5KAIZ

Nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLNFFVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Electron transport
total genus 21
structure length 62
sequence length 62
chains with identical sequence z
ec nomenclature
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 5kaiZ00
4UB6Z 5H2FZ 3A0BZ 4PJ0Z 4IL6Z 4UB8Z 5KAFZ 5TISZ 5KAIZ 5B5EZ 3A0HZ 5B66Z 2AXTZ 1S5LZ 3JCUZ 5E79Z 5GTHZ 5GTIZ 3WU2Z 3KZIZ
chains in the Genus database with same CATH superfamily
3HKCB 3L71H 1WB7A 3ZHQA 2WWWA 3RYCB 3J7AU 4JAUA 2VQEB 3CRRA 5JVDA 4X20B 3P3NA 4JI8O 1SQVH 1SQQH 3CRQA 4JI4B 1H2SB 2A3QA 5JJJB 1XNRO 4U7NA 1FXHA 3FKSG 4DV4B 2QA4V 1OCCC 3AEIA 1TGOA 2FL4A 2Q7HA 2Q5ZA 3K57A 4R6ZA 1Q82W 3N27A 3BAAA 1AILA 3IFXA 4GX0A 2JS5A 3OMAB 1PV0A 1SC5B 3AK3A 5E79Z 1FFTB 2ZT9B 3CPWU 1JVMA 4I9WA 4GKJB 4IHJB 1K7DA 3T2MA 2UUCO 4CS3A 2ZM6B 1MG1A 4GX1A 4DK0A 2CH7A 2FTKA 3A0BZ 4WFGA 4LF7O 5F2VO 5FNVB 2F43G 3CCJV 2OCCB 3HR0A 4MTXA 3CCQV 1KD1W 1K5QA 4X66O 1M5IA 1DF4A 1GK9A 1K5SA 5GTHZ 2L35A 2JGDB 4U3JA 3CMEV 1G8MA 2KKWA 1XBLA 3SGIA 4DV3O 1AI6A 3JSLA 1TA8A 5CA3A 2YEVA 2OTJV 1EN4A 2DYSC 2Y69B 4XDKA 2ZINA 3AG7A 3B8NA 5EZYA 2ZNJA 3AK1A 4CH6A 3K08A 2QJ1A 1I94B 4PA4A 1K8AW 3CCSV 4NXMO 4LWSA 1GH6A 1I7FA 1THZA 4I0XA 2EBOA 1ORQC 1N32O 4FLVA 4MTFA 4UB8Z 1BHAA 4AQYO 4LFAB 1XILA 4WFFA 5EIBD 1F23A 1V9PA 2PY5A 3OTOB 4BWAA 4ZI7A 4PA9A 1Q81W 2EZOA 5D5QA 1N8RW 3KZIZ 2QDOA 5LHIA 1FFXA 3ABLC 1VQ8V 4QE9A 1GO3F 4YJ2B 3M7MX 3SJCC 4F6RA 1QLEC 3E22A 3ZX6A 2YXYA 3OEHG 4FFBB 3E8HA 1XI1A 1F7YA 4RQFA 1EZVH 1EM1A 2JJ2G 5IY5B 5ITZA 4DK1A 1KECA 4J9ZB 4P9PA 4OX9B 4DR3O 2B1GA 3T1YB 4ICGA 2F23A 3JALA 4LF4O 3JASB 1KQSU 2QE7G 5EYPB 5LBQA 3D36C 1EFRG 4C7UA 1H8EG 4MT8A 5IYZB 1E1RG 2XT9A 2ZDIC 4AI8A 4X8AA 4YHHB 4DR7O 2DYRC 4FM0A 4JI5O 4J42A 3WB0A 2UU9B 3AG3C 4ZOLB 3CB2A 1NTZH 1G6UA 4P9OA 3RYIA 3K59A 1OCZC 2N04A 2NNUA 1JJ2U 2ARHA 4B3MB 3O65A 3FB7C 5B1AB 2ITCC 3CCEV 2YIDA 3UM7A 5CBFA 1FKAO 3R65A 4O2AA 1AJQA 2IJJA 2Q68A 3AK2A 4NTWA 4DW1A 4AHCA 3G67A 2VQEO 1YF2A 1KYOF 1KMIZ 2CUGA 3GWKC 2GTAA 2LGWA 2A7WA 1NZ6A 1X4TA 1SQFA 5LA6B 5IYBO 4JI4O 4I7ZB 2ZE5A 2MW2B 3ETQA 4PA6A 3NR7A 1XREA 4EFBA 3ICXA 4GT1A 1DLBA 5KAIZ 5CBHA 1KBHA 5LHGA 4JI3B 4D7TA 5K1PA 1SETA 2DW4A 1TVKB 2OCHA 3UQ8A 1OHHG 3JAKA 1RSOA 2CK3G 3ZN0A 5JH7A 1N36B 1AR5A 1ROPA 2R9AA 2P6JA 4GKJO 1U97A 4LF5B 2ADPA 2ZM6O 1SQGA 3OGCC 3K0DA 2M7WA 2WLIB 5L3DA 3RFRA 3H01A 1YI2V 5IYDO 1YJWV 2QM7A 2PZSA 4TSFG 1XDCA 5C8YA 4DUZB 2QTSA 3N2KB 1XUQA 4HZ3A 4X62O 2MK3A 2ODMA 2K1EA 1GAXA 4JI2B 4HNAA 5JVDB 1WB8A 3UO2A 4P2ZA 4H37A 3VQXA 2QWQB 3CD6V 4O4LA 2OYQA 1N34B 3RYHA 4BR6A 1JCHA 2QSAA 4DXWA 1NJIW 1ZX3A 1GN6A 1WA8A 4O4JB 4X65B 2F1MA 1I94O 4PA3A 3HKBB 4YJ3B 4D7SA 1K4DC 1W59A 1ZL8A 4JGSA 5B66Z 5L3GA 3LSQA 2UXNA 4LF6B 4I4TB 5CBGA 4LFAO 2OCCC 2Q7EA 1TUEB 3ABUA 3OTOO 5JCOA 1VQ4V 1VQNV 1Q3EA 2QTOA 1YHQV 4JZGA 2DJVA 5KMGB 1VIBA 2Q4PA 1Z5VA 5GONA 1Q43A 1JQ0A 1U96A 3NXSA 4I5SA 4QNHB 2YIBD 3U10A 2Y69C 1GN2A 3K79A 4O4HA 2X7RB 1URFA 5LP6A 3ZHVA 5KX5B 4LNUB 1VQLV 5LOVA 3ZRWA 1UPGA 5EC2C 1VEWA 4RUEA 2HHHB 4UVAA 1MZFA 4OX9O 4R7CA 4O4IA 3JARA 3T1YO 1NKDA 2F66C 4X9QA 4H33A 3DXRB 3K5MA 2E75B 3E89A 2EIJB 2XAHA 2IBZH 2B9ZA 4DR5B 1DGSA 5EZYB 1QU7A 4CC6A 1LR1A 4YHHO 3CC4V 1WPXA 2BOBC 1FXVA 4JYBA 4DR6B 2UU9O 1PNMA 1XMQB 1YDXA 4Z2WA 2Y0IA 3BHPA 5CA1A 1Y76B 4J7ZA 4B3MO 4CC5A 3CCLV 3SYQA 4CH5A 5IE9A 2N74A 1IZ3A 4TQFA 1MABG 2WLLB 3FYIB 2X6BA 3H1LH 3ZHSA 1FS0G 5IY5C 1IBKB 1MSWD 3MAQA 4MVUA 1QNMA 3L73H 3LNMB 4JI6B 4K35A 2P7TC 4A5UB 1QR9A 3F7YC 1AJPA 2CTWA 3L70H 2ILMA 2EX3A 2NR5A 4RQEA 3OT7A 1QLNA 3QVNA 4GX5A 2UUBB 5KUKA 3UKMA 1XNQB 2QWNB 4FLXA 3JCUZ 2VRZA 4K3AA 2OIEA 1ZSPA 3QO5A 3QTCA 1M1KW 4JI3O 5B1AC 1B06A 3VBBA 4EEQA 1PL4A 5KA6A 2LQTA 3AG1B 3AG2B 3VQYA 1PNLA 2Q9LA 3KKYA 4E2LA 3DGEA 1M9NA 1N36O 3FB6C 3K5LA 1HNXB 1GRJA 2GUZB 4LF5O 3T4DA 2FKXA 1NBMG 3OE7G 4NR1A 3ABMB 2R70A 4LH6A 1VQ9V 5LYJA 4K0KB 1VF6A 4J9YB 2AHZA 4MVQA 1EBOA 4DUZO 4Q6GA 1HWYA 1VF5B 3M99B 3B40A 4JV5B 4JI2O 4FVMA 2LFRA 3JYCA 4UFZA 1R6KA 1R3JC 3SPCA 1NH2D 3S3WA 2P4VA 4JTAB 1N34O 3CSXA 4FIPC 4DYLA 1P4RA 2O57A 4LF8B 3RN4A 2OT5A 2BTQA 5JWPA 2RNBA 3GWOA 4ZBMA 4X1YB 2GSMB 1SA0B 2HJDA 4PI2A 2PI5A 4EFEA 4LF6O 1JOYA 4LF9B 5L3EA 4UXNA 2W6JG 5AG2A 2E5LB 5CB4B 3Q4HA 1WP8A 1VMGA 4LR3A 4L87A 2ZXWB 3CJHA 2KQXA 3HKEA 1GMGA 2ZCEA 1RFYA 3L72H 2ZE7A 1MA1A 2GTSA 4DV7B 1FJGB 2YI9A 3B77A 1Y67A 3MDSA 1JA8A 3SYPA 4DRXB 3HB3B 4Z1VA 5J2TA 4OXSA 3RW0A 3H1HH 1Y74B 3HKDA 1S5HC 2EJ7A 2HHHO 3ZMVA 2ZIMA 2L6LA 5IJ9B 3TETA 3B8MA 4W4KA 1SF9A 3OMIB 3BA9A 3TJTA 4DR1B 5LGTA 2A0LA 4NTYA 4DR5O 2NN4A 1NH2B 2ZKOA 3QG5A 5FPOA 1ZLZA 2P5OA 4MVRA 4UV8A 3K3WA 5L3FA 4TV9B 4DR6O 3TCUA 1YTFD 1NVPD 1Y4MA 4X62B 3JAWA 1XMQO 3JD3A 1UJWB 4GKKB 3CCUV 2P67A 3ETGA 2ZE8A 4PV1B 2GDSA 2WLKA 1SKVA 4YIPA 2GBOA 3K5OA 5J2UA 1WN7A 1IBKO 2EINB 1I5XA 1TUBA 1Q6IA 3WU2Z 1JFFA 4UVCA 4FJCC 4PDVA 5B1BB 3CC2V 2Q67A 4JI6O 3SPHA 4AILC 4GCZA 3DC6A 4X1KB 2EIJC 4K8ZA 2IJKA 2OTLV 1HNWO 5LOVB 1FPOA 2AXTZ 1QVGU 3ZRVA 4NXNB 1H2MA 5K1XA 4PELA 4PDLA 5CMUA 5BR8B 2UXBB 1N33B 1BSMA 4TUYA 3I56V 2UUBO 1XNQO 2Z0AA 4LP8A 3TK1A 3KCYA 4MS2A 3SR2C 2Q73A 1PNKA 1QCEA 5KAFZ 1B3QA 3OM3B 4PDMA 4J10A 4IIJB 2XTAA 1AR4A 2LW7A 3G80A 4ZHQA 2XAGA 4X1IA 1HNXO 1YVWA 1MNGA 1M93A 2ZNIA 3CRCA 4G27B 1P49A 2CDYA 3FAVA 1WJZA 2UXDB 3B4SA 1KU9A 1YTFB 4JYAO 1NVPB 4KP4A 5B5EZ 4JASA 4O2BB 3D36A 4K0KO 1I5YA 3OGIB 3QO7A 2ZDIA 4GUNA 1Z5WA 3E8GA 4TV8A 1XL6A 2NLJC 1AVMA 1AP5A 1S72V 2XAQA 1Z2GA 3JD1A 2AHYA 4UCRA 1J5EB 4I9QA 4JV5O 1LNQA 3UT5B 1IURA 4WFBV 4MW8A 4UVBA 1O9GA 4YY3B 5DN6G 2B5UA 3IAYA 4EB6B 1VQPV 3AG2C 3AG1C 3ZCCA 4KFMA 4QJFB 1LUVA 5KLVH 3N2GA 4LF8O 2JGUA 2R72A 4FMTA 4JYYA 1AI4A 1CP9A 3RYFB 3LDCA 1RP3B 1EN5A 4FM1A 1K33A 2VS0A 4LF9O 3ABMC 3SYCA 4B3RB 2VQFB 2KG7A 5J9PC 1R73A 3F5TA 5GTIZ 2E5LO 1NTKH 2IU3A 5HFMA 1M90W 5H9CA 2A9HA 4FK5C 3MHSC 1BE3H 5LL6Y 3ML0A 5BZBA 5CA0A 1NS1A 2Q69A 2BCCH 4WBNB 2DN9A 5HFLA 5H6RA 4DV7O 1YCIA 3W7WA 5TISZ 1FJGO 2QWOB 1H2LA 4B3SB 1P7GA 5IT9N 2OIGA 1KP3A 4MSWC 3RVYA 4PDRA 4J7KA 1W0KG 1IBLB 1BT8A 1NQTA 1DF5A 1VP7A 2QWPB 1RPRA 2R9IA 1BL8A 1VQ6V 3FYEB 4NYKA 3QF7A 2WLMA 4F6EA 3K0GA 3EXAA 4DW0A 2EILB 3JATA 4R50A 3HKCA 2YUAA 3C90A 3RYCA 4DR1O 1XMOB 1QVFU 4RWUA 5BMVB 4KHPO 2JEXA 1XHXA 4X20A 1VQMV 2EZPA 4J41A 3CMAV 3SPIA 3IC9A 2ZXWC 3K9SA 2V1DA 1KP2A 4JAAA 4GKKO 3OD4A 2XAJA 3OR7C 3PN1A 2ITDC 1QQCA 2BE3A 4QGPA 1NI8A 1V55B 2AZ2A 2G38A 5LMNO 5IJ0A 2WSSG 1BHBA 1J95A 1Q8IA 3ZMUA 3ZMTA 2CTPA 4KUMA 1H2GA 1Q5OA 3WG7B 2WA4A 4IHJA 4GYCB 1JJOA 5IDJA 2PUSA 4CS4A 3CWBH 2DMXA 3OUFA 1COWG 5FNVA 3SJAC 2QM8A 2M6YA 3CS5A 3G6BA 4KXRA 1YIJV 4NXNO 2IH1C 3HKDB 5EK0A 4PJ0Z 3ETEA 3M8AA 5BR8O 1W2BU 2UXBO 1N33O 4IL6Z 2JDIG 2JGDA 3RGBA 1SQXH 2FMLA 1NR1A 4GZRB 3EVKA 3SPGA 2CH7B 5EBWC 5BXZA 3APOA 4P30A 4IT5A 1WAZA 3T1CA 3CCMV 2EIMB 1PL0A 1S0VA 2Q6AA 2GV9A 3ASNB 3P30A 3WB1A 4U3JB 2EINC 4UCVA 2V7QG 3VQWA 3SJBC 5B1BC 3CC7V 2RN9A 3K03A 2XOKG 1AI7A 2XAFA 2UXDO 3BRCA 2YEVB 3ASOB 3PJSK 4DV2B 1P7BA 2Q0AA 1SQBH 3P3PA 4G28B 5A2QN 4LCUC 4R8CA 3H1IH 1JMKC 4JI1B 3UCSC 2YIAA 3FD9A 1UFIA 2HFEC 5A9GA 2HJFC 3SDLA 4FZ1A 1JPXA 4RAIA 1AJNA 3CXHF 1XEQA 3ZBHA 3DSQA 4LWSB 1J5EO 4I0XB 2DWEC 4YJ2A 4FPPA 1YJ9V 3R66A 4JZ2A 1FXKA 1Q6UA 1QR8A 3ZHTA 1M56B 4YY3O 3OUSA 4FFBA 4ZI7B 4H44B 3W7TA 3E83A 3JSNA 3FB8C 2ADQB 1SRYA 1LUWA 2ETNA 1T5EA 1FFXB 5KUMA 2YC0A 2CTRA 4MTOA 3OAAG 3CEIA 3FFQA 2LFSA 1YXBA 3W7SA 3JAMN 1VQKV 1BQZA 4F6RB 4HAMA 3E22B 3K04A 4IYHA 1WLEA 5EYPA 1K3EA 5C93A 4B3RO 1K4CC 2VQFO 3P32A 2RJZA 1HNWB 1XOUA 3DC5A 1Y66A 4X1IB 3BABA 5ITZB 5IYZA 3FAVB 4NTXA 4QPKA 4ZOLA 3JALB 3APQA 4B3SO 1F4MA 3OTFA 2KSDA 4LFCB 2A79B 4B08A 1M57B 4TQDA 4TWKA 3STLC 2YSUB 5B1NA 4UCOA 3K06A 2X6AA 1IX9A 1IBLO 4UCTA 1Q7YW 1OCRB 4Z1MG 2N05A 3JD4A 2FYUH 4PD4F 2LGQA 2XHBA 3AG3B 5EIBC 2IU0A 4CZZA 1FYJA 3F7VC 3ABKB 3RYIB 2UUAB 1K34A 3OEEG 1B6QA 4CH3A 4OGQB 4JYAB 1XMOO 5EC1C 1D2DA 4MVSA 1VF7A 1K9MW 1HW7A 3L75H 4YXWG 1PP9H 2EJRA 4O2AB 3QO8A 3E2EA 3A2FA 5L3CA 3W7XA 4FZ0A 5LA6A 2CE4A 1VARA 3I55V 3CCVV 1IXBA 2YICA 3QNEA 4FM2A 3BCCH 3VOUA 2E74B 4I50A 4UB6Z 4B7EA 1VQ7V 2YS8A 4K8XA 5H6QA 4GLXA 3WFVA 2BSKA 5CA0B 4N23A 2DE0X 2E3CA 4LH7A 4DR4B 1KKCA 3BA8A 2PF4E 1NR7A 2EILC 1OJHA 3T1HO 1YEWA 3A0RA 4I55A 1MZEA 2WLIA 2ZD9A 4CBCA 1DTOA 3JAKB 5H5NA 2CGOA 2CTQA 5FL7G 3ZMZA 2FB5A 1M4UA 4CH4A 1RSOB 2IJIA 1AI5A 2W0FC 5JH7B 2KB1A 3BY6A 4J7JA 1R3LC 2Y4TA 2QR4A 3BFRA 3JATB 1BS3A 1G1XB 3N2KA 3ZIAG 2B1IA 3STZC 2D2CB 4X64B 5IWAB 1BZKA 1V55C 2WLHA 3CX5F 1WNSA 2HLDG 2Q7GA 2ZR2A 5C8YB 4O4JA 2F4VB 1EZJA 1PM9A 4DV6B 4E4EA 1H38A 4JI0B 1S77D 2X6CA 1QHTA 1N4CA 3WG7C 5GW7A 4HNAB 5KHIA 3HKBA 4YJ3A 3E35A 5B3SB 4O4LB 4DV2O 1AROP 3RYHB 1H2NA 5IJ0B 4I4TA 3CP1A 4JI1O 4ZKIA 4FLUA 4KHPB 3A0HZ 4XDLA 1WA8B 2V4DA 3SPJA 2DQ0A 1X59A 1O9HA 1YITV 4NB5A 3S3XA 4DR2B 1ZL8B 5KMGA 4LFBB 3LUTB 2ZE6A 3ETDA 2AGAA 4EKWA 1F51A 4H13B 3BVOA 2EIMC 3K58A 3GVMA 4MVZA 1I0HA 1D5NA 4BIUA 2YXHA 3ASNC 5LMNB 3ZS8C 5KX5A 3K9AA 4LNUA 3JD0A 3KCXA 5KHHA 4PHZA 4QIWF 1CEZA 5GONB 1YZBA 3ASOC 2HR3A 3DXRA 4O4HB 3E8BA 3E86A 5LP6B 1K73W 4MW3A 3ZRWB 5LMUB 2QKAA 4DV5B 2RCVA 1R1BA 1KKDA 1GM8A 4PI0A 1GTOA 3CE2A 3OFNG 4O4IB 3JARB 4UUJC 3C3SA 3K5NA 1H2KA 4ZIBA 1GN3A 2Y48A 3H1KH 1OCOB 3L74H 4WF9V 3VQVA 4H0LB 1GM9A 3ZHRA 1Y76A 1GM7A 2WPDG 4LFCO 2Q0OC 1M56C 1V54B 2P06A 2RQ6A 2UXXA 2JS3A 3ZN1A 3X2QB 4B3TB 2WLLA 4UV9A 1Y6XA 5LXTA 5LGUA 4BIZA 4TOIA 2EULA 3ZJZA 2UUAO 2AZ0A 5CA1B 2C2AA 2H3OA 2H94A 2UXCB 4J11A 1FXKB 1NT2B 2F93B 4ABMA 4X88A 3SJQC 4JYCA 4F4LA 1E79G 2P90A 1P84F 4DV1B 2F95B 2Y4UA 2YIBA 1S76D 3W7UA 2PYJA 3OMNB 3ZRXA 1PKXA 4WFHA 1CXZB 1SZXA 2A06H 5JQGA 1S5LZ 2WAMA 1M57C 1BGYH 3RBZA 4BAYA 1PPJH 2CGNA 1N0NA 1OCRC 1FAFA 5B1OA 5D5PA 4XDJA 3ABKC 4DR4O 2GUZA 2JIZG 1S3JA 2YDEA 2ZQMA 3MHHC 1IBMB 1WPBA 3AG4B 1MSDA 2HKOA 1RM1B 1HDJA 2XUMA 4X89A 3G6EV 3LSSA 1US6A 3J80N 3WB2A 4QPJA 3CHXA 2JEUA 3D3IA 1HR0B 4JPRA 2W6IG 2Y0PA 4X64O 5IWAO 2ATKC 2QKSA 2VWKA 5LYJB 3ZRSA 4DV0B 4OPAA 3LNNA 1HNZB 3EFFK 5JJEB 4LC1A 3L9DA 2F4VO 4FFKA 4ASUG 4HYOA 2P22C 4DV6O 1CPYA 4JI0O 1EN6A 4DV4O 3OW2U 4I50B 1XHZA 2Q8VA 4X1YA 4L8JA 3O9OA 1SA0A 5CN0A 3RWRD 1HP8A 2EIKB 2BSKB 4WCEV 5E1AC 4UCSA 4U7OA 2Z3YA 5CB4A 1VQ5V 1FD9A 2IJHA 2Z5UA 3TGUH 2BTQB 1L1FA 3ZEDA 4DR2O 2P4KA 2DOSA 4LFBO 5FPRA 4I55B 2JVDA 1L0NH 3H9VA 3IC7A 1BMFG 4JI7B 1SS3A 3MD0A 1ZUQA 4UCUA 5DECA 1JR9A 3Q4HB 4NVPA 4DO2A 2BOCC 2IH3C 4N21A 1KC8W 4DUYB 4DRXA 1GKFA 1NU1H 3FB5C 3CJHB 4MVOA 2PI4A 3HKEB 3JD2A 2LW1A 3D3QA 4WFAV 1OZ0A 2QGNA 1Y74A 2CAZC 3TXQA 2QKCA 1R6TA 1OCCB 4NKGB 2DQ3A 3T1HB 2K9PA 1JX9A 1QBZA 5B3SC 5IJ9A 1RPOA 1R3KC 1E1QG 2AW9A 1A32A 5LMUO 5KHJA 5J2TB 4DV5O 3U0ZA 2RDCA 1L8DA 2BTOA 2WLNA 1H8HG 2LJ2A 4TV9A 3EHBB 4Q20A 1OV9A 1Q86W 3GB7C 5JCOC 2XNDG 2HG5C 4JI8B 2WLJA 5IYCO 4B3TO 1XNRB 3C3TA 3UO3A 3G4SV 1D5AA 1SERA 4XBFA 4G2KA 1ZWIC 3LDEA 3JAWB 2QWRB 1ZTEA 4LBEC 3RT3C 2UXCO 1G4YB 1NTMH 2DYSB 4X1KA 3THOA 4MVMA 5LP6C 3DTUB 1MMMA 5J2UB 2H8PC 4DV1O 1YJNV 1TUBB 1R6NA 1JFFB 2VWJA 4RO2A 1AP6A 3JCZA 3LSUA 4KL1A 2UUCB 2PGGA 3FX7A 1OCOC 3KG2A 4HBNA 2E76B 2DWDC 5EBLC 2W0XA 5BY1A 4LF7B 3HPLC 4RUFA 3J81N 3SYOA 1V54C 4CS2A 4B7KA 4TT3G 3IGAC 4X66B 3X2QC 4IIJA 1KUQA 2OWOA 2IW5A 4TUYB 5FLXN 1F4NA 3ABLB 5KA5A 1XL4A 4DV3B 4J80A 1IBMO 1N0JA 5LHHA 1SZTA 3CXCU 2HEPA 1KB9F 1FXKC 1QLEB 5EBMC 1IXMA 4FLTA 3JASA 4BW9A 5DEDA 2LP7A 4O2BA 2JJ1G 5LXTB 1SQPH 1K97A 3RVZA 3CYOA 1BCCH 4ZHQB 1MOFA 1IVSA 2R9RB 4U3FH 3BPZA 1TAEA 4YIOA 3D8CA 4NXMB 2XASA 4QE7A 1ENVA 2X0LA 1HR0O 3ABTA 1N32B 3SYAA 3UT5A 4AQYB 4DV0O 1Q6HA 4FLYA 4JAVA 1HNZO 1Q90D 5L3BA 4EB6A 1PD3A 4IGGA 4TV8B 2DYRB 1B04A 1YSCA 3H1JH 5JQGB 1WP7A 3RYFA 1OCZB 2YI8A 1L0LH 4BIOA 3AG4C 2HVKC 4BW5A 4JTCB 1RM1C 3U11A 1W0JG 1R3IC 2LO1A 3OR6C 2WA3A 3CCRV 4IYIA 1GN4A 4W4LA 2ZIOA 5JJNB 3BEHA 2QM4A 4OPHA 3N2GB 3TXSA 3IJ4A 3LDDA 2YXLA 2HP8A 3B2EE 4MTGA 3ZHUA 4DR3B 4WBNA 2PYLA 3T4ZA 4FLWA 4LF4B 2ZR3A 1BQ0A 4JTDB 4PA7A 4JI7O 5H2FZ 4D6TH 2KG7B 3I5DA 3ZMSA 1AR1B 1XQ8A 1VQOV 2PTMA 1VF6C 4FLZA 1TVKA 1K92A 2JK5C 4DUYO 4DR7B 3B09A 2JRIA 4JI5B 4GX2A 1SESA 2GHYA 3F5WC 2RMKB 1IDSA 3A8TA 1DK1A 5KHKA 1S5JA 1AB3A 5DM6V 3E8FA 5KHGA 4WFEA 2EIKC 2HVJC 3G71V 3CRMA 4JF3A 5BMVA 2IM9A 4X65O 2QEXV 1I08A 3CRAA 1ZAUA 5LGNA 2D3OW
chains in the Genus database with same CATH topology
4UB6Z 5H2FZ 3A0BZ 4PJ0Z 4IL6Z 4UB8Z 5KAFZ 5TISZ 5KAIZ 5B5EZ 3A0HZ 5B66Z 2AXTZ 1S5LZ 3JCUZ 5E79Z 5GTHZ 5GTIZ 3WU2Z 3KZIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UB6 Z;  5H2F Z;  3A0B Z;  4PJ0 Z;  4IL6 Z;  4UB8 Z;  5KAF Z;  5TIS Z;  5KAI Z;  5B5E Z;  3A0H Z;  5B66 Z;  2AXT Z;  1S5L Z;  3JCU Z;  5E79 Z;  5GTH Z;  5GTI Z;  3WU2 Z;  3KZI Z; 
#chains in the Genus database with same CATH topology
 3HKC B;  3L71 H;  1WB7 A;  3ZHQ A;  2WWW A;  3RYC B;  3J7A U;  4JAU A;  2VQE B;  3CRR A;  5JVD A;  4X20 B;  3P3N A;  4JI8 O;  1SQV H;  1SQQ H;  3CRQ A;  4JI4 B;  1H2S B;  2A3Q A;  5JJJ B;  1XNR O;  4U7N A;  1FXH A;  3FKS G;  4DV4 B;  2QA4 V;  1OCC C;  3AEI A;  1TGO A;  2FL4 A;  2Q7H A;  2Q5Z A;  3K57 A;  4R6Z A;  1Q82 W;  3N27 A;  3BAA A;  1AIL A;  3IFX A;  4GX0 A;  2JS5 A;  3OMA B;  1PV0 A;  1SC5 B;  3AK3 A;  5E79 Z;  1FFT B;  2ZT9 B;  3CPW U;  1JVM A;  4I9W A;  4GKJ B;  4IHJ B;  1K7D A;  3T2M A;  2UUC O;  4CS3 A;  2ZM6 B;  1MG1 A;  4GX1 A;  4DK0 A;  2CH7 A;  2FTK A;  3A0B Z;  4WFG A;  4LF7 O;  5F2V O;  5FNV B;  2F43 G;  3CCJ V;  2OCC B;  3HR0 A;  4MTX A;  3CCQ V;  1KD1 W;  1K5Q A;  4X66 O;  1M5I A;  1DF4 A;  1GK9 A;  1K5S A;  5GTH Z;  2L35 A;  2JGD B;  4U3J A;  3CME V;  1G8M A;  2KKW A;  1XBL A;  3SGI A;  4DV3 O;  1AI6 A;  3JSL A;  1TA8 A;  5CA3 A;  2YEV A;  2OTJ V;  1EN4 A;  2DYS C;  2Y69 B;  4XDK A;  2ZIN A;  3AG7 A;  3B8N A;  5EZY A;  2ZNJ A;  3AK1 A;  4CH6 A;  3K08 A;  2QJ1 A;  1I94 B;  4PA4 A;  1K8A W;  3CCS V;  4NXM O;  4LWS A;  1GH6 A;  1I7F A;  1THZ A;  4I0X A;  2EBO A;  1ORQ C;  1N32 O;  4FLV A;  4MTF A;  4UB8 Z;  1BHA A;  4AQY O;  4LFA B;  1XIL A;  4WFF A;  5EIB D;  1F23 A;  1V9P A;  2PY5 A;  3OTO B;  4BWA A;  4ZI7 A;  4PA9 A;  1Q81 W;  2EZO A;  5D5Q A;  1N8R W;  3KZI Z;  2QDO A;  5LHI A;  1FFX A;  3ABL C;  1VQ8 V;  4QE9 A;  1GO3 F;  4YJ2 B;  3M7M X;  3SJC C;  4F6R A;  1QLE C;  3E22 A;  3ZX6 A;  2YXY A;  3OEH G;  4FFB B;  3E8H A;  1XI1 A;  1F7Y A;  4RQF A;  1EZV H;  1EM1 A;  2JJ2 G;  5IY5 B;  5ITZ A;  4DK1 A;  1KEC A;  4J9Z B;  4P9P A;  4OX9 B;  4DR3 O;  2B1G A;  3T1Y B;  4ICG A;  2F23 A;  3JAL A;  4LF4 O;  3JAS B;  1KQS U;  2QE7 G;  5EYP B;  5LBQ A;  3D36 C;  1EFR G;  4C7U A;  1H8E G;  4MT8 A;  5IYZ B;  1E1R G;  2XT9 A;  2ZDI C;  4AI8 A;  4X8A A;  4YHH B;  4DR7 O;  2DYR C;  4FM0 A;  4JI5 O;  4J42 A;  3WB0 A;  2UU9 B;  3AG3 C;  4ZOL B;  3CB2 A;  1NTZ H;  1G6U A;  4P9O A;  3RYI A;  3K59 A;  1OCZ C;  2N04 A;  2NNU A;  1JJ2 U;  2ARH A;  4B3M B;  3O65 A;  3FB7 C;  5B1A B;  2ITC C;  3CCE V;  2YID A;  3UM7 A;  5CBF A;  1FKA O;  3R65 A;  4O2A A;  1AJQ A;  2IJJ A;  2Q68 A;  3AK2 A;  4NTW A;  4DW1 A;  4AHC A;  3G67 A;  2VQE O;  1YF2 A;  1KYO F;  1KMI Z;  2CUG A;  3GWK C;  2GTA A;  2LGW A;  2A7W A;  1NZ6 A;  1X4T A;  1SQF A;  5LA6 B;  5IYB O;  4JI4 O;  4I7Z B;  2ZE5 A;  2MW2 B;  3ETQ A;  4PA6 A;  3NR7 A;  1XRE A;  4EFB A;  3ICX A;  4GT1 A;  1DLB A;  5KAI Z;  5CBH A;  1KBH A;  5LHG A;  4JI3 B;  4D7T A;  5K1P A;  1SET A;  2DW4 A;  1TVK B;  2OCH A;  3UQ8 A;  1OHH G;  3JAK A;  1RSO A;  2CK3 G;  3ZN0 A;  5JH7 A;  1N36 B;  1AR5 A;  1ROP A;  2R9A A;  2P6J A;  4GKJ O;  1U97 A;  4LF5 B;  2ADP A;  2ZM6 O;  1SQG A;  3OGC C;  3K0D A;  2M7W A;  2WLI B;  5L3D A;  3RFR A;  3H01 A;  1YI2 V;  5IYD O;  1YJW V;  2QM7 A;  2PZS A;  4TSF G;  1XDC A;  5C8Y A;  4DUZ B;  2QTS A;  3N2K B;  1XUQ A;  4HZ3 A;  4X62 O;  2MK3 A;  2ODM A;  2K1E A;  1GAX A;  4JI2 B;  4HNA A;  5JVD B;  1WB8 A;  3UO2 A;  4P2Z A;  4H37 A;  3VQX A;  2QWQ B;  3CD6 V;  4O4L A;  2OYQ A;  1N34 B;  3RYH A;  4BR6 A;  1JCH A;  2QSA A;  4DXW A;  1NJI W;  1ZX3 A;  1GN6 A;  1WA8 A;  4O4J B;  4X65 B;  2F1M A;  1I94 O;  4PA3 A;  3HKB B;  4YJ3 B;  4D7S A;  1K4D C;  1W59 A;  1ZL8 A;  4JGS A;  5B66 Z;  5L3G A;  3LSQ A;  2UXN A;  4LF6 B;  4I4T B;  5CBG A;  4LFA O;  2OCC C;  2Q7E A;  1TUE B;  3ABU A;  3OTO O;  5JCO A;  1VQ4 V;  1VQN V;  1Q3E A;  2QTO A;  1YHQ V;  4JZG A;  2DJV A;  5KMG B;  1VIB A;  2Q4P A;  1Z5V A;  5GON A;  1Q43 A;  1JQ0 A;  1U96 A;  3NXS A;  4I5S A;  4QNH B;  2YIB D;  3U10 A;  2Y69 C;  1GN2 A;  3K79 A;  4O4H A;  2X7R B;  1URF A;  5LP6 A;  3ZHV A;  5KX5 B;  4LNU B;  1VQL V;  5LOV A;  3ZRW A;  1UPG A;  5EC2 C;  1VEW A;  4RUE A;  2HHH B;  4UVA A;  1MZF A;  4OX9 O;  4R7C A;  4O4I A;  3JAR A;  3T1Y O;  1NKD A;  2F66 C;  4X9Q A;  4H33 A;  3DXR B;  3K5M A;  2E75 B;  3E89 A;  2EIJ B;  2XAH A;  2IBZ H;  2B9Z A;  4DR5 B;  1DGS A;  5EZY B;  1QU7 A;  4CC6 A;  1LR1 A;  4YHH O;  3CC4 V;  1WPX A;  2BOB C;  1FXV A;  4JYB A;  4DR6 B;  2UU9 O;  1PNM A;  1XMQ B;  1YDX A;  4Z2W A;  2Y0I A;  3BHP A;  5CA1 A;  1Y76 B;  4J7Z A;  4B3M O;  4CC5 A;  3CCL V;  3SYQ A;  4CH5 A;  5IE9 A;  2N74 A;  1IZ3 A;  4TQF A;  1MAB G;  2WLL B;  3FYI B;  2X6B A;  3H1L H;  3ZHS A;  1FS0 G;  5IY5 C;  1IBK B;  1MSW D;  3MAQ A;  4MVU A;  1QNM A;  3L73 H;  3LNM B;  4JI6 B;  4K35 A;  2P7T C;  4A5U B;  1QR9 A;  3F7Y C;  1AJP A;  2CTW A;  3L70 H;  2ILM A;  2EX3 A;  2NR5 A;  4RQE A;  3OT7 A;  1QLN A;  3QVN A;  4GX5 A;  2UUB B;  5KUK A;  3UKM A;  1XNQ B;  2QWN B;  4FLX A;  3JCU Z;  2VRZ A;  4K3A A;  2OIE A;  1ZSP A;  3QO5 A;  3QTC A;  1M1K W;  4JI3 O;  5B1A C;  1B06 A;  3VBB A;  4EEQ A;  1PL4 A;  5KA6 A;  2LQT A;  3AG1 B;  3AG2 B;  3VQY A;  1PNL A;  2Q9L A;  3KKY A;  4E2L A;  3DGE A;  1M9N A;  1N36 O;  3FB6 C;  3K5L A;  1HNX B;  1GRJ A;  2GUZ B;  4LF5 O;  3T4D A;  2FKX A;  1NBM G;  3OE7 G;  4NR1 A;  3ABM B;  2R70 A;  4LH6 A;  1VQ9 V;  5LYJ A;  4K0K B;  1VF6 A;  4J9Y B;  2AHZ A;  4MVQ A;  1EBO A;  4DUZ O;  4Q6G A;  1HWY A;  1VF5 B;  3M99 B;  3B40 A;  4JV5 B;  4JI2 O;  4FVM A;  2LFR A;  3JYC A;  4UFZ A;  1R6K A;  1R3J C;  3SPC A;  1NH2 D;  3S3W A;  2P4V A;  4JTA B;  1N34 O;  3CSX A;  4FIP C;  4DYL A;  1P4R A;  2O57 A;  4LF8 B;  3RN4 A;  2OT5 A;  2BTQ A;  5JWP A;  2RNB A;  3GWO A;  4ZBM A;  4X1Y B;  2GSM B;  1SA0 B;  2HJD A;  4PI2 A;  2PI5 A;  4EFE A;  4LF6 O;  1JOY A;  4LF9 B;  5L3E A;  4UXN A;  2W6J G;  5AG2 A;  2E5L B;  5CB4 B;  3Q4H A;  1WP8 A;  1VMG A;  4LR3 A;  4L87 A;  2ZXW B;  3CJH A;  2KQX A;  3HKE A;  1GMG A;  2ZCE A;  1RFY A;  3L72 H;  2ZE7 A;  1MA1 A;  2GTS A;  4DV7 B;  1FJG B;  2YI9 A;  3B77 A;  1Y67 A;  3MDS A;  1JA8 A;  3SYP A;  4DRX B;  3HB3 B;  4Z1V A;  5J2T A;  4OXS A;  3RW0 A;  3H1H H;  1Y74 B;  3HKD A;  1S5H C;  2EJ7 A;  2HHH O;  3ZMV A;  2ZIM A;  2L6L A;  5IJ9 B;  3TET A;  3B8M A;  4W4K A;  1SF9 A;  3OMI B;  3BA9 A;  3TJT A;  4DR1 B;  5LGT A;  2A0L A;  4NTY A;  4DR5 O;  2NN4 A;  1NH2 B;  2ZKO A;  3QG5 A;  5FPO A;  1ZLZ A;  2P5O A;  4MVR A;  4UV8 A;  3K3W A;  5L3F A;  4TV9 B;  4DR6 O;  3TCU A;  1YTF D;  1NVP D;  1Y4M A;  4X62 B;  3JAW A;  1XMQ O;  3JD3 A;  1UJW B;  4GKK B;  3CCU V;  2P67 A;  3ETG A;  2ZE8 A;  4PV1 B;  2GDS A;  2WLK A;  1SKV A;  4YIP A;  2GBO A;  3K5O A;  5J2U A;  1WN7 A;  1IBK O;  2EIN B;  1I5X A;  1TUB A;  1Q6I A;  3WU2 Z;  1JFF A;  4UVC A;  4FJC C;  4PDV A;  5B1B B;  3CC2 V;  2Q67 A;  4JI6 O;  3SPH A;  4AIL C;  4GCZ A;  3DC6 A;  4X1K B;  2EIJ C;  4K8Z A;  2IJK A;  2OTL V;  1HNW O;  5LOV B;  1FPO A;  2AXT Z;  1QVG U;  3ZRV A;  4NXN B;  1H2M A;  5K1X A;  4PEL A;  4PDL A;  5CMU A;  5BR8 B;  2UXB B;  1N33 B;  1BSM A;  4TUY A;  3I56 V;  2UUB O;  1XNQ O;  2Z0A A;  4LP8 A;  3TK1 A;  3KCY A;  4MS2 A;  3SR2 C;  2Q73 A;  1PNK A;  1QCE A;  5KAF Z;  1B3Q A;  3OM3 B;  4PDM A;  4J10 A;  4IIJ B;  2XTA A;  1AR4 A;  2LW7 A;  3G80 A;  4ZHQ A;  2XAG A;  4X1I A;  1HNX O;  1YVW A;  1MNG A;  1M93 A;  2ZNI A;  3CRC A;  4G27 B;  1P49 A;  2CDY A;  3FAV A;  1WJZ A;  2UXD B;  3B4S A;  1KU9 A;  1YTF B;  4JYA O;  1NVP B;  4KP4 A;  5B5E Z;  4JAS A;  4O2B B;  3D36 A;  4K0K O;  1I5Y A;  3OGI B;  3QO7 A;  2ZDI A;  4GUN A;  1Z5W A;  3E8G A;  4TV8 A;  1XL6 A;  2NLJ C;  1AVM A;  1AP5 A;  1S72 V;  2XAQ A;  1Z2G A;  3JD1 A;  2AHY A;  4UCR A;  1J5E B;  4I9Q A;  4JV5 O;  1LNQ A;  3UT5 B;  1IUR A;  4WFB V;  4MW8 A;  4UVB A;  1O9G A;  4YY3 B;  5DN6 G;  2B5U A;  3IAY A;  4EB6 B;  1VQP V;  3AG2 C;  3AG1 C;  3ZCC A;  4KFM A;  4QJF B;  1LUV A;  5KLV H;  3N2G A;  4LF8 O;  2JGU A;  2R72 A;  4FMT A;  4JYY A;  1AI4 A;  1CP9 A;  3RYF B;  3LDC A;  1RP3 B;  1EN5 A;  4FM1 A;  1K33 A;  2VS0 A;  4LF9 O;  3ABM C;  3SYC A;  4B3R B;  2VQF B;  2KG7 A;  5J9P C;  1R73 A;  3F5T A;  5GTI Z;  2E5L O;  1NTK H;  2IU3 A;  5HFM A;  1M90 W;  5H9C A;  2A9H A;  4FK5 C;  3MHS C;  1BE3 H;  5LL6 Y;  3ML0 A;  5BZB A;  5CA0 A;  1NS1 A;  2Q69 A;  2BCC H;  4WBN B;  2DN9 A;  5HFL A;  5H6R A;  4DV7 O;  1YCI A;  3W7W A;  5TIS Z;  1FJG O;  2QWO B;  1H2L A;  4B3S B;  1P7G A;  5IT9 N;  2OIG A;  1KP3 A;  4MSW C;  3RVY A;  4PDR A;  4J7K A;  1W0K G;  1IBL B;  1BT8 A;  1NQT A;  1DF5 A;  1VP7 A;  2QWP B;  1RPR A;  2R9I A;  1BL8 A;  1VQ6 V;  3FYE B;  4NYK A;  3QF7 A;  2WLM A;  4F6E A;  3K0G A;  3EXA A;  4DW0 A;  2EIL B;  3JAT A;  4R50 A;  3HKC A;  2YUA A;  3C90 A;  3RYC A;  4DR1 O;  1XMO B;  1QVF U;  4RWU A;  5BMV B;  4KHP O;  2JEX A;  1XHX A;  4X20 A;  1VQM V;  2EZP A;  4J41 A;  3CMA V;  3SPI A;  3IC9 A;  2ZXW C;  3K9S A;  2V1D A;  1KP2 A;  4JAA A;  4GKK O;  3OD4 A;  2XAJ A;  3OR7 C;  3PN1 A;  2ITD C;  1QQC A;  2BE3 A;  4QGP A;  1NI8 A;  1V55 B;  2AZ2 A;  2G38 A;  5LMN O;  5IJ0 A;  2WSS G;  1BHB A;  1J95 A;  1Q8I A;  3ZMU A;  3ZMT A;  2CTP A;  4KUM A;  1H2G A;  1Q5O A;  3WG7 B;  2WA4 A;  4IHJ A;  4GYC B;  1JJO A;  5IDJ A;  2PUS A;  4CS4 A;  3CWB H;  2DMX A;  3OUF A;  1COW G;  5FNV A;  3SJA C;  2QM8 A;  2M6Y A;  3CS5 A;  3G6B A;  4KXR A;  1YIJ V;  4NXN O;  2IH1 C;  3HKD B;  5EK0 A;  4PJ0 Z;  3ETE A;  3M8A A;  5BR8 O;  1W2B U;  2UXB O;  1N33 O;  4IL6 Z;  2JDI G;  2JGD A;  3RGB A;  1SQX H;  2FML A;  1NR1 A;  4GZR B;  3EVK A;  3SPG A;  2CH7 B;  5EBW C;  5BXZ A;  3APO A;  4P30 A;  4IT5 A;  1WAZ A;  3T1C A;  3CCM V;  2EIM B;  1PL0 A;  1S0V A;  2Q6A A;  2GV9 A;  3ASN B;  3P30 A;  3WB1 A;  4U3J B;  2EIN C;  4UCV A;  2V7Q G;  3VQW A;  3SJB C;  5B1B C;  3CC7 V;  2RN9 A;  3K03 A;  2XOK G;  1AI7 A;  2XAF A;  2UXD O;  3BRC A;  2YEV B;  3ASO B;  3PJS K;  4DV2 B;  1P7B A;  2Q0A A;  1SQB H;  3P3P A;  4G28 B;  5A2Q N;  4LCU C;  4R8C A;  3H1I H;  1JMK C;  4JI1 B;  3UCS C;  2YIA A;  3FD9 A;  1UFI A;  2HFE C;  5A9G A;  2HJF C;  3SDL A;  4FZ1 A;  1JPX A;  4RAI A;  1AJN A;  3CXH F;  1XEQ A;  3ZBH A;  3DSQ A;  4LWS B;  1J5E O;  4I0X B;  2DWE C;  4YJ2 A;  4FPP A;  1YJ9 V;  3R66 A;  4JZ2 A;  1FXK A;  1Q6U A;  1QR8 A;  3ZHT A;  1M56 B;  4YY3 O;  3OUS A;  4FFB A;  4ZI7 B;  4H44 B;  3W7T A;  3E83 A;  3JSN A;  3FB8 C;  2ADQ B;  1SRY A;  1LUW A;  2ETN A;  1T5E A;  1FFX B;  5KUM A;  2YC0 A;  2CTR A;  4MTO A;  3OAA G;  3CEI A;  3FFQ A;  2LFS A;  1YXB A;  3W7S A;  3JAM N;  1VQK V;  1BQZ A;  4F6R B;  4HAM A;  3E22 B;  3K04 A;  4IYH A;  1WLE A;  5EYP A;  1K3E A;  5C93 A;  4B3R O;  1K4C C;  2VQF O;  3P32 A;  2RJZ A;  1HNW B;  1XOU A;  3DC5 A;  1Y66 A;  4X1I B;  3BAB A;  5ITZ B;  5IYZ A;  3FAV B;  4NTX A;  4QPK A;  4ZOL A;  3JAL B;  3APQ A;  4B3S O;  1F4M A;  3OTF A;  2KSD A;  4LFC B;  2A79 B;  4B08 A;  1M57 B;  4TQD A;  4TWK A;  3STL C;  2YSU B;  5B1N A;  4UCO A;  3K06 A;  2X6A A;  1IX9 A;  1IBL O;  4UCT A;  1Q7Y W;  1OCR B;  4Z1M G;  2N05 A;  3JD4 A;  2FYU H;  4PD4 F;  2LGQ A;  2XHB A;  3AG3 B;  5EIB C;  2IU0 A;  4CZZ A;  1FYJ A;  3F7V C;  3ABK B;  3RYI B;  2UUA B;  1K34 A;  3OEE G;  1B6Q A;  4CH3 A;  4OGQ B;  4JYA B;  1XMO O;  5EC1 C;  1D2D A;  4MVS A;  1VF7 A;  1K9M W;  1HW7 A;  3L75 H;  4YXW G;  1PP9 H;  2EJR A;  4O2A B;  3QO8 A;  3E2E A;  3A2F A;  5L3C A;  3W7X A;  4FZ0 A;  5LA6 A;  2CE4 A;  1VAR A;  3I55 V;  3CCV V;  1IXB A;  2YIC A;  3QNE A;  4FM2 A;  3BCC H;  3VOU A;  2E74 B;  4I50 A;  4UB6 Z;  4B7E A;  1VQ7 V;  2YS8 A;  4K8X A;  5H6Q A;  4GLX A;  3WFV A;  2BSK A;  5CA0 B;  4N23 A;  2DE0 X;  2E3C A;  4LH7 A;  4DR4 B;  1KKC A;  3BA8 A;  2PF4 E;  1NR7 A;  2EIL C;  1OJH A;  3T1H O;  1YEW A;  3A0R A;  4I55 A;  1MZE A;  2WLI A;  2ZD9 A;  4CBC A;  1DTO A;  3JAK B;  5H5N A;  2CGO A;  2CTQ A;  5FL7 G;  3ZMZ A;  2FB5 A;  1M4U A;  4CH4 A;  1RSO B;  2IJI A;  1AI5 A;  2W0F C;  5JH7 B;  2KB1 A;  3BY6 A;  4J7J A;  1R3L C;  2Y4T A;  2QR4 A;  3BFR A;  3JAT B;  1BS3 A;  1G1X B;  3N2K A;  3ZIA G;  2B1I A;  3STZ C;  2D2C B;  4X64 B;  5IWA B;  1BZK A;  1V55 C;  2WLH A;  3CX5 F;  1WNS A;  2HLD G;  2Q7G A;  2ZR2 A;  5C8Y B;  4O4J A;  2F4V B;  1EZJ A;  1PM9 A;  4DV6 B;  4E4E A;  1H38 A;  4JI0 B;  1S77 D;  2X6C A;  1QHT A;  1N4C A;  3WG7 C;  5GW7 A;  4HNA B;  5KHI A;  3HKB A;  4YJ3 A;  3E35 A;  5B3S B;  4O4L B;  4DV2 O;  1ARO P;  3RYH B;  1H2N A;  5IJ0 B;  4I4T A;  3CP1 A;  4JI1 O;  4ZKI A;  4FLU A;  4KHP B;  3A0H Z;  4XDL A;  1WA8 B;  2V4D A;  3SPJ A;  2DQ0 A;  1X59 A;  1O9H A;  1YIT V;  4NB5 A;  3S3X A;  4DR2 B;  1ZL8 B;  5KMG A;  4LFB B;  3LUT B;  2ZE6 A;  3ETD A;  2AGA A;  4EKW A;  1F51 A;  4H13 B;  3BVO A;  2EIM C;  3K58 A;  3GVM A;  4MVZ A;  1I0H A;  1D5N A;  4BIU A;  2YXH A;  3ASN C;  5LMN B;  3ZS8 C;  5KX5 A;  3K9A A;  4LNU A;  3JD0 A;  3KCX A;  5KHH A;  4PHZ A;  4QIW F;  1CEZ A;  5GON B;  1YZB A;  3ASO C;  2HR3 A;  3DXR A;  4O4H B;  3E8B A;  3E86 A;  5LP6 B;  1K73 W;  4MW3 A;  3ZRW B;  5LMU B;  2QKA A;  4DV5 B;  2RCV A;  1R1B A;  1KKD A;  1GM8 A;  4PI0 A;  1GTO A;  3CE2 A;  3OFN G;  4O4I B;  3JAR B;  4UUJ C;  3C3S A;  3K5N A;  1H2K A;  4ZIB A;  1GN3 A;  2Y48 A;  3H1K H;  1OCO B;  3L74 H;  4WF9 V;  3VQV A;  4H0L B;  1GM9 A;  3ZHR A;  1Y76 A;  1GM7 A;  2WPD G;  4LFC O;  2Q0O C;  1M56 C;  1V54 B;  2P06 A;  2RQ6 A;  2UXX A;  2JS3 A;  3ZN1 A;  3X2Q B;  4B3T B;  2WLL A;  4UV9 A;  1Y6X A;  5LXT A;  5LGU A;  4BIZ A;  4TOI A;  2EUL A;  3ZJZ A;  2UUA O;  2AZ0 A;  5CA1 B;  2C2A A;  2H3O A;  2H94 A;  2UXC B;  4J11 A;  1FXK B;  1NT2 B;  2F93 B;  4ABM A;  4X88 A;  3SJQ C;  4JYC A;  4F4L A;  1E79 G;  2P90 A;  1P84 F;  4DV1 B;  2F95 B;  2Y4U A;  2YIB A;  1S76 D;  3W7U A;  2PYJ A;  3OMN B;  3ZRX A;  1PKX A;  4WFH A;  1CXZ B;  1SZX A;  2A06 H;  5JQG A;  1S5L Z;  2WAM A;  1M57 C;  1BGY H;  3RBZ A;  4BAY A;  1PPJ H;  2CGN A;  1N0N A;  1OCR C;  1FAF A;  5B1O A;  5D5P A;  4XDJ A;  3ABK C;  4DR4 O;  2GUZ A;  2JIZ G;  1S3J A;  2YDE A;  2ZQM A;  3MHH C;  1IBM B;  1WPB A;  3AG4 B;  1MSD A;  2HKO A;  1RM1 B;  1HDJ A;  2XUM A;  4X89 A;  3G6E V;  3LSS A;  1US6 A;  3J80 N;  3WB2 A;  4QPJ A;  3CHX A;  2JEU A;  3D3I A;  1HR0 B;  4JPR A;  2W6I G;  2Y0P A;  4X64 O;  5IWA O;  2ATK C;  2QKS A;  2VWK A;  5LYJ B;  3ZRS A;  4DV0 B;  4OPA A;  3LNN A;  1HNZ B;  3EFF K;  5JJE B;  4LC1 A;  3L9D A;  2F4V O;  4FFK A;  4ASU G;  4HYO A;  2P22 C;  4DV6 O;  1CPY A;  4JI0 O;  1EN6 A;  4DV4 O;  3OW2 U;  4I50 B;  1XHZ A;  2Q8V A;  4X1Y A;  4L8J A;  3O9O A;  1SA0 A;  5CN0 A;  3RWR D;  1HP8 A;  2EIK B;  2BSK B;  4WCE V;  5E1A C;  4UCS A;  4U7O A;  2Z3Y A;  5CB4 A;  1VQ5 V;  1FD9 A;  2IJH A;  2Z5U A;  3TGU H;  2BTQ B;  1L1F A;  3ZED A;  4DR2 O;  2P4K A;  2DOS A;  4LFB O;  5FPR A;  4I55 B;  2JVD A;  1L0N H;  3H9V A;  3IC7 A;  1BMF G;  4JI7 B;  1SS3 A;  3MD0 A;  1ZUQ A;  4UCU A;  5DEC A;  1JR9 A;  3Q4H B;  4NVP A;  4DO2 A;  2BOC C;  2IH3 C;  4N21 A;  1KC8 W;  4DUY B;  4DRX A;  1GKF A;  1NU1 H;  3FB5 C;  3CJH B;  4MVO A;  2PI4 A;  3HKE B;  3JD2 A;  2LW1 A;  3D3Q A;  4WFA V;  1OZ0 A;  2QGN A;  1Y74 A;  2CAZ C;  3TXQ A;  2QKC A;  1R6T A;  1OCC B;  4NKG B;  2DQ3 A;  3T1H B;  2K9P A;  1JX9 A;  1QBZ A;  5B3S C;  5IJ9 A;  1RPO A;  1R3K C;  1E1Q G;  2AW9 A;  1A32 A;  5LMU O;  5KHJ A;  5J2T B;  4DV5 O;  3U0Z A;  2RDC A;  1L8D A;  2BTO A;  2WLN A;  1H8H G;  2LJ2 A;  4TV9 A;  3EHB B;  4Q20 A;  1OV9 A;  1Q86 W;  3GB7 C;  5JCO C;  2XND G;  2HG5 C;  4JI8 B;  2WLJ A;  5IYC O;  4B3T O;  1XNR B;  3C3T A;  3UO3 A;  3G4S V;  1D5A A;  1SER A;  4XBF A;  4G2K A;  1ZWI C;  3LDE A;  3JAW B;  2QWR B;  1ZTE A;  4LBE C;  3RT3 C;  2UXC O;  1G4Y B;  1NTM H;  2DYS B;  4X1K A;  3THO A;  4MVM A;  5LP6 C;  3DTU B;  1MMM A;  5J2U B;  2H8P C;  4DV1 O;  1YJN V;  1TUB B;  1R6N A;  1JFF B;  2VWJ A;  4RO2 A;  1AP6 A;  3JCZ A;  3LSU A;  4KL1 A;  2UUC B;  2PGG A;  3FX7 A;  1OCO C;  3KG2 A;  4HBN A;  2E76 B;  2DWD C;  5EBL C;  2W0X A;  5BY1 A;  4LF7 B;  3HPL C;  4RUF A;  3J81 N;  3SYO A;  1V54 C;  4CS2 A;  4B7K A;  4TT3 G;  3IGA C;  4X66 B;  3X2Q C;  4IIJ A;  1KUQ A;  2OWO A;  2IW5 A;  4TUY B;  5FLX N;  1F4N A;  3ABL B;  5KA5 A;  1XL4 A;  4DV3 B;  4J80 A;  1IBM O;  1N0J A;  5LHH A;  1SZT A;  3CXC U;  2HEP A;  1KB9 F;  1FXK C;  1QLE B;  5EBM C;  1IXM A;  4FLT A;  3JAS A;  4BW9 A;  5DED A;  2LP7 A;  4O2B A;  2JJ1 G;  5LXT B;  1SQP H;  1K97 A;  3RVZ A;  3CYO A;  1BCC H;  4ZHQ B;  1MOF A;  1IVS A;  2R9R B;  4U3F H;  3BPZ A;  1TAE A;  4YIO A;  3D8C A;  4NXM B;  2XAS A;  4QE7 A;  1ENV A;  2X0L A;  1HR0 O;  3ABT A;  1N32 B;  3SYA A;  3UT5 A;  4AQY B;  4DV0 O;  1Q6H A;  4FLY A;  4JAV A;  1HNZ O;  1Q90 D;  5L3B A;  4EB6 A;  1PD3 A;  4IGG A;  4TV8 B;  2DYR B;  1B04 A;  1YSC A;  3H1J H;  5JQG B;  1WP7 A;  3RYF A;  1OCZ B;  2YI8 A;  1L0L H;  4BIO A;  3AG4 C;  2HVK C;  4BW5 A;  4JTC B;  1RM1 C;  3U11 A;  1W0J G;  1R3I C;  2LO1 A;  3OR6 C;  2WA3 A;  3CCR V;  4IYI A;  1GN4 A;  4W4L A;  2ZIO A;  5JJN B;  3BEH A;  2QM4 A;  4OPH A;  3N2G B;  3TXS A;  3IJ4 A;  3LDD A;  2YXL A;  2HP8 A;  3B2E E;  4MTG A;  3ZHU A;  4DR3 B;  4WBN A;  2PYL A;  3T4Z A;  4FLW A;  4LF4 B;  2ZR3 A;  1BQ0 A;  4JTD B;  4PA7 A;  4JI7 O;  5H2F Z;  4D6T H;  2KG7 B;  3I5D A;  3ZMS A;  1AR1 B;  1XQ8 A;  1VQO V;  2PTM A;  1VF6 C;  4FLZ A;  1TVK A;  1K92 A;  2JK5 C;  4DUY O;  4DR7 B;  3B09 A;  2JRI A;  4JI5 B;  4GX2 A;  1SES A;  2GHY A;  3F5W C;  2RMK B;  1IDS A;  3A8T A;  1DK1 A;  5KHK A;  1S5J A;  1AB3 A;  5DM6 V;  3E8F A;  5KHG A;  4WFE A;  2EIK C;  2HVJ C;  3G71 V;  3CRM A;  4JF3 A;  5BMV A;  2IM9 A;  4X65 O;  2QEX V;  1I08 A;  3CRA A;  1ZAU A;  5LGN A;  2D3O W; 
#chains in the Genus database with same CATH homology
 4UB6 Z;  5H2F Z;  3A0B Z;  4PJ0 Z;  4IL6 Z;  4UB8 Z;  5KAF Z;  5TIS Z;  5KAI Z;  5B5E Z;  3A0H Z;  5B66 Z;  2AXT Z;  1S5L Z;  3JCU Z;  5E79 Z;  5GTH Z;  5GTI Z;  3WU2 Z;  3KZI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...