5KAIZ

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
b'MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5kaiZ00
5B66Z 5TISZ 4PJ0Z 3A0HZ 4UB6Z 5GTIZ 1S5LZ 4IL6Z 3JCUZ 5KAFZ 3WU2Z 5E79Z 5H2FZ 2AXTZ 5GTHZ 3KZIZ 5B5EZ 4UB8Z 5KAIZ 3A0BZ
chains in the Genus database with same CATH superfamily
3K04A 1HR0O 1BSMA 4X1YB 4UVAA 2GHYA 1U97A 2ZE5A 3OE7G 1XHZA 2A7WA 3ZRXA 3H1LH 4LF7B 4GKJB 3ZHQA 3BCCH 1YDXA 5J9PC 2YSUB 3OM3B 4LR3A 3CXHF 2CTWA 5CA1B 3L74H 2V4DA 4XBFA 1W0KG 4BW5A 4CS2A 3KG2A 4X66O 4GX2A 1CP9A 2E3CA 4MT8A 2IJKA 4PELA 1VQ6V 2W6JG 2QWRB 4GZRB 5LP6C 3OTOO 1YCIA 3D36A 4LFBB 4UCSA 4X65B 3CJHB 1Q3EA 1WA8B 3BRCA 5KMGB 1S0VA 4NXMO 1RP3B 2BCCH 1IX9A 4WF9V 4DV3B 1QLEC 3APQA 1I0HA 2EJRA 3STLC 5L3DA 1AR4A 5CB4A 1SF9A 4AI8A 2A79B 4FLTA 1NR1A 2AHZA 1HNXO 1YJWV 2ZE7A 3APOA 3ZRWA 2UXNA 1NKDA 3RFRA 2R70A 2YI9A 3EFFK 2P67A 2DE0X 4R7CA 4DV5B 2JEXA 3ZX6A 4UCTA 3CCVV 1HW7A 1FYJA 2YC0A 5AG2A 5BXZA 3TETA 3ABLC 3M99B 1B04A 3W7XA 2QA4V 4FFBB 3LSQA 1S5JA 3J81N 1R3IC 3QNEA 1FXHA 4CH5A 3JALB 2ZXWB 2DYRC 1EN6A 2WWWA 4OGQB 2CAZC 3HKCA 2Z0AA 3ZMUA 4PI2A 2Q7HA 3A8TA 3TXQA 4UCUA 3QVNA 3FB8C 2ZR2A 1RM1C 1JVMA 3CHXA 1FFXB 1SS3A 4I7ZB 5CBGA 1T5EA 2EIMB 1S77D 4B7EA 4JI5O 1M4UA 3CMAV 2ZM6B 2CH7B 1ORQC 2LJ2A 5D5PA 5FNVA 5J2UB 1FJGO 3L70H 5GONA 1GAXA 4IYIA 2NNUA 4YHHO 4O4IB 4PA9A 4NTYA 2QKAA 3GVMA 4UCOA 2XAFA 5CA3A 3WB1A 1NH2B 1IBLB 3VQXA 2A06H 4D7TA 4DR1O 4JI6O 1D5AA 3ZCCA 3BHPA 3ZMTA 1VQ8V 4LH6A 3CWBH 2Q68A 1R3LC 3FB5C 2VQEO 3OT7A 1PL0A 5BR8O 1M56C 4RAIA 1F4NA 4H33A 3KKYA 3BABA 4BIZA 3ABMC 3ASOB 3W7SA 2HR3A 4QPKA 3LUTB 1J5EB 2YUAA 4DV1O 4OX9O 5KHHA 3BPZA 4F6RB 5LHIA 3W7UA 1AJPA 4JTDB 4MVRA 2LQTA 2PGGA 4OPHA 3QO5A 4L8JA 4KHPB 1QQCA 4MTFA 1H8EG 5GW7A 2P6JA 1JJ2U 4FMTA 1WAZA 3RYCB 1ZAUA 4F4LA 1X4TA 3GB7C 2X6CA 2QTSA 1KBHA 1WN7A 5IJ9B 2DYSC 3ABKB 1VQ4V 4B3TB 3CD6V 3CEIA 2UUCB 1P7GA 5B3SB 2UUAO 4GT1A 5KHJA 4IHJB 4J9ZB 3L75H 4WFHA 4X20A 1N0JA 3OTFA 1AJQA 4ZBMA 4LWSA 2JK5C 4B3SO 3K58A 3L72H 3B09A 3ZHTA 4DR5B 2QM8A 2D3OW 1Y74B 4BIUA 2GUZA 3G4SV 4FM0A 1JR9A 3CCMV 4PV1B 4QE9A 1B6QA 1Y66A 4MTXA 2KQXA 2ILMA 4P9OA 3P3PA 5KA5A 1M93A 2VRZA 2CTQA 2M6YA 4X88A 2ZIMA 3EVKA 1VQ7V 1AI6A 4BIOA 5KUMA 3K5LA 3P3NA 4I5SA 4CH6A 1Q86W 1Q8IA 3CSXA 1SQPH 4OXSA 1SZXA 4JPRA 1VIBA 5A2QN 4DUZB 1ZUQA 5BZBA 1PM9A 2IJJA 1D5NA 2F23A 3JD1A 4O4HB 1GN4A 4DW1A 4LF4O 1P7BA 3ICXA 4NB5A 3U0ZA 3ZRVA 3AK3A 3IAYA 1L8DA 3JSNA 5B1AC 4DR2O 1K5QA 1AP5A 3DC5A 5LHGA 1XMOO 3JARA 3E22B 2P90A 4GKKB 1NVPD 3K9AA 3HKBA 2QM7A 1JA8A 4TSFG 1SRYA 3OUFA 1TUEB 1GH6A 1IURA 5IYCO 3ZRWB 3CMEV 3RYFA 2KB1A 4PDVA 2PTMA 2YI8A 1HR0B 2Y0IA 4PDMA 5K1XA 3KCYA 5LP6B 1E1RG 1KB9F 2B5UA 4J11A 4GX1A 2E74B 3QO7A 3QO8A 1ENVA 3K59A 2BOCC 4Z2WA 1M57C 4NR1A 2HFEC 1PNKA 1IBMB 3Q4HB 4Q6GA 1QLEB 1RFYA 1JPXA 5EC1C 4BWAA 2RJZA 3HKCB 4X66B 2CK3G 3U10A 5BMVB 1MZEA 4KP4A 1Y76B 4FVMA 3AK2A 5IE9A 1WB7A 2H8PC 5HFMA 1N36B 3WB2A 4JI0O 4DV4O 1ZL8A 5IYZA 4NXMB 5KHGA 1P4RA 2ETNA 3BA8A 5FNVB 3MD0A 5GONB 4RO2A 5LGTA 3CCLV 4DUYO 3SGIA 3ABLB 3E8BA 3ZHRA 1KECA 4MVZA 5ITZA 2UU9O 1IZ3A 4MVMA 1ZSPA 4EB6B 1SKVA 2DYRB 4J7JA 1HNXB 4PHZA 5JWPA 3QF7A 4DO2A 4DR3O 4X1KA 1RM1B 3T1HO 3FFQA 2PZSA 4W4LA 5EK0A 1XDCA 2Q67A 1SQGA 3RGBA 4JYBA 2A9HA 3RWRD 2Y4UA 2AZ2A 4N21A 2F4VO 5LOVA 1WJZA 1SC5B 3LSSA 2LFRA 3CX5F 4PA3A 1B06A 1V9PA 4P30A 3ETQA 1L0NH 3UT5B 1TVKB 1VQPV 4LFAO 1H8HG 1R6NA 5KA6A 3VQWA 3JD2A 3HKEA 2YEVA 3ZHUA 4JI5B 2QDOA 3X2QC 2E5LO 1JQ0A 1M56B 4X20B 3JD4A 4LWSB 4C7UA 1FJGB 2JS3A 3ABMB 4HNAA 5EYPA 4YHHB 2RCVA 5LYJA 1AI5A 3AK1A 1MMMA 4IT5A 5LL6Y 4DR6O 1AB3A 4DR1B 4JI6B 2GUZB 1XHXA 3G6BA 3K5NA 2F43G 2VQEB 1GN2A 3H1IH 1G6UA 3AG1C 3B2EE 3M8AA 3FB6C 1M90W 5H6RA 5JJEB 4LF9O 2DYSB 3ML0A 4DV1B 3RT3C 2N05A 1I5YA 3AG4C 3MDSA 3NR7A 3UKMA 1YXBA 4JYAO 3CRQA 1I08A 3F5TA 4IIJB 4ZOLA 1LNQA 1NBMG 2BTQB 3RN4A 3DGEA 3L9DA 1URFA 4DV6O 3TK1A 1TAEA 3JAMN 2YS8A 4JV5O 3G80A 1F7YA 2V7QG 4EKWA 3VBBA 4MVSA 4LNUA 2LFSA 2ADPA 1MSDA 1SA0A 4H37A 2ODMA 1PP9H 2MK3A 4YIPA 1FXKA 4FZ0A 1PKXA 4B3SB 3ZMSA 3E8HA 4JYCA 1US6A 5IJ0A 2EILC 2WLMA 3C3SA 2WLLA 2W6IG 5FPOA 4KUMA 3HKBB 3JAKA 2HKOA 2YDEA 4RUEA 4LFCB 1QR8A 4Q20A 4MW3A 5L3GA 1BL8A 1VMGA 2ITDC 3E83A 1QNMA 2YXLA 1S5LZ 3DXRA 1NTKH 4I4TA 1DTOA 4YXWG 3CC7V 2HG5C 5B1AB 3SPCA 3A0BZ 3OD4A 3OR7C 4TV9B 2Q9LA 3ZIAG 3EHBB 1XI1A 1K33A 2BSKA 1EBOA 3ZHVA 4MTGA 2DWEC 2ZIOA 1ZWIC 5JQGB 4U7NA 3T1YO 4JI4O 4DW0A 4IYHA 1NTMH 1TA8A 2KG7A 1NI8A 2EINC 1O9HA 2UXXA 3PN1A 3SYOA 1KQSU 1KP2A 3M7MX 1G8MA 1ZL8B 3GWKC 4XDJA 5IYZB 1V54B 4ZI7B 5LMNO 1FD9A 1D2DA 3K5MA 4I0XB 2RQ6A 4FM1A 3WG7C 2UXCO 2QWPB 1GN3A 5CBHA 1XMOB 1WP7A 1NR7A 4WCEV 1MSWD 1KKCA 4DYLA 2IW5A 4O2BA 1M57B 3CC2V 3GWOA 3HB3B 3R65A 3CCSV 1KC8W 2F95B 1BZKA 1GK9A 1PNLA 1Z5VA 3IJ4A 4X89A 5B1NA 5GTIZ 2HHHO 1IDSA 2WLNA 1ROPA 3RYHB 3SPHA 3SYPA 1OCZB 1BHAA 2PI4A 3K0DA 1ZX3A 4UFZA 2AXTZ 2AZ0A 3SPGA 4O4LA 2UUBO 5LXTA 3OMAB 1Y67A 1QVGU 1DF5A 2VQFO 5EBMC 2WAMA 1CPYA 1F23A 2KKWA 1YJ9V 3K9SA 3SPJA 4PI0A 2EULA 3OMIB 4IGGA 3MAQA 3I56V 1GM9A 3BVOA 1SQVH 4JI1O 4TQFA 4K0KO 2IJHA 2OCCC 3BA9A 1VF7A 2OIEA 3SJAC 4U3JB 2GDSA 4H44B 4DR4O 2YICA 1TUBB 1RSOA 3CP1A 2YIAA 4JI0B 3OW2U 3LDDA 4DV4B 4DR7O 3HKEB 4G27B 1VQOV 1DK1A 1K7DA 1R6TA 2EZPA 5L3BA 3G67A 5EZYA 2O57A 3BFRA 4HNAB 4CZZA 4O2AB 4DUYB 2ZNIA 5E1AC 2PF4E 1CXZB 1N32B 1JFFA 5LYJB 3THOA 2AW9A 1K9MW 1SQFA 2UU9B 4K8XA 1YEWA 1SQQH 2ZD9A 4NYKA 2DQ3A 4YY3O 1AJNA 4G28B 1SZTA 1IXBA 3LDCA 3JSLA 4DXWA 1SQXH 2JJ1G 1BHBA 3E35A 4P2ZA 2A0LA 4DR3B 4QPJA 2Q7EA 4JYYA 4ABMA 5KAIZ 3T1HB 4JAAA 4GUNA 3VQVA 2WPDG 1VF6A 3X2QB 2X6AA 2EJ7A 2MW2B 1SESA 1FXVA 4MSWC 1TGOA 5EC2C 2ZE6A 4J7ZA 1N33O 3F7YC 1H2SB 1N34O 2F4VB 2Z5UA 3FB7C 3K0GA 4DV7O 1S72V 3W7TA 4JI7O 4TV8A 1E1QG 2JVDA 4ZOLB 2XHBA 4JF3A 5DM6V 1VP7A 3MHSC 5CA0A 4FLZA 4MVQA 3VOUA 4JZGA 1K3EA 3ZMZA 1R1BA 4LNUB 2XASA 1PPJH 1P84F 4X64O 4NTXA 3KCXA 3TXSA 4R50A 2AHYA 3AG1B 1E79G 4FZ1A 2CGNA 5LHHA 2VS0A 2W0FC 1I94O 2IH1C 3LDEA 2XAJA 5IJ0B 1AI4A 2EIKB 2JEUA 4JAVA 1R3JC 2WLLB 1GM7A 3RVZA 4I55A 4O4JA 4JI3B 3AG4B 1GM8A 1KP3A 3HPLC 1RPOA 3I5DA 4PDRA 4Z1VA 1QU7A 4DRXA 4DR6B 5FL7G 3B8NA 1OZ0A 1YITV 5E79Z 3E2EA 4NXNO 2B1GA 4XDKA 4UCVA 1KKDA 4HBNA 1BMFG 5KUKA 2D2CB 4JTAB 5CBFA 5TISZ 3CRAA 3LNNA 2DWDC 1R3KC 2IU0A 2JGDA 1BS3A 1YF2A 3QG5A 1N8RW 1YTFD 3E86A 4DV3O 2OCHA 2ZR3A 1N4CA 4JYAB 5KHKA 4AQYO 3JASA 2EILB 1MZFA 3L73H 4QIWF 5JJNB 4TUYA 2KG7B 5CB4B 2XTAA 4B08A 3OR6C 4DV6B 3HKDA 2JDIG 3RVYA 4Z1MG 4JV5B 2R9RB 5JJJB 2UXBO 2QWNB 1XEQA 2RN9A 5GTHZ 1BE3H 1V54C 2BOBC 3JD0A 3N2KA 4LH7A 5FPRA 3OMNB 2Q7GA 3FYEB 3ZN1A 5B66Z 1Q43A 3K5OA 2C2AA 3OGIB 4D7SA 4CC6A 4O2BB 3P30A 5CA1A 3FX7A 1GTOA 2JJ2G 3D3QA 4BW9A 2NLJC 4FLYA 2P7TC 1GKFA 5IDJA 1YSCA 3K3WA 3JD3A 1ZTEA 1H2NA 2HEPA 2EINB 2XAGA 1OCZC 5IWAO 4O4LB 1PL4A 4W4KA 3T2MA 3OTOB 1AP6A 5B1BC 1R6KA 3CRMA 3VQYA 3WB0A 4EEQA 1GMGA 2Q4PA 3ZJZA 4RUFA 1XMQO 2L35A 3DC6A 2X7RB 1MABG 1FAFA 2QGNA 1KD1W 1NTZH 2EX3A 3WG7B 1AR5A 1VARA 4R8CA 1K4DC 4DK1A 3J80N 5IT9N 2LW1A 3T1YB 4X1IA 4JI4B 2R72A 3SYQA 4DV2O 1NS1A 4E2LA 1RSOB 1FPOA 2GSMB 3JATA 5K1PA 2UXDO 2ZT9B 4UV8A 2WLHA 1QHTA 5LMNB 3E8GA 1XNQO 1SETA 5EZYB 1ZLZA 3SYCA 3K79A 1VQ5V 2UXCB 4LP8A 4UUJC 4E4EA 1J5EO 2PYLA 4FPPA 5LBQA 4IL6Z 2LGQA 1B3QA 1BT8A 3K03A 4K3AA 2YIDA 3WU2Z 1OJHA 2Z3YA 2CE4A 1K34A 3T4ZA 4DK0A 4KHPO 4HYOA 2OCCB 2QJ1A 5H6QA 2HHHB 2QKCA 1WPXA 4TOIA 1JMKC 3O65A 2A3QA 4FLUA 1HDJA 1FFXA 3FAVA 2UUBB 1NQTA 3B8MA 4G2KA 4UXNA 1IBKO 4QE7A 3JYCA 2CTPA 2VQFB 2W0XA 1EZJA 4GX5A 4WFGA 2VWJA 1LUWA 2PY5A 5IYBO 4ASUG 4JI1B 4CS4A 3L71H 2HJDA 4K0KB 4O4IA 4AHCA 3CE2A 3O9OA 4JTCB 4LF8O 4DR4B 3N2GA 1QCEA 5LMUO 2PYJA 4LBEC 4DV0O 2JRIA 1J95A 1JOYA 2DQ0A 4JASA 2IM9A 2P4KA 2P06A 4DR7B 3ASNC 3JCZA 2N04A 3WFVA 1HNZO 1VQKV 1EM1A 4CH3A 2XUMA 3OGCC 1DLBA 5BR8B 2Y4TA 1H38A 4A5UB 1FXKC 4YJ2A 2K1EA 2QE7G 4JGSA 5LA6A 1DF4A 4I55B 2EIKC 4OX9B 4MTOA 2OIGA 3ZMVA 1BQ0A 1Y6XA 3AG2C 5IY5C 1Q5OA 4ICGA 5EBLC 2ZE8A 1VQNV 4MVOA 4YY3B 3K06A 4DUZO 1YTFB 4AILC 3RYCA 2F1MA 1M5IA 4WFEA 2OYQA 3UQ8A 5IJ9A 4GCZA 4I50A 4GYCB 1H2GA 4IHJA 4X62O 2FB5A 4H0LB 1NVPB 2UUAB 1R73A 1N33B 2XAHA 2JGUA 1N34B 2QR4A 3NXSA 3U11A 2WA3A 3JASB 4JI7B 4CH4A 4H13B 1XL6A 3JARB 4TUYB 5J2TA 2RMKB 3ZHSA 3FD9A 4K35A 1QLNA 3HKDB 1MNGA 4I9QA 1GO3F 2R9AA 5LGNA 3JAWA 4UCRA 2QSAA 2Q73A 3IGAC 4TT3G 2LO1A 4X64B 2XAQA 3RYFB 3LNMB 3CB2A 3E89A 5L3CA 1YVWA 3CCJV 1EN5A 3N2KB 2NN4A 2EZOA 5JH7A 2RDCA 1HNWO 1I94B 5D5QA 2DJVA 1WPBA 1OCCC 1IBMO 1OCOC 2QTOA 2Q69A 1NT2B 2BTOA 2F66C 1FS0G 2CTRA 2Y69C 2Q8VA 2B1IA 5EIBD 5L3EA 2E75B 4QJFB 4NXNB 5L3FA 2CUGA 4LC1A 2EIJC 2X6BA 4O4HA 1N36O 1Q82W 1Y4MA 4LF4B 4EFBA 4WBNA 3AG7A 1VQMV 4B3RO 3RYIA 4X9QA 1S5HC 4LF5O 2OT5A 2YIBA 1Q81W 1YZBA 4DR2B 4CS3A 3CYOA 1H2KA 3ABTA 3K57A 2QWQB 3AG3C 4AQYB 3E22A 3IC7A 4X1IB 5B5EZ 2YIBD 2VWKA 4NKGB 1K4CC 3QTCA 1L0LH 3JATB 1NZ6A 3N27A 5ITZB 4LF6O 5KLVH 2UXBB 1K97A 3R66A 4WFBV 4UB6Z 3SPIA 5LP6A 1VEWA 2LW7A 4XDLA 3B77A 2B9ZA 4ZKIA 2HLDG 4FFKA 1K92A 3BY6A 1HP8A 2JIZG 4X1KB 5B1BB 2GBOA 4JZ2A 4FLVA 1F4MA 3Q4HA 4BAYA 2IJIA 2P4VA 3SJQC 2AGAA 3A0HZ 3IC9A 1XNRO 5CN0A 2PUSA 1BGYH 1EZVH 5BMVA 4RQFA 2KSDA 1H2MA 5LOVB 4FK5C 3T4DA 1Y76A 1SERA 3G71V 1KUQA 4FIPC 4JI2O 2QM4A 1W0JG 5A9GA 4UB8Z 2FKXA 5IWAB 3FAVB 3H01A 1VQ9V 2R9IA 4B3MO 2HVJC 2WLKA 4JI8O 2ITCC 4RWUA 4YJ3A 1AI7A 2WA4A 3UCSC 1UPGA 2GV9A 3ZBHA 1S76D 2YEVB 1XMQB 2OTLV 1VF6C 1L1FA 3OFNG 2QEXV 5EBWC 2EBOA 5EYPB 3N2GB 1SQBH 4HAMA 4DV2B 1BCCH 4ZHQA 1JX9A 4EB6A 1XILA 3G6EV 1YIJV 2WLIA 2FTKA 2UXDB 1VQLV 1QVFU 4FJCC 1Q7YW 4KFMA 2F93B 1XNQB 3BEHA 4GX0A 5H9CA 4YIOA 4BR6A 1OHHG 4YJ2B 2XT9A 2HJFC 3B4SA 4P9PA 4MW8A 5LA6B 1XL4A 2Q0OC 2DW4A 2FMLA 4J41A 2ADQB 1A32A 3HR0A 2QWOB 3T1CA 2DOSA 3AEIA 3J7AU 4J80A 1X59A 3SJBC 4QGPA 3W7WA 5C93A 1K5SA 3ABUA 2CDYA 3UT5A 1TVKA 2DMXA 5C8YA 4I50B 3SDLA 1I5XA 4LFAB 1IBKB 3ASNB 5DEDA 1YJNV 5KX5A 3A0RA 1SA0B 4L87A 3CPWU 2E5LB 3CXCU 1V55C 4U7OA 3ZEDA 1G1XB 1FXKB 3CCQV 4LF7O 2GTSA 2XOKG 4GKJO 1G4YB 3ETGA 1KU9A 1XBLA 3SJCC 2ATKC 5J2TB 5H5NA 1K8AW 4LF8B 5LMUB 1M1KW 1COWG 4TQDA 2P22C 4PJ0Z 5HFLA 2NR5A 3AG2B 4LFCO 4DV0B 2DN9A 5IY5B 4CBCA 3JAKB 3A2FA 1MG1A 3JAWB 4FLXA 3DTUB 1MA1A 2ZINA 5JCOC 3CCRV 1HNZB 3UO2A 2V1DA 5JH7B 3DXRB 1W59A 3CCUV 1LR1A 4I4TB 1K73W 4LFBO 3EXAA 4N23A 4X65O 1JJOA 4J9YB 1U96A 4LF9B 1AR1B 4PA4A 3DSQA 4UVCA 2ARHA 4K8ZA 1AILA 3BAAA 3E8FA 4J7KA 1RPRA 3ZS8C 4EFEA 1OCRB 2BSKB 3UM7A 2ZKOA 4IIJA 5JVDA 4J10A 2BTQA 2FYUH 1PV0A 1IVSA 3SYAA 3ETEA 1DGSA 3OEEG 4WBNB 3RYIB 4WFFA 4GLXA 2Q6AA 1MOFA 5JCOA 4U3FH 3CRRA 4X62B 2WLJA 4FLWA 1YI2V 4X1YA 2N74A 3KZIZ 3H1JH 2CGOA 4DV5O 2Y0PA 1OV9A 4ZIBA 4PA7A 1WP8A 1EN4A 1OCCB 1QBZA 1OCOB 2G38A 3C90A 2IBZH 1Q6IA 1THZA 2ZDIC 1FFTB 1VF5B 2Y69B 1F51A 3S3XA 4KL1A 1Q6HA 3CC4V 3CS5A 2XNDG 1WLEA 1LUVA 2EIJB 4KXRA 3OAAG 1HNWB 3ETDA 2FL4A 5LXTB 1S3JA 2JS5A 1GRJA 3ZRSA 2YXHA 3CJHA 2P5OA 4R6ZA 1WA8A 4TV9A 5KAFZ 5KMGA 3OEHG 4UVBA 1EFRG 3S3WA 2ZM6O 3STZC 2ZXWC 2Q5ZA 1KYOF 1PNMA 3OUSA 3AG3B 3P32A 5JQGA 1H2LA 4I9WA 3D3IA 4J42A 4QNHB 2ZDIA 3MHHC 2Q0AA 1IBLO 4OPAA 1N0NA 2H94A 4MS2A 3RW0A 1IXMA 4B3RB 1NU1H 1P49A 4YJ3B 3SR2C 4ZI7A 4LF5B 2EIMC 4WFAV 4NVPA 4I0XA 3LSUA 1UFIA 1Z5WA 4B7KA 3F5WC 2YXYA 2H3OA 1PD3A 5DECA 1N32O 4FM2A 1JFFB 3D8CA 4ZHQB 2QKSA 4FFBA 2OTJV 1XQ8A 2WLIB 2X0LA 1Q6UA 3UO3A 4LF6B 3JALA 3RYHA 3CCEV 5DN6G 1NJIW 4NTWA 2OWOA 3FKSG 1AROP 5BY1A 2M7WA 2ZCEA 4TWKA 3B40A 5CMUA 3JCUZ 3ASOC 4B3TO 5FLXN 5H2FZ 2UUCO 3TCUA 5F2VO 2CH7A 4PDLA 4UV9A 4CC5A 5J2UA 1XNRB 3K08A 2ZQMA 3C3TA 2WSSG 4U3JA 2LP7A 1YHQV 1FKAO 3FYIB 3PJSK 4TV8B 4JI2B 1TUBA 3TGUH 4DR5O 3ZN0A 4MVUA 5CA0B 4F6EA 1CEZA 1Q90D 5C8YB 5LGUA 1GN6A 2ZNJA 3TJTA 4RQEA 4B3MB 4X8AA 2HVKC 1M9NA 4JI8B 1W2BU 3ABKC 5KX5B 1KMIZ 5B3SC 2IH3C 1XREA 2RNBA 1WB8A 1JCHA 3IFXA 5IYDO 4O2AA 1NH2D 4JI3O 2HP8A 4O4JB 1O9GA 2E76B 4PA6A 1I7FA 4JAUA 4F6RA 5B1OA 4DRXB 1XOUA 1BQZA 2K9PA 3H9VA 5KHIA 3H1HH 1Z2GA 4PD4F 2Y48A 1UJWB 2GTAA 1HWYA 5EIBC 4D6TH 2JGDB 3CRCA 1QR9A 1V55B 1WNSA 3RBZA 2L6LA 4LCUC 1XUQA 5JVDB 1OCRC 3I55V 2PI5A 4DV7B 4HZ3A 2LGWA 2BE3A 2IU3A 4GKKO 3D36C 1AVMA 3F7VC 3H1KH 1Y74A
chains in the Genus database with same CATH topology
5B66Z 5TISZ 4PJ0Z 3A0HZ 4UB6Z 5GTIZ 1S5LZ 4IL6Z 3JCUZ 5KAFZ 3WU2Z 5E79Z 5H2FZ 2AXTZ 5GTHZ 3KZIZ 5B5EZ 4UB8Z 5KAIZ 3A0BZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B66 Z;  5TIS Z;  4PJ0 Z;  3A0H Z;  4UB6 Z;  5GTI Z;  1S5L Z;  4IL6 Z;  3JCU Z;  5KAF Z;  3WU2 Z;  5E79 Z;  5H2F Z;  2AXT Z;  5GTH Z;  3KZI Z;  5B5E Z;  4UB8 Z;  5KAI Z;  3A0B Z; 
#chains in the Genus database with same CATH topology
 3K04 A;  1HR0 O;  1BSM A;  4X1Y B;  4UVA A;  2GHY A;  1U97 A;  2ZE5 A;  3OE7 G;  1XHZ A;  2A7W A;  3ZRX A;  3H1L H;  4LF7 B;  4GKJ B;  3ZHQ A;  3BCC H;  1YDX A;  5J9P C;  2YSU B;  3OM3 B;  4LR3 A;  3CXH F;  2CTW A;  5CA1 B;  3L74 H;  2V4D A;  4XBF A;  1W0K G;  4BW5 A;  4CS2 A;  3KG2 A;  4X66 O;  4GX2 A;  1CP9 A;  2E3C A;  4MT8 A;  2IJK A;  4PEL A;  1VQ6 V;  2W6J G;  2QWR B;  4GZR B;  5LP6 C;  3OTO O;  1YCI A;  3D36 A;  4LFB B;  4UCS A;  4X65 B;  3CJH B;  1Q3E A;  1WA8 B;  3BRC A;  5KMG B;  1S0V A;  4NXM O;  1RP3 B;  2BCC H;  1IX9 A;  4WF9 V;  4DV3 B;  1QLE C;  3APQ A;  1I0H A;  2EJR A;  3STL C;  5L3D A;  1AR4 A;  5CB4 A;  1SF9 A;  4AI8 A;  2A79 B;  4FLT A;  1NR1 A;  2AHZ A;  1HNX O;  1YJW V;  2ZE7 A;  3APO A;  3ZRW A;  2UXN A;  1NKD A;  3RFR A;  2R70 A;  2YI9 A;  3EFF K;  2P67 A;  2DE0 X;  4R7C A;  4DV5 B;  2JEX A;  3ZX6 A;  4UCT A;  3CCV V;  1HW7 A;  1FYJ A;  2YC0 A;  5AG2 A;  5BXZ A;  3TET A;  3ABL C;  3M99 B;  1B04 A;  3W7X A;  2QA4 V;  4FFB B;  3LSQ A;  1S5J A;  3J81 N;  1R3I C;  3QNE A;  1FXH A;  4CH5 A;  3JAL B;  2ZXW B;  2DYR C;  1EN6 A;  2WWW A;  4OGQ B;  2CAZ C;  3HKC A;  2Z0A A;  3ZMU A;  4PI2 A;  2Q7H A;  3A8T A;  3TXQ A;  4UCU A;  3QVN A;  3FB8 C;  2ZR2 A;  1RM1 C;  1JVM A;  3CHX A;  1FFX B;  1SS3 A;  4I7Z B;  5CBG A;  1T5E A;  2EIM B;  1S77 D;  4B7E A;  4JI5 O;  1M4U A;  3CMA V;  2ZM6 B;  2CH7 B;  1ORQ C;  2LJ2 A;  5D5P A;  5FNV A;  5J2U B;  1FJG O;  3L70 H;  5GON A;  1GAX A;  4IYI A;  2NNU A;  4YHH O;  4O4I B;  4PA9 A;  4NTY A;  2QKA A;  3GVM A;  4UCO A;  2XAF A;  5CA3 A;  3WB1 A;  1NH2 B;  1IBL B;  3VQX A;  2A06 H;  4D7T A;  4DR1 O;  4JI6 O;  1D5A A;  3ZCC A;  3BHP A;  3ZMT A;  1VQ8 V;  4LH6 A;  3CWB H;  2Q68 A;  1R3L C;  3FB5 C;  2VQE O;  3OT7 A;  1PL0 A;  5BR8 O;  1M56 C;  4RAI A;  1F4N A;  4H33 A;  3KKY A;  3BAB A;  4BIZ A;  3ABM C;  3ASO B;  3W7S A;  2HR3 A;  4QPK A;  3LUT B;  1J5E B;  2YUA A;  4DV1 O;  4OX9 O;  5KHH A;  3BPZ A;  4F6R B;  5LHI A;  3W7U A;  1AJP A;  4JTD B;  4MVR A;  2LQT A;  2PGG A;  4OPH A;  3QO5 A;  4L8J A;  4KHP B;  1QQC A;  4MTF A;  1H8E G;  5GW7 A;  2P6J A;  1JJ2 U;  4FMT A;  1WAZ A;  3RYC B;  1ZAU A;  4F4L A;  1X4T A;  3GB7 C;  2X6C A;  2QTS A;  1KBH A;  1WN7 A;  5IJ9 B;  2DYS C;  3ABK B;  1VQ4 V;  4B3T B;  3CD6 V;  3CEI A;  2UUC B;  1P7G A;  5B3S B;  2UUA O;  4GT1 A;  5KHJ A;  4IHJ B;  4J9Z B;  3L75 H;  4WFH A;  4X20 A;  1N0J A;  3OTF A;  1AJQ A;  4ZBM A;  4LWS A;  2JK5 C;  4B3S O;  3K58 A;  3L72 H;  3B09 A;  3ZHT A;  4DR5 B;  2QM8 A;  2D3O W;  1Y74 B;  4BIU A;  2GUZ A;  3G4S V;  4FM0 A;  1JR9 A;  3CCM V;  4PV1 B;  4QE9 A;  1B6Q A;  1Y66 A;  4MTX A;  2KQX A;  2ILM A;  4P9O A;  3P3P A;  5KA5 A;  1M93 A;  2VRZ A;  2CTQ A;  2M6Y A;  4X88 A;  2ZIM A;  3EVK A;  1VQ7 V;  1AI6 A;  4BIO A;  5KUM A;  3K5L A;  3P3N A;  4I5S A;  4CH6 A;  1Q86 W;  1Q8I A;  3CSX A;  1SQP H;  4OXS A;  1SZX A;  4JPR A;  1VIB A;  5A2Q N;  4DUZ B;  1ZUQ A;  5BZB A;  1PM9 A;  2IJJ A;  1D5N A;  2F23 A;  3JD1 A;  4O4H B;  1GN4 A;  4DW1 A;  4LF4 O;  1P7B A;  3ICX A;  4NB5 A;  3U0Z A;  3ZRV A;  3AK3 A;  3IAY A;  1L8D A;  3JSN A;  5B1A C;  4DR2 O;  1K5Q A;  1AP5 A;  3DC5 A;  5LHG A;  1XMO O;  3JAR A;  3E22 B;  2P90 A;  4GKK B;  1NVP D;  3K9A A;  3HKB A;  2QM7 A;  1JA8 A;  4TSF G;  1SRY A;  3OUF A;  1TUE B;  1GH6 A;  1IUR A;  5IYC O;  3ZRW B;  3CME V;  3RYF A;  2KB1 A;  4PDV A;  2PTM A;  2YI8 A;  1HR0 B;  2Y0I A;  4PDM A;  5K1X A;  3KCY A;  5LP6 B;  1E1R G;  1KB9 F;  2B5U A;  4J11 A;  4GX1 A;  2E74 B;  3QO7 A;  3QO8 A;  1ENV A;  3K59 A;  2BOC C;  4Z2W A;  1M57 C;  4NR1 A;  2HFE C;  1PNK A;  1IBM B;  3Q4H B;  4Q6G A;  1QLE B;  1RFY A;  1JPX A;  5EC1 C;  4BWA A;  2RJZ A;  3HKC B;  4X66 B;  2CK3 G;  3U10 A;  5BMV B;  1MZE A;  4KP4 A;  1Y76 B;  4FVM A;  3AK2 A;  5IE9 A;  1WB7 A;  2H8P C;  5HFM A;  1N36 B;  3WB2 A;  4JI0 O;  4DV4 O;  1ZL8 A;  5IYZ A;  4NXM B;  5KHG A;  1P4R A;  2ETN A;  3BA8 A;  5FNV B;  3MD0 A;  5GON B;  4RO2 A;  5LGT A;  3CCL V;  4DUY O;  3SGI A;  3ABL B;  3E8B A;  3ZHR A;  1KEC A;  4MVZ A;  5ITZ A;  2UU9 O;  1IZ3 A;  4MVM A;  1ZSP A;  4EB6 B;  1SKV A;  2DYR B;  4J7J A;  1HNX B;  4PHZ A;  5JWP A;  3QF7 A;  4DO2 A;  4DR3 O;  4X1K A;  1RM1 B;  3T1H O;  3FFQ A;  2PZS A;  4W4L A;  5EK0 A;  1XDC A;  2Q67 A;  1SQG A;  3RGB A;  4JYB A;  2A9H A;  3RWR D;  2Y4U A;  2AZ2 A;  4N21 A;  2F4V O;  5LOV A;  1WJZ A;  1SC5 B;  3LSS A;  2LFR A;  3CX5 F;  4PA3 A;  1B06 A;  1V9P A;  4P30 A;  3ETQ A;  1L0N H;  3UT5 B;  1TVK B;  1VQP V;  4LFA O;  1H8H G;  1R6N A;  5KA6 A;  3VQW A;  3JD2 A;  3HKE A;  2YEV A;  3ZHU A;  4JI5 B;  2QDO A;  3X2Q C;  2E5L O;  1JQ0 A;  1M56 B;  4X20 B;  3JD4 A;  4LWS B;  4C7U A;  1FJG B;  2JS3 A;  3ABM B;  4HNA A;  5EYP A;  4YHH B;  2RCV A;  5LYJ A;  1AI5 A;  3AK1 A;  1MMM A;  4IT5 A;  5LL6 Y;  4DR6 O;  1AB3 A;  4DR1 B;  4JI6 B;  2GUZ B;  1XHX A;  3G6B A;  3K5N A;  2F43 G;  2VQE B;  1GN2 A;  3H1I H;  1G6U A;  3AG1 C;  3B2E E;  3M8A A;  3FB6 C;  1M90 W;  5H6R A;  5JJE B;  4LF9 O;  2DYS B;  3ML0 A;  4DV1 B;  3RT3 C;  2N05 A;  1I5Y A;  3AG4 C;  3MDS A;  3NR7 A;  3UKM A;  1YXB A;  4JYA O;  3CRQ A;  1I08 A;  3F5T A;  4IIJ B;  4ZOL A;  1LNQ A;  1NBM G;  2BTQ B;  3RN4 A;  3DGE A;  3L9D A;  1URF A;  4DV6 O;  3TK1 A;  1TAE A;  3JAM N;  2YS8 A;  4JV5 O;  3G80 A;  1F7Y A;  2V7Q G;  4EKW A;  3VBB A;  4MVS A;  4LNU A;  2LFS A;  2ADP A;  1MSD A;  1SA0 A;  4H37 A;  2ODM A;  1PP9 H;  2MK3 A;  4YIP A;  1FXK A;  4FZ0 A;  1PKX A;  4B3S B;  3ZMS A;  3E8H A;  4JYC A;  1US6 A;  5IJ0 A;  2EIL C;  2WLM A;  3C3S A;  2WLL A;  2W6I G;  5FPO A;  4KUM A;  3HKB B;  3JAK A;  2HKO A;  2YDE A;  4RUE A;  4LFC B;  1QR8 A;  4Q20 A;  4MW3 A;  5L3G A;  1BL8 A;  1VMG A;  2ITD C;  3E83 A;  1QNM A;  2YXL A;  1S5L Z;  3DXR A;  1NTK H;  4I4T A;  1DTO A;  4YXW G;  3CC7 V;  2HG5 C;  5B1A B;  3SPC A;  3A0B Z;  3OD4 A;  3OR7 C;  4TV9 B;  2Q9L A;  3ZIA G;  3EHB B;  1XI1 A;  1K33 A;  2BSK A;  1EBO A;  3ZHV A;  4MTG A;  2DWE C;  2ZIO A;  1ZWI C;  5JQG B;  4U7N A;  3T1Y O;  4JI4 O;  4DW0 A;  4IYH A;  1NTM H;  1TA8 A;  2KG7 A;  1NI8 A;  2EIN C;  1O9H A;  2UXX A;  3PN1 A;  3SYO A;  1KQS U;  1KP2 A;  3M7M X;  1G8M A;  1ZL8 B;  3GWK C;  4XDJ A;  5IYZ B;  1V54 B;  4ZI7 B;  5LMN O;  1FD9 A;  1D2D A;  3K5M A;  4I0X B;  2RQ6 A;  4FM1 A;  3WG7 C;  2UXC O;  2QWP B;  1GN3 A;  5CBH A;  1XMO B;  1WP7 A;  1NR7 A;  4WCE V;  1MSW D;  1KKC A;  4DYL A;  2IW5 A;  4O2B A;  1M57 B;  3CC2 V;  3GWO A;  3HB3 B;  3R65 A;  3CCS V;  1KC8 W;  2F95 B;  1BZK A;  1GK9 A;  1PNL A;  1Z5V A;  3IJ4 A;  4X89 A;  5B1N A;  5GTI Z;  2HHH O;  1IDS A;  2WLN A;  1ROP A;  3RYH B;  3SPH A;  3SYP A;  1OCZ B;  1BHA A;  2PI4 A;  3K0D A;  1ZX3 A;  4UFZ A;  2AXT Z;  2AZ0 A;  3SPG A;  4O4L A;  2UUB O;  5LXT A;  3OMA B;  1Y67 A;  1QVG U;  1DF5 A;  2VQF O;  5EBM C;  2WAM A;  1CPY A;  1F23 A;  2KKW A;  1YJ9 V;  3K9S A;  3SPJ A;  4PI0 A;  2EUL A;  3OMI B;  4IGG A;  3MAQ A;  3I56 V;  1GM9 A;  3BVO A;  1SQV H;  4JI1 O;  4TQF A;  4K0K O;  2IJH A;  2OCC C;  3BA9 A;  1VF7 A;  2OIE A;  3SJA C;  4U3J B;  2GDS A;  4H44 B;  4DR4 O;  2YIC A;  1TUB B;  1RSO A;  3CP1 A;  2YIA A;  4JI0 B;  3OW2 U;  3LDD A;  4DV4 B;  4DR7 O;  3HKE B;  4G27 B;  1VQO V;  1DK1 A;  1K7D A;  1R6T A;  2EZP A;  5L3B A;  3G67 A;  5EZY A;  2O57 A;  3BFR A;  4HNA B;  4CZZ A;  4O2A B;  4DUY B;  2ZNI A;  5E1A C;  2PF4 E;  1CXZ B;  1N32 B;  1JFF A;  5LYJ B;  3THO A;  2AW9 A;  1K9M W;  1SQF A;  2UU9 B;  4K8X A;  1YEW A;  1SQQ H;  2ZD9 A;  4NYK A;  2DQ3 A;  4YY3 O;  1AJN A;  4G28 B;  1SZT A;  1IXB A;  3LDC A;  3JSL A;  4DXW A;  1SQX H;  2JJ1 G;  1BHB A;  3E35 A;  4P2Z A;  2A0L A;  4DR3 B;  4QPJ A;  2Q7E A;  4JYY A;  4ABM A;  5KAI Z;  3T1H B;  4JAA A;  4GUN A;  3VQV A;  2WPD G;  1VF6 A;  3X2Q B;  2X6A A;  2EJ7 A;  2MW2 B;  1SES A;  1FXV A;  4MSW C;  1TGO A;  5EC2 C;  2ZE6 A;  4J7Z A;  1N33 O;  3F7Y C;  1H2S B;  1N34 O;  2F4V B;  2Z5U A;  3FB7 C;  3K0G A;  4DV7 O;  1S72 V;  3W7T A;  4JI7 O;  4TV8 A;  1E1Q G;  2JVD A;  4ZOL B;  2XHB A;  4JF3 A;  5DM6 V;  1VP7 A;  3MHS C;  5CA0 A;  4FLZ A;  4MVQ A;  3VOU A;  4JZG A;  1K3E A;  3ZMZ A;  1R1B A;  4LNU B;  2XAS A;  1PPJ H;  1P84 F;  4X64 O;  4NTX A;  3KCX A;  3TXS A;  4R50 A;  2AHY A;  3AG1 B;  1E79 G;  4FZ1 A;  2CGN A;  5LHH A;  2VS0 A;  2W0F C;  1I94 O;  2IH1 C;  3LDE A;  2XAJ A;  5IJ0 B;  1AI4 A;  2EIK B;  2JEU A;  4JAV A;  1R3J C;  2WLL B;  1GM7 A;  3RVZ A;  4I55 A;  4O4J A;  4JI3 B;  3AG4 B;  1GM8 A;  1KP3 A;  3HPL C;  1RPO A;  3I5D A;  4PDR A;  4Z1V A;  1QU7 A;  4DRX A;  4DR6 B;  5FL7 G;  3B8N A;  1OZ0 A;  1YIT V;  5E79 Z;  3E2E A;  4NXN O;  2B1G A;  4XDK A;  4UCV A;  1KKD A;  4HBN A;  1BMF G;  5KUK A;  2D2C B;  4JTA B;  5CBF A;  5TIS Z;  3CRA A;  3LNN A;  2DWD C;  1R3K C;  2IU0 A;  2JGD A;  1BS3 A;  1YF2 A;  3QG5 A;  1N8R W;  1YTF D;  3E86 A;  4DV3 O;  2OCH A;  2ZR3 A;  1N4C A;  4JYA B;  5KHK A;  4AQY O;  3JAS A;  2EIL B;  1MZF A;  3L73 H;  4QIW F;  5JJN B;  4TUY A;  2KG7 B;  5CB4 B;  2XTA A;  4B08 A;  3OR6 C;  4DV6 B;  3HKD A;  2JDI G;  3RVY A;  4Z1M G;  4JV5 B;  2R9R B;  5JJJ B;  2UXB O;  2QWN B;  1XEQ A;  2RN9 A;  5GTH Z;  1BE3 H;  1V54 C;  2BOB C;  3JD0 A;  3N2K A;  4LH7 A;  5FPR A;  3OMN B;  2Q7G A;  3FYE B;  3ZN1 A;  5B66 Z;  1Q43 A;  3K5O A;  2C2A A;  3OGI B;  4D7S A;  4CC6 A;  4O2B B;  3P30 A;  5CA1 A;  3FX7 A;  1GTO A;  2JJ2 G;  3D3Q A;  4BW9 A;  2NLJ C;  4FLY A;  2P7T C;  1GKF A;  5IDJ A;  1YSC A;  3K3W A;  3JD3 A;  1ZTE A;  1H2N A;  2HEP A;  2EIN B;  2XAG A;  1OCZ C;  5IWA O;  4O4L B;  1PL4 A;  4W4K A;  3T2M A;  3OTO B;  1AP6 A;  5B1B C;  1R6K A;  3CRM A;  3VQY A;  3WB0 A;  4EEQ A;  1GMG A;  2Q4P A;  3ZJZ A;  4RUF A;  1XMQ O;  2L35 A;  3DC6 A;  2X7R B;  1MAB G;  1FAF A;  2QGN A;  1KD1 W;  1NTZ H;  2EX3 A;  3WG7 B;  1AR5 A;  1VAR A;  4R8C A;  1K4D C;  4DK1 A;  3J80 N;  5IT9 N;  2LW1 A;  3T1Y B;  4X1I A;  4JI4 B;  2R72 A;  3SYQ A;  4DV2 O;  1NS1 A;  4E2L A;  1RSO B;  1FPO A;  2GSM B;  3JAT A;  5K1P A;  2UXD O;  2ZT9 B;  4UV8 A;  2WLH A;  1QHT A;  5LMN B;  3E8G A;  1XNQ O;  1SET A;  5EZY B;  1ZLZ A;  3SYC A;  3K79 A;  1VQ5 V;  2UXC B;  4LP8 A;  4UUJ C;  4E4E A;  1J5E O;  2PYL A;  4FPP A;  5LBQ A;  4IL6 Z;  2LGQ A;  1B3Q A;  1BT8 A;  3K03 A;  4K3A A;  2YID A;  3WU2 Z;  1OJH A;  2Z3Y A;  2CE4 A;  1K34 A;  3T4Z A;  4DK0 A;  4KHP O;  4HYO A;  2OCC B;  2QJ1 A;  5H6Q A;  2HHH B;  2QKC A;  1WPX A;  4TOI A;  1JMK C;  3O65 A;  2A3Q A;  4FLU A;  1HDJ A;  1FFX A;  3FAV A;  2UUB B;  1NQT A;  3B8M A;  4G2K A;  4UXN A;  1IBK O;  4QE7 A;  3JYC A;  2CTP A;  2VQF B;  2W0X A;  1EZJ A;  4GX5 A;  4WFG A;  2VWJ A;  1LUW A;  2PY5 A;  5IYB O;  4ASU G;  4JI1 B;  4CS4 A;  3L71 H;  2HJD A;  4K0K B;  4O4I A;  4AHC A;  3CE2 A;  3O9O A;  4JTC B;  4LF8 O;  4DR4 B;  3N2G A;  1QCE A;  5LMU O;  2PYJ A;  4LBE C;  4DV0 O;  2JRI A;  1J95 A;  1JOY A;  2DQ0 A;  4JAS A;  2IM9 A;  2P4K A;  2P06 A;  4DR7 B;  3ASN C;  3JCZ A;  2N04 A;  3WFV A;  1HNZ O;  1VQK V;  1EM1 A;  4CH3 A;  2XUM A;  3OGC C;  1DLB A;  5BR8 B;  2Y4T A;  1H38 A;  4A5U B;  1FXK C;  4YJ2 A;  2K1E A;  2QE7 G;  4JGS A;  5LA6 A;  1DF4 A;  4I55 B;  2EIK C;  4OX9 B;  4MTO A;  2OIG A;  3ZMV A;  1BQ0 A;  1Y6X A;  3AG2 C;  5IY5 C;  1Q5O A;  4ICG A;  5EBL C;  2ZE8 A;  1VQN V;  4MVO A;  4YY3 B;  3K06 A;  4DUZ O;  1YTF B;  4AIL C;  3RYC A;  2F1M A;  1M5I A;  4WFE A;  2OYQ A;  3UQ8 A;  5IJ9 A;  4GCZ A;  4I50 A;  4GYC B;  1H2G A;  4IHJ A;  4X62 O;  2FB5 A;  4H0L B;  1NVP B;  2UUA B;  1R73 A;  1N33 B;  2XAH A;  2JGU A;  1N34 B;  2QR4 A;  3NXS A;  3U11 A;  2WA3 A;  3JAS B;  4JI7 B;  4CH4 A;  4H13 B;  1XL6 A;  3JAR B;  4TUY B;  5J2T A;  2RMK B;  3ZHS A;  3FD9 A;  4K35 A;  1QLN A;  3HKD B;  1MNG A;  4I9Q A;  1GO3 F;  2R9A A;  5LGN A;  3JAW A;  4UCR A;  2QSA A;  2Q73 A;  3IGA C;  4TT3 G;  2LO1 A;  4X64 B;  2XAQ A;  3RYF B;  3LNM B;  3CB2 A;  3E89 A;  5L3C A;  1YVW A;  3CCJ V;  1EN5 A;  3N2K B;  2NN4 A;  2EZO A;  5JH7 A;  2RDC A;  1HNW O;  1I94 B;  5D5Q A;  2DJV A;  1WPB A;  1OCC C;  1IBM O;  1OCO C;  2QTO A;  2Q69 A;  1NT2 B;  2BTO A;  2F66 C;  1FS0 G;  2CTR A;  2Y69 C;  2Q8V A;  2B1I A;  5EIB D;  5L3E A;  2E75 B;  4QJF B;  4NXN B;  5L3F A;  2CUG A;  4LC1 A;  2EIJ C;  2X6B A;  4O4H A;  1N36 O;  1Q82 W;  1Y4M A;  4LF4 B;  4EFB A;  4WBN A;  3AG7 A;  1VQM V;  4B3R O;  3RYI A;  4X9Q A;  1S5H C;  4LF5 O;  2OT5 A;  2YIB A;  1Q81 W;  1YZB A;  4DR2 B;  4CS3 A;  3CYO A;  1H2K A;  3ABT A;  3K57 A;  2QWQ B;  3AG3 C;  4AQY B;  3E22 A;  3IC7 A;  4X1I B;  5B5E Z;  2YIB D;  2VWK A;  4NKG B;  1K4C C;  3QTC A;  1L0L H;  3JAT B;  1NZ6 A;  3N27 A;  5ITZ B;  4LF6 O;  5KLV H;  2UXB B;  1K97 A;  3R66 A;  4WFB V;  4UB6 Z;  3SPI A;  5LP6 A;  1VEW A;  2LW7 A;  4XDL A;  3B77 A;  2B9Z A;  4ZKI A;  2HLD G;  4FFK A;  1K92 A;  3BY6 A;  1HP8 A;  2JIZ G;  4X1K B;  5B1B B;  2GBO A;  4JZ2 A;  4FLV A;  1F4M A;  3Q4H A;  4BAY A;  2IJI A;  2P4V A;  3SJQ C;  2AGA A;  3A0H Z;  3IC9 A;  1XNR O;  5CN0 A;  2PUS A;  1BGY H;  1EZV H;  5BMV A;  4RQF A;  2KSD A;  1H2M A;  5LOV B;  4FK5 C;  3T4D A;  1Y76 A;  1SER A;  3G71 V;  1KUQ A;  4FIP C;  4JI2 O;  2QM4 A;  1W0J G;  5A9G A;  4UB8 Z;  2FKX A;  5IWA B;  3FAV B;  3H01 A;  1VQ9 V;  2R9I A;  4B3M O;  2HVJ C;  2WLK A;  4JI8 O;  2ITC C;  4RWU A;  4YJ3 A;  1AI7 A;  2WA4 A;  3UCS C;  1UPG A;  2GV9 A;  3ZBH A;  1S76 D;  2YEV B;  1XMQ B;  2OTL V;  1VF6 C;  1L1F A;  3OFN G;  2QEX V;  5EBW C;  2EBO A;  5EYP B;  3N2G B;  1SQB H;  4HAM A;  4DV2 B;  1BCC H;  4ZHQ A;  1JX9 A;  4EB6 A;  1XIL A;  3G6E V;  1YIJ V;  2WLI A;  2FTK A;  2UXD B;  1VQL V;  1QVF U;  4FJC C;  1Q7Y W;  4KFM A;  2F93 B;  1XNQ B;  3BEH A;  4GX0 A;  5H9C A;  4YIO A;  4BR6 A;  1OHH G;  4YJ2 B;  2XT9 A;  2HJF C;  3B4S A;  4P9P A;  4MW8 A;  5LA6 B;  1XL4 A;  2Q0O C;  2DW4 A;  2FML A;  4J41 A;  2ADQ B;  1A32 A;  3HR0 A;  2QWO B;  3T1C A;  2DOS A;  3AEI A;  3J7A U;  4J80 A;  1X59 A;  3SJB C;  4QGP A;  3W7W A;  5C93 A;  1K5S A;  3ABU A;  2CDY A;  3UT5 A;  1TVK A;  2DMX A;  5C8Y A;  4I50 B;  3SDL A;  1I5X A;  4LFA B;  1IBK B;  3ASN B;  5DED A;  1YJN V;  5KX5 A;  3A0R A;  1SA0 B;  4L87 A;  3CPW U;  2E5L B;  3CXC U;  1V55 C;  4U7O A;  3ZED A;  1G1X B;  1FXK B;  3CCQ V;  4LF7 O;  2GTS A;  2XOK G;  4GKJ O;  1G4Y B;  3ETG A;  1KU9 A;  1XBL A;  3SJC C;  2ATK C;  5J2T B;  5H5N A;  1K8A W;  4LF8 B;  5LMU B;  1M1K W;  1COW G;  4TQD A;  2P22 C;  4PJ0 Z;  5HFL A;  2NR5 A;  3AG2 B;  4LFC O;  4DV0 B;  2DN9 A;  5IY5 B;  4CBC A;  3JAK B;  3A2F A;  1MG1 A;  3JAW B;  4FLX A;  3DTU B;  1MA1 A;  2ZIN A;  5JCO C;  3CCR V;  1HNZ B;  3UO2 A;  2V1D A;  5JH7 B;  3DXR B;  1W59 A;  3CCU V;  1LR1 A;  4I4T B;  1K73 W;  4LFB O;  3EXA A;  4N23 A;  4X65 O;  1JJO A;  4J9Y B;  1U96 A;  4LF9 B;  1AR1 B;  4PA4 A;  3DSQ A;  4UVC A;  2ARH A;  4K8Z A;  1AIL A;  3BAA A;  3E8F A;  4J7K A;  1RPR A;  3ZS8 C;  4EFE A;  1OCR B;  2BSK B;  3UM7 A;  2ZKO A;  4IIJ A;  5JVD A;  4J10 A;  2BTQ A;  2FYU H;  1PV0 A;  1IVS A;  3SYA A;  3ETE A;  1DGS A;  3OEE G;  4WBN B;  3RYI B;  4WFF A;  4GLX A;  2Q6A A;  1MOF A;  5JCO A;  4U3F H;  3CRR A;  4X62 B;  2WLJ A;  4FLW A;  1YI2 V;  4X1Y A;  2N74 A;  3KZI Z;  3H1J H;  2CGO A;  4DV5 O;  2Y0P A;  1OV9 A;  4ZIB A;  4PA7 A;  1WP8 A;  1EN4 A;  1OCC B;  1QBZ A;  1OCO B;  2G38 A;  3C90 A;  2IBZ H;  1Q6I A;  1THZ A;  2ZDI C;  1FFT B;  1VF5 B;  2Y69 B;  1F51 A;  3S3X A;  4KL1 A;  1Q6H A;  3CC4 V;  3CS5 A;  2XND G;  1WLE A;  1LUV A;  2EIJ B;  4KXR A;  3OAA G;  1HNW B;  3ETD A;  2FL4 A;  5LXT B;  1S3J A;  2JS5 A;  1GRJ A;  3ZRS A;  2YXH A;  3CJH A;  2P5O A;  4R6Z A;  1WA8 A;  4TV9 A;  5KAF Z;  5KMG A;  3OEH G;  4UVB A;  1EFR G;  3S3W A;  2ZM6 O;  3STZ C;  2ZXW C;  2Q5Z A;  1KYO F;  1PNM A;  3OUS A;  3AG3 B;  3P32 A;  5JQG A;  1H2L A;  4I9W A;  3D3I A;  4J42 A;  4QNH B;  2ZDI A;  3MHH C;  2Q0A A;  1IBL O;  4OPA A;  1N0N A;  2H94 A;  4MS2 A;  3RW0 A;  1IXM A;  4B3R B;  1NU1 H;  1P49 A;  4YJ3 B;  3SR2 C;  4ZI7 A;  4LF5 B;  2EIM C;  4WFA V;  4NVP A;  4I0X A;  3LSU A;  1UFI A;  1Z5W A;  4B7K A;  3F5W C;  2YXY A;  2H3O A;  1PD3 A;  5DEC A;  1N32 O;  4FM2 A;  1JFF B;  3D8C A;  4ZHQ B;  2QKS A;  4FFB A;  2OTJ V;  1XQ8 A;  2WLI B;  2X0L A;  1Q6U A;  3UO3 A;  4LF6 B;  3JAL A;  3RYH A;  3CCE V;  5DN6 G;  1NJI W;  4NTW A;  2OWO A;  3FKS G;  1ARO P;  5BY1 A;  2M7W A;  2ZCE A;  4TWK A;  3B40 A;  5CMU A;  3JCU Z;  3ASO C;  4B3T O;  5FLX N;  5H2F Z;  2UUC O;  3TCU A;  5F2V O;  2CH7 A;  4PDL A;  4UV9 A;  4CC5 A;  5J2U A;  1XNR B;  3K08 A;  2ZQM A;  3C3T A;  2WSS G;  4U3J A;  2LP7 A;  1YHQ V;  1FKA O;  3FYI B;  3PJS K;  4TV8 B;  4JI2 B;  1TUB A;  3TGU H;  4DR5 O;  3ZN0 A;  4MVU A;  5CA0 B;  4F6E A;  1CEZ A;  1Q90 D;  5C8Y B;  5LGU A;  1GN6 A;  2ZNJ A;  3TJT A;  4RQE A;  4B3M B;  4X8A A;  2HVK C;  1M9N A;  4JI8 B;  1W2B U;  3ABK C;  5KX5 B;  1KMI Z;  5B3S C;  2IH3 C;  1XRE A;  2RNB A;  1WB8 A;  1JCH A;  3IFX A;  5IYD O;  4O2A A;  1NH2 D;  4JI3 O;  2HP8 A;  4O4J B;  1O9G A;  2E76 B;  4PA6 A;  1I7F A;  4JAU A;  4F6R A;  5B1O A;  4DRX B;  1XOU A;  1BQZ A;  2K9P A;  3H9V A;  5KHI A;  3H1H H;  1Z2G A;  4PD4 F;  2Y48 A;  1UJW B;  2GTA A;  1HWY A;  5EIB C;  4D6T H;  2JGD B;  3CRC A;  1QR9 A;  1V55 B;  1WNS A;  3RBZ A;  2L6L A;  4LCU C;  1XUQ A;  5JVD B;  1OCR C;  3I55 V;  2PI5 A;  4DV7 B;  4HZ3 A;  2LGW A;  2BE3 A;  2IU3 A;  4GKK O;  3D36 C;  1AVM A;  3F7V C;  3H1K H;  1Y74 A; 
#chains in the Genus database with same CATH homology
 5B66 Z;  5TIS Z;  4PJ0 Z;  3A0H Z;  4UB6 Z;  5GTI Z;  1S5L Z;  4IL6 Z;  3JCU Z;  5KAF Z;  3WU2 Z;  5E79 Z;  5H2F Z;  2AXT Z;  5GTH Z;  3KZI Z;  5B5E Z;  4UB8 Z;  5KAI Z;  3A0B Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...