5KAIO

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
244
structure length
244
Chain Sequence
b'QTLTYDDIVGTGLANKCPTLDDTARGAYPIDSSQTYRIARLCLQPTTFLVKEEPKNKRQEAEFVPTKLVTRETTSLDQIQGELKVNSDGSLTFVEEDGIDFQPVTVQMAGGERIPLLFTVKNLVASTQPNVTSITTSTDFKGEFNVPSYRTANFLDPKGRGLASGYDSAIALPQAKEEELARANVKRFSLTKGQISLNVAKVDGRTGEIAGTFESEQLSDDDMGAHEPHEVKIQGVFYASIEPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 42
structure length 244
sequence length 244
chains with identical sequence o
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF01716 MSP Manganese-stabilising protein / photosystem II polypeptide
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.30 Mainly Beta Beta Barrel Porin Photosystem II, cytochrome c-550 precursor 5kaiO01
3.30.2050.10 Alpha Beta 2-Layer Sandwich photosynthetic oxygen evolving center fold photosynthetic oxygen evolving center domain 5kaiO02
5E79O 3WU2O 5G38A 4PJ0O 5G39A 5B5EO 5GTIO 4IL6O 4UB6O 5TISO 2AXTO 5G3AA 5H2FO 3KZIO 5B66O 4UB8O 5KAIO 5GTHO 3A0BO 3A0HO 5KAFO 3JCUO 1S5LO
chains in the Genus database with same CATH superfamily
1HXTA 3EMNX 2GE4A 2JQYA 2OMFA 4FRXA 5G38A 3BRZA 2R4LA 2N2MA 2LHFA 2ODJA 4N74A 4PJ0O 4AKRA 1MM5A 5AFUK 3BS0A 1E54A 4O3XB 1P4TA 3A2SX 3K19A 4E1SA 3SY7A 3AA1B 3VE1A 4C4VB 3VZWX 3C5OA 3POXA 2F1TA 1ZHXA 4PR7A 5GTIO 4UB6O 4AFKA 7PRNA 3PGRA 2PORA 3AAEB 1PRNA 1T16A 2QTKA 4JCHA 4KR4A 4O49A 1PHOA 3V8UA 4XNKA 8PRNA 2FGQX 3WI5A 1YS5A 4B61A 1GFNA 1Q9FA 3AAAA 1IZNA 1GFOA 2O4VA 4FSPA 4FQEA 2KZ7A 4FZMA 4K3CA 2K4TA 4LSHA 3LK41 1GFQA 1H6S1 2M07A 2XG6A 2XE2A 3AA0A 4N75A 4XNLA 2M06A 2R8AA 3DWOX 4FSOA 4KRAA 1HXUA 1IZNB 3VY9X 3PORA 4AYID 3LK3B 1ZHTA 2X9KA 4AKRB 3AA0B 4G75A 3AA1A 4C4VA 3DZMA 2R88A 3VZUX 2FGRA 5ADXL 5B5EO 4C69X 3AAEA 3DWNA 4GHBA 2K0LA 3PQSA 4GCQA 4O3WA 2XE1A 1QJ9A 4AZLA 4O4XA 2W81C 2W80C 3PF1A 4AKMA 1ZHYA 4FZNA 2XE5A 3SYSA 3UPGA 2XMXA 4N59A 3KZIO 1QJ8A 5KAIO 5ADXK 3SY9A 4KR8A 4K3BA 5EE2A 3VY8X 1GFPA 2R4OA 3AA7B 3HW9A 3PRNA 4RLCA 5DL6A 3SZVA 4D65A 3DA3A 3GP6A 4AUIA 3LK3A 2ERVA 2R4PA 5KAFO 2YPVA 2KC0A 3O0EA 3HOEA 3T24A 2X27X 3UAQA 2XTQA 5IYUA 2MHLA 3JCUO 5T5FA 1BH3A 3T20A 1T1LA 4D5UA 2Y0HA 4GCSA 4AYDC 4GF4A 4AYNA 5E79O 3BRYA 4FUVA 2KXPB 2J1NA 3QRCA 2WVPA 3SYBA 1ORMA 1Q9GA 4D64A 3FYXA 2XE3A 3AA6B 3LK42 3POQA 1MM4A 1QJPA 1HXXA 4O3ZA 4RJXA 5G26A 5TISO 3VZTX 3TZGA 4QQ1A 2ZLDA 4RLBA 5G3AA 3AA7A 4AYEC 1OSMA 5B66O 5H2FO 4RL9A 1OPFA 2Y7SA 3DA4A 3NJTA 4UB8O 3VE2A 4LSFA 4RJWA 4N58A 4U9CA 5D5DA 3PGUA 4E1TA 3KVDD 5AFUL 3WI4A 1BT9A 2WJRA 4F4BA 2Y2XA 4FMSA 1BXWA 3PGSA 5DL8A 2Y0KA 2KXPA 3SZDA 4CTDA 3LK2B 1G90A 1S5LO 2ZFGA 1THQA 4FESA 3RBHA 3WU2O 3AA6A 2LFUA 5G39A 4FOZA 5DL5A 2MNHA 2F1CX 4O3YA 2PRNA 5DL7A 2WJQA 4O4UA 3HWBA 2Y0LA 3HOLA 2N2LA 4GCPA 4IL6O 4AYMC 2AXTO 3UU2A 2KDYA 2JMMA 2YNKA 6PRNA 3G7GA 4Z3TA 5PRNA 3POUA 4FZLA 3PQUA 5GTHO 5JDPA 3A0BO 4FRTA 1GFMA 4G76A 4LSIA 3JTYA 3T0SA 3LK2A 2J4UP 2R4NA 3A0HO 2XTRA 2IWVA 5FVNA 3QRAA 4LSEA 3AAAB 4PUXA 1ZHZA 2R89A 3NSGA 4BUMX 4C00A 4FT6A 2KZ7B 2F1VA 2IWWA 1MPFA 5GV0A 1ZHWA 4JFBA
chains in the Genus database with same CATH topology
5E79O 3WU2O 5G38A 4PJ0O 5G39A 5B5EO 5GTIO 4IL6O 4UB6O 5TISO 2AXTO 5G3AA 5H2FO 3KZIO 5B66O 4UB8O 5KAIO 5GTHO 3A0BO 3A0HO 5KAFO 3JCUO 1S5LO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 O;  3WU2 O;  5G38 A;  4PJ0 O;  5G39 A;  5B5E O;  5GTI O;  4IL6 O;  4UB6 O;  5TIS O;  2AXT O;  5G3A A;  5H2F O;  3KZI O;  5B66 O;  4UB8 O;  5KAI O;  5GTH O;  3A0B O;  3A0H O;  5KAF O;  3JCU O;  1S5L O; 
#chains in the Genus database with same CATH topology
 1HXT A;  3EMN X;  2GE4 A;  2JQY A;  2OMF A;  4FRX A;  5G38 A;  3BRZ A;  2R4L A;  2N2M A;  2LHF A;  2ODJ A;  4N74 A;  4PJ0 O;  4AKR A;  1MM5 A;  5AFU K;  3BS0 A;  1E54 A;  4O3X B;  1P4T A;  3A2S X;  3K19 A;  4E1S A;  3SY7 A;  3AA1 B;  3VE1 A;  4C4V B;  3VZW X;  3C5O A;  3POX A;  2F1T A;  1ZHX A;  4PR7 A;  5GTI O;  4UB6 O;  4AFK A;  7PRN A;  3PGR A;  2POR A;  3AAE B;  1PRN A;  1T16 A;  2QTK A;  4JCH A;  4KR4 A;  4O49 A;  1PHO A;  3V8U A;  4XNK A;  8PRN A;  2FGQ X;  3WI5 A;  1YS5 A;  4B61 A;  1GFN A;  1Q9F A;  3AAA A;  1IZN A;  1GFO A;  2O4V A;  4FSP A;  4FQE A;  2KZ7 A;  4FZM A;  4K3C A;  2K4T A;  4LSH A;  3LK4 1;  1GFQ A;  1H6S 1;  2M07 A;  2XG6 A;  2XE2 A;  3AA0 A;  4N75 A;  4XNL A;  2M06 A;  2R8A A;  3DWO X;  4FSO A;  4KRA A;  1HXU A;  1IZN B;  3VY9 X;  3POR A;  4AYI D;  3LK3 B;  1ZHT A;  2X9K A;  4AKR B;  3AA0 B;  4G75 A;  3AA1 A;  4C4V A;  3DZM A;  2R88 A;  3VZU X;  2FGR A;  5ADX L;  5B5E O;  4C69 X;  3AAE A;  3DWN A;  4GHB A;  2K0L A;  3PQS A;  4GCQ A;  4O3W A;  2XE1 A;  1QJ9 A;  4AZL A;  4O4X A;  2W81 C;  2W80 C;  3PF1 A;  4AKM A;  1ZHY A;  4FZN A;  2XE5 A;  3SYS A;  3UPG A;  2XMX A;  4N59 A;  3KZI O;  1QJ8 A;  5KAI O;  5ADX K;  3SY9 A;  4KR8 A;  4K3B A;  5EE2 A;  3VY8 X;  1GFP A;  2R4O A;  3AA7 B;  3HW9 A;  3PRN A;  4RLC A;  5DL6 A;  3SZV A;  4D65 A;  3DA3 A;  3GP6 A;  4AUI A;  3LK3 A;  2ERV A;  2R4P A;  5KAF O;  2YPV A;  2KC0 A;  3O0E A;  3HOE A;  3T24 A;  2X27 X;  3UAQ A;  2XTQ A;  5IYU A;  2MHL A;  3JCU O;  5T5F A;  1BH3 A;  3T20 A;  1T1L A;  4D5U A;  2Y0H A;  4GCS A;  4AYD C;  4GF4 A;  4AYN A;  5E79 O;  3BRY A;  4FUV A;  2KXP B;  2J1N A;  3QRC A;  2WVP A;  3SYB A;  1ORM A;  1Q9G A;  4D64 A;  3FYX A;  2XE3 A;  3AA6 B;  3LK4 2;  3POQ A;  1MM4 A;  1QJP A;  1HXX A;  4O3Z A;  4RJX A;  5G26 A;  5TIS O;  3VZT X;  3TZG A;  4QQ1 A;  2ZLD A;  4RLB A;  5G3A A;  3AA7 A;  4AYE C;  1OSM A;  5B66 O;  5H2F O;  4RL9 A;  1OPF A;  2Y7S A;  3DA4 A;  3NJT A;  4UB8 O;  3VE2 A;  4LSF A;  4RJW A;  4N58 A;  4U9C A;  5D5D A;  3PGU A;  4E1T A;  3KVD D;  5AFU L;  3WI4 A;  1BT9 A;  2WJR A;  4F4B A;  2Y2X A;  4FMS A;  1BXW A;  3PGS A;  5DL8 A;  2Y0K A;  2KXP A;  3SZD A;  4CTD A;  3LK2 B;  1G90 A;  1S5L O;  2ZFG A;  1THQ A;  4FES A;  3RBH A;  3WU2 O;  3AA6 A;  2LFU A;  5G39 A;  4FOZ A;  5DL5 A;  2MNH A;  2F1C X;  4O3Y A;  2PRN A;  5DL7 A;  2WJQ A;  4O4U A;  3HWB A;  2Y0L A;  3HOL A;  2N2L A;  4GCP A;  4IL6 O;  4AYM C;  2AXT O;  3UU2 A;  2KDY A;  2JMM A;  2YNK A;  6PRN A;  3G7G A;  4Z3T A;  5PRN A;  3POU A;  4FZL A;  3PQU A;  5GTH O;  5JDP A;  3A0B O;  4FRT A;  1GFM A;  4G76 A;  4LSI A;  3JTY A;  3T0S A;  3LK2 A;  2J4U P;  2R4N A;  3A0H O;  2XTR A;  2IWV A;  5FVN A;  3QRA A;  4LSE A;  3AAA B;  4PUX A;  1ZHZ A;  2R89 A;  3NSG A;  4BUM X;  4C00 A;  4FT6 A;  2KZ7 B;  2F1V A;  2IWW A;  1MPF A;  5GV0 A;  1ZHW A;  4JFB A; 
#chains in the Genus database with same CATH homology
 5E79 O;  3WU2 O;  5G38 A;  4PJ0 O;  5G39 A;  5B5E O;  5GTI O;  4IL6 O;  4UB6 O;  5TIS O;  2AXT O;  5G3A A;  5H2F O;  3KZI O;  5B66 O;  4UB8 O;  5KAI O;  5GTH O;  3A0B O;  3A0H O;  5KAF O;  3JCU O;  1S5L O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...