5KAIO

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
244
structure length
244
Chain Sequence
QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 42
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5kaiO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5kaiO02
3A0HO 5TISO 3WU2O 4UB6O 5G38A 5G3AA 5GTIO 5E79O 5B66O 5KAFO 4UB8O 4IL6O 4PJ0O 3A0BO 5KAIO 3JCUO 2AXTO 5B5EO 1S5LO 5G39A 5GTHO 3KZIO 5H2FO
chains in the Genus database with same CATH superfamily
4AKRA 1PRNA 3WU2O 2WVPA 4K3CA 3HWBA 2ODJA 1GFQA 2R88A 4O3ZA 2XE3A 1G90A 3UPGA 3AAAB 4C4VB 4UB6O 1BT9A 4XNLA 2LHFA 2J4UP 1T1LA 2OMFA 3EMNX 3T24A 1MM4A 3VY8X 4O49A 1MM5A 3BS0A 2XG6A 3LK41 4CTDA 4O3YA 4AYNA 1Q9FA 3DWOX 3UU2A 4D64A 3AAEA 4GF4A 2X9KA 2YPVA 3POQA 4AYID 1GFNA 3SYSA 2X27X 2PORA 3BRZA 2XTRA 3AA1B 3WI5A 4GHBA 1QJ8A 3AA0A 3O0EA 4RJWA 2WJRA 4AKRB 2ZLDA 3DA4A 3SYBA 3SZVA 2FGQX 3G7GA 4D65A 5GTHO 3PQUA 3NJTA 3DZMA 3AA6A 5D5DA 5DL6A 3A0HO 5TISO 4QQ1A 4U9CA 2J1NA 3DWNA 4GCSA 4RJXA 2XE2A 2XTQA 3LK3B 4O4XA 4B61A 5DL8A 2XMXA 2K0LA 2WJQA 5AFUK 2PRNA 4K3BA 5JDPA 5G3AA 5ADXL 3A2SX 2KXPA 5E79O 5B66O 3AAEB 2R4LA 3POXA 2FGRA 5KAFO 1GFPA 2O4VA 4AYEC 3LK42 4UB8O 3QRCA 2Y7SA 3PRNA 4FESA 3PGRA 4KR4A 5KAIO 1ZHTA 2M07A 3AA0B 2F1TA 2W81C 2Y0LA 4AUIA 1QJ9A 1QJPA 3VY9X 3VZUX 2AXTO 4FT6A 5AFUL 5B5EO 1GFOA 4FZMA 2R8AA 4FRTA 1PHOA 3AA6B 4AYMC 5ADXK 2R89A 2M06A 1HXTA 4E1TA 2IWVA 2Y0KA 5DL7A 2R4NA 1T16A 2Y0HA 3NSGA 4GCPA 3VE1A 4LSHA 4AKMA 2XE1A 4LSFA 2KXPB 4FOZA 4JFBA 2LFUA 1IZNA 3GP6A 3LK2A 4C69X 4G75A 1BH3A 5G38A 3PORA 3AAAA 4LSIA 4N58A 3AA7A 2IWWA 1HXUA 1ZHZA 2GE4A 3DA3A 3KVDD 4N75A 4AZLA 4C00A 2F1CX 4IL6O 2MHLA 4KR8A 4O3XB 8PRNA 2N2MA 2XE5A 2JQYA 3HW9A 1ZHYA 3A0BO 5EE2A 5G26A 3PGSA 3RBHA 3VZWX 2R4PA 1YS5A 4E1SA 2ERVA 1OPFA 3SY7A 3PF1A 3JCUO 2N2LA 5PRNA 1S5LO 3PGUA 1ZHWA 4KRAA 4N59A 3WI4A 4O3WA 5FVNA 3TZGA 4RLBA 2KZ7A 2QTKA 2W80C 4AFKA 5G39A 3KZIO 2KDYA 5IYUA 5H2FO 4FQEA 3FYXA 1E54A 1IZNB 4FRXA 2R4OA 3LK2B 4JCHA 3C5OA 2ZFGA 4BUMX 3POUA 3SZDA 3BRYA 4FZLA 3T0SA 3HOLA 3AA7B 4Z3TA 1P4TA 1MPFA 3LK3A 7PRNA 5GTIO 1THQA 4FSOA 3QRAA 1ZHXA 4LSEA 4O4UA 1HXXA 3JTYA 4FUVA 4C4VA 4FMSA 3K19A 3PQSA 2MNHA 2KC0A 3UAQA 4D5UA 2Y2XA 5DL5A 4FSPA 1BXWA 4PR7A 3V8UA 1H6S1 4PJ0O 4RL9A 3VZTX 4G76A 4FZNA 5GV0A 4F4BA 2KZ7B 2K4TA 4GCQA 4XNKA 2F1VA 1Q9GA 3T20A 4PUXA 3HOEA 3VE2A 5T5FA 1OSMA 4N74A 2YNKA 3AA1A 3SY9A 6PRNA 1ORMA 1GFMA 4RLCA 4AYDC 2JMMA
chains in the Genus database with same CATH topology
3A0HO 5TISO 3WU2O 4UB6O 5G38A 5G3AA 5GTIO 5E79O 5B66O 5KAFO 4UB8O 4IL6O 4PJ0O 3A0BO 5KAIO 3JCUO 2AXTO 5B5EO 1S5LO 5G39A 5GTHO 3KZIO 5H2FO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H O;  5TIS O;  3WU2 O;  4UB6 O;  5G38 A;  5G3A A;  5GTI O;  5E79 O;  5B66 O;  5KAF O;  4UB8 O;  4IL6 O;  4PJ0 O;  3A0B O;  5KAI O;  3JCU O;  2AXT O;  5B5E O;  1S5L O;  5G39 A;  5GTH O;  3KZI O;  5H2F O; 
#chains in the Genus database with same CATH topology
 4AKR A;  1PRN A;  3WU2 O;  2WVP A;  4K3C A;  3HWB A;  2ODJ A;  1GFQ A;  2R88 A;  4O3Z A;  2XE3 A;  1G90 A;  3UPG A;  3AAA B;  4C4V B;  4UB6 O;  1BT9 A;  4XNL A;  2LHF A;  2J4U P;  1T1L A;  2OMF A;  3EMN X;  3T24 A;  1MM4 A;  3VY8 X;  4O49 A;  1MM5 A;  3BS0 A;  2XG6 A;  3LK4 1;  4CTD A;  4O3Y A;  4AYN A;  1Q9F A;  3DWO X;  3UU2 A;  4D64 A;  3AAE A;  4GF4 A;  2X9K A;  2YPV A;  3POQ A;  4AYI D;  1GFN A;  3SYS A;  2X27 X;  2POR A;  3BRZ A;  2XTR A;  3AA1 B;  3WI5 A;  4GHB A;  1QJ8 A;  3AA0 A;  3O0E A;  4RJW A;  2WJR A;  4AKR B;  2ZLD A;  3DA4 A;  3SYB A;  3SZV A;  2FGQ X;  3G7G A;  4D65 A;  5GTH O;  3PQU A;  3NJT A;  3DZM A;  3AA6 A;  5D5D A;  5DL6 A;  3A0H O;  5TIS O;  4QQ1 A;  4U9C A;  2J1N A;  3DWN A;  4GCS A;  4RJX A;  2XE2 A;  2XTQ A;  3LK3 B;  4O4X A;  4B61 A;  5DL8 A;  2XMX A;  2K0L A;  2WJQ A;  5AFU K;  2PRN A;  4K3B A;  5JDP A;  5G3A A;  5ADX L;  3A2S X;  2KXP A;  5E79 O;  5B66 O;  3AAE B;  2R4L A;  3POX A;  2FGR A;  5KAF O;  1GFP A;  2O4V A;  4AYE C;  3LK4 2;  4UB8 O;  3QRC A;  2Y7S A;  3PRN A;  4FES A;  3PGR A;  4KR4 A;  5KAI O;  1ZHT A;  2M07 A;  3AA0 B;  2F1T A;  2W81 C;  2Y0L A;  4AUI A;  1QJ9 A;  1QJP A;  3VY9 X;  3VZU X;  2AXT O;  4FT6 A;  5AFU L;  5B5E O;  1GFO A;  4FZM A;  2R8A A;  4FRT A;  1PHO A;  3AA6 B;  4AYM C;  5ADX K;  2R89 A;  2M06 A;  1HXT A;  4E1T A;  2IWV A;  2Y0K A;  5DL7 A;  2R4N A;  1T16 A;  2Y0H A;  3NSG A;  4GCP A;  3VE1 A;  4LSH A;  4AKM A;  2XE1 A;  4LSF A;  2KXP B;  4FOZ A;  4JFB A;  2LFU A;  1IZN A;  3GP6 A;  3LK2 A;  4C69 X;  4G75 A;  1BH3 A;  5G38 A;  3POR A;  3AAA A;  4LSI A;  4N58 A;  3AA7 A;  2IWW A;  1HXU A;  1ZHZ A;  2GE4 A;  3DA3 A;  3KVD D;  4N75 A;  4AZL A;  4C00 A;  2F1C X;  4IL6 O;  2MHL A;  4KR8 A;  4O3X B;  8PRN A;  2N2M A;  2XE5 A;  2JQY A;  3HW9 A;  1ZHY A;  3A0B O;  5EE2 A;  5G26 A;  3PGS A;  3RBH A;  3VZW X;  2R4P A;  1YS5 A;  4E1S A;  2ERV A;  1OPF A;  3SY7 A;  3PF1 A;  3JCU O;  2N2L A;  5PRN A;  1S5L O;  3PGU A;  1ZHW A;  4KRA A;  4N59 A;  3WI4 A;  4O3W A;  5FVN A;  3TZG A;  4RLB A;  2KZ7 A;  2QTK A;  2W80 C;  4AFK A;  5G39 A;  3KZI O;  2KDY A;  5IYU A;  5H2F O;  4FQE A;  3FYX A;  1E54 A;  1IZN B;  4FRX A;  2R4O A;  3LK2 B;  4JCH A;  3C5O A;  2ZFG A;  4BUM X;  3POU A;  3SZD A;  3BRY A;  4FZL A;  3T0S A;  3HOL A;  3AA7 B;  4Z3T A;  1P4T A;  1MPF A;  3LK3 A;  7PRN A;  5GTI O;  1THQ A;  4FSO A;  3QRA A;  1ZHX A;  4LSE A;  4O4U A;  1HXX A;  3JTY A;  4FUV A;  4C4V A;  4FMS A;  3K19 A;  3PQS A;  2MNH A;  2KC0 A;  3UAQ A;  4D5U A;  2Y2X A;  5DL5 A;  4FSP A;  1BXW A;  4PR7 A;  3V8U A;  1H6S 1;  4PJ0 O;  4RL9 A;  3VZT X;  4G76 A;  4FZN A;  5GV0 A;  4F4B A;  2KZ7 B;  2K4T A;  4GCQ A;  4XNK A;  2F1V A;  1Q9G A;  3T20 A;  4PUX A;  3HOE A;  3VE2 A;  5T5F A;  1OSM A;  4N74 A;  2YNK A;  3AA1 A;  3SY9 A;  6PRN A;  1ORM A;  1GFM A;  4RLC A;  4AYD C;  2JMM A; 
#chains in the Genus database with same CATH homology
 3A0H O;  5TIS O;  3WU2 O;  4UB6 O;  5G38 A;  5G3A A;  5GTI O;  5E79 O;  5B66 O;  5KAF O;  4UB8 O;  4IL6 O;  4PJ0 O;  3A0B O;  5KAI O;  3JCU O;  2AXT O;  5B5E O;  1S5L O;  5G39 A;  5GTH O;  3KZI O;  5H2F O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...