ A;  3GHG A;  3L75 E;  2ZVO B;  4H44 B;  1FZG A;  1BE3 G;  3H1I G;  3VP8 A;  1PGP A;  1PZQ A;  1Y47 A;  1SQP E;  2WQY C;  3CME P;  3MUD A;  2LKM A;  4I1L A;  1N86 A;  1A02 J;  2XND H;  2JKV A;  5CHX A;  3CWB E;  1X22 A;  1L4A D;  2B89 A;  1SQV K;  3RL0 C;  3SWF A;  3NFQ A;  3Q5P A;  3A0H H;  3N7N A;  2BEZ F;  2E75 D;  1VQ6 P;  2LXC B;  2Y9Z A;  2WVR A;  4HYT B;  3BCC D;  5BVZ A;  2WSF H;  1G2C A;  1Q90 D;  3U59 A;  2R3C A;  1K9M Q;  1KOR A;  5AVS B;  2RN0 A;  1SQP K;  1EXJ A;  3L73 J;  1ZW0 A;  2K88 A;  3P7K A;  1S5L E;  1KB9 D;  2FYU K;  5CCG A;  3MIW A;  2ZYD A;  2WPS A;  1NTM G;  1FOS F;  1P84 E;  2QJK B;  1JMB A;  5AW2 B;  2DW3 A;  3H1H D;  3AED C;  1BCC D;  1U7J A;  1P84 I;  3KPE A;  3CCS P;  2E75 C;  1LT9 B;  4UB6 H;  3RK2 B;  1RHZ B;  3L37 A;  3ITK A;  3L72 D;  1FAV A;  3OJA B;  4XE5 B;  3O6Q A;  5CCH A;  3B5N D;  4YTP C;  3HE5 B;  1HWT C;  2QJP B;  1IK7 A;  3CCJ P;  3A3Y B;  2KK7 A;  2GUV A;  3H1L D;  2NPS C;  3P8C E;  1NU1 G;  2OYH A;  1LWU A;  1KQF B;  1SQV J;  1HJ0 A;  4W80 A;  1YBK A;  1N7S C;  4WY4 A;  3MTU E;  4D6T E;  3SWK A;  2H43 A;  3G6E P;  4PJ0 E;  2H8P D;  3MHV A;  1EDK A;  3OW2 O;  3E7K A;  1VQP P;  2OYO A;  1FS0 E;  1SQP J;  1KD1 Q;  5H2F H;  2MKV A;  4NPD A;  3RK3 C;  4R4L A;  1OZH A;  2FYU J;  1IK9 A;  5KLV D;  1SQB E;  1Q86 Q;  3GHG C;  1H0T B;  1J1E C;  4WVZ A;  3CWB J;  1T2K D;  1N8R Q;  1K8A Q;  1M7L A;  1GU5 A;  3U1A A;  1YJW P;  3MUD C;  1KIL D;  1CSB A;  2J58 A;  2NPS B;  3IF4 A;  1GK6 A;  1PP9 D;  2KLU A;  2H89 C;  4H0L B;  2QRX A;  2C0W A;  5KAF E;  3L70 G;  2IFM A;  3H1K E;  1FDI A;  2E42 A;  2D2C B;  1LTJ A;  1S9K E;  1NAF A;  1S72 P;  1ZP0 C;  2M3E A;  3W68 A;  1ZOY C;  4KHX A;  1Q2N A;  3BCC E;  1OXZ A;  2LR2 A;  1NWQ A;  1JCC A;  5CCG C;  4Z1M H;  2QE7 H;  3RK3 B;  5TIS E;  1BDC A;  1SP4 A;  2FBW C;  5CJ0 A;  1QEX A;  2WMM A;  2V7Q H;  5APX A;  2YMK A;  3H1H E;  1BCC E;  1RQU A;  2ITA A;  3CCM P;  1NJI Q;  3FXD A;  2E76 D;  4IFF A;  3HUS A;  2KSJ A;  5CCH C;  4CPG A;  3M9B A;  3L73 D;  1GW4 A;  2QEX P;  3A7O A;  3CXH E;  3CD6 P;  3NMD A;  1BGY G;  1SS1 A;  2YO2 A;  3A2A A;  1RF0 A;  4N78 D;  4N6J A;  3CXH I;  2ZYA A;  3D71 A;  4D6T J;  1FZC B;  1LP1 A;  2OYH C;  1PL5 A;  3V2N A;  1LWU C;  3WUU A;  3HE4 B;  3SFE C;  2KXP B;  2JP3 A;  2ZXX A;  5KJ7 C;  4WY4 C;  3B8E B;  2WTY A;  2JJL A;  1VQL P;  3TNU A;  4UB8 H;  1DX7 A;  1LTT C;  1ZR2 A;  5APQ A;  1M1J A;  3AEG C;  4EIJ A;  1GTW A;  1NH4 A;  2B9B A;  5DJU B;  3H1J E;  3AE6 C;  3W67 A;  1SQV D;  2HPC A;  3H32 B;  3LW5 J;  1NTM K;  3G4S P;  1URQ A;  2FXO A;  2O3J A;  2KNC B;  1VQ8 P;  4BXL A;  1HUC A;  3QH9 A;  3H1K J;  3HTK A;  3E1I A;  4PJ0 H;  1PIX A;  1OX3 A;  1GU4 A;  2N1T B;  2R32 A;  1KIL E;  4PD4 E;  1VQK P;  1SQP D;  3II6 A;  4PD4 I;  2L91 A;  1PP9 E;  2KZI A;  4H13 B;  1M8O B;  2IPP A;  5CMZ A;  3QWO C;  3NXS A;  4KJM A;  1M1K Q;  4I2L C;  3A5T A;  2QM8 A;  3CWB D;  2P58 A;  1J1D B;  1NKN A;  3PHL A;  1NTK G;  3IR9 A;  2IBZ G;  3P32 A;  1JNM A;  2K1A A;  1NU1 K;  3TGU G;  3L74 G;  3CPW O;  2OTL P;  1PV3 A;  2Y0E A;  5E79 H;  3RGU A;  4LLH A;  2FKW B;  3Q3D A;  1RF1 A;  2B87 A;  1NHL A;  4OGQ B;  3CCU P;  1M56 D;  1R8E A;  1TU3 F;  1P84 D;  1ZN5 A;  4TT3 H;  2WSC J;  2XDJ A;  1L4A A;  3KQG A;  2QM7 A;  1N73 B;  1DEE G;  3CCL P;  1Q82 Q;  1N2D C;  2QA4 P;  5B66 H;  1OVU A;  1RF0 C;  1KB9 H;  3F89 A;  1SQQ E;  1QL1 A;  1YYC A;  2Q3E A;  2M0B A;  1KQG B;  5AW5 B;  4N78 E;  1KYO E;  2ZJS E;  5AW1 B;  4I7Z B;  2YKO A;  2AXT E;  2FYZ A;  1AV1 A;  3FX0 A;  1UIX A;  1KYO I;  2N9B A;  5APS A;  1FZE A;  3P8C D;  2QSI A;  3H1J J;  3AEF C;  5AVZ B;  1M1J C;  1K73 Q;  1EDL A;  2WSE J;  5KAI E;  1NU1 J;  4D6T D;  1SQQ K;  2NRG A;  2FFD A;  2WPQ A;  3VMX A;  2H7H A;  3CL3 D;  3A0B H;  3M0A A;  1URQ C;  2IDB A;  2YMY A;  2Q3I A;  1FDO A;  2WT7 A;  1PFI A;  5AW7 B;  2Y0C A;  1W2B O;  2Q1K A;  3PP5 A;  2HOD B;  2Q9I A;  2W6B A;  4IL6 X;  3B4S A;  5GTI H;  1HBW A;  1S3J A;  2WPR A;  4Y99 C;  3PRJ A;  4B86 A;  1GL2 B;  1NTZ G;  4C7N A;  3JCU H;  2POH A;  1N7L A;  2IZ0 A;  2FYU E;  2O1J A;  4GOF A;  2M5A B;  3S9O A;  1KC8 Q;  3T97 A;  3L4F A;  1USE A;  3H1K D;  1SVF A;  2YKP A;  1S9K D;  1CI6 A;  1EZV G;  2JR8 A;  2KZJ A;  1JY2 O;  2OTJ P;  2KS1 B;  2ZYG A;  1LTA C;  3V2Q A;  1IFN A;  4GOD A;  2KYV A;  1RF1 C;  2FXP A;  1Y8A A;  2BCC E;  4RO0 A;  1H89 A;  1JM0 A;  2HR3 A;  1KIL A;  2W6J H;  1T3U A;  3AE2 C;  5CJ4 A;  2O01 H;  3L71 G;  3CLQ A;  2Q5U A;  3L72 G;  3MGN A;  1SQQ J;  3MP7 B;  3O8Z A;  5AW9 B;  3KXD A;  1L4A C;  1MKM A;  3L36 A;  1VDF A;  5B5E H;  4U3F G;  4DJG A;  3H1L G;  2A06 E;  4LGD E;  1QL2 A;  3CXH D;  2B88 A;  3PTZ A;  1OFC X;  1MUU A;  1AVO A;  1U7M A;  3RL0 B;  3K5B A;  3VMY A;  3FWL A;  2J5U A;  3KHU A;  3CI9 A;  3HD7 A;  1PGO A;  1VQ7 P;  2KNC A;  1X79 B;  3TYY A;  3GG2 A;  3V5B A;  3CMA P;  1OW6 A;  1NTK K;  3M0D A;  4DCK A;  3WU2 E;  4BRY B;  1VF5 D;  1CW5 A;  1MZ9 A;  3Q5S A;  1OIP A;  2R3S A;  2CPS A;  1FC2 C;  2FFD C;  5KLV G;  3CCE P;  1K05 A;  2N1T A;  3B5N C;  3NTN A;  1AA0 A;  2FYN C;  3I55 P;  2JO1 A;  1JTH B;  4GOE A;  2A45 I;  3H1J D;  2Y9Y A;  3C9I A;  3VMA A;  2E75 B;  3PLN A;  3VOP A;  2R44 A;  2ZFC A;  1RQV A;  2K9J B;  2K37 A;  2W6A A;  3IFM A;  3CX5 H;  1NU1 D;  1L0N G;  3RBZ A;  1XTG B;  1M57 D;  3VYI A;  3G71 P;  4W7Y A;  3ZDM A;  1VF5 C;  2AEJ A;  3RL0 g;  1VPC A;  4PD4 D;  1RE3 A;  3M91 A;  5BU5 A;  2G8Y A;  2VRS A;  1L0L G;  1OVR A;  2BCC J;  1SQX E;  2H88 C;  2YXR B;  1HGZ A;  2V7Q J;  1UII A;  1WRG A;  3KDP B;  4HKZ H;  1N7S B;  2JEE A;  3Q5R A;  3B5N B;  1NO4 A;  1T2K C;  1N73 A;  3R2P A;  1VL2 A;  4WB4 A;  4PV1 D;  1NTK J;  1KIL C;  5APW A;  1M90 Q;  3OA7 A;  1BE3 E;  3H1I E;  1FOS E;  1FJP A;  3AE9 C;  3I56 P;  2KI7 B;  2QJY C;  3TGU J;  3GW6 A;  3F5H A;  3L73 G;  4NPE A;  4DT0 A;  3HD7 D;  1X0T A;  3GHG B;  3TSI A;  1J1E B;  2OYI A;  4AYC A;  1SQX K;  2OQQ A;  1SFC A;  1OW8 A;  3TF5 A;  4RJT A;  4JF7 A;  2N1T D;  4PV1 C;  3M06 A;  4ZKU A;  1EZV I;  2WIT A;  3EWK A;  4IOI H;  3Q1M A;  1S5L H;  2QVA A;  1SQQ D;  1JO5 A;  1EXI A;  2P7J A;  1P84 H;  1JCD A;  1KYO D;  1NTZ K;  3HD7 C;  3CCR P;  1NTM E;  3M0D C;  1QVG O;  2HFE D;  1VQN P;  2E76 C;  2HYN A;  3AE1 C;  4L73 A;  2YIU C;  3CC4 P;  1SQV G;  1VQO P;  1FZF A;  2HLO A;  2XV5 A;  2OAR A;  5L8R J;  3E1R A;  2WZ7 A;  2WPV B;  2GUS A;  3SSU A;  5APU A;  1OWA A;  5GTH E;  1GL2 A;  2P10 A;  1ZV8 A;  3U1C A;  3L75 G;  3AEC C;  3VTP C;  1SQP G;  1FJK A;  3O6Q B;  4KT0 J;  1NU1 E;  1LTS C; 
#chains in the Genus database with same CATH homology
 5B5E E;  3KZI E;  4PJ0 E;  1W5C E;  5H2F E;  4UB8 E;  4UB6 E;  3A0H E;  5KAF E;  3JCU E;  3WU2 E;  5B66 E;  2AXT E;  5TIS E;  5KAI E;  4IL6 E;  1S5L E;  3A0B E;  5GTI E;  5GTH E;  5E79 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...