5KAMA

Trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with inosine 5' monophosphate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
158
Chain Sequence
b'TSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Crystal structures and inhibition of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 47
structure length 158
sequence length 182
chains with identical sequence C
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kamA00
2PRYA 4RANA 3N2LA 1TC1A 1DKRA 2JI4A 4P84A 5KAMA 2AEEA 4PAWA 2YZKA 1ZN8A 3DAHA 1G2QA 2GEBA 2VFAA 1A97A 1IBSA 4RAOA 4LZAA 2FXVA 1STOA 2EHJA 4MB6A 2WNSA 3LRTA 2JKZA 1QB8A 5ESWA 4LYGA 2H07A 1L1RA 1ECBA 4RACA 5JV5A 1A98A 1U9ZA 1CJBA 2E55A 3M3HA 1VDMA 4Z1OA 1ECGA 2JKYA 3OZGA 2PRZA 1I0IA 1ECCA 4LZNA 1XZ8A 3ACBA 1I0LA 4LZOA 1XTTA 2H08A 1ZN9A 1LH0A 4M0KA 4P82A 1G9SA 5E38A 1G9TA 1J7JA 2DY0A 1DBRA 1UPFA 4RV4A 1DQPA 1U9YA 1OREA 1QK3A 4WMLA 1AO0A 1ZN7A 1P18A 1GPH1 1BD3A 1Z7GA 4QYIB 3QW4B 2H06A 4M0UA 1JLRA 4QRIA 3ACCA 4X45A 1O5OA 4P81A 4P83A 1BD4A 1W30A 2HCRA 2IGBA 1JLSA 5BSKA 1MZVA 2C4KA 1I13A 4P80A 1DKUA 1ECFA 1Y0BA 3GGJA 1A95A 3KB8A 4FYMA 4WN3A 4QYIA 2PS1A 5HIAA 2XBUA 4RHXA 4LYYA 1NONA 1A96A 4RHYA 4RHTA 4RADA 2P1ZA 1G2PA 1I14A 1P4AA 5KAPA 1A3CA 1R3UA 1V9SA 5BQOA 1VSTA 3EFHA 5IPFA 4RAQA 5BRNA 5HKLA 4RABA 1XZNA 4PFQA 1FSGA 1P19A 3ACDA 1UPUA 3O7MA 5BQPA 1QCCA 1HGXA 3H83A 4P86A 1GRVA 4JLSA 4TWBA 1L1QA 1DQNA 1HMPA 4X44A 1NULA 1P17A 1BZYA 4F8EA 5IAOA 1A4XA 1XTVA 4RHUA 1PZMA 4IJQA 1D6NA 3NAGA 5EUCA 4P3KA 1OROA 1XTUA 4S2UA 1YFZA 3DMPA 3LPNA 4M0PA 3GEPA 4RQAA 1I5EA 3OZFA 1QB7A 5ESXA 3GGCA 1QCDA 1ECJA 1UFRA 5K51A 4ZFNA 3S5JA 1QK4A 4RQBA 1O57A 5JSQA 4OHCA 1QK5A 1VCHA 1WD5A 3G6WA 4JITA 1OPRA 3MBIA 2JBHA 3HVUA 3DEZA 4KN6A 1TC2A 3MJDA 3OHPA
chains in the Genus database with same CATH superfamily
1OYVA 3V1UA 1UZLA 3R7WA 4JT8A 3ZS9A 2AD5A 4O8CA 4E1BA 1LF0A 1MBZA 1VDZA 3C24A 3OCCA 4FZJA 5CTJA 2F3RA 3NHAA 4X6UA 1ZGGA 1Q7BA 3CF6R 3P2EA 1H85A 4Y1FA 1YFJA 2ACEA 2GXSA 1GN8A 1R18A 3G1WA 3WWEA 4EG4A 4RSGA 3A27A 2QX8A 1ORHA 2PANA 3HBFA 4WRRA 3W5AA 3C4VA 2I2WA 2P9EA 4HI0E 3JYPA 4GSLA 2IEIA 3TL2A 5LQUA 3U2QA 4CM7A 1IYZA 5KU1A 3DL7A 1F2UA 3LKZA 2A59A 4AF7A 3AWDA 1UC4B 4EI9A 4NFLA 4IRMA 4HNGA 2L17A 4ILEA 2AWNA 5BN4B 2IGTA 2J4CA 1OXTA 1RXEA 1V35A 2HTEA 2ZYTX 4OUDA 5GONA 2GCIA 1FTNA 5L3VA 3GFOA 2PJZA 2H0AA 2BFBB 3V8QA 3IAEA 1B4DA 2XRFA 2ZDQA 4EO7A 3ZX4A 4PHHA 121PA 3CX3A 5DCWA 1E20A 1JXMA 2Y1KA 1JDZA 1WKCA 3DMFA 2FPIB 1GU1A 4L4XA 1LSSA 1AUQA 1T2FA 4R2XA 2DTEA 3G5LA 2XXAB 5K3BA 1DJQA 10MHA 2PGXA 3G7UA 3NXSA 3PI6A 5BR8B 1Y33E 5LFAA 1QH1A 2IOYA 4MVJI 2EFHB 5U4XA 1I2BA 3B1FA 1JLRA 2BLNA 2C59A 2PD6A 3ESZA 4W5TA 3KAKA 1F06A 3BL6A 3L3BA 4N5NA 3T35A 1Z28A 2Y66A 4Z0NA 1GUZA 3T3DA 2LXNA 3OWXA 5FNZA 4XDYA 4DIFA 3SQDA 2CB9A 4WJZA 1MHTA 1EDEA 5I7VA 1KZ1A 1YQQA 4QJBA 2FN9A 3SWWA 1MXFA 1TQ6A 3BILA 4MWGA 2UAGA 4J1TC 5CH3A 3K9CA 4P3NA 1V1RA 4HB0A 2VLIA 3R44A 3F9CA 4MRPA 2NVOA 2BH9A 3F47A 5CCXA 3DE5X 1MJGA 5IAGA 3KOUA 1QQ5A 3DZGA 3LVFO 2V9PA 5B3JC 5IEJA 1IEQA 2YN4A 2OXRA 4RABA 4WNAA 2AG0A 3RVJA 3SS7X 1FNCA 1YJAA 2P11A 1RRKA 3GP5A 4HAXA 1Y8RA 1TT5A 2XGOA 4US1R 2MCFA 2P79A 1JE0A 3W2FA 2QTCA 5DTRA 4JT9A 5FP0A 3ERCA 2PZBA 4BUZA 4BQNA 3DWGA 3F7NA 4P7FA 1RI2A 2AL7A 4MUBA 1YA8A 3GZ4A 3H3JA 2EEPA 4P31A 2WFLA 5CGZA 4ZVOA 2PLRA 4RMNA 2KX7A 4TROA 2H5JA 5L3QB 1IEXA 1HDZA 4HXYA 1ZI9A 3MTAA 4YRFA 5AW6A 4ERXA 3T7CA 2VHEA 2LKDA 1MIOB 3L7LA 1ZLXA 2BKEA 3FSRA 4NBRA 1U4NA 1VMAA 1Z0ZA 2A9JA 3O1LA 1HWYA 1H5QA 5M04A 1IE3A 1U0BB 1GTVA 3PHGA 4OHCA 4PGMA 4IVNA 2IH2A 4E5NA 2G0NA 1JKMA 4GLBA 1B42A 3MJDA 1UXKA 3HYCA 2Z5FA 1UKCA 1J22A 3C4JA 3IJRA 2O2XA 1KDOA 2IUEA 2GJ8A 4DB4A 1UKAA 2YWBA 3E9RA 3CX8A 3I8SA 1Y1PA 2IYZA 4V0NA 2JPDA 2YCBA 3PDUA 3AUYA 1NWCA 3TG8A 2A9OA 4B4DA 2XVYA 5JZBA 1CNFA 2PKXA 2WHEA 2FGJA 4MLPA 2XTAA 1BQ4A 5G0UA 4BE9A 5LUAA 5MHTA 2XVZA 2QZ4A 3W3ZB 4Y0NA 4UEJA 1WULS 3EEFA 1G63A 2FXVA 2GX6A 3KOOA 4GGPA 4KMSA 3D02A 1NJ8A 1KK1A 2YXLA 3AY3A 4O1IA 1A5ZA 1X2BA 1IUPA 4BRSA 2ZS9A 2IP1A 3QU4A 1YHNA 4OQFA 2QTNA 2OOSA 4JP8A 5CAEB 4KDEA 2CVHA 1XU4A 3C3XA 1Y81A 1ZJ4A 1W87A 3ZX5A 1UBMS 1E9CA 1AMUA 2QTAA 5HP4A 3CSUA 1RM0A 5IN5A 4I6GA 1TKCA 2XAAA 2PNFA 1ECCA 3LHSA 4DWWA 5ICMA 4KQ1A 3Q88A 1MP0A 2DPHA 2GM3A 3AI1A 3B20A 5JG7A 5GOZA 4EG5A 2OCKA 3IHWA 4EVRA 5CLGA 3DXYA 1W2HA 3R9XA 4J9UE 3ZY3A 1C3JA 1C3OB 3JV7A 3LWNA 4EFMA 1JEAA 1PTKA 2V1UA 2WFMA 1NL3A 3EIUA 5FR1A 3GRZA 3NBQA 5JO9A 2DC1A 2RGRA 3LX5A 4LPSA 1C9MA 3AEKA 4FB4A 4F6RB 3ANNA 3H4TA 5L7YA 3RVLA 1AV6A 3JW8A 4AWAA 5TPWA 3OQ1A 4KTVE 5ALTA 2H06A 2QR5A 1DXOA 3GDWA 5FQOA 3RIYA 2RHRA 1J1UA 1EP1B 2PT9A 3GQVA 2ZCUA 4DLRA 2G63A 4QTXA 3QBVA 4U39A 1CS0B 1I3KA 3JQ6A 2J6CA 4DLUA 3TNJA 3I2JA 5LKAA 2H4WA 5CVCA 3ZWYA 2BHRA 2IOHA 2R7NA 4IIFA 2B99A 2HYIC 3LPCA 4D41A 5E6UA 2BEKA 5JS6A 1PT9A 2GK3A 1E9VA 3D7RA 4B7ZA 3WIUA 2B1QA 3HP4A 3PPVA 3V2IA 1E3MA 4X1OA 2VJMA 3V48A 4EMBA 5INTA 1T4DA 1HORA 2ATXA 3V34A 4CFYA 4QASA 1UDCA 4PF1A 3V8PA 3FCOA 3ZCXA 1VHTA 3HN2A 1E32A 1HZZA 2GD6A 1QGUB 1IHPA 1VCMA 4O63O 5ULLA 3QF4B 4BFYA 4DBZA 3D6AA 2I7CA 5D6OA 2WK1A 4M9ZA 2NZWA 5EIHA 1GPYA 1KVTA 4PYQA 1VCOA 1YUNA 1ABBA 3THWA 1GAQA 4E6EA 1HX7A 4G1VA 4Q15A 4R2MA 4BLRA 1GKUB 4QM7A 3SQWA 2QD5A 2VBGA 2YV5A 3L7MA 9LDBA 1QIDA 2P6RA 1KORA 2R8OA 2V5VA 4INZA 4Y2UA 3RC1A 2OAEA 2Q1SA 3C8MA 4Y2GA 4UBOA 2CCKA 2I67A 4HUJA 2PA0A 4F9GA 3QVWA 4B82A 1IAVA 1MAWA 1BOOA 3B1YA 4BMZA 3LY7A 1SVSA 2CV0A 4JR0A 1KPHA 3F5FA 4AJPA 4OD0A 1YRQA 3FTNA 4CKBA 3CEJA 5JAOA 3MGBA 3DCYA 1PEKE 1NLFA 4ZGWA 1N2EA 2VDLB 3TCXB 3JCZA 1JLMA 3R3WA 4HGRA 3W5BA 2ZULA 3QLTA 2C78A 2IL1A 1C0EA 3V5NA 4YT4A 4B4OA 1H42A 3FBGA 3FOCA 3ZQ4A 3II6X 2CNKA 1S3SA 2OGUA 4Y9TA 3T7SA 3VC3A 4ZTZB 1TVKA 1Y6FA 5JD4A 4RANA 3IMGA 3OT4A 2MINA 3WFIA 4KKVA 2A1UB 3FZEA 1G18A 3P19A 1P7VA 3VSAA 4PGGA 3UBMA 2B4AA 1PT8A 4RTJA 2CXSA 2YRWA 3F2VA 5EJAA 3TLGB 4LNUA 3TJZA 1HKUA 4MA0A 2BSXA 3T7AA 2FP3A 1MD9A 1SBYA 3OKCA 1UEIA 2CFTA 1VHWA 3CLSD 4FTWA 3U16A 3UPDA 4X24A 5AKIA 4ZGBA 2P9YA 2PH1A 1JALA 5K0LA 3T15A 5JYBA 1USIA 2WP0A 2WABA 2ZRNA 3D7NA 1R0CA 2P9FA 4R8RA 2JIOA 1ZK3A 1LBQA 2D3WA 1NNLA 4UQPA 5D84A 5HF6A 2NVWA 5KWJA 5HGJA 2VTBB 3U4QB 1NAIA 3ND8A 2RB4A 4MV9A 5EJMA 3O8OB 5SZHB 4AKHA 3T5TA 2ZYGA 1V47A 4RLFA 2RHLA 1JPJA 3BH0A 5K3AA 2ZUVA 3V4ZA 1EQUA 2QBYA 1I4EB 5DIFA 2OHJA 4CI0B 3FPGA 4FUTA 2FZWA 3V80A 3I6ZA 4Z1MD 4FDUA 4RKQA 5BWOA 4QRHA 4FBMA 4ZVUA 1G9SA 1NN5A 3FETA 3MHPA 4ZOEA 1SVWA 2DVMA 2GBLA 4NXMB 1TAUA 3NT2A 4F0JA 5K4HA 3MC1A 3WQHA 2QIOA 1C8KA 3OIGA 4FHDA 1E0JA 5CT8A 5KTRA 4FSHA 2IH4A 2KM1A 3AUXA 4MSUA 4NEHB 3BF7A 4N39A 3X2SA 4D8YA 1H4QA 2FMTA 1IG3A 3L0CA 3GFTA 5LN1A 1U63A 2AZTA 4C08A 3WHIA 1NMYA 1RJWA 3OO0A 2AFHB 1S0UA 3MCAA 4YAKA 4EJ2A 5J2TB 3NRCA 3A28A 4QU9A 2XIQA 1K68A 1BYUA 1WDMA 7MDHA 1G6HA 3A6GA 4IJ5A 4M8SA 4LXHA 5LWQA 2V6JA 5A7HA 1A5AB 1V71A 1WZIA 2PSDA 2IZ6A 3PRYA 4UU0A 2MMCA 3U81A 3T5AA 1JEYA 4HNUA 3M70A 3EQ8A 2AX4A 4NMHA 3HXKA 1NBIA 4D4LA 3FHOA 3AEUA 3AHIA 2FOLA 2V6GA 3COJA 1U2GA 4RK0A 1CSEE 1Y80A 1G8PA 3L8YA 1NVKA 3K70C 4OSPA 3WIOA 4X66B 5J4YA 4GQBA 1XPOA 1UFOA 2D0IA 5KWIA 3RASA 2PUVA 1KVQA 3EK2A 3I01M 2CV1A 4TVBA 1P9LA 5LJIA 2Z5GA 3MM4A 1TL7C 4AT1A 4JNCA 1RI1A 5ALPA 1H4VB 3VV2A 4WVLA 3PEUA 3RJTA 3TLCA 3USCS 2ENUA 3LRXA 4EQ6A 4UUOA 3FNQA 1VPTA 3CGWA 5AVRA 4V2UA 4ZZ0A 4ZIRB 2HSEA 4FI3F 1I7PA 1ZD8A 2WYVA 4IV8A 2NMVA 1NJGA 2AE1A 4JROA 4JJEA 4G5GA 3PRHA 1P0QA 5SYMA 1DTWA 4K9KA 3ESAA 1G20E 1QYVA 1LV7A 2EG9A 1BS9A 3EGIA 4GBED 4FN4A 1U3TA 1V2GA 3I9FA 3PGXA 4NBLA 2ACVA 3DBOB 5MN4A 1DPFA 2FPOA 1P2GA 2HK6A 5EE0A 4C4SA 5IYZA 2JFZA 4X90A 3D3NA 1QFXA 5JAPA 5IX8A 2DFDA 4P84A 1ZEJA 2OLEA 2PMBA 3MW8A 3R0VA 1PL7A 4ZVPA 4C7KA 1JEQA 4DB2A 2WA2A 1MO5A 1XMXA 4G1MB 3IBTA 4XZ3A 4Z4CA 4N3AA 3CG4A 3HRKA 1TYEB 1ACJA 2R8YA 2OV3A 2R4UA 5EIBD 5TR9A 1XALA 5A9SB 2LP4Y 4XJSA 2IS6A 1KC3A 2HIAA 4ZCMA 4AMVA 4JVSB 3GLQA 3BD9A 2PKQO 1W96A 3ZXSA 1DAHA 1F5SA 1SUPA 1SA0B 2HGSA 5EYPB 1RBYA 1UBCA 2Q2VA 3W5VA 4UNSA 5BQ3A 5HKKD 2H2FA 3OAAD 3FSGD 5HCUA 4Z6KA 1XHLA 2REOA 3IXLA 5FF9A 3UWSA 4BZQA 4ZHQB 1JIJA 5FDFA 2GSDA 2BHNA 4QAJA 3RT7A 2AFRA 4C78A 5EA2A 4Y2JA 1JKFA 3U7IA 3JQQA 1TRKA 2XMQA 4FI3C 1ESDA 5B2EA 5B57C 1XBTA 1SD5A 5EKDA 3SHTA 4J0JA 3HH8A 3VNQA 1JDPA 4FDAA 3JYQA 3BD8A 1QOZA 2IHKA 1G3IA 1XTPA 4C0HA 4I1OA 4F3YA 4E6PA 3Q9UA 3DO5A 4U9HS 2G1JA 4JC4A 5DRTA 5JXGA 3GRPA 2H11A 4AMUA 1TJ3A 4TGLA 4LWOA 2P9ZA 3VU1A 4WFKA 2X6RA 5FUMA 4M9RA 3QHQA 2XMGA 1FU7A 2ZI4A 3SFZA 1JUDA 2ZJAA 1U9JA 1RXCA 4JU8A 2GTPA 3DOFA 5K03A 4IDFA 3M82A 2A3NA 2R1UA 4YCNA 1QH1B 4KFTA 2PO5A 1O94D 4J0HA 1E6LA 3SZLA 1I30A 4CEJA 4EMUA 3SQMA 1YNOA 1PJ3A 1U2DA 2DFPA 2VJNA 3N76A 4KO2S 2E4XA 2EKQA 3UAYA 3IC5A 1Y3FE 3ZHOA 2ZBUA 3R0ZA 4FGSA 3MTQA 4R1UA 1AOXA 4JYZA 3I52A 3AILA 1U1IA 3LSYA 3T3GA 3K8ZA 4HQRA 4OQQA 3PUYA 3L93A 4UFOA 4BTVA 3DVAA 4U6QA 4CU5A 2RI0A 5C5CA 3I6IA 1V1RB 1DAEA 4KX3A 3LLCA 1Z6TA 4B9AA 3IVRA 1UKYA 2QQEA 3WL5A 5FJJA 2Q5FA 4L7VA 2BM8A 4RM2A 2OXEA 2R0QC 4ZODA 4OMCA 4PAGA 2QXYA 3FIUA 1EK0A 2AXPA 4HDKB 4PO3X 4O4HF 1UC5B 2IYXA 5TY0A 4QODA 1B26A 2N47A 1YXMA 3KAQA 1MQ8B 4MV3A 4JVMA 3L7AA 4TQUS 1Y8RB 4BP9A 3VH1A 3GHYA 5CYOA 5BVGB 4LJAA 1CUHA 2PZGA 5LP6F 1XEAA 4OREX 1WSAA 4DCVA 1LVUA 3DLPX 3HJFA 2QVZX 4C2BA 5KYTA 1QV6A 1KKUA 3H6GA 3V33A 1CQJB 2YXPX 1QHGA 4NNOA 3L6UA 4YFVA 1ZR4A 2ATCA 4GF5A 4D4MA 1OH5A 4Q9LA 3A1CA 1HE2A 2EP7A 1N6IA 1TLTA 3I9KA 3VPFA 4X64B 4BZPA 5JH7F 4TXLA 3WNCA 1YR8A 1R9GA 3ZE0B 1FBTA 1J1ZA 1R0ZA 3DW1X 3L6RA 3QKSA 2BGWA 3PNPA 3A3NA 3K09A 5B58T 4K9PA 2Q1WA 3J80A 1BXGB 2BE7A 1QH9A 3OIUA 4V0RA 3VR2D 4F8YA 2EP8A 4BY9E 1DAGA 2DBYA 2G8LA 4N3NA 4OMFG 3ZHXA 2JEZA 4K05A 1VBFA 4KQXA 5EZSA 3QVSA 4ISBA 3ZZNA 3GLIE 1IQ0A 1W47A 4RQTA 2WTBA 2X7XA 1KBOA 3R6WA 4X61A 4B8WA 1YO6A 3PNMA 4W5JA 3T3NA 2EZ8A 3VPDA 3Q15C 4XRGA 1NN3A 3MERA 3I04M 4KAFA 1BMTA 2IQIA 3ADKA 3OJXA 5KI6A 4K9RA 2FMHA 1DO2A 1ZA1A 3BHNA 2EW1A 3CE9A 1KOLA 4GVLA 2PTHA 4BDTA 3DE0X 3NBUA 4LXGA 1GGEA 5FOWA 3ECCA 1Q3KA 4Y1RA 4Y3UA 3V7UA 4AZSA 4CKCA 4N6GA 3VPXA 3I2FA 1G42A 1ESEA 1YR2A 3H0CA 4OCZA 4BEWA 1ZBDA 1UC9A 1VL0A 5FRDA 1KQNA 3WAKA 1YZGA 3AIMA 4KQCA 4E2ZA 1I6KA 1GCIA 1E1RD 5G53C 1ZIXA 5SYNA 4QJ3A 1WPGA 1UBJS 4OI1A 2Y77A 5JJBA 1I7DA 2IEGA 1BFUA 3IH5A 1J0DA 3RWBA 3RAEC 3G3EA 4EPWA 2D0PB 5KMGA 1BAPA 3GLKA 3H5WA 4I50F 4GEKA 4ONEA 4DVJA 3ZHSA 3PI7A 1U0HC 3PUHA 4Z4FA 1E3IA 1FX1A 3AC0A 3MRSA 5KTNA 1TJNA 1WB5A 2ZWMA 3HKDB 2J87A 4RGQA 3R7AA 4H35A 1DBSA 3SDSA 3SSOA 1ENPA 5JDCA 1AQIA 3L7CA 2EF1A 2I6FA 4JXXA 2QNIA 2AG6A 4FBLA 1YS2X 2ZROA 5REQA 3I4FA 5A4FS 4D8XA 3GLGB 2PZLA 1WZUA 5K45A 2WTUA 2CL7X 4RHYA 1E77A 1VSVA 2XADA 3LBAA 3LH5A 4D6YA 3G82C 3E1KA 4J07A 1RCUA 1EA7A 4H4CA 1XN1A 4D79A 3B5IA 5HTKA 1KFKB 1B00A 1H6BA 1OMOA 1W0KA 1SXJB 1XDUA 1N78A 3U6BA 1GQQA 4RHFA 1BDHA 4GT1A 2BM1A 5HZKA 4R3UC 3PIDA 4WCFA 3WRXC 1VLJA 5BV2P 1G41A 1HT0A 4Q4AB 2X22A 3GRKA 3EVDA 3D8NA 1HH4A 1SUWA 1ZM4A 2VDMB 2VJMB 3G1UA 1N5DA 2R66A 1W75A 1TW2A 2OCLA 5DDIP 5HFNA 2A9VA 3HEBA 4EY4A 3I9V6 4DARA 1C29B 1SC6A 3AHFA 1K0UA 2IDJA 3ADPA 1KYQA 3PTAA 1R4ZA 3TTVA 1U02A 1WEHA 4HDMA 5J59A 1YZFA 1DIOB 3JZAA 4EVSA 3U7QA 1Y7TA 5DLYA 1QH8B 4D6XA 1V7ZA 3PHJA 4ZU1X 4QOEA 3L4EA 4YN3A 5KX5F 3CWCA 4BO5A 2HW8A 2C8KA 3EEIA 1AS3A 1C9DB 2N1MA 1XXHE 3DMYA 3IEPA 5F7XA 3HRIA 1LVHA 1NBWB 1XNGA 4TLDA 3RS2A 1SCUB 3KBBA 1TEHA 3PXUA 1IJBA 3N6VA 1Z7BA 2ZQ5A 4IXDA 4BO2A 2C9BA 4DMRA 3DZHA 3Q7TA 4Y98A 1Z08A 4J7XA 6CHYA 3TF5A 4FKMA 4Q6BA 1TYCA 4Y6RA 4CKBB 4PM4A 5L4LA 2NUPA 3VV3A 1V8BA 1XDSA 4ND8A 4N8DA 1KEZA 5LD2B 3IE2A 2C04A 4FUQA 4MEBA 5F4BA 2QJWA 3MSCA 1JHPA 4W6QA 4WEOA 3OQNA 2J0EA 2G77B 2A5YB 3KT3A 3OCYA 5JRZA 1GG8A 3M6VA 3TLXA 1D6MA 4PSUA 4ARZA 1TVKB 4CHTA 1X7ZA 1GJRA 3L7KA 4QKQA 2YN2A 3RTGA 4HFMA 3B1VA 4YQZA 2YYZA 3GRYA 1RWVA 1EK5A 2IPOA 4DXAA 3U7FB 4MS1A 1WOYA 1P74A 4CCYB 4BBAA 3M7IA 2Y1DA 1VKJA 4O2BF 4C6TA 3LECA 4BIMA 2OC9A 2DLNA 1R0WA 1VLZA 3EMDA 4IUYA 2POQX 4RVUA 5IK2A 2GCOA 3H2SA 3OTIA 4R1SA 2BHSA 5EQFA 1BC5A 5I48A 4HAYA 1E1MA 4DMKA 1QQ6A 1RFLA 1HG1A 5DLPA 4KXYA 2YQZA 2L2QA 3NOXA 4E46A 2RGYA 4G4SO 5K8CA 4GYYA 2GPNA 1SCIA 3MJRA 2B6HA 4WX2B 1NQXA 1RJDA 3KUKA 4DTCA 4DR4B 1YZUA 3WICA 1SEVA 2EP5A 1MB0A 2IE0A 1KARA 1ZX1A 3DP7A 3PGLA 4IIJF 5LA6A 4XAQA 1YBHA 2A0UA 1XRMA 1ORVA 3UB4A 4YHBA 4OK5A 1BD3A 1W8DA 1BWRA 4UMFA 2XVXA 1DKLA 1PW7A 3LE8A 5EJ2A 5T4BA 5JPDA 5I5GA 3WLAA 4OP3A 1M1NA 2F8MA 1KY2A 5AKYA 4BX9A 5JVDA 1TZBA 3ZD9A 5ITZA 3ABZA 4HN2A 2C4WA 4JBIA 4ZVLA 4Q4HB 3QPCA 2VNKA 1E3DA 3OMLA 4GVXA 4IJUA 1I13A 4MV6A 3IKMB 3ZGXA 2H7YA 4HTAA 1MNAA 4QQ8A 4TRJA 4E88A 1A8HA 1C9EA 1JQEA 3OWOA 3QIVA 3G8YA 1J8QA 3U1TA 4EUKA 1UPXA 4R7TA 4BNMA 4KWCA 3FFAA 1XC7A 1FE8A 3QXXA 3R75A 4ECAA 3QLEA 1AO3A 2IHUA 1KFCB 2I7DA 3OT1B 4Y2TA 3RS9A 4EW1A 4ZEXA 2QS9A 5KOHA 1TZKA 1W5BA 3BK2A 4H3SA 5CGQB 1CF4A 5AQEA 1NLYA 4MW5A 3N87A 2C07A 1LB1B 3DQZA 4HWSA 2EG5A 2WI8A 1N5KA 5C32A 4PFSA 5A5VA 4JCCA 3KKPA 2VUUA 4JEUA 3UANA 3DDUA 1KAHA 4M8LA 1OB5A 1EGMB 3P94A 2XRZA 5AK3A 5B4UA 3OQOA 2QSJA 1P72A 2BFFB 3QX8A 3LBIA 5EUCA 3E61A 2IPMA 3UV7A 3JZFA 4EJSA 2N3ZA 4Y2XA 1W5SA 4L22A 4CIYA 2E4WA 3E7FA 5DB4A 1QO7A 4L2IA 5EHGA 4HSEA 5FBKA 1L5VA 3IHLA 3PVSA 3BSWA 2ZEJA 3HN7A 2DPLA 3AM4A 1I6MA 1AXGA 1Z88A 3BWYA 5HQTA 1TT7A 3KD3A 2B8NA 2E89A 3JQBC 3K9LA 1IB0A 1UOQA 2FOIA 1MPXA 1OHHA 5FA5A 4IL5A 3W9SA 4YV0A 3RV3A 4BMOB 2Y6UA 2PRYA 3OSUA 4JK3A 2EFGA 3H84A 1KZGB 3DB2A 1XD9A 1HT3A 3QI2A 1NDHA 1FFDA 2JI4A 4HAIA 3IDAA 1D07A 1N2IA 4BVEA 1QYRA 2OENG 4RDCA 1XMQB 2O57A 3KC2A 3TL3A 5KYXB 1GSOA 2XKKA 4BASA 2V1XA 1P4GA 1EFUA 4U2KA 3F73A 2PX6A 3GT7A 2WV7A 1D2NA 1DT3A 5D7BA 1AA6A 2QRQA 3U4AA 4KR6A 4B2YA 3G8BA 2GF2A 3AJRA 1AZWA 2FSIA 1EIWA 3K4HA 1M2FA 1SJ9A 1T34A 1ZICA 4L1KA 4BPBA 2R7AA 1EGAA 1SKAA 4OYYA 1L5YA 4HZUB 3VR5A 5A3JA 3ZK7A 5ALVA 1P8JA 2AF3C 1L4FA 1BJTA 1DQZA 4HG2A 1BMFD 1JFVA 4K7JA 1BVUA 3IXMA 1ENYA 3HO1A 5ARCA 1DUSA 2AOTA 5BSTA 1Z8FA 4QTZA 4TLMB 5AVKA 4CRWB 5ALEA 3TOVA 3MG9A 1BNCA 5AW9A 2LVBA 3EGDB 1D1TA 2IBMA 2VH1A 4MVJE 3NNSA 1NA5A 4LYFA 2O1EA 4UTPA 3HJAA 1DBRA 5IDXA 4MQUA 2DFVA 5ICSA 1L0BA 2F1RA 1YULA 4I3FA 1ESNA 4MKRA 1L8QA 1ZJ5A 4LVCA 4LVNA 3L4BA 4IFEA 3HJUA 4UTRA 1HZJA 2A4KA 1Z5UA 2H5IA 4I4LA 4EG1A 3QW2A 5EIBC 2IGBA 4EABA 4TUYA 5EMNA 4RK7A 1PSZA 4PYKA 4HLDA 5JNTA 3EXHB 2QV0A 2XGGA 4R2JA 2OBBA 4R8VA 3X1JA 1R4MA 5LLDA 2UYYA 4NEQA 1Z0SA 5A71A 1FW6A 3CPSA 3MMZA 4UAGA 1ZL2A 4AFNA 5CG1A 2JC3A 3FVRA 1R9MA 5JSYA 3KOMA 2QZZA 3BTVA 3D59A 4B4WA 4DW8A 4MUMA 1CY2A 2I4RA 1LLDA 5HZGA 3ZLTA 5CCDA 4FMBB 1B1CA 1T2NA 4DCPA 5MGNA 1OH7A 4JUIA 5JBQA 4IM7A 4BFZA 4ZT6A 3EUAA 1V2HE 4WOPA 3P9KA 4Q03A 3PUWA 4NESA 1D0SA 5H82A 2W6QA 1F2TB 3A4MA 3JARB 4R9VA 4UTNA 1A9ZA 1Z4QA 3D6HA 3F1LA 1RHJA 3H18A 5DHSA 5FTLA 4JJ7A 4JP5A 2TYSB 1U7PA 3TKLA 2GVZC 3R5JA 3DO8A 2IYVA 4KOAA 1FFSA 4TYQA 4MUEA 1THTA 1FFAA 1YU9A 1GU7A 3QSYA 2G72A 5HA5A 1A7KA 1ATIA 3NH6A 2G70A 3DVAB 1QHYA 4FD2A 4IVQA 4RMIA 2KW5A 4OQ4A 5COQA 2KSQA 4PSDA 5CX1B 2C9MA 3PPXA 5HWSA 1NY5A 4HWOA 2E0IA 5G0VA 5DNAA 4Z7JA 3PNLA 5KNCA 4CHGA 2AS0A 1T8YA 1OXUA 1U0LA 1D7AA 2JFQA 3NALA 5JSQA 4TKUA 3G0DA 5LVAA 4V1CI 1WL8A 4LI3X 3P9CA 1O94C 4YALA 1BS2A 4IRXA 4B43A 2JBHA 3OPVA 4QHTA 4E2WA 4Z8XA 5LDHA 2ZXEA 1CJMA 1EDDA 4OP2A 4IOLA 5GOTA 4FYHA 1CZOA 1POXA 2CK3A 4HUQB 4XR4A 1FFXA 1X38A 1ZVJA 3SLKA 2H51A 2YMLA 1Z62A 3TD6A 1G5QA 2R1ZA 4W7SA 3U39A 3HK2A 2XMRA 2QRHA 1W5TA 1MOSA 4RDHA 4UXIA 1VMIA 2C0PA 1H1DA 2Y1FA 3CXRA 4MB0A 4UBNA 3IFSA 2VPWA 4KE9A 3EZNA 1OBFO 5IJ9A 3TTTA 1G1MA 2NXJA 3UB2A 5L51A 1Z2DA 3S2SA 4QVGA 3SHWA 2CNDA 3LNCA 4ZJUA 1WUIS 1A9OA 2HJVA 5AI4A 2XBMA 3KYIB 1F2DA 3HCFA 4ITVA 4FGUA 3R0QA 4W8OA 5D2CA 1ND6A 3HZHA 2XY4A 1P2TA 2A30A 4WY2A 1YVRA 4D4JA 3BA6A 2DERA 4ZCSA 2E7ZA 2QP3A 3LHIA 2NO4A 3K2EA 2LR0A 4D7AA 4TMKA 1KS9A 3CCCA 1NI3A 2GFQA 2LW7A 2ZIXB 3HDVA 3HLTA 1Z18A 4J1TA 4ZT3A 1JA0A 3V3TA 4NS4A 3ET5A 1OV6A 3AY7A 3C85A 1RZRD 1PO7A 2C9OA 2X1LA 4P82A 5KKAA 5JYCA 2CHFA 1J7JA 3TQSA 1BW9B 2LRHA 3JQ7A 4N82A 4RCYA 3I9JA 4G4JA 5HDQA 1V16A 2F6RA 2G09A 4G1FA 3R7FA 3SM3A 4A8JC 3RLIA 3SIWA 3TQOA 4BRZA 4HH0A 2F7SA 2SHKA 2L18A 5F3WB 1U28A 4Y1RB 2IZ0A 1QVVA 4UQOA 3HA2A 5F7JA 5IBCA 4ZREA 4EKYA 4YXWA 1FTGA 3WGHA 1JDUA 4U3JB 5HFAA 3WMEA 4CIWA 2V74B 4G2TA 4GR5A 5IVDA 3JYLA 3A26A 2QJFA 2R84A 3DPIA 4PR0A 3BTSA 1T5IA 2Z8YA 1Z47A 2YDXA 4Q16A 3AUSA 1ZUNB 3BHIA 1E7RA 1ONSA 1Q2XA 3AINA 2X9LA 4M9XA 3TX6A 3UAXA 1E9RA 3ROQA 1T91A 5FQNA 4F9FA 1EMDA 4ZU6X 4A0GA 2M6SA 1NNI1 2O8EA 5EERA 3KE8A 3VSBA 3LWBA 3EUEA 4DAEA 1OZGA 2V3CC 1AGRA 2O4UX 4HBZA 4XWYA 3ZVRA 1VSTA 1WVMA 1R10A 2VHXA 3DZCA 1SY7A 2PV7A 1C3VA 3JATA 4EO4A 3V7NA 3CO5A 3EOZA 1EFKA 1XV5A 3LC0A 4KLZA 2FSVA 3KU1A 3H8VA 4GMGA 3IUNA 2YUTA 4NDAA 2OQVA 4M54A 2FETA 2W2VA 4TWBA 4P4TA 3LS2A 3OCZA 1I2AA 3UUGA 1RYYA 1CJUC 1L7XA 3N53A 1O4WA 3PC4A 5D5QA 2I87A 1P17A 2PUCA 4UOZA 2V6IA 3WMGA 2GZRA 1LDBA 4JI1B 2AOWA 1SQ6A 2CJYA 4JNKA 1KGSA 5DWQA 4WCFB 2PUFA 1LPNA 3KSDO 4KSBA 3S1AA 2CL5A 4J1QA 2XWJI 5EE3A 3F7TA 4KUGA 5LNK1 4GXRA 4G5OA 3S5JA 4U2BA 5J4KA 3BB4A 5EPEA 3U80A 2FR1A 3UATA 3ROXA 1NXSA 1QG0A 5EOVA 1VSQA 2W6JD 1Z8DA 4I66A 1XRNA 4PC2A 4GOLD 2CJPA 3IVGA 1QAMA 1D2MA 2XUGA 3QNUA 4RFLA 2H4HA 2V4ZA 1RAEA 1WWKA 2P2CA 3PP8A 1U8TA 3DHVA 1GAWA 1Q83A 3LUFA 4LF8B 2CXQA 2EXXA 3OZAA 1CUVA 3B9PA 2PLFA 4HZGA 4C9BA 5CDTA 1QP8A 2X5XA 2ET6A 4TXNA 4KI7A 3QG1A 2IXGA 1V3TA 1L5LA 4RFSB 2G8NA 1A50B 1B3BA 2VJLA 2A1TS 3CR3C 5KHOC 2O3UA 5GVSA 4M9UA 2JA1A 3QFTA 4O4LA 2JAUA 2JW5A 1UWKA 2ODBA 1V5GA 2WNSA 4G8JA 4H4DA 2EX4A 5TMDA 4ND8B 3SZ3A 3QGMA 2C1XA 1A2QA 1O08A 1ZIYA 3ANXA 5F1PA 4A6EA 4EK9A 4LOHA 5KEIA 1IIRA 5JV5A 1JKJB 1PX0A 1WD7A 1L8XA 3GVCA 2VA8A 3OUZA 1P7WA 4HQLA 4MUYA 4QXRA 5DH9A 3TYXA 4ARZB 1S1CA 4GPEA 1EFAA 1QUFA 2AOUB 3KLBA 3U3XA 1K7XB 2XE8A 3B2EA 1M8FA 5HUJA 3EVGA 3NWEA 2O7NA 3PENA 5JAUA 1IQRA 1DLIA 1OU4A 1JU9A 1WUHS 3NBXX 5C8VA 3LUJA 1FRZA 5SICE 4WBNF 1Q95A 1DEXA 4S05A 4P2BA 4WQMA 1M8KA 2G4VA 4KU4A 3O5AA 2QAIA 2QRLA 3CLUC 4GYJA 2IIQA 2ZBVA 3F71A 1Y7IA 3RFTA 5I7FA 1AZTA 2VJBA 1K3TA 1W36B 3MJEA 3DTNA 3WQQA 4KE8A 4XVUA 4MPPA 2JFWA 5FIUA 4H60A 3DD5A 3E03A 4S1TA 1X7WB 1JZQA 2NT3A 4D26A 4MW4A 4AMBA 1G21B 1BE8A 1AKYA 2SCUA 3IUBA 4QYWA 4WI1A 3KQUA 4AJJA 1MT0A 2F62A 3H11A 4C0AC 2GK7A 1TMOA 1LU9A 3NPAA 4Y8VA 3CB2A 4WAUA 1E3EA 1KYWA 1LRJA 2GPWA 4MZDA 4EPVA 1TADA 2AWOA 1Y1LA 2P0EA 3H5TA 1Y4SA 1YT5A 2QVGA 3UUWA 2I91A 3EF0A 3L79A 2RC6A 1CEEA 1AKEA 4RF3A 3MJSA 3SKVA 3WDSA 1XTQA 3IQEA 4B7AA 2Z2KA 3GIDA 3B82A 4W4TA 4MK4A 4NJOA 2NACA 1GTG1 4M4SA 4MYRA 4I46A 1FP7A 1H93A 2WMDA 3LVRE 2WWVD 2HA6A 4FYJA 4UM9B 1YZTA 2HIHA 2J0VA 2JIZD 4HN4B 3UK1A 3COVA 3P2IA 5A04A 2CHQA 4RCZA 2ZR8A 1NBAA 1D4OA 2EAUA 2ZIWB 3IAUA 1VMEA 2WHPB 5DNEA 3RU7A 3W90A 4HH4A 3V8BA 1QMGA 3GCDA 5K2OA 1CFJA 1H94A 4DNFA 3MTDA 2W58A 3CJQA 3HCOA 3WX0A 1OZFA 2EZ4A 3FCXA 1ISSA 4GICA 3KR2A 2MHCA 1QV7A 2HPAA 3HJCA 4XTCS 4QC2A 2EGUA 2WU8A 3O0TA 1T9GS 5K0EA 1ZWLA 1V25A 3Q7PA 2ANBA 2IIBA 1E3SA 1W4LA 1IN5A 4ND6A 2J85A 5HKBA 4BQSA 4JUCA 2QENA 2GKOA 1T4CB 1NKSA 4JI2B 4P7GA 1VCHA 1KJJA 3DHEA 3VTAA 3FHJA 2AKAB 2ZJ7A 4KN8A 4O4IF 4UAVA 3UAGA 4AN1A 1E1DA 4D92A 1ADYA 2D5CA 5L4NA 4CLRB 4LQCA 1B7GO 2NZUG 3INNA 1ODKA 3TW0A 2VSYA 1ZH0A 4BVBA 1Z0KA 3GH3A 4GL4A 2CFIA 1JR3D 1MMFB 3V4OA 1DOHA 1E2FA 5TSDA 1V48A 1UT6A 3WYDA 4YMHA 5C2JB 1LTKA 3GGSA 1XWFA 3X1YA 4KK4A 4M7WA 4F4FA 3DXXA 1XWWA 4II2A 1YDEA 3SSAA 1KJWA 3DTVA 3UY4A 1ZIDA 1MAAA 4FCWA 4IHAA 3ZV6A 1CHNA 4DJJA 4EOGA 1TM4E 2IUYA 4XX0B 1GUDA 1IUOA 4LA4A 2YVUA 2J3QA 5EMKA 5ALZA 1C7IA 1QLHA 3EGCA 3TUZC 4F2WA 1QBGA 1Q6YA 2IV2X 4I6JA 3K1YA 3N5CA 1X8KA 2UYGA 2B4YA 3AH8A 1Y1KE 3AIKA 3LWZA 1GL3A 4C3VA 3UM9A 1E92A 1TF7A 4QPJC 4QFBA 4LX8A 4IQ4A 1WO8A 2GVNA 4O4LF 4O0MA 1DHRA 2X4IA 3F46A 5SZJA 2JFBA 4CIDA 2XVAA 4D5EA 4YJ3F 3RVDA 2YH2A 2AGVA 4MA4A 4C0BA 5LOVF 1XQ1A 3TQTA 4UASA 3PWKA 2Q99A 1ZOIA 4DC0A 2QM3A 1KXZA 4UUMA 1ZO8A 3SKYA 5AJZA 4D74A 1ZZGA 3T7RA 1GPLA 2QN3A 3C6QA 3LO5A 2WYUA 3A3KA 4GPIB 5ERGB 2YV1A 1RC0A 3P2KA 4BJ5A 5CEJA 1RQGA 2H29A 3N7AA 1JQLB 2JCYA 2J41A 2VVTA 2ZTUA 1NW3A 1YGYA 3FKSD 4PLFA 5JNLA 1JAIA 4RMHA 3S81A 4BLUA 1OXKB 4E22A 1XCGB 1YQXA 1TX4B 1VZ3A 1EXWA 3KKNA 4GSYA 3ONVA 4A23A 1JJFA 4X54A 3RARA 4BV9A 5HKAA 5JW6A 2QMEA 2WTXA 4OAOA 5D85A 2HV9A 2J9RA 2Z3ZA 1KPIA 1F0PA 1HL3A 3V1NA 4ZQFA 4QSMA 3WKAA 2OO7A 1S9DA 3C5WP 2WWYA 4IX1A 3HBMA 4G89A 3FMOB 4MO9A 4MMXB 1TM7E 2PV0A 3C7DB 4OV6B 1BTOA 4LOAA 4XSHA 2JLAA 3T5MA 5EJ6A 2JHPA 6ABPA 2JHAA 1POWA 1EI9A 2OECA 4EHBA 3S2YA 2BP7B 3DD1A 2VRBA 1R4MB 3WV4A 4H7PA 4UZSA 4DCCA 4FU0A 1NF2A 4BUCA 3AF6A 4XWWA 1NTOA 2VJYA 3KOYA 1ZY2A 3MWGA 3RYHB 4O08A 1GU0A 1RRGA 2IXDA 2ZAYA 3PEFA 1ADJA 1YDHA 4MH0R 5HCIA 3M9XA 3TOXA 5UKDA 3HG7A 1EX6A 1XJ0A 4Y18A 1RM3A 2PGDA 3UAOA 1Y3IA 6REQA 4B7UA 2HZ7A 1EU1A 1ARZA 1GPUA 3B5JA 3RUIA 3ELDA 1ISHA 5BNIA 2GF9A 5IVIA 1NX6A 2MIIA 3C1TA 1O97D 4TXJA 1B93A 1RJ9A 4LGCA 2VT7A 4HDNA 5I9TA 5SZIA 4LTDA 4QUEA 1P2BA 2ZYRA 1EK1A 3Q8MA 3DYIA 2GPJA 2QKYA 1FU4A 3WADA 3OLVA 1J33A 1TMGE 1L4LA 3TW6A 3LPLA 3EXEA 1B16A 2FDCA 2GLUA 3KYJB 5GZ1A 3RV4A 5K0FA 2DLCX 3G0GA 5CFOA 4DZTA 2GWRA 3D0KA 5FWXB 3A14A 1O8BA 2VJAA 3N2KB 1L8AA 3HA5A 1YS6A 5JADA 2GM5A 2B98A 4URWR 3S40A 2QL6A 5KHAA 1ZOLA 4TKUB 1RKUA 5I7AA 1AQUA 2Z08A 4UAJA 4Z7OB 1GSHA 2BMDA 2EBFX 2QHXA 5BURA 3ABOB 3BXGA 1B3RA 1ZHOA 2BFAA 1QPZA 4E5DA 3F2IA 4IV0A 4KV7A 5C8YB 4FOPA 3O4GA 6PFKA 3FCYA 5GIPE 2FZLA 5IARA 4D2IA 4HYYA 4HLNA 3SOPA 3WMFA 3FPFA 1GFZA 1A9RA 3P20A 3DDHA 4PQEA 2ZZMA 3G1TA 3OD5A 4GEGA 3ORRA 4R16A 1OI7A 2CFSA 4JBNA 2PWPA 3G59A 4DQKA 2MJLA 5FHQA 5KYGA 1DKNA 4KPEC 1IFXA 5AXDA 2C2HA 5I01A 2WSSD 4Q82A 1JHRA 5ES4B 1FXSA 3A9RA 1U2TA 1XHFA 1NVTA 1XTTA 2H08A 2W37A 5MN5A 1WV0A 3LY5A 5KB3A 3ITKA 4KCGA 2XD4A 4F2DA 1PUJA 1Q15A 4H7EA 4KGZA 1LPPA 4G25A 1WHSA 3PEYA 2X4LA 2XF8A 1KY3A 4DRZA 1FP2A 4LMBA 1P1KA 2P5YA 1AUOA 1P6QA 1DX4A 2PXHA 3PXXA 4JOBA 1T2DA 3U3KA 5B30A 1S8AA 1Y5RA 3GBVA 2CHGA 1QUEA 4DLTA 3DMNA 4KI0A 3GZTB 1O54A 2ZM6B 5B6PA 5ADVA 1TMYA 1UDXA 1B0UA 2R85A 1V5IA 4HMQA 4HN9A 3JQ7B 3WGMA 1PGOA 1T9DA 3LW7A 3D4BA 3EDOA 4NH0A 4KK3A 3C3KA 2V0NA 2GJAA 3BCSA 3RSHA 3NWBA 2O1XA 1GITA 3F4KA 5E4FA 1H1LA 5JBIA 2OMKA 1DXQA 2JLYA 4JA2A 4YWHA 3PVCA 5I4KA 3VO1A 1C2YA 3KKEA 4KLRA 3M9LA 2QXUA 2R6R1 4B83A 1OLSB 4OQPA 3VVCA 4E32A 3PK0A 4PRYA 5LR6A 4HQKA 1CNEA 2H9IA 1BX1A 1KFEB 1QHFA 2Z2YA 1JHAA 2C84A 2D54A 3LYUA 2XB8A 2KS6A 3K6JA 2WM2A 1B15A 2Z6VA 3MVEA 2Y0DA 3SDBA 2BRUC 4KX5A 2A33A 5JD3A 3AUKA 2HHJA 1XZLA 3PE3A 3AF4A 5C9ZA 2UU9B 1KXJA 1L1QA 3DT6A 1DQNA 3PL5A 4XGRA 4LHZA 2G9NA 4D46A 5LBTA 221PA 1YKSA 3JTMA 3DMDA 4DJ5X 2ZJFA 3PIRA 1N6LA 1T3TA 4NZZA 3IKVA 3CSSA 5L7WA 1VP3A 1NZJA 1V45E 2VAPA 1E4OA 2X0RA 4Q1AA 5LQJA 1NW6A 3O9VA 1FFHA 1N4DA 3PR2B 4OLAA 3QE0A 2Q5OA 4KLAA 5CEFA 2F1IA 2V7UA 1TZMA 2BFCA 3OJFA 4P33A 4TQAA 1HBJA 3A9CA 1QVRA 1RWBA 4K6HA 4TXMA 1JQ5A 3ZCVA 5FV4A 3B60A 1EB8A 1IATA 3GGGA 3QELB 4FQ5A 3MLBA 4RTPA 3HJHA 1U0OC 4Y1GA 2P9BA 2CNLA 3FCCA 4ZRNA 5CG2A 3K53A 2YBEA 4QZVA 1I1NA 5LP6A 3H7IA 3S1AB 3M6XA 3M5WA 4FVTA 3WLQA 4L8YA 4ZZ2A 5KYWA 1VE7A 4FGWA 3AF2A 1C1DA 1O95D 3O0DA 3IDSA 1NQUA 1JKXA 4TTSA 4JC5A 1MORA 1WU7A 1RAFA 2H4ZA 1KR5A 5A0FA 1P6XA 1X7YA 2XMPA 3IAM6 2PUGA 1H3NA 2ZIVB 4UUPA 2G17A 3AB8A 1OGIA 3MBKA 4MWOA 4M6WB 2FR8C 3S1LA 4HDRA 5GM1A 3RODA 4IWYA 3TMKA 3UW1A 1I94B 2I4NA 3AIIA 5JH7A 1O3YA 3OQIB 1P7PA 3ORFA 2PWBA 4JB8A 4UC0A 2HQ1A 4GYWA 1V41E 2QL9A 3N07A 4NFHA 3IEMA 3GYBA 1CJSA 2HY7A 4S0ZA 3WL3A 1US8B 4PWYA 1LCIA 1D9ZA 3TIXB 1ZNYA 2IQ5A 4PZCA 2HPZA 4CM8B 1CLUA 2CUTA 1GUAA 1UBOS 2YR0A 3GRFA 4NY1A 1C1YA 4OATA 4LRWA 4FS8A 4G1UC 1OX5A 4KXMA 3O74A 2Q3HA 3IP1A 1OJ7A 3KQYA 4JLDA 4ITRC 3C5HA 3F6EX 5BNWA 1SMKA 4OY3A 4DRYA 4FDTA 3H0EA 1R0SA 4DA7A 1L4BA 2B0CA 1Q17A 2WAYA 3FNIA 5A3RA 4D8WA 3ICPA 1DI0A 4H2DA 2PUJA 4TOIA 3QYJA 3K94A 1XEWX 1R9NA 2JS7A 5KINB 2D7DA 2B25A 1A8IA 4AP5A 2UUPA 5BSUA 2WWWA 3W7BA 3OQJA 2WU4A 1CZHA 3JQGA 4TM8A 1S96A 1UWVA 3ZV7A 5HJ2A 5ETJA 2PH3A 3WO1A 2PEZA 1QHSA 2OKGA 3Q2OA 3TIGA 4OIMA 5JTTA 2C5GA 3PG5A 4I50A 1GZ3A 2K6GA 1Z0JA 3INRA 3Q3JB 4WXHA 5CVDA 4F06A 3CLVA 4RADA 3S8MA 1RE0A 1Y3AA 1E5XA 1L7PA 1DRWA 2H2WA 1HYQA 3HZOA 3ZU6A 1YQGA 1KYZA 3ZZTA 4OJQA 3UV6A 5AD1A 2ZI5A 4JI8B 1SBNE 3EF3A 5DN6D 2EJTA 1D2AA 2Q0QA 4GFDA 3VO9A 3SJCA 5IJWA 3IURA 3O03A 4RPLA 4RD4A 5AJUA 4P86A 3LL4A 1KO4A 2QN6A 1SD2A 1CDEA 2D1RA 4TWZA 1MEOA 4WZZA 2ISCA 3ZGNA 2CMDA 2QN8A 1VYTA 3MWKA 1N2SA 4QBIA 3RJMA 5F98A 4RTSA 3AVOA 1PFVA 3T1HB 4BV3A 5HJEA 1R16A 1XEXA 2V4UA 4MI3A 3OP4A 1P6UA 4BO0A 1EP9A 1OBOA 4LSWA 1E2UA 2VJKA 4IS2A 3ZWCA 1RKQA 4NYIQ 3QUBA 5D3KA 3JALB 3ZKWB 1N0HA 1H6DA 2QDXA 1GLVA 1DAMA 3EGXA 5F2OA 3WLNA 4ZFNA 2DXIA 1XVLA 1Y4ZA 3TRJA 1RYMA 3MGAA 4PSVA 1VI5A 5ILQA 2W42A 2Z2ZA 1GNTA 4QECA 1GADO 1H3EA 3V32A 3ZHYA 2FPLA 4NATA 4Z2AA 1EWTA 2HX1A 3WVNA 5BPHA 2OHFA 2IU4A 5KX5A 4GAEA 1ZR2A 3FH0A 4IY1A 3USES 3BJZA 3FPKA 3KZVA 3CBQA 2JI6A 5BSRA 1DE0A 2NNWB 4M0DA 4RETA 3W2HA 3ESCA 4WIAA 4ARAA 4BEVA 3WGYA 5AM3A 1IIBA 2GD2A 1C81A 2Y76A 3DZFA 3HP1A 4LXXA 1RW4A 2IH5A 1KA9H 6ADHA 1T4BA 4LZWA 5AW0A 1RQ2A 3H13A 4W5OA 3WV5A 1FL9A 3EC2A 3ILHA 4KQ9A 1BU8A 3K1JA 3ER8A 5G40A 5JLJA 4K9QA 3GA5A 5M34A 4NRDA 2IZOA 5AIBA 1ZVVA 2VAVA 4PO1A 5AJXA 2ZZNA 5KNDH 4ND2A 3G2HA 4YJHA 4ALIA 2ZB3A 1JF8A 2H07A 3KXIA 3PFHA 1FDVA 4FYKA 3BM5A 4X3OA 5CXSA 3DTVB 2CZCA 3C1OA 1WMSA 2P0YA 3LQ1A 4HGYA 4RZ2A 4WXMA 3UXEA 4EHKA 3WXMA 2XF2A 4Z4HA 5JZOA 5EIXA 1YE8A 2JLZA 2DPXA 1RZVA 4G4SP 3LXXA 4MXDA 4GUDA 4YVFA 1J5PA 3RKRA 2O7QA 2JLRA 4LVUA 4O2BA 1KI9A 4ABYA 2W22A 3L9WA 2JL1A 2AYXA 4L08A 5FFMA 3R7NA 4AMYA 5DYWA 1VRCA 4FYPA 4RPIA 1FJGB 3HFGA 3NVKI 2NXEA 1T2CA 2ZETA 2O8DB 2VBCA 5J3JA 1JB9A 1QNLA 2IY9A 3FCSB 3A3PA 4NLLA 5EP1A 2CL0X 2EKZA 3RCBA 4CMEA 4HLCA 3QW4B 4Z1MA 2ID8A 2QLTA 1AM4D 2DLDA 3IBGA 4LK3A 1F2VA 3TTWA 4E09A 4F8JA 4IIJA 3DHWC 3WNDA 2FLVA 3WYFA 1T9AA 2H92A 3ZWPA 5DSTA 3A1UA 4FONA 5FUWA 1CUAA 1V8PA 4DL9A 4XWTA 3SYTA 3K70B 1FDSA 3SKXA 2BOVA 2JATA 3IEUA 5K09A 1V11A 2OHVA 3OOSA 4PY2A 4YRAA 5GINE 2BCEA 2PPVA 1LBIA 1Y5IA 3GMSA 2R65A 4BS9A 3ZHBA 3GN1A 1SKBA 4CM4A 3L6EA 4DQUA 2BUCA 1UXGA 4NE9A 4ZAYA 4AU1A 3JPWA 2PRJA 3OZSA 1TGVA 2Y2VA 3MAAC 4D3XA 1QWOA 4DV6B 5GGYA 3R9IA 3CVVA 3JQBA 1SIWA 1KAGA 1R66A 4XEUA 5CK4A 2QL7A 3FPJA 2CLMB 3H5AA 4FXPA 4BN5A 3BPSA 4PLCA 1DLJA 4V02A 5ER9A 3WY9A 4TMTA 4G24A 3M4YA 3C0KA 3WYEA 4LE2A 3N2GA 4QNRA 1KI7A 5E2AA 3QUQA 2UUCB 1I7NA 1VL6A 1YNSA 3WAJA 3P9ZA 3P5SA 4P9NA 4ZO6A 4GLJA 3RE1A 1VZ2A 1QG2A 2PX8A 2ZLBA 2YJZA 4G1CA 4IHJF 2CLKB 3I09A 4RD2A 1U7OA 5FPSA 3OFND 3EHEA 4YUZA 1X0XA 4FHFA 3RAGA 1EBUA 2RKOA 3T5DA 2Y0CA 5ER6A 3BGSA 3E5NA 4Y2SA 4PZEA 3WWCA 3AU9A 1VJRA 3EW9A 4C6HA 1WHTA 2I7TA 5BWCA 4HCJA 2I3GA 3ZG6A 3QPWA 1MU0A 1D4ZA 1Q1BA 1RJ9B 3NCTA 2VDWA 4UUBA 1ADGA 1HT1E 3C3BA 3OZDA 2Z1MA 2DRIA 3HY3A 4R54A 4DCTA 3M1LA 2I54A 4XCVA 2B7CA 2HMAA 4NV3A 3C6KA 1GGHA 2VP3A 1GAEO 2O8FA 1SK9A 1SK8A 1YB7A 2YOFA 1JSRA 4KXXA 1IJEA 4AZTA 4NPCA 4X3CA 4Z4QA 4X3PA 5D8DA 3JU3A 4EDFA 2XTNA 1XVAA 3RSFA 1Q77A 3IB6A 1NFRA 2R2AA 2Z2IA 3B1WA 3NP9A 3F6SA 4XB6B 5I9LA 2E4VA 2PD3A 1AKWA 4J0GA 2RB5A 1FA9A 3AR9A 4LSZA 3RDPA 1FRVA 1F20A 1Z2PX 2YV3A 4S1PA 3GYGA 1J9EA 3LLVA 3AOGA 4TTQA 4DMHA 1OAAA 1PYGA 4NU0A 2NZ8A 3RU2A 1QP4A 3H2HA 5IN4A 5HS4A 3OAAA 3FSGA 1GWNA 2NV2B 3EVAA 4GR9A 4A91A 5JEDA 3R3ZA 1SOWA 3BT7A 4YONB 4EAAA 3EVZA 5E4TA 1E2BA 1K5GA 2O6HA 4OO3A 1U9YA 4K6FA 4I14A 2F43B 4OGFA 4BIIA 4ESOA 3O91A 3L84A 3SR3A 2PH5A 1UAYA 3EIHA 3R5SA 4I7EA 3OG9A 3EWIA 3OQBA 3ROGA 4C2UA 3KETA 1FFEA 1F6BA 2HU5A 2OXFA 2PGOA 1O6ZA 3H87A 3LTEA 5IP5A 3U56A 3FUVA 2OYRA 4AZ3B 1DWUA 2X8BA 4N9WA 4WKGA 3V7WA 1AT1A 1WHSB 1Y37A 2HTFA 1PEDA 3NRBA 2VZ9A 4NP6A 1L3BA 2F90A 3TR5A 5AKGA 1Z5NA 4B4KA 4RZQA 3EEBA 4OB8A 2F55A 2ECKA 2ZKLA 3BMNB 4GOMD 3T9CA 4P3YA 2C61A 5FBHA 1GPAA 4MAFA 1M7HA 1KNQA 4CL8A 3EZ2A 2WHRA 4RHEA 2OXTA 1BO6A 4D9BA 2CV2A 4O6VA 1EG7A 1O94A 1RCFA 4G0ZA 1NVFA 4GRAA 5JASA 4C07A 4LHVA 2PUWA 3NHZA 1XZBA 4C0WA 4DLXA 2EQ5A 5T7BA 3WTCA 2IX3A 4OB6A 3HNPA 4G0YA 1XKQA 1QO9A 2O7RA 3K0HA 4M83A 5CHEA 1C0PA 2JD2A 2WILA 3GRUA 2P7IA 4XD2A 5KSZA 1R8SA 3HA7A 2V98A 2DULA 1ZMXA 3KZKA 3Q4GA 3P71T 4YP5A 2CNWD 4GMFA 3RT9A 4D3ZA 1H4TA 2ZVPX 2CXNA 3C1AA 2QA5A 4JBGA 5KNDA 5BT9A 2ODTX 4YCLA 1QIIA 3KLMX 4OQLA 3JY6A 1Q0UA 1QAOA 1QHEA 3PZRA 4M0PA 2G9QA 2I6GA 1HPLA 3BWCA 4M0LA 4NNJA 3FDFA 3LGXA 3LBFA 4URFA 2H17A 2ORVA 1M0SA 3SLRA 4DSOA 3K16A 3A6DA 4GLOA 2GK6A 2JKVA 3LHKA 4D97A 4MCAA 2ERCA 2ZYHA 3OFVA 4R8MA 1K6IA 2R8PA 2CJFA 2X3YA 2XCIA 3EFOA 4H1WA 5FL3A 1RAAA 1BXKA 4LHSA 4XWAA 1FFCA 2XMBA 4F5EA 4BV2A 1S02A 1WY5A 5F1YA 1IZYA 1NPTO 4IDAA 5AJYA 1DC8A 3DBRB 1P0MA 5EWJB 2WD8A 2RKBA 1Q22A 2O7VA 3AV3A 4O4HB 1VKZA 4RA6B 4Z3DA 5DGDA 3KTOA 2I5PO 4RS3A 4PS0A 1Z4OA 1NKVA 3OZIA 4R9SA 3K8QA 2DWCA 3FPCA 3ZLVA 5JJLA 2ZRGA 2EFDB 1YMUA 2QRJA 3V6MA 4CF6A 3NAQA 4Z86A 2B94A 1DRJA 3AUAA 2D06A 3EIFA 4GWLA 4QDXA 1C4XA 5F2NA 3C3YA 1BQEA 2ORWA 3IIIA 1NSFA 1G0OA 3IRUA 5ESWA 5TMBA 1QVAA 4WPGA 2PSJA 1PNQA 1Y48E 4ITUA 1X7YB 3OEHA 3DP9A 2AMJA 1K63A 3I72A 3LQ2A 5FPHA 3SXPA 1CJBA 3FPEA 1B6RA 4HATA 3VR2A 4A0RA 1DC3A 2QMZA 4E31A 2PRZA 5JS7A 3V8EA 1QNFA 4EA8A 5TIIA 1IN7A 1X77A 3H6KA 4IUCS 2H3HA 3WLHA 4AJHA 4QFDA 3IHTA 3DDZX 3SJUA 5JANA 1NBHA 2QSZA 3AG6A 2YJ4A 2CNOA 1X1CA 5I6DA 5EP4A 4MKXA 3KYDB 1GQFA 3ESBA 4JT2A 4PWZA 1HLGA 5I4BA 5KSOA 3JQ9C 3MELA 3THSA 3EOBI 1AY0A 1MDFA 1DWOA 1VLLA 3PPYA 4XOIA 1SPBS 2ONJA 4X45A 1IEWA 1YI0A 2O2CA 2OHHA 2WT9A 4PVDA 5DHAA 5HQJA 3TZCA 4AICA 3PEEA 2D2IA 3EAGA 4Z54A 1CIPA 3I2HA 4GLLA 4HBGA 2AF4C 4MGYR 1E1RA 3A36A 3Q0EA 5LQSA 3OA2A 4CMGA 3LI2A 3VMMA 3WK9A 3U6KA 1KTVA 2O14A 3DPUA 3LUKA 3INYA 2NO7A 1KC1A 2E4UA 2QN2A 3OF3A 4XXHA 4OQYA 1ZGZA 2BFMA 3WAGA 5IZCC 2XLCA 3QFSA 2DETA 3LNTA 2XRMA 2ZZKA 1XZGA 1QORA 1CUIA 4JJIA 2DKNA 4UBKA 3NATA 4ACAA 1KK0A 1VE5A 5AKHA 4PN7A 1KIAA 2C95A 2D8MA 1BE0A 3JASB 4AS3A 2VOJA 2JEYA 5B3LA 2ADFA 2O0KA 3BQNB 2QUBA 4RCVA 4YR7A 3GMIA 4BLOA 3D2CA 5JCOA 3SZUA 1A0OA 3JPYA 1NT4A 2QZPA 3QP9A 4ID3A 3VDNB 5CM8B 2AN9A 3PDJA 1OC4A 4LGVA 4PLYA 4B44A 5KPDA 3VR6H 4FT4A 4HNSA 2Q28A 1GNLA 2XE7A 1MEJA 2NVUB 4DLSA 1G5TA 3ZDYB 1UL1X 3RIGA 4C1BA 4QGSA 3SVTA 3ER9A 3SEZA 3GLFE 4LZJA 3T7KA 2O1WA 3AR4A 3OZFA 4IIGA 4DF3A 4DIDA 3MWFA 3WHPA 5L9AA 4QM6A 2GYWA 3LDUA 1TUIA 3B1JA 4XUGB 4CKWB 2QG9A 5IH7A 4E5VA 4B45A 1I32A 4LGYA 3ZI4A 3E4CA 4B6OA 4DBLC 5KJEA 4R0MA 5J63A 1XEXB 1HTTA 1OUMA 1RKBA 3I9NA 1U80A 4ODIA 3KPUA 1DADA 3F9RA 2Q7OE 3VOAA 4CFSA 3ROPA 3ZJVA 2G76A 3N2LA 5LYJF 4O25A 5FPKA 3DVSX 1JHUA 3CF2A 2X14A 3GJ0A 3ZI0A 4O2AF 3U61B 3M6IA 3D4NA 1FTWA 4CMBA 4JZYA 3CIFA 1M34E 4ZC8A 3GV0A 2WTEA 1U8FO 1IXKA 2BGRA 3ILXA 4QRDA 3HJGA 3NGMA 3AM5A 4M87A 2GZDA 4QU0A 5KX5B 4Z2YA 1NXVA 3MWLA 2XVMA 1H6CA 1W4BA 1HQKA 2ZYSA 1EBFA 3DCNA 3FGZA 4S3MA 4J0DA 2FDRA 4V0OA 3COSA 5AJVB 1ZUWA 4C0JA 1QTIA 5THQA 3TOCA 4AYWA 1FSFA 1Z17A 4FFBB 2JGNA 1X9IA 4RL6A 4TMYA 4U2FA 3U3RA 3IVXA 5PGMA 4YMVA 3H1AA 2AFVA 3CO0S 1ONNA 1N8NA 2BIFA 1FMTA 3AZOA 1C7JA 1J1IA 1H8ED 2HQBA 3HHEA 3T4PA 2JVKA 3E3MA 3BXHA 3C8HA 4ZYTA 1ORDA 3BJMA 3DT8A 4CN9A 5F9HA 4O5OA 2PQ0A 4WY8A 1NXXA 4MKIA 4I9GA 2VJQA 4XOUA 4MRRA 1A9PA 1DC7A 1H6AA 4JIGA 3G9UA 3A4VA 3P96A 2YIJA 4MGKR 5IHPA 4FZ5A 2BF7A 3FMFA 4W9NA 4E2YA 3RJ5A 4NK4A 4U2EA 4DUPA 1KDZA 1OWNA 4O2BB 2CDNA 1EG2A 1YA4A 1VGRA 2QI9F 4JVNA 4YEDA 1ODFA 1JAHA 4LBYA 4BZXA 1E1NA 1JLSA 3NC0C 4WLUA 1UQUA 2DJIA 5EJ5A 2VCEA 3DE1X 4DLLA 3LVBA 1KEVA 1X1QA 3DUFA 4F93B 4M76B 3HUFA 1U0FA 2JCVA 6LDHA 3LF2A 5FWAA 4NOJA 1RMQA 4DMUB 1QQAA 2E5LB 4EA7A 3QA9A 2AR0A 2HSZA 1V26A 4J1SA 3V7YA 1ZMTA 4XWKA 2HNKA 4BWVA 1UT5A 3IA2A 4IIJB 3U9TA 5K6AA 1GKKA 3HBAA 4TYPA 5BWMA 2OZLB 1K3UB 2BEJA 2QJRA 1R6TA 2I2AA 2QF7A 4BJ6A 5JNSA 1HRKA 4FBGA 1XQVA 1LDEA 2ZXFA 1V5WA 4BO6A 5KOYA 1QDUA 3GAMA 3RYCA 2WR8A 3SZGA 1OZAA 3KFXA 3ZS8A 2F9FA 5IXYA 1JEOA 4CM4B 4ZALA 1DBWA 1G4HA 2J4DA 2ZK7A 4Z4GA 2ZANA 2UVPB 4RHUA 1PFQA 3A4IA 4P8RA 5DRYA 1LX6A 2EJBA 2AVNA 3KTFA 4H17A 3GT4A 3L1JA 4MLZA 2QI9C 4KWEA 3HCEA 4R51A 3OA0A 3WLSA 1XTIA 3AI2A 4IINA 2YL2A 3ZEAA 5CDGA 1WXWA 3VNAA 2AZMA 1EM6A 4NENB 2DGDA 4X71A 2DP4E 1WDWB 3T3HA 3N2GB 1C4OA 1W2GA 1UJBA 2BM9A 2NVBA 1CZUA 3JRNA 4A9AA 1PWZA 4HUTA 3O4FA 2FK7A 1RFGE 3KJGA 2Z2JA 2G6BA 5TGZA 4B6RA 3GRAA 1O87A 4I1RA 4TMWA 4UBJA 4ZOLF 2ACWA 1TD1A 3E1GA 3MTEA 2GARA 5FOSA 3R76A 4JB3A 5H83A 4OI2A 4BX0A 3PD7A 5KWVA 5LMCA 3ZNPA 1RBQA 2VXCA 3DZKA 3TH5A 4N8EA 2Z6AA 4B9EA 2DQZA 3PDHA 2N1BA 3BFJA 3GVHA 4PZDA 4DYHA 5KQRA 5ELLA 1W9HA 2VH2A 1IN4A 2HF8A 2ZRLA 1ZVKA 4O8ZA 2YQ5A 3AOEA 4ICIA 4L4SA 5E2IA 4ZK6A 1J5EB 1QP0A 2VDWB 3OU2A 4IGAA 4IJ6A 4AJ9A 4FYYA 2DUMA 1RTKA 2A6PA 3A06A 3D1JA 4ZOAA 5EXXA 3SJBA 4LXYA 1CG6A 4IGFA 3I2YX 5JECA 2LTAA 2G4LA 2GESA 5ELXA 2C5EA 3W8EA 1I3NA 3VYUB 1QGED 1WXQA 2BFEA 2Q5EA 2VKQA 5FKJA 3DE2X 1RZ3A 1YSCA 2EBWA 5DHTA 4JL8A 3V42A 4UHCA 2C8VA 1Q14A 4AC9A 3OQVA 1I0IA 3NHYA 4LZNA 4CBVA 4HS9A 1Z5OA 4BNJA 2ZM5A 1EE2A 2CMFA 3KG2A 1RP7A 3P97A 1BCRA 3PIIA 4KH0A 1IUNA 1FF9A 4JU9A 4BAGA 4KC0A 2H7VA 4TL9A 3UFBA 2P0AA 4DBLE 4AN4A 4DABA 2JK0A 4OHBA 3QV1A 1ZW6A 1UPFA 5E7JA 1XNHA 1BMFA 3PITA 1V96A 1GGJA 2H0RA 3K6RA 1WUKS 1IG0A 2B4RO 2ZP1A 5EQDA 1UP7A 1RP1A 4JT4A 3EX7C 2YCLA 1DVRA 4WOBA 2HA0A 1PVVA 4BGEA 5LOVA 2DWOA 3KV3O 1CBUA 1IQPA 3UGTA 1TQHA 1T5TA 5HILA 2Q2WA 3LK6A 3RNLA 2FU5C 4P32A 3T94A 3U37A 4YRGA 9ATCA 3DEKA 3HM2A 2C2MA 1AKQA 4FW9A 2GXAA 1DEHA 1PV2A 2G1KA 3G9ZA 1PK9A 4HDAA 4TYMA 4PZ0A 3LXUX 4NZMA 1EAYA 3R5HA 1R4AA 1A7AA 1B14A 3IQGX 4UDNA 1ZJJA 2RIPA 4J0CA 3A6LA 5T6MA 5LNK6 3PC8C 2MYUA 5JCJD 4PSAA 2KMLA 4ZCIA 1R7RA 4FFOA 4G1BA 5KYUA 1NT2A 3T5PA 3MQFA 1B74A 1K88A 4O4JA 1XZNA 1P19A 2GD1O 4YJGB 3A9VA 3OECA 2GYUA 1H0SA 3OE5A 1V9LA 4V24A 4AYTA 5HPYB 3NUZA 4F60A 4FJ1A 4CLOB 2FJ0A 5HHTA 5IFLA 1GRCA 3R0XA 3KS9A 4TRMA 4TWJA 4EUSA 3W2TA 4YMGA 2VHZA 3EDRA 5D00A 1G19A 4REMA 3ZCRA 5BR4A 1AQNA 3BCHA 4M7RA 1H66A 5I8WA 2CMGA 3G0OA 3A2MA 2OEPA 3PLRA 4YRJA 2A7XA 2GMWA 3N7TA 3NIGB 1BH2A 3RVPA 4QLBA 1VP9A 3JX9A 1P9OA 2IVFA 3HACA 3W8DA 4CDGA 1E2IA 3MOSA 1N6NA 3QXGA 3BXXA 3IBSA 1PUIA 3SZMA 5J2UB 3WLRA 2AFIA 3CWZA 3ZDDA 3ME5A 2ZDGA 3F49S 2Q41A 3EUFA 3TEJA 2C4VA 2HDOA 4JC8A 1W76A 5IT0A 3B3JA 1C7FA 1G8SA 2X2FA 4Q3BA 5TDHA 2XZDA 4EARA 1I0ZA 3A1SA 1L9KA 3DLCA 3FB4A 4JLKA 2R6DA 3X3HA 1VB3A 1Y7LA 1I9CA 2RGUA 3URKA 4PYIA 2QAGC 4W1QA 4WOKA 1OAKA 1UKZA 3ICCA 1ADBA 4PAWA 3PPIA 1TRHA 5CFQA 4KGVA 1AE1A 3I2GA 4D3DA 1D6JA 4C7MA 3KQLA 1C0IA 2VFAA 3B7WA 1IBSA 1Z4KA 5AH0A 2A7QA 3HV2A 1EDOA 4YI5A 1RLJA 3GELA 3TBFA 4HP8A 1OT3A 1KWGA 3IIEA 2C5LA 1ZYUA 5A4KA 1ZIOA 2HBZA 3NHMA 3M2PA 4KDCA 5EQTA 4ZVRA 4QX6A 2DH6A 6GPBA 2W2KA 2RI6A 4IIBA 3DLTA 1O89A 2J0UA 4GPD1 4Q7LA 3HWRA 3Q41A 4P4UA 1LW7A 1C4WA 2YFHA 4MJ3A 2I03A 1QU3A 1B23P 4BQPA 4A8JB 1UKVY 1PSDA 4CLDA 2BM0A 1W94A 2E4YA 1SBTA 4PSKA 4GGOA 1PJAA 1THGA 1ZI8A 3AEZA 3IMFA 2ID4A 4LKOA 3RSLA 3S4YA 1MVNA 1N6OA 2HF2A 3NUGA 3WJ1A 5D3MA 1RM5A 3I5XA 2C2KA 1Q6ZA 4BKUA 1U6KA 1SOMA 4HVAA 4YJ2B 1TU0A 2YIDA 4GE0A 3MAJA 4NECA 5HM8A 2O20A 1UPBA 2XA9A 1C30B 4DM3A 1E0AA 1Z45A 2W43A 1RZRA 2JH3A 4D0RA 1PQYA 3ZDCA 3GRVA 5G4KB 2EX1A 3QFRA 1UM9A 4IGEA 3NXKA 2V03A 3BK1A 3E9EA 3PRJA 4A2CA 5IBRA 1QGZA 1UWLA 2AQHA 5BXQC 3GGJA 1OH8A 4YUVA 3HCNA 4LAFA 2Q8QA 1Z38A 1G8KA 3D8HA 4E4RA 4GWKA 1M2WA 4HB4A 2G9RA 1TVEA 4FYVA 1LSUA 2B7LA 4F2GA 1NM5A 1QRDA 3B8HA 3N74A 4E5UA 4XWOA 5J4HA 4NOLA 1CDZA 4V03A 2AJCA 5FLXA 2X7HA 2WIJA 1Q1ZA 3MXTA 1J2EA 2IHJA 4C4XA 1DAIA 1L5SA 1RYFA 3QJ5A 4MS3A 3QUSA 4RAQA 4BCDA 4U8HA 4F4JA 5CB4F 1A9XA 2IWHA 3BTOA 5AKZA 1NVDA 1WQ1R 2OCDA 1OAOC 2IEAA 3T12A 3K0AA 4Q39A 4CIVA 1GQ2A 3PNYA 2M6LA 1RXVA 4YJFA 1TO1E 5IM4F 4RMJA 2Q9AA 3BGDA 5GPBA 4DLNA 4JC0A 4P38A 3PHHA 3VJMA 3L8DA 2HWUA 1A2OA 3JQ8A 2M6KA 4YRSA 1I9GA 2QW1A 1CVLA 3EQ7A 1K75A 1T0IA 2QQ5A 4HYQA 1GQOA 5LZ9A 5T67A 2I3DA 4C2TA 4X8MA 1QYDA 1OTHA 5DNYB 3FNHA 1SXQA 1MJ5A 4MR8A 1E61A 1UCFA 1LK7A 1Z25A 3LVQE 4JLOA 3ZBQA 3VA7A 1PF7E 4C0QC 1L7OA 4XGKA 3STTA 1R8XA 3AFHA 4AD8A 2GD0A 1CRWG 3FWHA 3GNTA 4UFPA 3A9SA 4KSYA 5GP1A 3SYKA 4ZQEA 1FXUA 3WYBA 1XDDA 2Q5HA 3AZQA 5KIAA 1I3LA 1W2WB 4CF4A 1S8OA 2HF9A 3CG0A 1XD2A 5BVHB 4P7KA 4N7BA 3COZA 3QEMA 2ORIA 3O8CA 4KIUA 5KS2A 1DV2A 4V38A 4C5BA 1HG0A 5K20A 3BMOA 1X1RA 4K40A 4ZXPA 4DNXA 2W6JA 3A3YA 3DAHA 1D5WA 1DIRA 3W04A 2P65A 1A04A 2BH2A 1T0UA 2PT6A 4DMLA 1LBEA 4CQLA 3E9CA 2OBLA 2FZ5A 5DCLA 1KTIA 1GM5A 1CS4C 2V58A 2OXIA 4EITA 2UXDB 2G6TA 3EN0A 1MQSA 2WF7A 2Q2QA 1RPAA 4DUGD 4DFDA 5T6BA 1KAQA 3NMUF 2GCPA 3IAXA 4F9EA 3UFXA 1KEEB 2F3PA 1A98A 4MIEA 1NZDA 1OFTA 1LRLA 1P1BA 3C6ZA 3GR6A 4IV5A 3Q7SA 4QBHA 2BEVB 5FR2A 3ASYA 1VXRA 4CMHA 3GG2A 3DWEX 3Q9SA 5KTSA 3M81A 2Z6QA 1O1YA 2C00A 2WAXA 2WUVA 2VWGA 3H9CA 4WCVA 1J97A 1D4AA 3QM1A 3IP5A 3BSYA 3T5CA 3TSOA 1RBMA 2PQ2A 3SDZA 3TMAA 3HYSA 2PUBA 1DUIA 1EB9A 4NU6A 1F4PA 4HEA1 1ZGJA 1CUFA 1UXIA 3ODPA 4QARA 4RY9A 1NBEA 1R00A 2O9JA 3KSMA 1W34A 4JQSA 3EB9A 4AQ7A 2YS6A 2O5EA 4RK5A 3FLAA 2IRWA 2C7QA 1GTSA 3CZ9A 1QE5A 1SWVA 1K8XB 3ZE1B 4OQMA 1J90A 3QVVA 1QHXA 3ENWA 4POAA 5DMXA 2K7FA 2O3QA 3WTBA 5G0TA 1LPOA 3TG2A 4AY6A 5BSKA 4DN6A 1XRSB 1SCNE 2PX3A 1Z6ZA 2P1RA 3OQHA 4KIGA 1BGVA 3U5ZB 3UK7A 1FJ2A 3WK8A 4ZDIA 1BKDR 1DAFA 4JLUA 4RHCA 4FW8A 2BMJA 3U5TA 4L5AA 1FUEA 4G85A 2W9XA 5KBYA 13PKA 3GCGA 3PUKA 4OQZA 4WBNB 1A3CA 1IPEA 5K0JA 2YHUA 5HTOA 3C87A 1XLTC 1CQZA 3ABQB 3QNMA 4W5QA 1XPUA 4WLVA 3QY0A 3TCNA 3HO8A 3BD6A 4YB8A 4DLBA 3AKDA 5F23A 4QAQA 1ZRHA 3DE3X 2Z57A 2FZ4A 4GC5A 2O8BA 1EFLA 4TT3D 1GP2A 3B3FA 5C7OO 1QS0A 1UFVA 2J3HA 2NO9A 4PGHA 3W8RA 1G20A 1KO8A 2J9GA 2HK9A 3DV2A 5IKXA 2HHLA 2HF7A 3AJ8A 4U63A 3PR1A 5C1OA 2IEDA 4NJEB 2NU7B 1P4HA 1WBJB 3UICA 5AVVA 1PX2A 1IH8A 3NEPX 2PGAA 4X8OA 2JIZA 1MRNA 2ZAOA 5JS1A 4ZARA 1QYWA 2IYRA 3ZWQA 1FPQA 3ZWMA 4NCJA 3FOZA 3ZIUA 4JKIA 2P5TB 2QT9A 4FSDA 4J29A 1Z9BA 2VBIA 3BAFA 1WLSA 3CYFA 5DYTA 3C2QA 4R7ZA 5CMLA 3BULA 4HVTA 1MABA 2GEJA 4TXHA 4RULA 1JG4A 2V7VA 2MR5A 3KXPA 1P5ZB 3R40A 1EEHA 1ZK4A 4P4SA 4YACA 1NBOA 4G1EB 4MZXA 2I4TA 1XQ6A 3K1TA 1WZ2A 2HU7A 4RGVA 1ML4A 3S0JA 3ANLA 1DMRA 1ZD4A 4WXRA 4C7BA 1WSWA 3DR5A 2WU0A 3VDMA 5JPCA 4EZBA 3ORHA 3L8CA 1LNQA 3EGWA 3IT3A 5M3BA 3CU5A 2BUAA 1SPXA 2R1VA 3H1PA 3LLMA 4OIFA 4IR7A 4D8TA 3K9GA 1JR3A 4EP1A 1GDTA 2ORYA 1YI1A 2CXRA 1UBTS 3KKLA 5FLKA 5JXIA 4TN5A 4O4IB 1CZKA 2QW8A 2YHSA 4NBSA 5LB2A 3DR3A 4EW6A 1K08A 1OX4B 4PYRA 5DI9A 3RSQA 1SHKA 3ZOZA 4PG8A 3CLRD 2C4HA 4XQGA 2TSYB 1SR8A 1EP3B 3A2NA 3CZCA 2XOEA 3D6UA 3LLUA 3GEIA 3DOEA 5AI0A 4A16A 4NCBA 3P9QA 3HWX1 3LYAA 1G6Q1 2WJ6A 4D4KA 3ZTYA 1YZQA 2Z58A 1FUYB 3R3YA 5EZ5A 2FUEA 3B13B 1HYHA 4YCAA 3NWOA 1KVUA 3GPBA 2BFEB 3WLLA 1EKXA 4NQZA 5B53A 5TT0A 3U3MA 3VDRA 4X60A 4GGMX 1U7XA 3BIFA 4WMLA 1JL3A 3OTHA 1CB0A 1EFTA 4F45A 1EJ2A 1QGDA 2DPMA 2LPMA 1N2HA 3NO4A 4Q4LA 4XYLA 5IF9A 5AJTA 2DT8A 2XIJA 3R5TA 3RIMA 3RYTC 3TR0A 1U8CB 5A6VA 1IBMB 3HADA 1O5OA 2QSYA 4I4TF 4C0KA 4KN5A 4LV8B 2ZTSA 1RQ7A 3V9PA 4AF6A 4MTCA 2Z8XA 1N4AA 2Q2NA 4GOKA 1WV1A 2XNDD 1IK4A 4OL0A 4YK7A 1OQAA 1SIUA 3QUTA 4K1LA 4EAQA 2VAWA 5LXTB 4CM9A 4CQMD 2COUA 4O4LB 3WIVA 3BMCA 4YJ3B 4ZVKA 4YH1A 2H1CA 5E6RA 3FKSA 5LOVB 1II0A 2A9QA 3Q8LA 3P0FA 1I5RA 2XA2A 3SIPA 2I29A 4HX5A 2OFOA 4P7JA 5AK5A 1C1XA 3UMFA 2ZOSA 2VQDA 5IKMA 2VDNB 5H68A 1XJQA 1N1GA 3QFCA 3W05A 3DBLB 5KNBD 2AKEA 5JIBA 3T9EA 2H52A 1QC5A 3HCCA 4RE5A 3V55A 5D3QA 3M6WA 3R4VA 5TB5A 5A05A 1S8FA 4G63A 4IH4A 3GCWA 1KSFX 1YFKA 2ZPAA 4WADA 1L1FA 3A2LA 4M1YA 1EZ4A 4MEJA 4R2IA 1N0WA 5AHWA 1WMBA 4DGQA 4ENVA 2NYAA 1REQA 3SR4A 4N0EA 1ZU5A 2VYFA 3AEQB 4Z9XA 5MFZA 2H1OA 2Q4EA 3E5RA 8ABPA 1GT6A 2QRKA 1TTQB 2JI7A 2Z98A 1P45A 3A6JA 2FQXA 2Q1XA 2Y05A 1E6UA 3G2PA 3MOIA 4HGOA 4KQWA 1QDLB 4R1NA 5GZ6A 5M29A 3ROEA 1GSAA 4HK4A 1UBHS 5GONF 4D0LB 5HZHA 3F6BX 3IDFA 3UT6A 3RTAA 4Y2QA 3BZBA 1RI4A 2R6ZA 3EG9A 3H4VA 3O4IA 5FOUA 1ETUA 3UNXA 2WM3A 4NBKA 4ZDKA 5AVQA 4BMPB 4CLHA 4JD5A 2FWJA 2E1PA 2K87A 1GLNA 2HT6A 4L0MA 1YRAA 3QLVC 4IHJA 2WB4A 5A62A 3GT0A 3WKCA 4EW2A 2AR7A 3ET4A 3T8YA 1NVMB 2P9CA 1M2OB 1XK7A 2FZKA 2RDMA 1DKRA 1TA9A 1XLWA 4OUKX 4BNXA 4GSKA 4LS3A 2AFIB 3J81A 3F5SA 2O52A 3A4YA 4RTOA 2GOYA 3KZXA 1F6DA 2GBIA 3DNFA 4UULA 4FJ2A 1G8JA 2VZLA 5H0IA 4AXXA 2VSFA 2DWUA 2M32A 3JSXA 3KVOA 4TSRA 2J6IA 1N5JA 4CIXA 4DRXB 3UK6A 3BBPA 2FP4B 4KVZA 4IIYA 4AKEA 1FTYA 2GEUA 1YOVB 3MUOA 5EXSA 4DMMA 3I39X 3NPMA 4BNFA 2ZVDA 2ZYDA 3C41J 4DY6A 2CXXA 3DFIA 4BO9A 2TMDA 4TMXA 3S5UA 1JILA 3WL6A 4DIOA 5B3KA 1F12A 5DNVA 3D5EA 2DUNA 3GP3A 3NZEA 2D00A 4H08A 3JD1A 3CX7A 3P9YA 3A1FA 5CXUA 2ZRDA 1QFYA 1MNQA 2XHEA 3OKFA 1OR8A 4Y9SA 2GQ0A 3ELUA 2REQA 3L7YA 2AW3A 2W2KB 3OZ7A 3AR5A 4NG4A 2FW9A 4TKVB 3VR0A 4PRLA 2QD2A 1ZBQA 1AK2A 4YP9A 2GCNA 1YJBA 4BFTA 1RADA 4QU8A 2D6FA 1Z75A 2WSSA 3AG5A 4UPEA 4IX9A 1GYRA 3DZDA 3FZNA 3QXSA 1CZNA 4XASA 4P81A 5IC4A 2I2XB 3TCKA 1PD1A 1GRNA 1P33A 3D7MA 1QRTA 3TS1A 1NRWA 3EISA 4KXQA 5D3MB 3CS3A 4NCHA 1UDWA 3REQA 1E2LA 1HLDA 2IW1A 2SNIE 1DC6A 2B37A 3SEFA 5ILOA 1LPSA 4UMVA 4QPNA 5J40A 1WETA 5BSVA 2R79A 1NXTA 2PX5A 1DTSA 1PJLA 2PA3A 4FS3A 3RSOA 1TCVA 3PGJA 4IXWA 1C0KA 2AJDA 5WRFA 4MI6A 4N3GA 1U5BB 4HX2A 5HF8A 2COEA 3C3AA 3QWAA 1KO1A 2XYPA 5BQ5A 5T8KA