5KAIZ

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5kaiZ00
5KAFZ 4IL6Z 5H2FZ 3JCUZ 5GTIZ 5B66Z 5B5EZ 1S5LZ 3A0HZ 5E79Z 4PJ0Z 3KZIZ 5KAIZ 2AXTZ 4UB6Z 5GTHZ 3A0BZ 5TISZ 4UB8Z 3WU2Z
chains in the Genus database with same CATH superfamily
4LFAO 3W7WA 2VQEB 4HZ3A 1F4MA 2UXBO 1VF7A 1QR8A 1VQ6V 4GKKB 1EM1A 3FFQA 3OGIB 5IDJA 1SQPH 5JCOC 4JI4O 4YXWG 3DSQA 3A0BZ 2CTPA 2ZDIC 3JSLA 4FFBB 5AG2A 1IURA 1P84F 5H9CA 2UXCB 1XNQB 3L72H 2V4DA 5KHJA 1M57B 4CZZA 1V9PA 2JGDA 5KX5B 2Q69A 5B1OA 1N33O 5IYBO 4DV2O 4H0LB 3OTOB 2EINB 3JD2A 1RSOA 4GZRB 4YHHB 1XL4A 5KMGA 5EK0A 4R8CA 3L9DA 2UUBO 1E1RG 4HYOA 2ZNJA 3CRAA 3F7VC 2XT9A 5GTIZ 1O9HA 2WLJA 4PA4A 3X2QB 1ROPA 1UPGA 1HW7A 3FYEB 3SYQA 1I0HA 1NBMG 4JI8B 2EBOA 2NNUA 1KQSU 5JH7B 1YI2V 1TGOA 3ETDA 3ABTA 1S3JA 2CUGA 4X8AA 5L3DA 1OCZC 2LFSA 1VQ7V 2RQ6A 5DECA 1AROP 4DV6B 4EB6A 1BCCH 2WLIA 2ZE7A 3GB7C 1TUEB 3J7AU 1PNLA 1W0JG 4LF8B 3TJTA 4PDVA 4DW0A 2FL4A 2JRIA 3D8CA 3MHSC 3BRCA 4K8XA 5IT9N 2P4VA 4DK0A 4PHZA 2YIAA 1SETA 1WNSA 3OFNG 4JI2B 4P9OA 2XAJA 3TGUH 2UXDO 4JI7O 2WA4A 4DV7O 2EIMC 3DXRB 1S77D 1S5JA 2WLMA 1GAXA 4QPKA 2UXNA 5BR8B 5B3SB 5DN6G 1E1QG 2BTOA 3KKYA 3T2MA 1PNKA 3SPCA 3VOUA 4DR2O 1Q3EA 1R3LC 1AB3A 3H9VA 4JI5B 4D6TH 3P30A 5EBLC 4JI1O 1RM1B 2DE0X 4KUMA 3OT7A 5LYJB 1VQMV 4NTYA 2IJHA 5KHKA 1V54C 4F6EA 1EN4A 2CGNA 3JAMN 2F4VB 3T4ZA 4OGQB 2JEUA 1QHTA 1CXZB 2ZIMA 4MSWC 1N32B 4DV5B 3RGBA 2NR5A 2X0LA 3ASOB 4KHPO 1FXVA 2AHYA 3ZEDA 5B5EZ 1FAFA 3TXQA 3BHPA 1VF6A 3ZN0A 5CMUA 1J95A 1XDCA 2ZT9B 4JI3O 2Q9LA 5CBFA 4LP8A 3KCXA 4DV4B 1FKAO 4DR7B 1MA1A 3JALA 2Q6AA 5IJ9A 3LDCA 3HKEA 3CCUV 1K7DA 1XMOO 4J7JA 3Q4HB 1XUQA 2RJZA 5IWAB 4X66O 1JFFB 4Q6GA 3ZBHA 1S72V 4FIPC 3RVZA 3QO7A 4LH6A 4HNAA 5FPOA 1HNXB 3UM7A 3AK3A 1KD1W 1JX9A 3LSQA 1R6KA 2ZE8A 4UCRA 1YJWV 1Q82W 4FJCC 1JA8A 4MTXA 3O9OA 1YJ9V 2ILMA 2DWEC 5F2VO 5LL6Y 4LF9B 2QKCA 2PZSA 2LO1A 4GX5A 2QEXV 1G4YB 2BE3A 4P9PA 4ZOLB 4JAVA 5C93A 4G2KA 3B8NA 3K06A 2OCCC 1SA0B 2QWQB 3HKBB 4YY3B 4JYYA 2QWNB 4BAYA 2IH3C 5LA6B 2A3QA 1VQ8V 5EC1C 5KA5A 2UUAB 1YF2A 4I50B 1EN6A 1M4UA 1NTMH 2P90A 3BPZA 3JASA 4DV3O 3APQA 1XMQO 1N34B 4DR4O 1OCZB 1WAZA 5GTHZ 4CC5A 1Q43A 3CRMA 4LFBO 1WB8A 4B08A 5BZBA 2ZXWC 4X1IB 1OCCC 2JJ1G 4DR5O 3CC7V 4PDMA 1N36B 1F51A 4WBNB 4JGSA 5IE9A 5LGTA 3VQWA 3H1IH 1YXBA 3JD3A 3JSNA 2ZM6B 1VQLV 3SJQC 2EIMB 5LHIA 3W7TA 1URFA 1QR9A 3CC2V 3RN4A 3L75H 2R72A 3ZMSA 4O4IB 4EFBA 4U7OA 1F23A 1AI7A 2KG7A 1TUBA 5B1BC 4LF7B 3FB6C 1KMIZ 2BOBC 1D5NA 4N21A 4MTGA 3OMIB 2GTAA 3CP1A 2ZR2A 2YIDA 1MABG 5EYPA 1V54B 5ITZA 3CB2A 3E8GA 4D7TA 3LUTB 5JCOA 3ASNC 4LR3A 3MAQA 3U0ZA 2LW7A 3PJSK 4UV9A 3IC7A 4JI6O 4X62O 4G28B 4DYLA 2P5OA 4PELA 4UCVA 4I55A 3IAYA 2XAQA 1P49A 4L8JA 4ZBMA 4WF9V 3AG1C 2VRZA 5LOVB 4GKKO 3OR6C 1D2DA 3SYAA 3CCJV 4DUYB 3K57A 4H33A 5EBWC 2BCCH 3UO3A 1SA0A 2MK3A 1WLEA 2ZE6A 5KAFZ 3HKBA 1SS3A 3ZHSA 1OV9A 1N0NA 1NI8A 2NN4A 2QM4A 2UXCO 4CS4A 5H6QA 2A06H 4A5UB 3ABMC 1XBLA 4I50A 2EZPA 2Z3YA 1VQPV 3OUFA 4LNUB 5J2UB 2IU3A 4UVBA 1SQFA 3UQ8A 2Y4TA 3RWRD 1OJHA 3G67A 2EIKC 2IBZH 3J81N 3CWBH 4OXSA 2OCCB 3T1YO 3D36A 1VF6C 1IBKB 4LWSB 1X59A 2Y69C 4WBNA 1M1KW 4JI8O 2Q7GA 4E2LA 3WU2Z 2DQ0A 1VQ5V 3UT5A 4LF6B 3QO5A 5B66Z 4BIZA 3C90A 3I5DA 4PA7A 4OX9O 1SQVH 3ZRWA 5E79Z 4X65B 2G38A 4DV6O 2IJJA 1GH6A 3HR0A 5FPRA 2AHZA 4NXMB 2ZXWB 4KFMA 1OCCB 4FM2A 4FLVA 3H1HH 3QTCA 3T1CA 2ADPA 5FNVB 4X9QA 2JGDB 2QR4A 4O4JA 3ZCCA 5IJ0A 3AEIA 3K5LA 5LMNB 4JZ2A 4JI2O 1QLEC 4H37A 1KKDA 2RNBA 1Y4MA 2W6IG 4LF4B 1G8MA 3GVMA 5BR8O 2Q7EA 2P6JA 3CD6V 1IXBA 3JYCA 4LH7A 2H3OA 3SJCC 1ZUQA 3W7UA 3LSUA 1SC5B 4MW3A 5B1BB 1FS0G 5K1XA 3OMNB 1JJ2U 2UUCB 1R6TA 3FAVB 2ZIOA 2E5LB 3A2FA 4XDKA 2F4VO 4CH5A 1R3IC 5HFLA 4BIUA 2E76B 4EB6B 2WLIB 2N04A 1N32O 3ABUA 4DV5O 4DUZB 5CA3A 1GN6A 3ASNB 2FYUH 1YVWA 3SYPA 5LBQA 4I5SA 4H44B 2FKXA 1NR7A 4JTAB 2Y48A 4X20B 4DR7O 3CC4V 2HR3A 2ZQMA 2KQXA 1NR1A 1B06A 2YEVA 2YS8A 2O57A 4DO2A 2EILC 3AG1B 4TT3G 1VF5B 4YIPA 1GMGA 1JMKC 1CPYA 3CE2A 3LNNA 2LGQA 4J11A 1HNXO 3TK1A 2QJ1A 3LNMB 1KB9F 4LWSA 1P7BA 2VWKA 2YI9A 1Z2GA 2C2AA 4UUJC 4K8ZA 1DTOA 3ABMB 3AG3C 2D3OW 2Q68A 1FXKC 1I94O 4JZGA 1WA8A 3ZMZA 3K58A 2EIKB 1Q86W 2ETNA 3OE7G 4WFEA 2GUZA 4WFHA 3L74H 1WP7A 4LF5B 4R50A 2WLKA 5FNVA 1AR1B 3G6EV 3CMAV 1HNWO 2Y69B 3JALB 3OM3B 5IJ9B 5BXZA 3HKEB 1MG1A 4J7ZA 2UUAO 2LGWA 3E89A 1NQTA 1W2BU 2E75B 5EBMC 2OIGA 2RN9A 1K4DC 1N34O 4HNAB 1HNZB 2P22C 3ICXA 3RYFB 1HR0B 4Z1MG 3CXCU 2Z0AA 1N4CA 1W0KG 2EIJC 2OT5A 3K3WA 1MSDA 2OCHA 2ZD9A 3AG7A 2B1IA 1G1XB 1GM9A 4JI0B 2DQ3A 4FK5C 1JCHA 2FTKA 1N36O 1YZBA 2V1DA 3FAVA 3MHHC 3H01A 2JS3A 4X64B 3JATA 1O9GA 1AI5A 1QLEB 1FPOA 1SZTA 1YEWA 1EZVH 2Q5ZA 1BT8A 1Z5WA 1AVMA 3UO2A 1RPRA 3D36C 1E79G 1UJWB 3CRCA 3ZS8C 1OCRC 3OD4A 2AW9A 4JASA 4X20A 3RT3C 4I9WA 4NTWA 4LF7O 3CMEV 4DV1O 3G6BA 3OMAB 3ZMUA 4GX0A 5JQGB 5BY1A 3K5NA 2RDCA 3JASB 5D5PA 1NU1H 1K8AW 3E83A 4TSFG 1QCEA 2VS0A 1Q8IA 1OZ0A 2YUAA 3T1HB 4U3JA 2IW5A 5K1PA 2GBOA 3L73H 4MTOA 3LDDA 4LC1A 1DF5A 3BABA 3FYIB 1KU9A 1BHAA 4JPRA 1VP7A 2JDIG 2WLHA 4GKJO 4UCTA 2R9IA 4R6ZA 4PI2A 3STZC 3QO8A 2Y4UA 4U7NA 1ORQC 2Q0OC 2ZR3A 2EILB 3NXSA 2VQFB 3ETGA 1SESA 2GSMB 2ZKOA 3THOA 2QWRB 3STLC 1K73W 4MVQA 4DUYO 3JCZA 4DR1O 3FB5C 1WJZA 1R3JC 1COWG 1WP8A 2KG7B 3CHXA 1JOYA 1Y74A 3ZX6A 1QQCA 1TUBB 3G71V 1XREA 4GX1A 4IGGA 2WLLA 5LMUO 4FLTA 3AG3B 1XI1A 3K9SA 2HG5C 1NTKH 3B09A 5LXTB 5EYPB 3UCSC 5ITZB 5KUKA 1B6QA 1ZX3A 1FXKB 3CCSV 2XOKG 4B7KA 5LHGA 1L1FA 3RYFA 1YIJV 4CS2A 2PI4A 3BA9A 3JAWA 1OCOC 2EJRA 2AXTZ 2F66C 2QKAA 1AI6A 3BEHA 4W4LA 1AJQA 3IJ4A 3HPLC 4OPAA 4JAAA 3QF7A 4JTDB 4WFFA 1SERA 4UVCA 4K0KB 4I55B 3TXSA 4JV5B 4RWUA 5BMVA 4TOIA 3HKDA 1TVKA 3JARA 2ZINA 4MVUA 1MOFA 4QIWF 4LF6O 2QTOA 2ODMA 4JYAO 2KSDA 4LFAB 1K97A 1VEWA 3P3PA 1RP3B 2CH7A 4DR3B 3APOA 3OTFA 3MD0A 3CCEV 5CB4A 1MSWD 1BSMA 1ZTEA 2EIJB 4NXMO 1ZAUA 2HVKC 4EEQA 1V55C 4FM1A 1S5LZ 1QVFU 1Y6XA 5JQGA 3VQVA 4GX2A 1VARA 3M99B 4AQYB 1PD3A 4CBCA 2B5UA 3MDSA 4GT1A 3ML0A 1GRJA 5JVDA 1VQOV 5IY5C 4F6RA 5C8YB 3ZMTA 4IIJA 4J42A 1A32A 1FJGO 4LF4O 4TV9A 4BW5A 4GLXA 4B3SB 3PN1A 4MTFA 1M56C 1OCRB 1GO3F 4TWKA 2UUBB 4I4TA 5A9GA 4X89A 1IDSA 4MT8A 2XTAA 3UT5B 2WSSG 4MW8A 2E5LO 1F7YA 3ZRWB 4ZI7A 1FFXA 4LFCB 1KUQA 4PJ0Z 2BSKB 1NT2B 4DUZO 2QA4V 1K92A 4Z2WA 4BWAA 3B4SA 3W7SA 4ZKIA 4YJ2A 2AGAA 2KB1A 2B1GA 3C3SA 4MVOA 1L8DA 5KUMA 3SYOA 4CH3A 2EZOA 4O4JB 5IJ0B 4DR6B 3ABLC 5LXTA 1SQXH 1WB7A 1FXKA 5CA0A 1R1BA 3K04A 2HJDA 2PF4E 4TQFA 1N0JA 2X7RB 1ZL8A 2AZ0A 1H8EG 3AK1A 3FB7C 1H2KA 3QNEA 4JI7B 4B3TB 2DYRC 3UKMA 1DF4A 1AR5A 1JVMA 3RYCA 2Y0IA 3B77A 4O2BA 2VQEO 1M90W 2Q7HA 2YXLA 1UFIA 1BHBA 2A9HA 1Q7YW 1NVPD 4CC6A 2ITCC 2XNDG 4C7UA 3ZRXA 4TV8A 2LJ2A 4DV0B 1OCOB 4K35A 3IC9A 1QLNA 4J41A 3AG4C 5GW7A 4I9QA 4LF5O 3G80A 1XNQO 2CDYA 3CCLV 2IU0A 3JAKA 2YEVB 3I55V 3CCQV 5IYCO 4JI3B 4HAMA 4UCSA 4MVRA 3OTOO 4YHHO 5C8YA 1XL6A 4KP4A 2AZ2A 1BE3H 1MZEA 4X66B 1N8RW 3P32A 1PKXA 3E2EA 1JR9A 1QBZA 2IJIA 4E4EA 1V55B 2KKWA 5IYZB 1RPOA 2OIEA 2H94A 1GTOA 2B9ZA 4RO2A 2QM8A 4FMTA 1WA8B 5IY5B 1Q81W 2YC0A 5LHHA 3SR2C 4AHCA 2BSKA 2GUZB 4ZHQB 4LF8O 1R3KC 4JAUA 5B1AC 3ZRSA 1M56B 4I7ZB 1IXMA 3LSSA 4DRXA 1GK9A 1S5HC 3ETQA 2CE4A 1K34A 1RFYA 3KZIZ 4RUEA 1L0LH 4MVSA 1H38A 5KHHA 3B40A 3DGEA 4FVMA 2X6CA 1K4CC 4YJ3B 1SKVA 2GHYA 3SDLA 2RMKB 1BL8A 5B1NA 2PY5A 2GDSA 1XMQB 4DR4B 5GONA 1LR1A 2WWWA 2MW2B 3SGIA 1NVPB 4X1KB 2HKOA 4JYBA 4LFBB 4JI5O 2JS5A 2RCVA 1IX9A 1ENVA 3ABLB 3JATB 4ICGA 4KXRA 3ZJZA 2HHHB 4J80A 3G4SV 5CA1A 2Q8VA 2VQFO 3EVKA 2ITDC 3FKSG 3RVYA 2WPDG 3K9AA 1XOUA 3SPIA 3ZIAG 3ZHVA 4O2AA 3DTUB 1I7FA 4R7CA 2JIZG 2DYRB 3E22A 2YI8A 3CJHA 1XILA 4DV4O 4O4HA 2CGOA 4NTXA 2PTMA 4IL6Z 4B3RB 2JK5C 2QKSA 4FM0A 2P7TC 5IWAO 1KP3A 1WPXA 1THZA 4MVZA 4PA9A 3H1JH 5JJEB 2W0XA 2DYSC 4JF3A 2YIBA 4U3JB 3A0RA 4RQFA 4FLZA 4FLXA 1Q6UA 1NS1A 2ZE5A 1US6A 4Q20A 2Q73A 4TUYA 5LP6C 1NKDA 3AG4B 2JGUA 4FPPA 5IYZA 5EIBC 1HP8A 2IJKA 5DEDA 1PNMA 2M7WA 1Q90D 3HKCA 1AP5A 4JV5O 4X62B 1ZSPA 4MVMA 3R66A 4LF9O 1I5YA 1YSCA 4RAIA 2LQTA 4B3MB 2DN9A 4ZHQA 3LDEA 4IYIA 1JQ0A 4DR3O 2Q67A 1Y74B 3CX5F 1GM8A 4DXWA 3OEHG 4YY3O 5LGUA 2PUSA 5LGNA 3S3XA 2QM7A 3OEEG 4U3FH 2WLLB 4I0XA 3P3NA 1XHZA 4B7EA 1YITV 3NR7A 5L3FA 4GCZA 3D3QA 3RYIA 1VIBA 3H1LH 4AQYO 1DGSA 4YJ3A 4DW1A 2FB5A 4O4LB 5JWPA 2PI5A 4G27B 2NLJC 3CEIA 1K5SA 5EIBD 3BAAA 1EBOA 5H6RA 1H2SB 1XNRB 3JAWB 2XASA 5B1AB 3CCRV 1Y66A 4B3SO 2V7QG 4X1KA 1IBMB 1LNQA 2YXHA 1I08A 1VMGA 4P30A 3T1YB 3JD4A 1YJNV 5BMVB 3E8FA 3JCUZ 3HKDB 1TVKB 3JARB 2ZM6O 3RYHA 4AILC 4D7SA 4LBEC 4WCEV 1Y76A 3L70H 4CH4A 4FLYA 4EKWA 5EZYB 3KG2A 2CH7B 2H8PC 4LFCO 4JTCB 4QGPA 5CB4B 3OGCC 1G6UA 2A79B 4PDRA 1YTFD 2QGNA 4J9ZB 2DWDC 3K03A 4OX9B 3N2KA 1H2GA 1PP9H 4NKGB 2PGGA 1AJPA 2Y0PA 3U10A 1QNMA 2BTQB 2YICA 2WAMA 2K9PA 2HFEC 2E3CA 5L3CA 3ZHQA 3BCCH 3N2GB 4DR6O 4X1YB 3QG5A 1NH2D 2HEPA 5JVDB 4F6RB 3S3WA 1BZKA 4IIJB 1NZ6A 1KECA 1ZLZA 4TV9B 1GKFA 1H2NA 2F95B 2HJFC 4B3TO 3OR7C 1KP2A 2F1MA 4CH6A 4I4TB 1TAEA 4N23A 3M7MX 1GN4A 1D5AA 1XHXA 1P4RA 4NB5A 4WFBV 1NJIW 2QE7G 2OTLV 1J5EB 1DLBA 4ASUG 1IBLB 3F5WC 4ZI7B 1FFXB 2IM9A 3WG7C 4NXNB 2P4KA 1VQ4V 2XAFA 2DYSB 1F4NA 3J80N 3CYOA 1WPBA 3JD1A 1CP9A 4FLWA 1AP6A 2HLDG 4DV0O 1FD9A 3F7YC 1HWYA 5LP6B 1P7GA 2FMLA 1K5QA 4YJ2B 4ABMA 1B3QA 3WB2A 5A2QN 2OYQA 4FFBA 1YCIA 4QNHB 1AR4A 1DK1A 2P67A 5CA0B 4O4LA 2UU9B 2WLNA 3RFRA 3WB0A 1S76D 1ZL8B 5KX5A 2JVDA 2N74A 4BIOA 1XEQA 2N05A 4IHJB 1HDJA 1PV0A 3W7XA 1T5EA 1EN5A 4MS2A 4EFEA 1EFRG 1IBKO 3CRRA 3RYCB 3BVOA 4O2BB 5L3GA 3GWKC 2UXXA 4J9YB 5HFMA 5J9PC 3F5TA 3IFXA 1CEZA 2Q4PA 1YTFB 2W0FC 1KBHA 2QWOB 1Y67A 3ZHUA 4NYKA 4UFZA 3N27A 5EZYA 3ETEA 5JH7A 1SQGA 3CCVV 2UXBB 4TV8B 4X65O 3FX7A 3SPHA 2ADQB 1VQKV 3BY6A 1I94B 2YDEA 3SPGA 3ABKC 1NH2B 3O65A 4JI4B 3H1KH 5KHIA 1Q6HA 3ZMVA 4J10A 1IVSA 3VQYA 4L87A 3JAKB 5KLVH 2BTQA 2QWPB 1R73A 1M93A 3U11A 2CAZC 1MNGA 1SQBH 3N2GA 4X1YA 4UVAA 2GV9A 4W4KA 5LMNO 3E8BA 2R9AA 3AK2A 1HNWB 2A0LA 3OUSA 4PI0A 3B2EE 1N33B 4DV2B 4GUNA 2XAGA 1BMFG 3VBBA 3K79A 1KKCA 4RUFA 1AI4A 3DXRA 3FD9A 1YHQV 2EULA 3WB1A 4YIOA 3OW2U 2UUCO 2YIBD 3T4DA 5FLXN 3SJAC 1PM9A 3EHBB 3K0GA 1WN7A 5CN0A 2HHHO 2QSAA 4PA3A 2F23A 5FL7G 5LYJA 1K33A 4NVPA 5LP6A 2X6AA 4DRXB 3K5OA 2VWJA 2E74B 4QE9A 4X88A 3JD0A 3QVNA 4ZIBA 3CXHF 1JPXA 2BOCC 2W6JG 4B3RO 1W59A 2Q0AA 1KYOF 1M9NA 4QE7A 4DV1B 4QPJA 3B8MA 3WG7B 2R70A 3ZHRA 2LFRA 3CPWU 2UXDB 2EX3A 4DV7B 4BR6A 3Q4HA 4OPHA 2DW4A 4IHJA 5GONB 1JFFA 1KC8W 3AG2C 3SYCA 2Z5UA 2QTSA 3K59A 1BQZA 4UV8A 1AILA 1GN2A 4BW9A 1B04A 4DR2B 2GTSA 4NR1A 1PL0A 2ZDIA 4HBNA 3ZHTA 3IGAC 5CA1B 4JI1B 2ZNIA 4LCUC 2F43G 4B3MO 2X6BA 4GKJB 3EFFK 1SF9A 4O2AB 2M6YA 5KHGA 5IYDO 1S0VA 3L71H 1SZXA 1L0NH 3RW0A 3CCMV 2K1EA 1H8HG 3E22B 3DC5A 1YDXA 3CJHB 2CTRA 2JEXA 4O4HB 1U96A 4ZOLA 4UB6Z 4DR1B 4KHPB 3M8AA 1TA8A 4AI8A 2ARHA 4TQDA 3K5MA 5H2FZ 3BA8A 1FXHA 2ZCEA 3ZRVA 1U97A 1H2LA 1I5XA 5LA6A 1XMOB 1BS3A 1QVGU 4WFAV 5LMUB 1GN3A 4J7KA 1Q5OA 4PD4F 1HNZO 1IZ3A 1HR0O 3SJBC 1H2MA 2DMXA 1XNRO 1R6NA 2JJ2G 3C3TA 4TUYB 3ABKB 4UB8Z 1NTZH 4PV1B 4JI0O 1IBMO 4Z1VA 3RBZA 3SPJA 5EC2C 2L6LA 5J2TB 5CBHA 3HKCB 4X64O 1MMMA 5KA6A 4X1IA 2OTJV 4UCOA 3HB3B 4DK1A 2YSUB 1M57C 3EXAA 3A8TA 4XDLA 2A7WA 2YXYA 3E86A 4UCUA 1BQ0A 4XDJA 4FLUA 3E8HA 1GM7A 1QU7A 3I56V 4IYHA 1SRYA 2XUMA 4WFGA 3TETA 2EINC 4JYAB 4FZ0A 4I0XB 2P06A 4O4IA 2HP8A 3VQXA 3RYIB 2PYLA 1M5IA 1FFTB 2R9RB 4KL1A 3X2QC 1K9MW 3OAAG 2CTWA 5TISZ 4IT5A 3R65A 1VQ9V 1SQQH 2XAHA 4FFKA 2EJ7A 3K0DA 2QDOA 4DV3B 3T1HO 1RSOB 1JJOA 5KMGB 1X4TA 4PDLA 3K08A 1FJGB 1Z5VA 4H13B 4UXNA 4DR5B 3CS5A 2PYJA 2IH1C 4QJFB 3RYHB 1J5EO 1Y76B 1IBLO 4K3AA 2LW1A 1AJNA 1LUWA 2OWOA 4XBFA 4CS3A 4NXNO 2ATKC 4FZ1A 3D3IA 1OHHG 3N2KB 5LOVA 3AG2B 5CBGA 3FB8C 5B3SC 5L3BA 1VQNV 1EZJA 1Q6IA 1ZWIC 4P2ZA 1K3EA 2LP7A 5L3EA 4JYCA 1MZFA 3DC6A 5KAIZ 1RM1C 3KCYA 2UU9O 3CRQA 4F4LA 2WA3A 2CK3G 5DM6V 1FYJA 3E35A 4LNUA 3BFRA 1PL4A 5J2UA 2HVJC 4RQEA 3ZN1A 1PPJH 4GYCB 1LUVA 3WFVA 5JJNB 1XQ8A 2XHBA 2D2CB 2DJVA 3TCUA 5J2TA 5JJJB 3A0HZ 3ASOC 2CTQA 4K0KO 4PA6A 3CSXA 4JI6B 3GWOA 2F93B 5H5NA 1BGYH 2DOSA 5E1AC 2L35A 5D5QA
chains in the Genus database with same CATH topology
5KAFZ 4IL6Z 5H2FZ 3JCUZ 5GTIZ 5B66Z 5B5EZ 1S5LZ 3A0HZ 5E79Z 4PJ0Z 3KZIZ 5KAIZ 2AXTZ 4UB6Z 5GTHZ 3A0BZ 5TISZ 4UB8Z 3WU2Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAF Z;  4IL6 Z;  5H2F Z;  3JCU Z;  5GTI Z;  5B66 Z;  5B5E Z;  1S5L Z;  3A0H Z;  5E79 Z;  4PJ0 Z;  3KZI Z;  5KAI Z;  2AXT Z;  4UB6 Z;  5GTH Z;  3A0B Z;  5TIS Z;  4UB8 Z;  3WU2 Z; 
#chains in the Genus database with same CATH topology
 4LFA O;  3W7W A;  2VQE B;  4HZ3 A;  1F4M A;  2UXB O;  1VF7 A;  1QR8 A;  1VQ6 V;  4GKK B;  1EM1 A;  3FFQ A;  3OGI B;  5IDJ A;  1SQP H;  5JCO C;  4JI4 O;  4YXW G;  3DSQ A;  3A0B Z;  2CTP A;  2ZDI C;  3JSL A;  4FFB B;  5AG2 A;  1IUR A;  1P84 F;  5H9C A;  2UXC B;  1XNQ B;  3L72 H;  2V4D A;  5KHJ A;  1M57 B;  4CZZ A;  1V9P A;  2JGD A;  5KX5 B;  2Q69 A;  5B1O A;  1N33 O;  5IYB O;  4DV2 O;  4H0L B;  3OTO B;  2EIN B;  3JD2 A;  1RSO A;  4GZR B;  4YHH B;  1XL4 A;  5KMG A;  5EK0 A;  4R8C A;  3L9D A;  2UUB O;  1E1R G;  4HYO A;  2ZNJ A;  3CRA A;  3F7V C;  2XT9 A;  5GTI Z;  1O9H A;  2WLJ A;  4PA4 A;  3X2Q B;  1ROP A;  1UPG A;  1HW7 A;  3FYE B;  3SYQ A;  1I0H A;  1NBM G;  4JI8 B;  2EBO A;  2NNU A;  1KQS U;  5JH7 B;  1YI2 V;  1TGO A;  3ETD A;  3ABT A;  1S3J A;  2CUG A;  4X8A A;  5L3D A;  1OCZ C;  2LFS A;  1VQ7 V;  2RQ6 A;  5DEC A;  1ARO P;  4DV6 B;  4EB6 A;  1BCC H;  2WLI A;  2ZE7 A;  3GB7 C;  1TUE B;  3J7A U;  1PNL A;  1W0J G;  4LF8 B;  3TJT A;  4PDV A;  4DW0 A;  2FL4 A;  2JRI A;  3D8C A;  3MHS C;  3BRC A;  4K8X A;  5IT9 N;  2P4V A;  4DK0 A;  4PHZ A;  2YIA A;  1SET A;  1WNS A;  3OFN G;  4JI2 B;  4P9O A;  2XAJ A;  3TGU H;  2UXD O;  4JI7 O;  2WA4 A;  4DV7 O;  2EIM C;  3DXR B;  1S77 D;  1S5J A;  2WLM A;  1GAX A;  4QPK A;  2UXN A;  5BR8 B;  5B3S B;  5DN6 G;  1E1Q G;  2BTO A;  3KKY A;  3T2M A;  1PNK A;  3SPC A;  3VOU A;  4DR2 O;  1Q3E A;  1R3L C;  1AB3 A;  3H9V A;  4JI5 B;  4D6T H;  3P30 A;  5EBL C;  4JI1 O;  1RM1 B;  2DE0 X;  4KUM A;  3OT7 A;  5LYJ B;  1VQM V;  4NTY A;  2IJH A;  5KHK A;  1V54 C;  4F6E A;  1EN4 A;  2CGN A;  3JAM N;  2F4V B;  3T4Z A;  4OGQ B;  2JEU A;  1QHT A;  1CXZ B;  2ZIM A;  4MSW C;  1N32 B;  4DV5 B;  3RGB A;  2NR5 A;  2X0L A;  3ASO B;  4KHP O;  1FXV A;  2AHY A;  3ZED A;  5B5E Z;  1FAF A;  3TXQ A;  3BHP A;  1VF6 A;  3ZN0 A;  5CMU A;  1J95 A;  1XDC A;  2ZT9 B;  4JI3 O;  2Q9L A;  5CBF A;  4LP8 A;  3KCX A;  4DV4 B;  1FKA O;  4DR7 B;  1MA1 A;  3JAL A;  2Q6A A;  5IJ9 A;  3LDC A;  3HKE A;  3CCU V;  1K7D A;  1XMO O;  4J7J A;  3Q4H B;  1XUQ A;  2RJZ A;  5IWA B;  4X66 O;  1JFF B;  4Q6G A;  3ZBH A;  1S72 V;  4FIP C;  3RVZ A;  3QO7 A;  4LH6 A;  4HNA A;  5FPO A;  1HNX B;  3UM7 A;  3AK3 A;  1KD1 W;  1JX9 A;  3LSQ A;  1R6K A;  2ZE8 A;  4UCR A;  1YJW V;  1Q82 W;  4FJC C;  1JA8 A;  4MTX A;  3O9O A;  1YJ9 V;  2ILM A;  2DWE C;  5F2V O;  5LL6 Y;  4LF9 B;  2QKC A;  2PZS A;  2LO1 A;  4GX5 A;  2QEX V;  1G4Y B;  2BE3 A;  4P9P A;  4ZOL B;  4JAV A;  5C93 A;  4G2K A;  3B8N A;  3K06 A;  2OCC C;  1SA0 B;  2QWQ B;  3HKB B;  4YY3 B;  4JYY A;  2QWN B;  4BAY A;  2IH3 C;  5LA6 B;  2A3Q A;  1VQ8 V;  5EC1 C;  5KA5 A;  2UUA B;  1YF2 A;  4I50 B;  1EN6 A;  1M4U A;  1NTM H;  2P90 A;  3BPZ A;  3JAS A;  4DV3 O;  3APQ A;  1XMQ O;  1N34 B;  4DR4 O;  1OCZ B;  1WAZ A;  5GTH Z;  4CC5 A;  1Q43 A;  3CRM A;  4LFB O;  1WB8 A;  4B08 A;  5BZB A;  2ZXW C;  4X1I B;  1OCC C;  2JJ1 G;  4DR5 O;  3CC7 V;  4PDM A;  1N36 B;  1F51 A;  4WBN B;  4JGS A;  5IE9 A;  5LGT A;  3VQW A;  3H1I H;  1YXB A;  3JD3 A;  3JSN A;  2ZM6 B;  1VQL V;  3SJQ C;  2EIM B;  5LHI A;  3W7T A;  1URF A;  1QR9 A;  3CC2 V;  3RN4 A;  3L75 H;  2R72 A;  3ZMS A;  4O4I B;  4EFB A;  4U7O A;  1F23 A;  1AI7 A;  2KG7 A;  1TUB A;  5B1B C;  4LF7 B;  3FB6 C;  1KMI Z;  2BOB C;  1D5N A;  4N21 A;  4MTG A;  3OMI B;  2GTA A;  3CP1 A;  2ZR2 A;  2YID A;  1MAB G;  5EYP A;  1V54 B;  5ITZ A;  3CB2 A;  3E8G A;  4D7T A;  3LUT B;  5JCO A;  3ASN C;  4LR3 A;  3MAQ A;  3U0Z A;  2LW7 A;  3PJS K;  4UV9 A;  3IC7 A;  4JI6 O;  4X62 O;  4G28 B;  4DYL A;  2P5O A;  4PEL A;  4UCV A;  4I55 A;  3IAY A;  2XAQ A;  1P49 A;  4L8J A;  4ZBM A;  4WF9 V;  3AG1 C;  2VRZ A;  5LOV B;  4GKK O;  3OR6 C;  1D2D A;  3SYA A;  3CCJ V;  4DUY B;  3K57 A;  4H33 A;  5EBW C;  2BCC H;  3UO3 A;  1SA0 A;  2MK3 A;  1WLE A;  2ZE6 A;  5KAF Z;  3HKB A;  1SS3 A;  3ZHS A;  1OV9 A;  1N0N A;  1NI8 A;  2NN4 A;  2QM4 A;  2UXC O;  4CS4 A;  5H6Q A;  2A06 H;  4A5U B;  3ABM C;  1XBL A;  4I50 A;  2EZP A;  2Z3Y A;  1VQP V;  3OUF A;  4LNU B;  5J2U B;  2IU3 A;  4UVB A;  1SQF A;  3UQ8 A;  2Y4T A;  3RWR D;  1OJH A;  3G67 A;  2EIK C;  2IBZ H;  3J81 N;  3CWB H;  4OXS A;  2OCC B;  3T1Y O;  3D36 A;  1VF6 C;  1IBK B;  4LWS B;  1X59 A;  2Y69 C;  4WBN A;  1M1K W;  4JI8 O;  2Q7G A;  4E2L A;  3WU2 Z;  2DQ0 A;  1VQ5 V;  3UT5 A;  4LF6 B;  3QO5 A;  5B66 Z;  4BIZ A;  3C90 A;  3I5D A;  4PA7 A;  4OX9 O;  1SQV H;  3ZRW A;  5E79 Z;  4X65 B;  2G38 A;  4DV6 O;  2IJJ A;  1GH6 A;  3HR0 A;  5FPR A;  2AHZ A;  4NXM B;  2ZXW B;  4KFM A;  1OCC B;  4FM2 A;  4FLV A;  3H1H H;  3QTC A;  3T1C A;  2ADP A;  5FNV B;  4X9Q A;  2JGD B;  2QR4 A;  4O4J A;  3ZCC A;  5IJ0 A;  3AEI A;  3K5L A;  5LMN B;  4JZ2 A;  4JI2 O;  1QLE C;  4H37 A;  1KKD A;  2RNB A;  1Y4M A;  2W6I G;  4LF4 B;  1G8M A;  3GVM A;  5BR8 O;  2Q7E A;  2P6J A;  3CD6 V;  1IXB A;  3JYC A;  4LH7 A;  2H3O A;  3SJC C;  1ZUQ A;  3W7U A;  3LSU A;  1SC5 B;  4MW3 A;  5B1B B;  1FS0 G;  5K1X A;  3OMN B;  1JJ2 U;  2UUC B;  1R6T A;  3FAV B;  2ZIO A;  2E5L B;  3A2F A;  4XDK A;  2F4V O;  4CH5 A;  1R3I C;  5HFL A;  4BIU A;  2E76 B;  4EB6 B;  2WLI B;  2N04 A;  1N32 O;  3ABU A;  4DV5 O;  4DUZ B;  5CA3 A;  1GN6 A;  3ASN B;  2FYU H;  1YVW A;  3SYP A;  5LBQ A;  4I5S A;  4H44 B;  2FKX A;  1NR7 A;  4JTA B;  2Y48 A;  4X20 B;  4DR7 O;  3CC4 V;  2HR3 A;  2ZQM A;  2KQX A;  1NR1 A;  1B06 A;  2YEV A;  2YS8 A;  2O57 A;  4DO2 A;  2EIL C;  3AG1 B;  4TT3 G;  1VF5 B;  4YIP A;  1GMG A;  1JMK C;  1CPY A;  3CE2 A;  3LNN A;  2LGQ A;  4J11 A;  1HNX O;  3TK1 A;  2QJ1 A;  3LNM B;  1KB9 F;  4LWS A;  1P7B A;  2VWK A;  2YI9 A;  1Z2G A;  2C2A A;  4UUJ C;  4K8Z A;  1DTO A;  3ABM B;  3AG3 C;  2D3O W;  2Q68 A;  1FXK C;  1I94 O;  4JZG A;  1WA8 A;  3ZMZ A;  3K58 A;  2EIK B;  1Q86 W;  2ETN A;  3OE7 G;  4WFE A;  2GUZ A;  4WFH A;  3L74 H;  1WP7 A;  4LF5 B;  4R50 A;  2WLK A;  5FNV A;  1AR1 B;  3G6E V;  3CMA V;  1HNW O;  2Y69 B;  3JAL B;  3OM3 B;  5IJ9 B;  5BXZ A;  3HKE B;  1MG1 A;  4J7Z A;  2UUA O;  2LGW A;  3E89 A;  1NQT A;  1W2B U;  2E75 B;  5EBM C;  2OIG A;  2RN9 A;  1K4D C;  1N34 O;  4HNA B;  1HNZ B;  2P22 C;  3ICX A;  3RYF B;  1HR0 B;  4Z1M G;  3CXC U;  2Z0A A;  1N4C A;  1W0K G;  2EIJ C;  2OT5 A;  3K3W A;  1MSD A;  2OCH A;  2ZD9 A;  3AG7 A;  2B1I A;  1G1X B;  1GM9 A;  4JI0 B;  2DQ3 A;  4FK5 C;  1JCH A;  2FTK A;  1N36 O;  1YZB A;  2V1D A;  3FAV A;  3MHH C;  3H01 A;  2JS3 A;  4X64 B;  3JAT A;  1O9G A;  1AI5 A;  1QLE B;  1FPO A;  1SZT A;  1YEW A;  1EZV H;  2Q5Z A;  1BT8 A;  1Z5W A;  1AVM A;  3UO2 A;  1RPR A;  3D36 C;  1E79 G;  1UJW B;  3CRC A;  3ZS8 C;  1OCR C;  3OD4 A;  2AW9 A;  4JAS A;  4X20 A;  3RT3 C;  4I9W A;  4NTW A;  4LF7 O;  3CME V;  4DV1 O;  3G6B A;  3OMA B;  3ZMU A;  4GX0 A;  5JQG B;  5BY1 A;  3K5N A;  2RDC A;  3JAS B;  5D5P A;  1NU1 H;  1K8A W;  3E83 A;  4TSF G;  1QCE A;  2VS0 A;  1Q8I A;  1OZ0 A;  2YUA A;  3T1H B;  4U3J A;  2IW5 A;  5K1P A;  2GBO A;  3L73 H;  4MTO A;  3LDD A;  4LC1 A;  1DF5 A;  3BAB A;  3FYI B;  1KU9 A;  1BHA A;  4JPR A;  1VP7 A;  2JDI G;  2WLH A;  4GKJ O;  4UCT A;  2R9I A;  4R6Z A;  4PI2 A;  3STZ C;  3QO8 A;  2Y4U A;  4U7N A;  1ORQ C;  2Q0O C;  2ZR3 A;  2EIL B;  3NXS A;  2VQF B;  3ETG A;  1SES A;  2GSM B;  2ZKO A;  3THO A;  2QWR B;  3STL C;  1K73 W;  4MVQ A;  4DUY O;  3JCZ A;  4DR1 O;  3FB5 C;  1WJZ A;  1R3J C;  1COW G;  1WP8 A;  2KG7 B;  3CHX A;  1JOY A;  1Y74 A;  3ZX6 A;  1QQC A;  1TUB B;  3G71 V;  1XRE A;  4GX1 A;  4IGG A;  2WLL A;  5LMU O;  4FLT A;  3AG3 B;  1XI1 A;  3K9S A;  2HG5 C;  1NTK H;  3B09 A;  5LXT B;  5EYP B;  3UCS C;  5ITZ B;  5KUK A;  1B6Q A;  1ZX3 A;  1FXK B;  3CCS V;  2XOK G;  4B7K A;  5LHG A;  1L1F A;  3RYF A;  1YIJ V;  4CS2 A;  2PI4 A;  3BA9 A;  3JAW A;  1OCO C;  2EJR A;  2AXT Z;  2F66 C;  2QKA A;  1AI6 A;  3BEH A;  4W4L A;  1AJQ A;  3IJ4 A;  3HPL C;  4OPA A;  4JAA A;  3QF7 A;  4JTD B;  4WFF A;  1SER A;  4UVC A;  4K0K B;  4I55 B;  3TXS A;  4JV5 B;  4RWU A;  5BMV A;  4TOI A;  3HKD A;  1TVK A;  3JAR A;  2ZIN A;  4MVU A;  1MOF A;  4QIW F;  4LF6 O;  2QTO A;  2ODM A;  4JYA O;  2KSD A;  4LFA B;  1K97 A;  1VEW A;  3P3P A;  1RP3 B;  2CH7 A;  4DR3 B;  3APO A;  3OTF A;  3MD0 A;  3CCE V;  5CB4 A;  1MSW D;  1BSM A;  1ZTE A;  2EIJ B;  4NXM O;  1ZAU A;  2HVK C;  4EEQ A;  1V55 C;  4FM1 A;  1S5L Z;  1QVF U;  1Y6X A;  5JQG A;  3VQV A;  4GX2 A;  1VAR A;  3M99 B;  4AQY B;  1PD3 A;  4CBC A;  2B5U A;  3MDS A;  4GT1 A;  3ML0 A;  1GRJ A;  5JVD A;  1VQO V;  5IY5 C;  4F6R A;  5C8Y B;  3ZMT A;  4IIJ A;  4J42 A;  1A32 A;  1FJG O;  4LF4 O;  4TV9 A;  4BW5 A;  4GLX A;  4B3S B;  3PN1 A;  4MTF A;  1M56 C;  1OCR B;  1GO3 F;  4TWK A;  2UUB B;  4I4T A;  5A9G A;  4X89 A;  1IDS A;  4MT8 A;  2XTA A;  3UT5 B;  2WSS G;  4MW8 A;  2E5L O;  1F7Y A;  3ZRW B;  4ZI7 A;  1FFX A;  4LFC B;  1KUQ A;  4PJ0 Z;  2BSK B;  1NT2 B;  4DUZ O;  2QA4 V;  1K92 A;  4Z2W A;  4BWA A;  3B4S A;  3W7S A;  4ZKI A;  4YJ2 A;  2AGA A;  2KB1 A;  2B1G A;  3C3S A;  4MVO A;  1L8D A;  5KUM A;  3SYO A;  4CH3 A;  2EZO A;  4O4J B;  5IJ0 B;  4DR6 B;  3ABL C;  5LXT A;  1SQX H;  1WB7 A;  1FXK A;  5CA0 A;  1R1B A;  3K04 A;  2HJD A;  2PF4 E;  4TQF A;  1N0J A;  2X7R B;  1ZL8 A;  2AZ0 A;  1H8E G;  3AK1 A;  3FB7 C;  1H2K A;  3QNE A;  4JI7 B;  4B3T B;  2DYR C;  3UKM A;  1DF4 A;  1AR5 A;  1JVM A;  3RYC A;  2Y0I A;  3B77 A;  4O2B A;  2VQE O;  1M90 W;  2Q7H A;  2YXL A;  1UFI A;  1BHB A;  2A9H A;  1Q7Y W;  1NVP D;  4CC6 A;  2ITC C;  2XND G;  4C7U A;  3ZRX A;  4TV8 A;  2LJ2 A;  4DV0 B;  1OCO B;  4K35 A;  3IC9 A;  1QLN A;  4J41 A;  3AG4 C;  5GW7 A;  4I9Q A;  4LF5 O;  3G80 A;  1XNQ O;  2CDY A;  3CCL V;  2IU0 A;  3JAK A;  2YEV B;  3I55 V;  3CCQ V;  5IYC O;  4JI3 B;  4HAM A;  4UCS A;  4MVR A;  3OTO O;  4YHH O;  5C8Y A;  1XL6 A;  4KP4 A;  2AZ2 A;  1BE3 H;  1MZE A;  4X66 B;  1N8R W;  3P32 A;  1PKX A;  3E2E A;  1JR9 A;  1QBZ A;  2IJI A;  4E4E A;  1V55 B;  2KKW A;  5IYZ B;  1RPO A;  2OIE A;  2H94 A;  1GTO A;  2B9Z A;  4RO2 A;  2QM8 A;  4FMT A;  1WA8 B;  5IY5 B;  1Q81 W;  2YC0 A;  5LHH A;  3SR2 C;  4AHC A;  2BSK A;  2GUZ B;  4ZHQ B;  4LF8 O;  1R3K C;  4JAU A;  5B1A C;  3ZRS A;  1M56 B;  4I7Z B;  1IXM A;  3LSS A;  4DRX A;  1GK9 A;  1S5H C;  3ETQ A;  2CE4 A;  1K34 A;  1RFY A;  3KZI Z;  4RUE A;  1L0L H;  4MVS A;  1H38 A;  5KHH A;  3B40 A;  3DGE A;  4FVM A;  2X6C A;  1K4C C;  4YJ3 B;  1SKV A;  2GHY A;  3SDL A;  2RMK B;  1BL8 A;  5B1N A;  2PY5 A;  2GDS A;  1XMQ B;  4DR4 B;  5GON A;  1LR1 A;  2WWW A;  2MW2 B;  3SGI A;  1NVP B;  4X1K B;  2HKO A;  4JYB A;  4LFB B;  4JI5 O;  2JS5 A;  2RCV A;  1IX9 A;  1ENV A;  3ABL B;  3JAT B;  4ICG A;  4KXR A;  3ZJZ A;  2HHH B;  4J80 A;  3G4S V;  5CA1 A;  2Q8V A;  2VQF O;  3EVK A;  2ITD C;  3FKS G;  3RVY A;  2WPD G;  3K9A A;  1XOU A;  3SPI A;  3ZIA G;  3ZHV A;  4O2A A;  3DTU B;  1I7F A;  4R7C A;  2JIZ G;  2DYR B;  3E22 A;  2YI8 A;  3CJH A;  1XIL A;  4DV4 O;  4O4H A;  2CGO A;  4NTX A;  2PTM A;  4IL6 Z;  4B3R B;  2JK5 C;  2QKS A;  4FM0 A;  2P7T C;  5IWA O;  1KP3 A;  1WPX A;  1THZ A;  4MVZ A;  4PA9 A;  3H1J H;  5JJE B;  2W0X A;  2DYS C;  4JF3 A;  2YIB A;  4U3J B;  3A0R A;  4RQF A;  4FLZ A;  4FLX A;  1Q6U A;  1NS1 A;  2ZE5 A;  1US6 A;  4Q20 A;  2Q73 A;  4TUY A;  5LP6 C;  1NKD A;  3AG4 B;  2JGU A;  4FPP A;  5IYZ A;  5EIB C;  1HP8 A;  2IJK A;  5DED A;  1PNM A;  2M7W A;  1Q90 D;  3HKC A;  1AP5 A;  4JV5 O;  4X62 B;  1ZSP A;  4MVM A;  3R66 A;  4LF9 O;  1I5Y A;  1YSC A;  4RAI A;  2LQT A;  4B3M B;  2DN9 A;  4ZHQ A;  3LDE A;  4IYI A;  1JQ0 A;  4DR3 O;  2Q67 A;  1Y74 B;  3CX5 F;  1GM8 A;  4DXW A;  3OEH G;  4YY3 O;  5LGU A;  2PUS A;  5LGN A;  3S3X A;  2QM7 A;  3OEE G;  4U3F H;  2WLL B;  4I0X A;  3P3N A;  1XHZ A;  4B7E A;  1YIT V;  3NR7 A;  5L3F A;  4GCZ A;  3D3Q A;  3RYI A;  1VIB A;  3H1L H;  4AQY O;  1DGS A;  4YJ3 A;  4DW1 A;  2FB5 A;  4O4L B;  5JWP A;  2PI5 A;  4G27 B;  2NLJ C;  3CEI A;  1K5S A;  5EIB D;  3BAA A;  1EBO A;  5H6R A;  1H2S B;  1XNR B;  3JAW B;  2XAS A;  5B1A B;  3CCR V;  1Y66 A;  4B3S O;  2V7Q G;  4X1K A;  1IBM B;  1LNQ A;  2YXH A;  1I08 A;  1VMG A;  4P30 A;  3T1Y B;  3JD4 A;  1YJN V;  5BMV B;  3E8F A;  3JCU Z;  3HKD B;  1TVK B;  3JAR B;  2ZM6 O;  3RYH A;  4AIL C;  4D7S A;  4LBE C;  4WCE V;  1Y76 A;  3L70 H;  4CH4 A;  4FLY A;  4EKW A;  5EZY B;  3KG2 A;  2CH7 B;  2H8P C;  4LFC O;  4JTC B;  4QGP A;  5CB4 B;  3OGC C;  1G6U A;  2A79 B;  4PDR A;  1YTF D;  2QGN A;  4J9Z B;  2DWD C;  3K03 A;  4OX9 B;  3N2K A;  1H2G A;  1PP9 H;  4NKG B;  2PGG A;  1AJP A;  2Y0P A;  3U10 A;  1QNM A;  2BTQ B;  2YIC A;  2WAM A;  2K9P A;  2HFE C;  2E3C A;  5L3C A;  3ZHQ A;  3BCC H;  3N2G B;  4DR6 O;  4X1Y B;  3QG5 A;  1NH2 D;  2HEP A;  5JVD B;  4F6R B;  3S3W A;  1BZK A;  4IIJ B;  1NZ6 A;  1KEC A;  1ZLZ A;  4TV9 B;  1GKF A;  1H2N A;  2F95 B;  2HJF C;  4B3T O;  3OR7 C;  1KP2 A;  2F1M A;  4CH6 A;  4I4T B;  1TAE A;  4N23 A;  3M7M X;  1GN4 A;  1D5A A;  1XHX A;  1P4R A;  4NB5 A;  4WFB V;  1NJI W;  2QE7 G;  2OTL V;  1J5E B;  1DLB A;  4ASU G;  1IBL B;  3F5W C;  4ZI7 B;  1FFX B;  2IM9 A;  3WG7 C;  4NXN B;  2P4K A;  1VQ4 V;  2XAF A;  2DYS B;  1F4N A;  3J80 N;  3CYO A;  1WPB A;  3JD1 A;  1CP9 A;  4FLW A;  1AP6 A;  2HLD G;  4DV0 O;  1FD9 A;  3F7Y C;  1HWY A;  5LP6 B;  1P7G A;  2FML A;  1K5Q A;  4YJ2 B;  4ABM A;  1B3Q A;  3WB2 A;  5A2Q N;  2OYQ A;  4FFB A;  1YCI A;  4QNH B;  1AR4 A;  1DK1 A;  2P67 A;  5CA0 B;  4O4L A;  2UU9 B;  2WLN A;  3RFR A;  3WB0 A;  1S76 D;  1ZL8 B;  5KX5 A;  2JVD A;  2N74 A;  4BIO A;  1XEQ A;  2N05 A;  4IHJ B;  1HDJ A;  1PV0 A;  3W7X A;  1T5E A;  1EN5 A;  4MS2 A;  4EFE A;  1EFR G;  1IBK O;  3CRR A;  3RYC B;  3BVO A;  4O2B B;  5L3G A;  3GWK C;  2UXX A;  4J9Y B;  5HFM A;  5J9P C;  3F5T A;  3IFX A;  1CEZ A;  2Q4P A;  1YTF B;  2W0F C;  1KBH A;  2QWO B;  1Y67 A;  3ZHU A;  4NYK A;  4UFZ A;  3N27 A;  5EZY A;  3ETE A;  5JH7 A;  1SQG A;  3CCV V;  2UXB B;  4TV8 B;  4X65 O;  3FX7 A;  3SPH A;  2ADQ B;  1VQK V;  3BY6 A;  1I94 B;  2YDE A;  3SPG A;  3ABK C;  1NH2 B;  3O65 A;  4JI4 B;  3H1K H;  5KHI A;  1Q6H A;  3ZMV A;  4J10 A;  1IVS A;  3VQY A;  4L87 A;  3JAK B;  5KLV H;  2BTQ A;  2QWP B;  1R73 A;  1M93 A;  3U11 A;  2CAZ C;  1MNG A;  1SQB H;  3N2G A;  4X1Y A;  4UVA A;  2GV9 A;  4W4K A;  5LMN O;  3E8B A;  2R9A A;  3AK2 A;  1HNW B;  2A0L A;  3OUS A;  4PI0 A;  3B2E E;  1N33 B;  4DV2 B;  4GUN A;  2XAG A;  1BMF G;  3VBB A;  3K79 A;  1KKC A;  4RUF A;  1AI4 A;  3DXR A;  3FD9 A;  1YHQ V;  2EUL A;  3WB1 A;  4YIO A;  3OW2 U;  2UUC O;  2YIB D;  3T4D A;  5FLX N;  3SJA C;  1PM9 A;  3EHB B;  3K0G A;  1WN7 A;  5CN0 A;  2HHH O;  2QSA A;  4PA3 A;  2F23 A;  5FL7 G;  5LYJ A;  1K33 A;  4NVP A;  5LP6 A;  2X6A A;  4DRX B;  3K5O A;  2VWJ A;  2E74 B;  4QE9 A;  4X88 A;  3JD0 A;  3QVN A;  4ZIB A;  3CXH F;  1JPX A;  2BOC C;  2W6J G;  4B3R O;  1W59 A;  2Q0A A;  1KYO F;  1M9N A;  4QE7 A;  4DV1 B;  4QPJ A;  3B8M A;  3WG7 B;  2R70 A;  3ZHR A;  2LFR A;  3CPW U;  2UXD B;  2EX3 A;  4DV7 B;  4BR6 A;  3Q4H A;  4OPH A;  2DW4 A;  4IHJ A;  5GON B;  1JFF A;  1KC8 W;  3AG2 C;  3SYC A;  2Z5U A;  2QTS A;  3K59 A;  1BQZ A;  4UV8 A;  1AIL A;  1GN2 A;  4BW9 A;  1B04 A;  4DR2 B;  2GTS A;  4NR1 A;  1PL0 A;  2ZDI A;  4HBN A;  3ZHT A;  3IGA C;  5CA1 B;  4JI1 B;  2ZNI A;  4LCU C;  2F43 G;  4B3M O;  2X6B A;  4GKJ B;  3EFF K;  1SF9 A;  4O2A B;  2M6Y A;  5KHG A;  5IYD O;  1S0V A;  3L71 H;  1SZX A;  1L0N H;  3RW0 A;  3CCM V;  2K1E A;  1H8H G;  3E22 B;  3DC5 A;  1YDX A;  3CJH B;  2CTR A;  2JEX A;  4O4H B;  1U96 A;  4ZOL A;  4UB6 Z;  4DR1 B;  4KHP B;  3M8A A;  1TA8 A;  4AI8 A;  2ARH A;  4TQD A;  3K5M A;  5H2F Z;  3BA8 A;  1FXH A;  2ZCE A;  3ZRV A;  1U97 A;  1H2L A;  1I5X A;  5LA6 A;  1XMO B;  1BS3 A;  1QVG U;  4WFA V;  5LMU B;  1GN3 A;  4J7K A;  1Q5O A;  4PD4 F;  1HNZ O;  1IZ3 A;  1HR0 O;  3SJB C;  1H2M A;  2DMX A;  1XNR O;  1R6N A;  2JJ2 G;  3C3T A;  4TUY B;  3ABK B;  4UB8 Z;  1NTZ H;  4PV1 B;  4JI0 O;  1IBM O;  4Z1V A;  3RBZ A;  3SPJ A;  5EC2 C;  2L6L A;  5J2T B;  5CBH A;  3HKC B;  4X64 O;  1MMM A;  5KA6 A;  4X1I A;  2OTJ V;  4UCO A;  3HB3 B;  4DK1 A;  2YSU B;  1M57 C;  3EXA A;  3A8T A;  4XDL A;  2A7W A;  2YXY A;  3E86 A;  4UCU A;  1BQ0 A;  4XDJ A;  4FLU A;  3E8H A;  1GM7 A;  1QU7 A;  3I56 V;  4IYH A;  1SRY A;  2XUM A;  4WFG A;  3TET A;  2EIN C;  4JYA B;  4FZ0 A;  4I0X B;  2P06 A;  4O4I A;  2HP8 A;  3VQX A;  3RYI B;  2PYL A;  1M5I A;  1FFT B;  2R9R B;  4KL1 A;  3X2Q C;  1K9M W;  3OAA G;  2CTW A;  5TIS Z;  4IT5 A;  3R65 A;  1VQ9 V;  1SQQ H;  2XAH A;  4FFK A;  2EJ7 A;  3K0D A;  2QDO A;  4DV3 B;  3T1H O;  1RSO B;  1JJO A;  5KMG B;  1X4T A;  4PDL A;  3K08 A;  1FJG B;  1Z5V A;  4H13 B;  4UXN A;  4DR5 B;  3CS5 A;  2PYJ A;  2IH1 C;  4QJF B;  3RYH B;  1J5E O;  1Y76 B;  1IBL O;  4K3A A;  2LW1 A;  1AJN A;  1LUW A;  2OWO A;  4XBF A;  4CS3 A;  4NXN O;  2ATK C;  4FZ1 A;  3D3I A;  1OHH G;  3N2K B;  5LOV A;  3AG2 B;  5CBG A;  3FB8 C;  5B3S C;  5L3B A;  1VQN V;  1EZJ A;  1Q6I A;  1ZWI C;  4P2Z A;  1K3E A;  2LP7 A;  5L3E A;  4JYC A;  1MZF A;  3DC6 A;  5KAI Z;  1RM1 C;  3KCY A;  2UU9 O;  3CRQ A;  4F4L A;  2WA3 A;  2CK3 G;  5DM6 V;  1FYJ A;  3E35 A;  4LNU A;  3BFR A;  1PL4 A;  5J2U A;  2HVJ C;  4RQE A;  3ZN1 A;  1PPJ H;  4GYC B;  1LUV A;  3WFV A;  5JJN B;  1XQ8 A;  2XHB A;  2D2C B;  2DJV A;  3TCU A;  5J2T A;  5JJJ B;  3A0H Z;  3ASO C;  2CTQ A;  4K0K O;  4PA6 A;  3CSX A;  4JI6 B;  3GWO A;  2F93 B;  5H5N A;  1BGY H;  2DOS A;  5E1A C;  2L35 A;  5D5Q A; 
#chains in the Genus database with same CATH homology
 5KAF Z;  4IL6 Z;  5H2F Z;  3JCU Z;  5GTI Z;  5B66 Z;  5B5E Z;  1S5L Z;  3A0H Z;  5E79 Z;  4PJ0 Z;  3KZI Z;  5KAI Z;  2AXT Z;  4UB6 Z;  5GTH Z;  3A0B Z;  5TIS Z;  4UB8 Z;  3WU2 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...