5KAMA

Trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with inosine 5' monophosphate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
158
Chain Sequence
TSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures and inhibition of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
total genus 47
structure length 158
sequence length 182
chains with identical sequence C
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kamA00
1UPFA 4F8EA 3H83A 3GEPA 4RV4A 1DQPA 3ACCA 2PS1A 1JLRA 1I13A 2JBHA 1STOA 4LYYA 2JKZA 1QB7A 4IJQA 2P1ZA 3OHPA 4P80A 4RHTA 1CJBA 2EHJA 3ACBA 2GEBA 4JLSA 1TC1A 3LRTA 1I0LA 1OROA 4P83A 1OREA 1YFZA 1VSTA 2WNSA 4LZOA 2PRZA 1VCHA 1XZ8A 3GGJA 4LZNA 4RABA 1A97A 1PZMA 2XBUA 5ESXA 5HIAA 2AEEA 4P3KA 1QCCA 3HVUA 3OZFA 2YZKA 1G2QA 3DEZA 1QB8A 3S5JA 4RACA 4RANA 1J7JA 1QK4A 1A98A 1DKUA 1Z7GA 5BRNA 4WMLA 4RHUA 1L1QA 5JSQA 1LH0A 1IBSA 1HGXA 1UPUA 4P86A 5IPFA 1XTVA 1BD3A 1DQNA 4M0KA 1OPRA 4PAWA 4P82A 5BQPA 1A4XA 3NAGA 1G9TA 1A95A 1P17A 1QK5A 1A96A 1R3UA 4TWBA 1P19A 4ZFNA 1D6NA 1MZVA 4RHXA 1ECGA 1UFRA 2JKYA 5IAOA 1P18A 4QYIA 4OHCA 2E55A 4KN6A 4JITA 2HCRA 4RHYA 1VDMA 2PRYA 3QW4B 5K51A 4M0UA 1ZN7A 1NULA 1XTUA 1A3CA 3DMPA 1W30A 4MB6A 1I5EA 1FSGA 4RQAA 1P4AA 3OZGA 5HKLA 1L1RA 1JLSA 1QCDA 2H08A 4RAQA 5KAMA 1WD5A 3G6WA 5KAPA 1ECFA 1ZN9A 3MBIA 4X44A 2FXVA 3ACDA 1TC2A 3O7MA 3MJDA 1BD4A 2C4KA 3M3HA 1I14A 1ECJA 3N2LA 5E38A 4P84A 1GRVA 3EFHA 1GPH1 4X45A 4QRIA 1U9YA 4S2UA 1I0IA 1ECBA 1XZNA 1ZN8A 1G2PA 3DAHA 4LZAA 5BSKA 1Y0BA 4RADA 5ESWA 1QK3A 5EUCA 1BZYA 1U9ZA 4PFQA 5JV5A 4RQBA 1O57A 2JI4A 1AO0A 1ECCA 4FYMA 3GGCA 5BQOA 2VFAA 4M0PA 1DBRA 1DKRA 4P81A 2H06A 3KB8A 4Z1OA 3LPNA 1HMPA 4RAOA 1V9SA 2IGBA 1G9SA 2DY0A 1O5OA 4QYIB 4WN3A 4LYGA 1XTTA 2H07A 1NONA
chains in the Genus database with same CATH superfamily
1DQPA 4EEXA 4AP6A 2O9JA 1ZRSA 3WOHA 4IUBS 4RPIA 2EG5A 2DR3A 3QVUA 4QFMA 1H22A 3QUCA 1E20A 1Y8CA 3FLMA 1V8ZA 3OF3A 2ZYDA 5DPMA 2G0TA 5DN6A 1O6GA 5BWMA 1NVFA 3CH5A 4CI0B 5I7UA 3FYTA 4IJMA 2ZTUA 4DLKA 4G67A 5FBVB 4MRRA 3FKSA 3P27A 2AFIB 4QNRA 4TWRA 5CNKA 4RMJA 2ODTX 4OGGA 2H5JA 1DIGA 1N6IA 3CZ9A 1OB2A 3GLRA 1DWQA 1XVIA 4S1PA 2ZI3A 2QVLA 3V55A 4BV9A 3U3XA 3PXAA 2HAEA 2RIRA 1UAAA 2O8FB 1NXTA 3EMVA 3AKDA 3I64A 4G0NA 3DZDA 1UWCA 1X7YA 1DDGA 3A8TA 3QIVA 4D8TA 2HV9A 3N8NA 4PZCA 4EJFA 2E4ZA 3D8BA 3NHYA 4AL4A 3AU8A 3JASB 3ETGA 4G0ZA 3HWSA 1BCSA 1QPGA 3MHPA 2UYYA 5GGYA 5F2NA 3E03A 3R3JA 5LP1A 3IT3A 3CEPB 4ZQHA 2X86A 4NYIR 2ZZNA 2I34A 4AY2A 1DJNA 2DPHA 5BP7A 3QMMA 1Z0SA 1X9GA 1BG6A 4UHKA 4OUDA 5CX1B 5LQJA 1NLFA 4FZJA 2PM8A 3BWCA 3EF0A 3FZQA 1PZXA 3IMFA 2I6QA 4FHFA 1CJTC 4HZUA 4Y7DA 1KQNA 4BO9A 5B3KA 1E1MA 3DH0A 1IY8A 3D6VA 1YJCA 4KQMA 4DE5A 2Z1MA 4C43A 1XD2B 2WPDD 1XE3A 3IVAA 3KSBC 3BGDA 3H8JA 1Y82A 4MEJA 3L46A 4MGHA 1XMOB 1Q74A 2CXHA 4HGRA 4HI0E 4RK6A 5HFAA 3VDMA 2C5EA 2YFQA 3R0VA 4TMFA 1Y3AA 4EB6B 1UBTS 1C80A 1CUWA 1QGUB 2YVAA 3PPVA 5KTRA 3THWA 1AY0A 3FY4A 5CXSA 4O1IA 2VDPB 1ZM2A 4KXYA 4PLWA 1QHNA 1BD4A 1PUXA 2FSFA 1ISMA 1PJSA 1A69A 1XQXA 3LDGA 1WNTA 4GU5A 3EG5A 3N6VA 3NGMA 4KAAA 4PBTA 4UBJA 2PX6A 1D5WA 1MRSA 4FMPA 2DUNA 3KLNA 4HDNA 2Y6UA 2VLIA 3CEAA 3C2QA 3DQZA 4L85A 5LBIA 4BAUA 2HSEA 4FQ7A 1Z2DA 3IBTA 5K0TA 5SZKB 4CMGA 3INYA 4ZC8A 3X1XA 4PYIA 1TA0A 2VOEA 2B4RO 1KFCB 5JNVA 2XZDA 3KYCB 1SG6A 2H7XA 4RM3A 3QPUA 5F1YA 3VZQA 4ZK6A 1RMYA 2WJYA 5KSYA 2IS2A 4B9EA 4L73A 3FRIA 3C5EA 4L5CA 4M9XA 2OXEA 2FRVA 2JATA 1DEAA 2ZUUA 4ESHA 4H17A 3BC1A 4LV5B 5I7EA 2ZWPA 1H2RS 1M2VA 1H85A 1WL8A 1GA6A 1QLWA 2RHLA 3D43A 3FSGA 4MW2A 1M6VB 3HVKA 5CGZA 4BB0A 4BLRA 4CMIA 2C7QA 4LXYA 3FNQA 4X1KA 1UIMA 3R8CA 1P60A 3BREA 1FDVA 1NDUA 1O94D 1J8YF 2RAVA 4NDAA 4ZYYA 4LCBA 4TT8A 4GVPA 1L7BA 4IV5A 4RPHA 4YI3A 3NP9A 4EUEA 3GLIB 4JYAB 4KJXA 3RT1A 2X3FA 4OXXA 1T43A 4G2NA 5KNLA 1PEAA 3KOYA 1GZSA 3KUDA 1GGFA 4HS9A 4F8EA 1RKVA 1JDPA 3ND5A 3JAKA 2GO7A 2VPTA 3M1AA 2IVZA 5HZMA 4FYWA 5K3SA 3KJZA 1RC1A 2NVOA 2QRJA 3B89A 2P1ZA 4NBUA 4I3HA 3AG5A 1IUNA 1VLQA 2XHZA 3SVZA 3BD8A 4JLKA 4MLPA 2QM7A 3ACBA 5LNK1 1N2EA 3H0KA 1ZYUA 3U6BA 9GPBA 2IXBA 3RR2A 1CJCA 4Q4HB 4TV9B 5JNTA 5BW5A 4D2IA 2IYVA 5F2OA 5KSZA 1A1SA 4LVOA 1BVUA 2VJYA 4FWBA 1FUKA 2Q6LA 4MUJA 3RRFA 4CM1A 2JIDA 3KQYA 4XSVA 3RYIB 1R6AA 5DLDA 5BT8A 4UPEA 1Z3IX 1TT5A 3TW4A 1PS9A 3IJ5A 5A5VA 5JY1A 4S04A 3X1YA 1O54A 5I6DA 1JE0A 2PO5A 3I01M 1NUQA 2CD9A 2FEKA 1CZNA 1KR2A 4OSOA 3AL0C 4Q66C 4UM9D 1E79A 1OYVA 1M5RA 4UTZA 4EGFA 3TGPA 2XT0A 2YRWA 3B70A 1QKIA 1ZIXA 3HNRA 1JH8A 4ARAA 4IIYA 4R2XA 1J00A 3VOTA 4O4LB 4YYZA 1RHUA 1E69A 3OTIA 3RO7A 1VIDA 1DBQA 2JD2A 2JHFA 2ZSKA 3M2TA 4H7EA 1KOLA 4RF3A 5GJCA 3STYA 1RJDA 1VL1A 3ZIDA 1LFAA 5ITSA 1FPQA 5ICMA 3PNOA 1XRJA 1Y8RA 2ZYUX 4RMHA 3VKGA 4FMBB 4OHCA 1UIRA 3CZAA 4KQJA 2Q3LA 4ETWA 5KC8A 2GDJA 1ENYA 3DUWA 1FQKA 4MLDA 1NASA 4R5HA 6REQA 3VR4D 5GVRA 1OHHD 3TQTA 3IGFA 2NPFA 5HK9A 2Z4TA 1VB5A 4B8WA 4E2YA 2WUEA 1E1CA 1C3VA 1J7KA 2QQ5A 4JUAA 5ICSA 5DIFA 1SY7A 3T5AA 4IL5A 1T1SA 3ZV6A 4BASA 5JEDA 4YDSA 1J8FA 2CLIB 3RS7A 2CDBA 4R1NA 1XPJA 4HEA6 4IG9A 2QTZA 1J0CA 1E9EA 1ZISA 2Q5EA 3LQ1A 4HNRA 4X3OA 4BE4A 1MUUA 1PV4A 3WZLA 4BNHA 2MJLA 4HAWA 3JARA 1Z56C 1U8ZA 3KL4A 5AJVB 4Z9FA 4DSTA 1KE1A 4A1FA 4PQGA 4D3XA 4YRJA 2BSXA 4KVGA 4C78A 2BEVB 1UAYA 1MQAA 3U2QA 4RZQA 1GN8A 1NQUA 5P8WA 3EGDB 3N6RA 3OICA 4RENA 5C4MA 1IDOA 4B17A 1KOFA 3V7UA 3BYZA 1FYDA 2AFHE 1PJCA 1ZVMA 2A0XA 1MU0A 4RFVA 4TTSA 4AN0A 2ADFA 4Q3AA 1SVWA 1NRJB 2RH4A 3M6WA 4QPJC 2PUWA 1JFLA 3DLTA 2O06A 5D7BA 2DFVA 2V6MA 3I6YA 4PXYA 4PG6A 4IBOA 3DAPA 3A9WA 1ZMRA 3MWYW 3PLAE 3VR3D 3CX6A 4H35A 4QUAA 1SG9A 1QSGA 4PHCA 2A78A 2Q1WA 4ENPA 3EIEA 3O4RA 3QK7A 3PD7A 5JYBA 1G19A 4O0MA 5C8YB 1TEVA 1ZOPA 4OM8A 3WDSA 3AYXB 4K9MA 3VZDA 2YXLA 4XA8A 3OTGA 4UFOA 2H07A 2JIZD 4JI7B 4IXMA 3GT3A 4BQNA 4ER0A 1JMKC 5JLAA 4A1OA 1BW9B 2UXBB 1WQ4A 2GPBA 2NTVA 4L8YA 1UXGA 1ZEJA 3GARA 3JQ8A 3P9PA 1RM0A 1RBMA 3KDAA 4L4ZA 4PZ9A 4IXDA 2CSXA 5FFMA 3DDNA 3N8KA 4HPWA 3D2LA 3JQEA 4UFNA 1NF8A 3VZPA 4Q3CA 4WT7A 2PUBA 5E6SA 2XOEA 3C4VA 5A62A 2GFIA 1URPA 3K6KA 2EIHA 1D4AA 2XQIA 5FB3A 3KEMA 5AJZA 4II2A 2H16A 1YDEA 3DWEX 4MV1A 4CCYB 3SXJA 4DILA 1WU7A 5K0FA 5C7YA 3AFNA 5FAXA 3H7IA 1DADA 1T2EA 3RRXA 4QYXA 1N4DA 4TTRA 1XZFA 2D2XA 2TSYB 2X8BA 3HABA 3RYFB 3UH1A 3A2LA 1EWVA 5BMVB 4MEAA 4MKFA 1JNYA 1HKUA 1W1WA 1MO6A 4UU0A 3IQGX 3KQMA 2WUVA 3HYRA 4JN6B 3KB1A 1WR8A 4D3DA 1M8GA 2IF2A 4YJHA 4LRQA 1G21B 2C4NA 1I33A 2RHJA 1WDWB 5IBPA 4CIDA 4C0QC 4DR6B 3O4VA 2O7NA 4BC0A 4KBFA 1XFAA 2JS7A 4E4RA 1QYRA 5KJ1A 5EMLA 3WJ7A 2CC2A 3W3AH 1AV7A 3JD1A 2W42A 2R0QC 4EI9A 1Z7BA 4C29A 1ZK2A 4A7PA 1NJSA 1JDSA 4B3TB 2Q46A 5KKNB 1HDOA 221PA 4RE6A 1AHHA 1JWLA 4IDCA 3QX3A 3WLOA 1Y4ZA 2HF2A 1G8SA 3WMEA 2HCFA 4G9GA 4EF5A 3ZVKA 5K3EA 3HJTA 1Y48E 2ZEJA 4DM7A 1UDBA 4HGOA 3AFMA 1R5OA 2N75A 4IMPA 1JJ7A 4AT1A 1Q7TA 1X0XA 1AU9A 1G6OA 3AKEA 3AT1A 2B4KA 3AFOA 3HLKA 4QDUA 3WTCA 3V8NA 4ZO7A 2GLTA 2G71A 4HS4A 1MA3A 2XQVA 3HB4X 4KK3A 4A0GA 1OC4A 1RHJA 4CIWA 4K0KB 3TX2A 1Z4PX 2O7VA 4E03A 3SHWA 1KDYA 1IN6A 1WJGA 4MJ3A 2F3UA 1SOVA 2O2IA 1YJ8A 3E9QA 5K0ZA 1DUSA 2CVFA 4WUTA 2HDOA 1MVLA 1XKQA 1UBFA 4NCKA 3TKAA 4MROA 1B41A 1SRQA 5K4AA 1Q1AA 3CC8A 4GWLA 1KZ6A 2DCUA 1U65A 2Q3CA 2AE2A 1TPZA 3DM5A 3DNFA 1EDBA 3R0ZA 4JL6A 4PHGA 4UBNA 2D1RA 2CYCA 3X3HA 3OZDA 3WNZA 3ZS9A 1O57A 5C1PA 1EESA 3FHLA 3MRTA 1G4AE 4FDLA 5EYPA 5B4TA 2GXQA 3RYIA 2RJNA 4JGIA 4ALMA 1J56A 1ZUHA 2W6QA 3PRHA 5JS7A 1PLKA 4J1TC 1JEAA 4QGSA 4WZAB 1G4UR 2EFYA 3T1QA 1C4OA 3ZU3A 2PT9A 5TQ2A 2R66A 2VH1A 3GPLA 2YV5A 1QBKC 2Q28A 5BN4A 1T0IA 2EZ8A 2QUKA 1WB6A 2O8DB 4CMEA 2PUDA 2IE8A 3QVKA 5TQJA 2XYPA 5BUSA 5CYOA 4C0KA 1NJ2A 2EX1A 2HTEA 2NXWA 2Z2ZA 3DS8A 3H2HA 1MJGM 2WFLA 4IJQA 2DB3A 4TTAA 5IAJA 1FTWA 1W96A 2WTMA 3OG9A 3PQ8A 1LZKA 2Q8QA 5T4FA 5BSMA 5D84A 2XW6A 4EUFA 4L9RA 2GCNA 1MH9A 1N0IA 2ZRAA 3TZHA 3KXIA 2R1TA 4JVSB 1NLYA 1S2LA 3A9RA 4U7WA 2YYAA 5LYJB 1U31A 1T10A 1KAEA 1Y3BE 4L0CA 3HE3A 3HSKA 4B75A 1R6VA 1Z5GA 4IIJB 2P9FA 2W2LD 3B1JA 1JAYA 2XCQA 3HVUA 3VYUB 1BQ4A 4G5HA 2I87A 1PCXA 1WCWA 2W4QA 4FNGA 2CJYA 4EB8A 4HAIA 1NATA 3RQIA 5C7LO 3MMPA 2V7TA 3AEQB 1R9NA 1NFQA 2DQ4A 5E9AA 3ZWNA 5AKHA 5F4ZA 2JZOA 4P3YA 1T9GS 2F8TA 4ZT5A 1GZ4A 5ALLA 5FUYA 2JK0A 4IWNA 5JISA 1GKIA 3IRVA 3ZWAA 2JIQA 3EB9A 2VDMB 2OD9A 4L1KA 1E1RD 1X92A 1BMDA 2NO4A 1Z75A 4JGBA 4QUKA 3SF8B 3SOZA 2C29D 4L6CA 4MUFA 5EIXA 4B44A 4H6VA 4C0SA 5EAIA 1UPTA 3WX0A 2XZOA 3LKDA 2A1TS 3H4MA 2G09A 3GEEA 3H04A 2C83A 3AIOA 4ZIRB 3IB3A 2QMEA 1C8BA 3TF5A 1RM4A 2BZGA 1XD2A 2XMSA 4JJ4A 2ZJZA 4LDQA 3PX2A 1WP9A 4GZ5A 1JPNA 3AM5A 4ZVKA 4Z7OB 2X9QA 5CBKA 2H4JA 2JZNA 1ZW6A 4BMPB 1Y4AE 1BC5A 2QLFA 2I80A 2BFOA 3BXOA 2VHUA 2QN3A 4EA7A 5CA1F 1IN7A 4QAQA 5B30A 3JQGB 4XWKA 3EGVA 3OCCA 2HRRA 1IEXA 5FLEX 2YS6A 4G5XA 2ZSIA 4ZN6A 4NG5A 4RY0A 4BRUA 4DYHA 1NZJA 4OA8A 3TAHA 3IBYA 3L77A 5FTJA 5K7SA 1EQ2A 4KACA 3FLAA 3LTNC 2JCYA 2WICA 4HN9A 4ENWA 1DO8A 1VECA 2YXNA 2CVHA 4PZ0A 4ZCTA 2BSAA 1KKUA 3I01A 4HAVA 5CMLA 3T7KA 2Z04A 3FSRA 2ZWMA 4F1KA 1DC6A 2NWQA 4N0PA 1F6DA 3KYDA 2I2XB 2WU8A 4X84A 2Q1UA 2VYNA 4YYEA 1N3BA 2FRXA 1RKUA 3NM4A 4JLUA 4OI0A 1THZA 1UXOA 4W5HA 4RIEA 1F5NA 1FP4B 2ODBA 3FHTA 1M83A 1JR3E 1ZGCA 2WIKA 1N6LA 4YALA 1Z0IA 4D9NA 2AR9A 2ZJ5A 3OLWA 1C3LA 2XUJA 3HVJA 4OXNA 4UQPA 2Q8PA 1MO4A 5KVVA 3C4JA 3I4FA 4MULA 4H7JA 1GZDA 2OCYC 1XTQA 2FA9A 2VDOB 2ZRJA 3QV2A 5H9VA 3UBTA 1XDBA 1Z2CA 2B0CA 1QDLB 1J39A 2PTHA 3I04M 4YRFA 2PIDA 3WKBA 1AUXA 1D5CA 2C7PA 3T1YB 1PGPA 1N7IA 3GF4A 4I9UA 2JDID 3BXHA 4L50A 3PA6A 4W82A 3GCXA 4HQLA 4W4TA 1A9QA 3H3FA 3KRTA 3K30A 3QXCA 4TLDA 3NOVA 5LPNA 3PEYA 1EVIA 1XVUA 1ULAA 3QU9A 2WFMA 3U61B 3FCOA 3AR4A 3LX8A 1R10A 4Y0VA 3EOAI 1EHYA 1QV6A 1U28A 1UDCA 1I3LA 1XHFA 2ORVA 4KNWA 4YJGA 3ZD9A 5K8TA 4EPXA 4YRIA 5TB5A 2VK8A 3LBHA 1KERA 1E3QA 2P2NA 2YMQA 3H8SA 4UNPA 5T67A 2AEEA 1QCCA 3Q0EA 1KMMA 1SCNE 3NDPA 4NU5A 5AW5A 2C8KA 4BNYA 3GRAA 3R9XB 2GX6A 5JRDS 2P78A 2CHGA 3QJGA 3I04A 1ZRMA 3BRCA 3SLRA 5J63A 3C8ZA 2X8WA 1LX6A 1YK0A 2P5SA 1HDRA 2YRFA 4II3A 5E9JA 3W5CA 5ISMA 2FZEA 3SKVA 4N7JA 4EQ6A 5F98A 3NVDA 4LC1A 4J0QA 2H2HA 3AY3A 5LVAA 1ETHA 2LDBA 2ZDQA 4MUIA 1RWWA 4OPMA 4KDRA 5THQA 4AJ2A 3AVXA 5EUQB 4BP1A 3O6VA 1EFVB 3GPIA 3I05A 3K0CA 5ALWA 4CEHB 3W34A 1U3VA 4URXR 2H54A 1ISSA 3D8SA 4OMUA 3IILA 3VISA 1E0JA 2VR1A 4R71A 1PNVA 2XDWA 3V33A 4XD7A 3ZLVA 2JFVA 4LA4A 2EBFX 3RRNA 2JFNA 4R9SA 5ARBA 4BGIA 2BI4A 2UYGA 4TWAA 4QLOA 3DL7A 5JMTA 5CG2A 1F17A 2VEOA 1I3KA 1SXHA 4K6GA 5IANA 1B6RA 4MW6A 1IC6A 2BCJQ 3AOEA 4KR0A 1Y9JA 4US1R 1KYVA 1JDJA 1NN3A 3FYSA 1OBVA 2OEPA 5LDHA 4UHEA 4EHJA 5JU6A 2Q9UA 2CBZA 1UWKA 4FDUA 1Y5MA 3CLRD 1GPNA 2YMLA 5F9MA 4TXJA 1SA0A 1X7DA 2IYYA 4ARZA 2ZIFA 4OOFA 5K0BA 4MVJG 1J24A 1C9EA 2FDCA 3WJ1A 2JAXA 4N0EA 2JFHA 3D6TB 4AKGA 4IQ8A 3G8DA 4TXMA 4KQGA 1W47A 4HDSA 1P8JA 2VF8A 3P9XA 2W2VA 1TKAA 4JLJA 3MPOA 1NRXA 1TYZA 3AB8A 3ZZTA 4EB0A 3F4BA 3H2YA 5TLSA 5CB8A 1LW6E 3AHDA 1QOZA 3TRJA 2I91A 5DO9A 4FMCF 1P7CA 2MR6A 1GLVA 3CF4G 1JYSA 3LGSA 4YRCA 5HF5A 1J99A 1FYWA 3FBWA 1YL5A 1TU3A 1X8XA 4KKVA 3EXEB 1SQ6A 4LHWA 3KR2A 3LGAA 1XXHB 4XCQA 3G0CA 2WMNB 1PJ2A 1XMSA 2H65A 2YY7A 1VHWA 1TX4B 4EX6A 1K0UA 2PV0A 3NS7A 4L3VA 5ITVA 2IOFK 1X7ZA 4PYMA 4U7PB 2G76A 3LT4A 2JA1A 3IEUA 1YCHA 4OHRA 3VHQA 1Q7GA 5IBRA 2W48A 1F60A 1OGYA 1YO6A 3DFFA 5H4GA 3KAPA 1QVZA 3T5PA 3FCUB 5FLKA 4ASUD 4P80A 4X3PA 3C45A 1CBUA 3SX4A 2EX4A 1E9FA 4B43A 1C3XA 4V1CA 3TLMA 4JP2A 1BWPA 4MVWA 1ZR4A 2B34A 5CNJA 3T0GA 4MYRA 2JLYA 4GO1A 2A7XA 3M5PA 2B4AA 3Q9UA 3ZXYA 3VU8A 3EGEA 2C3OA 1BXRB 3MINB 2HIMA 4HAXA 3MELA 1R16A 3SJCA 3TE7A 4C4ZA 3NBAA 4OU4A 3IAS6 4WAUA 5K6TA 1ORRA 4HGPA 2ZS8A 3QBDA 5GY7A 1PJRA 4G1EB 1J7JA 4YUVA 3IKMB 3KL2A 2Q5JA 3IV9A 3KQVA 2O0JA 3O74A 3U4DA 4E15A 4EIWA 1SCUA 2Y05A 3EIOA 1TO2E 2BGIA 2WABA 4LDRA 1J2TA 1Z5PA 3GBPA 4TX1A 1EFUA 2PX8A 1EX1A 1LGYA 1U2EA 1NM5A 5FORA 5E3JA 4B4UA 1NVMB 2CVPA 3F6EX 3SQXA 5CB4A 4LJKA 4RBNA 3PJEA 1TQHA 3CKMA 5KVQA 3VZSA 1D6JA 2BFPA 1IY1A 5D2CA 4D9BA 2R8RA 1PSZA 2ONZA 2W2TA 2ZOSA 3RC7A 2ZTHA 3V9AA 2XE4A 2YINC 4JOBA 1CUIA 5HZKA 4C7OB 1FFYA 1J1ZA 1GTZA 2F1RA 3AV3A 1HDXA 4RGVA 1O0SA 3RHTA 2CZCA 3UCXA 2C5HA 1U0HC 1DAHA 2VS1A 4HN4B 1BFDA 1O94C 4PY2A 5E4JA 1QPZA 5GZ1A 3V2GA 1SHJA 2AH5A 1ZKDA 2CFSA 1GGEA 4LMBA 1IH8A 3BXPA 1IMJA 1I7DA 4W1SA 1UK9A 2IW3A 4LHVA 1MB2A 4LJ9A 3T4EA 4ABYA 1AGRA 3I2HA 5ULLA 2W6OA 3QUQA 3C3KA 4RFLA 1GPKA 4U2FA 1G7TA 4EPVA 3GNTA 4TOIA 1V5GA 4MKRA 4HT3B 3VH1A 5KWEA 4X24A 3AY7A 4IVNA 3NLLA 1GSAA 3C1AA 1NNUA 3CXUA 4ARVA 1L7RA 3VO8A 1EUZA 2H63A 3LFTA 5IT4A 3GZNB 1OT3A 4D1YA 1EM8A 1S0UA 1WW3A 1PT5A 1TYEB 3L8FA 1OF1A 1XXLA 3PJDA 4XOIA 5KWVA 1EUYA 4R83A 4D46A 4OI2A 1KRHA 2GVNA 5ALOA 1JSRA 3V6LA 3I2KA 2BGKA 3TL6A 2YDYA 4D6YA 3BGSA 3PTLA 2A94A 4MI6A 3T15A 4G56A 1AO0A 3W90A 5BYBA 2ATVA 4ZJYA 4GBMA 4R81A 1RLUA 3GLGB 2YXEA 4AKTA 3UC5A 4PPFA 2IEAA 4RK0A 3DE0X 1JLKA 3ZD8A 3TMAA 2CNLA 3KQKA 1N1EA 3GAFA 1XGKA 5DGTA 2QJWA 3IDQA 3HV2A 4H0CA 5EJAA 1IPHA 4KKXB 1PI3A 1Y33E 2HA3A 2XB4A 2I6TA 3E53A 4FFVA 1ZIPA 3UG6A 4JK3A 1BN7A 2V7EA 3EQ8A 3MGAA 4LY3A 4MR7A 3SM3A 5TX7A 1DC5A 4G24A 4AO6A 4BBJA 2BUCA 1K7EB 2P7IA 3LVRE 3MOSA 3U4HA 3OCZA 2FPOA 1KMIY 2PKCA 2VUHB 1PK7A 4XAQA 2JFXA 3PUVA 4NH4A 5K3DA 3KPJA 1UBGA 2B1IA 3DL2A 1IEWA 3B3GA 2QSZA 4PLYA 2OK7A 2WSMA 3KLMX 4KXQA 5EG5A 5KOJB 1EJBA 5DYNA 3R40A 1XAGA 3TIXB 2ODQA 1KZ1A 1M2KA 1VLVA 2BFBA 1WUHS 3SZLA 2ZBVA 2KPOA 1OXTA 4MDHA 1CIVA 2IIPA 4Y2TA 4NU6A 3RGGA 2YZ2A 3RWMB 3VR5A 3GT4A 2JLVA 1GR1A 3W7BA 3A9TA 1E1KA 3KTFA 1YMVA 5FYDA 4Z1MA 4C6SA 2WJVA 1K8XB 4CQJA 3E9MA 1JR3D 3NHFA 3SR3A 4X6LA 4XR4A 2XNKA 3OIWA 5H5JA 3S0JA 2PNJA 1ICEA 3C7TA 5T6MA 3R5FA 3Q3VA 1GUBA 3JWEA 3ZWYA 4G0MA 1OH8A 1UJBA 2A9OA 2HM7A 4BBZA 1V5IA 1U80A 2Z95A 3AUTA 4UTPA 3GJ4A 5KNBD 1Z5ZA 3MLAA 3HKBA 4EOGA 3RUDA 3IAM1 1AQJA 5CNIA 1TCVA 4BO5A 1GCOA 4OHXA 4BZXA 3RBVA 5LXTB 1IM5A 1BH6A 1ESCA 4HNVA 3RASA 1LI4A 4HB2A 5A6SB 4J8PA 5K6RA 4RVNA 4UDXX 4W99A 3PG5A 2C2WA 1BNCA 1IJEA 3MIZA 2EW2A 2R79A 2R97A 2HW8A 1CR2A 2B98A 4J94A 1P0IA 2GPTA 3F3KA 4OBWA 4RXTA 5DNCA 4CZ2A 4CFSA 3KTAB 4PRZA 3MS2A 4IOKA 1WV1A 3AY0A 4JODA 1Z5VA 3JVUA 4FU0A 2QNIA 2ZIEA 3G2QA 3RIHA 2BHLA 3AR6A 4B9AA 4LF8B 4WNAA 1JX6A 1OXBB 2CEAA 2NV2B 5D6NA 4CCAA 2H0RA 5K1ZA 1EWQA 1D2HA 1CEQA 2FKNA 3OE7D 4A8JB 4PPQA 3HVIA 5DJ5A 1X94A 5SY6A 1PUIA 1ZMOA 1VP3A 2A3RA 3KHUA 4FGZA 3EGXA 2WIBA 3HKEB 3HXQA 1XDGA 2F7SA 3R41A 3CO0S 3GY0A 3RSOA 5J2UA 3KZXA 3AEQA 2D5LA 1FXWA 4L8VA 4L4XA 1T0JB 4GPIB 2O05A 4MQ4A 3MUOA 3GZNA 2V7PA 4PLPA 4JQZA 4V02A 3AV0B 3HEAA 2PZ8A 2OFWA 4JHLA 1FNMA 1HLGA 1CY1A 3P26A 4OXYA 1N9ZA 4P5DA 1R6BX 4YRPA 1YB2A 3RRJA 5I7VA 5CCBA 3T4UA 1DI0A 1WSDA 1ZUIA 2ORED 1IWPB 1C4WA 2XPCA 3E7XA 1QR6A 3PA8A 4JBHA 4KCGA 4ZT4A 3TQRA 3D3WA 1XPRA 1NG9A 5HS4A 3I5YA 1VPLA 4QJIA 4K46A 3VVLA 2O5CA 3VC7A 1V45E 3DB2A 3CRW1 1HMPA 5DBIA 3R7DA 2YASA 3IKLA 4QUDA 3REQB 3OFVA 4A03A 1QNFA 4LBYA 2ZUCA 4KN5A 2ZB2A 4QVKA 4FYIA 3IOBA 3OM1A 4F21A 4ACAA 5A4AA 4UAJA 1D9ZA 3WA7A 3WHIA 2ADOA 3OCWA 4U4AA 3EC7A 3EWSA 3WYNA 1QDEA 3VPGA 5L9AA 1FB5A 4FFBA 1I7LA 2F3TA 1OOEA 4AD8A 3DVRX 1V9LA 1JMYA 1A2KC 1PYGA 1X1TA 3A6ZA 3BH0A 2A84A 1L8OA 2VUIB 4IGFA 1GZVA 2IXAA 2X2OA 4KFTA 2QMHA 1Z6XA 4QQRA 4KIJA 4R2JA 1SUEA 1U0RA 1D8TA 1O03A 2ZYTX 1ODTC 3DZKA 1P61B 3A27A 1CF4A 4MTLA 2K2WA 1XZDA 2PWYA 3GVCA 1JXOA 2BEVA 2AFVA 4POOA 4EQZA 3TCXB 2JA2A 4INOA 4UAGA 1VKOA 3K0KA 3EGWA 4DCMA 1OLSA 1YZHA 4H16A 1LV8A 4OM7A 4ZVVA 5LUAA 1YL6A 1E3LA 2JLQA 3IIJA 1JFRA 1GVNB 1I7NA 1E0KA 1O7JA 1UDAA 4NBRA 3DVAB 4UD2A 5KTOA 3CGWA 2IYTA 5LZ9A 4IIBA 1ICIA 1JHRA 1K08A 1QIMA 3CLTC 5DDIP 2RGUA 5DXAA 4PZDA 3DNPA 3LYAA 3MCAA 1DQYA 5FULA 4F5YA 1RZRA 4X1OA 1JHVA 1K5HA 1J0EA 3UK0A 1W36B 4ARIA 1ECGA 4G26A 5CVDA 4K1LA 1RTTA 2ZYIA 3VPDA 4NDZA 4CHGA 5LU9A 4Y1GA 5I8PA 1UDRA 3NKLA 2D5IA 3BWBA 2WZBA 3PDHA 1U3UA 2AZTA 4GC5A 2WYIA 2FW9A 3KZCA 2Q3MA 3QH4A 4MR9B 1D9XA 3OVMA 4Z9AA 1JP7A 3E22A 4MI1A 3BILA 5B7NA 1CRPA 1Q3TA 2GERA 4GGMX 3QOXA 4GQBA 1DIAA 4LGVA 3UWKA 1MO5A 3JTEA 3KJEA 3CYFA 3L84A 3OUZA 4D0GA 3SZ3A 4R1TA 4KXXA 3T9AA 3AKZA 3UICA 3G8CA 4G5GA 1F8UA 4IXTA 1RTKA 1IQPA 5KKCA 1RM5A 2JJ2D 3UH0A 3MWJA 1RRVA 5CDHA 3ACDA 5DYYA 1Y1LA 3OOJA 5KOHA 5CPFA 4U2KA 3D3NA 3RLIA 4WZZA 3AZOA 2IYQA 4JLOA 1RCUA 2FFJA 3SPXA 4ZYLA 3WLQA 1REQB 4PLZA 1G16A 5EMHA 3WO0A 3I92A 1QZZA 4V0KA 5TVGA 2FUG6 1NR1A 3HDHA 4PX3A 5BN1A 4YI5A 3TRIA 2QGFA 2ZBFA 3HB5X 3V8EA 1TEHA 2VRCD 2YHAA 3QU2A 2EKZA 4L2IB 3U9SA 2ZJAA 4P22A 3TJMA 5HIKA 3KQLA 5EN4A 3DVQX 2X4LA 1GFWA 3KR9A 2WHPB 1RJWA 3GMTA 3VX4A 3RBAA 1XF9A 1IWBB 4FK8A 2YICA 2O59A 3NONA 1JYFA 2C5BA 1FSPA 2J3IA 2GETA 4Z49A 1XDSA 4RA6A 2IHJA 5FLYA 1I2DA 2VQSA 1K1EA 3R3XA 4JJ7A 4JBLA 3LH5A 5JOQA 4RPJA 3NIWA 3VRHA 3KM0A 4DNQA 3CVXA 4ZAVA 3KB6A 1PZGA 4ISBA 3SI7A 4CMJA 5DLYA 3GNLA 1TT7A 4HH4A 1GU0A 1BW9A 3VPHA 3C70A 4YP9A 3M6XA 2C07A 4JT9A 4X90A 4GRDA 5L53A 4PO1A 5KC9A 2H57A 3ILSA 2FPUA 4EGAA 4P35A 5DM2A 4F4CA 2DFDA 1K6MA 1NQAO 1QGZA 4QATA 4O0LA 3TW0A 2B2NA 2VNKA 3O03A 3PXGA 2OO7A 4ZKEA 2X4DA 1DKOA 1X70A 3K1YA 2EHJA 4GPAA 2IV7A 4JLSA 3CX4A 1OBOA 1KAQA 2A35A 3L6BA 4KBYA 5HIJA 4BFTA 4MYHA 5JSZB 2AC7A 3OOHA 4MI9A 5JCPA 3LOQA 3VU9B 3HBMA 4DJTA 5CDYA 1F1BA 2XJ4A 4Q21A 5FI0B 4B6JA 4QULA 2R65A 4LWQA 5BYJA 2D3TA 3OZFA 1E3WA 5B1SA 3LD9A 1AUVA 1T4MA 4C30A 3T3MB 3UJ3X 5HCUA 2F8MA 2W83A 3COSA 5HKKA 2C0CA 1L1QA 4WKCA 2NU8B 2GM5A 3UMBA 4BQRA 1VZ3A 2C5FA 3EGDA 1Z6ZA 3U37A 3EVEA 3SVTA 3BE4A 1QGOA 2WJWA 2F9FA 3IUQA 3B7PA 2V7BA 3LHSA 2ET6A 4OK3A 3D6AA 1NUSA 4XM0A 3JWPA 1EAMA 2BFNA 1GZUA 3KAKA 4PAOA 4X54A 1IAQA 3ITNA 1JQDA 1U0OC 2QP3A 1AQUA 5AXCA 3WGYA 2VF5X 3FDJA 1R8SA 2GLUA 3HJNA 3P4UA 5D01A 4WXPA 3I28A 3OEEA 4G5SA 3VAYA 5B7PA 1XJCA 1UKVY 2HJRA 4JXKA 1QOQB 3RTGA 5EJ4A 3ICEA 2JJYA 3B5EA 3ORFA 3L40A 3MNFA 4U0KA 1GKLA 5DZSA 4BVAA 5JALA 3TEJA 3MTEA 2CXXA 3IVRA 2AXPA 4JVMA 3CZ4A 1ISJA 2BFEB 2VJOA 3NTXA 1LLUA 4PYJA 3H3XA 2D7JA 1IHYA 4NFHA 2DPGA 1BMTA 4J91A 4UCXA 1MQ8B 4BJ1A 4PS1A 5DXFA 4OI1A 1DIOB 4FS8A 2Q27A 3H5LA 1T1JA 2G1KA 1ZFNA 3P2IA 1TW2A 1UJ2A 1RWBA 1E3EA 3PWSA 4ZI7A 2DHDA 4ZOEA 4WQMA 2FPSA 4K05A 4OIFA 4UHHA 2F6RA 1NLZA 2P4SA 4G4SP 5DT2A 2CLOB 1L5GB 4DCVA 1NN5A 3JZAA 4WVFA 4DMUB 1QFXA 2XMCA 5DX0A 3W8RA 1JWBB 2BEUB 3KQSA 3QXHA 3AVWA 1UZMA 2FJPA 2WSSA 3B6MA 4IGIA 2GBFA 4R1SA 4UTRA 1JJAA 5AVTA 5KHOC 3GLFA 1ECBA 2FSGA 3DFMA 3ZV7A 3E5MA 4F11A 3SFVA 3VM6A 4E1AA 5BPFA 2R11A 3GP3A 3LUPA 2GUWA 4YQZA 2DFKB 3QLEA 4R54A 4TM7A 4DABA 4RADA 1VE6A 4MJ7A 3EQ6A 2XT9A 4DY4A 3R6WA 2JIOA 4W5TA 1M1XB 3AFGA 1B0ZA 4B3JA 3WAGA 1KI7A 4MVXA 1YDFA 5BQOA 4Z4FA 3DOJA 4D0LB 4RDHA 1OIVA 2PBFA 2WYVA 3C7KA 3MBOA 3T3GA 4C3ZA 4CQMA 2A1TR 4YQYA 2VSXA 4XUDA 2QMUA 4PNHA 1QQ5A 2O8NA 4JT2A 3ZI4A 5FEUA 1MEJA 4FFRA 2J85A 3IODA 1T5HX 2HTFA 3B9RA 4OJYA 3U5ZB 1TAGA 2B30A 4WNYA 2NZUG 1PFVA 3L43A 3B36A 3U4IA 5FPHA 3F8SA 4P98A 3EVDA 4WN9B 2QYOA 3H19A 3JRNA 3N2GA 4MVJP 2VT6A 4XB2A 3P32A 3U0BA 3K2QA 2BTOA 2ZJFA 4A73A 4CL0A 4ZCMA 4DPMA 4QGBA 1DIHA 1A5TA 3LUFA 4AKSA 3NRBA 2B8TA 3C6ZA 2DETA 2P77A 3LRTA 4OP2A 5AJUA 3UKJA 4LOIA 3IP5A 4WACA 2HLHA 1AX9A 1YBVA 4EDHA 1YB7A 1G20E 1ZRNA 3KXPA 1XTIA 5E1BA 1C1DB 1V3QE 3EPRA 2IQ5A 3OD5A 4BNKA 1N9KA 3L92A 4D02A 5CAEA 2JEOA 2JJQA 3C16C 1JG3A 3H4VA 3UJBA 3F3MA 1E3MA 3KYCA 2NVUB 4NF2A 3KJNA 3D4IA 1LBSA 2DWCA 3Q3JB 4LOHA 3U62A 5AI8A 4A2QA 4EGCB 2B7CA 3W1WA 3HU5A 3B13B 2ECFA 3FZNA 1I1QB 2HRCA 5LA6A 2W43A 2FFRA 3F7OA 3K8YA 3LA8A 5FAKA 1SVIA 4PC6A 2ZTLA 4KOAA 1JU3A 2YWRA 2YR0A 3A4IA 4TWBA 3RT7A 4O2RA 4LNAA 4EY3A 1Y89A 4CQNA 1Q77A 4CI9A 1RVV1 2AXNA 2BE9A 6GPBA 5KNDH 2OD7A 3JWJA 4G41A 1YRQA 3RAPR 5BW8A 1AO3A 2F1IA 2H1CA 3IA7A 3IT0A 4GAEA 4GE3A 3BD6A 4AKEA 2H4XA 3MCWA 3CURA 3K9LA 1TYDE 5A5GA 3Q0IA 5F7XA 3OQ6A 4QOIA 3VR6D 2WYWA 2HU7A 3A6GA 3I9JA 4ER6A 2XOXA 1G4HA 3CVWA 2V96A 3VPCA 4LNHA 1V43A 4EA8A 3EULA 1E2NA 2DWQA 3UQYS 1R64A 1WXHA 3NPAA 3H5VA 1E6CA 1V3UA 3QBJA 4HWOA 2ODNA 4H6PA 4CT5A 4R8MA 5F1OA 9ABPA 5A7GA 2J6IA 1T4CA 1NMQA 1RXCA 2CDAA 2YH2A 2IFTA 3IDSA 4L4YA 4A2CA 4WBNB 5GZ3A 3GFSA 1JA0A 5HKAA 5DGIA 3NOOA 3LUGA 5AI0A 1H05A 2B36A 4WKPA 5AW9A 5A9RA 2QJTA 2WINI 4LK2A 4DJEC 3DLAA 4KMOA 4EUNA 2J0SA 3VNUA 1F06A 4LN1A 1NBHA 4Q1CA 3RE1A 4YK7A 1ZW1A 5FRDA 1XUOA 4HVTA 1OTHA 4CNBA 2A3NA 1CDOA 3W2EA 2J5KA 3PXUA 2H7CA 2JAWA 4PAMA 4ZWNA 4OO3A 3RS8A 3OQ1A 3ZZ0A 3HKDB 2WTUA 4PQRA 2QI9C 2GS9A 4GGPA 1Z2NX 2GSDA 1E2GA 2NQ2C 3IOEA 4CMEC 3MJVA 5EJ9A 1KO5A 5EIAA 2D5CA 5BSEA 1CTQA 3W3ZB 2DUJA 3F97A 5JY6A 5KMGA 2DXIA 4RD4A 2AKEA 2ZRBA 3C74A 4PC7A 2BH9A 1P29A 1KOJA 3NNDA 4M9UA 4MUXA 1IOWA 2EEPA 4W5WA 1DX4A 3IHLA 3N39C 4WUVA 5EHNA 2C54A 4DIFA 3C43A 5CH3A 4FOLA 1DCMA 4QSMA 4H9GA 1G5RA 1J9GA 4FLEA 4L15A 3GFRA 4UXJA 1DTEA 3HN2A 5ALTA 5TS3A 3T7CA 2FEOA 1US8B 2Q41A 2ZUBA 4FBGA 4JUDX 1ZXXA 1HPLA 2EZTA 4Q3NA 3UWDA 3WYCA 3IKTA 3CY6A 1VMAA 2C5GA 4G4JA 5IJXA 1GAXA 2X0RA 5CBPA 4JYPA 4QUBA 1L1FA 3D31A 2H4FA 4LCEA 5DHFA 1ZINA 1ACMA 4IO0A 4B79A 2CNBA 2DUWA 5CLLA 4F60A 3GIDA 2I4RA 3OIUA 1YV9A 4NPAA 3DHWC 3QXSA 4ETMA 1KPGA 2HCJB 6YASA 1EFRA 1ZGHA 4BZZA 4OMDA 5HTOA 1SIOA 4DRXB 2Q5LA 1SEPA 1E9DA 1WABA 5CT4A 3ZK9A 1TRHA 5AW0A 2H4YA 3RK1A 3EPJA 4NBLA 3ULKA 3EXIA 4NFSA 1ZI8A 2P2ZA 2PT7A 3V1MA 1DJPA 4LYJA 1QG0A 4KDFA 4ENTA 4HLDA 1YBAA 2Y66A 3F96A 4I4CA 1QO7A 2ERXA 3HCRA 1SVSA 3WYGA 5K0JA 1Y8AA 1HDEA 4K40A 4LJ4A 1SVMA 1NVXQ 1V8DA 1EK6A 2BFFB 2EWWA 2H7YA 2IIVA 2HLNA 1UBUS 2WWXA 4B6FA 3E2PA 3SJAA 1RAEA 2Y1FA 4X7MA 1W2HA 4CDNA 4CCYA 3RU2A 3OIYA 3EDQA 3OZVA 2FMUA 4Y9UA 3L07A 1QRUA 3WYFA 5JCJA 4LJ8A 1O0BA 3F9CA 4IJ6A 1CZKA 1QZXA 4DR3B 1H93A 1J0BA 1YZGA 1KU6A 2JGAA 2PHZA 3QY0A 4KJZA 4RGYA 1F3LA 1E63A 3O4IA 3WBBA 5AKKA 3RKUA 1Z82A 4JWTA 3QF4A 2QX6A 3UZUA 4PCUA 1DS6A 3MMNA 2XSZA 3JRXA 1OYWA 4I4TB 1R4NA 5EMJA 3FDIA 5DM1A 2BEJA 4PC1A 2CD7A 5ECGC 4WBNA 2GGSA 3CX8A 2Y1XA 3IAUA 1Z16A 3TTYA 4ZGWA 1CVRA 3P4YA 2OXCA 4ERXA 4N8DA 3P0EA 5M5BA 1T3HA 3GJXC 4YCCA 4GFDA 4DNOA 1LI7A 1Z4LA 3HY6A 2P0YA 2BFWA 1OR8A 1PWZA 2N0SA 3B3QA 5A2QA 3MFYA 2I8LA 1D1QA 1P0FA 2IHUA 3CUEF 2CJWA 2HQBA 4HXGA 3H9EO 4MYSA 4Z0TA 4C7JA 4DV0B 1DO0A 1FOEB 2ODPA 3UMJA 3U4QB 3CU5A 1C30A 1O96B 2SKDA 2QZJA 1B8OA 4ROTA 4FHZA 4HYEA 1JI0A 5JWHA 1U1CA 1W9MA 4KWHA 4O5OA 4W6ZA 2A0WA 3IPCA 5CYPA 4EHFA 3IA2A 3RIEA 3T0IA 4B48A 2CLMB 4R3WA 5EWLA 3L79A 4O2AA 3HDQA 4V2UA 1CE8B 4BNTA 2D7DA 1THMA 4H1HA 2FUEA 5C35A 2WWHA 4MW7A 3IEXA 1X7GA 2RAFA 4I14A 3A2NA 1NAHA 2AG0A 3PWZA 1ZWLA 4BMSA 2NACA 4HK4A 1KU0A 1BS1A 2XWBF 3RPEA 2R60A 2FWAA 4GPBA 3N70A 3O38A 2W8BA 5DHQA 4AJHA 2DBVO 1X7XA 3UMCA 2IELA 2YVLA 4LOJA 5DIZA 3PHBE 5ILGA 4YRGA 3GFVA 3HFGA 1USIA 2VJAA 4X97A 3RC8A 1A7UA 5AOAA 2X19A 4N40A 1FW8A 4YMIA 3ROGA 4X7RA 2YNMC 4KV7A 1PVVA 3NTOA 4X92A 5DBEX 1I6MA 4MLCA 2EFDB 3GCWA 3KZMA 3TQFA 4G1FA 3FCEA 2Z09A 1TI7A 5TR9A 4H4EA 3HWRA 1RQ2A 3OWXA 2XQGA 1P7YA 3SKXA 3TPCA 3GLHB 3F7MA 3ONFA 5IF9A 1L9XA 2H2WA 4P08A 2HSDA 5EE5B 3GQVA 1QB7A 3P2MA 1KR5A 2VHEA 3IALA 1YHYA 4EW1A 3HP7A 5CFOA 1JECA 3Q3HA 4U3JB 2O20A 3FUWA 4D82A 4F9EA 1VL6A 1LWOA 1YRAA 1D2EA 4B4DA 5ITZA 1XRRA 1X7YB 1XYGA 3OPYI 1GYQA 3AR3A 2OO5A 2F43B 3BWDD 3I6BA 1ZCAA 5C53B 3AHIA 2O8FA 1CW2B 5IYZF 1X8JA 1Y9EA 1GPAA 3PYLA 7AT1A 1N3IA 2IEZA 1TAQA 4LBVA 1OX5A 1EFDN 4BZQA 3LL7A 2ZUSA 3LXMA 2G5TA 3E5HA 4NJMA 4PW0A 4U5XA 3UOGA 4AUKA 1VL2A 1NVTA 1YR6A 3EG9A 4FM9A 3ZCUA 2R6AA 3FYCA 1JSXA 5I9LA 2IXDA 1RYNA 2GRAA 3LRPA 4OGWA 3TXYA 2FZLA 2C31A 4ZYTA 4CM8B 1EEXB 4LWZA 3E82A 1NI4A 2FV8A 3AI7A 4X94A 4YVFA 1G60A 3R7SA 5FO0A 1NUUA 5K2MA 3WWPA 1NXQA 4W7SA 3TECE 4MV4A 5IKOA 1WPQA 2AEJA 2JPDA 2YNMD 4R1OA 3ETEA 4D3ZA 4NK5A 3KR0A 4ZYUA 4TZ6A 3U3MA 1VGQA 3PC2A 2FQQA 1Q7EA 4MDFA 3FNIA 2I65A 3L7KA 3QW4B 1EXVA 3WXBA 3A6DA 4LVNA 4C01A 4N4AA 5K0NA 3PHHA 2G1JA 1Z08A 4Q3OA 3ZK7A 4DY6A 5ALGA 3AO0B 1PGNA 2AX4A 2IHZA 4Z9XA 2FFBA 4WA8A 1G6Q1 4IIXA 1DO2A 4ZOQI 3FNRA 4RQUA 1KJJA 1LCIA 1Q1BA 3KDSE 2RKWA 4ON9A 1M67A 3FLBA 3CH4B 1U02A 3PI7A 1O4VA 4FZ5A 3OUUA 5CG1A 2PQ6A 3EFHA 4AZ3B 3W7AA 3KT6A 5MF6A 1NIJA 2PMKA 4R01A 3KP1A 2IU4A 2OCLA 2P9JA 3IP9A 4U2GA 5B1DA 3UCEA 4AXBA 4FHDA 3KD3A 1SXPA 4QYMA 2OV1A 2FUNB 3CG0A 4FGLA 3ZDEA 1NJFA 1H9CA 3GAZA 1PNOA 3S40A 1UKBA 3SHTA 1OFTA 2QV7A 1TU0A 2C7OA 3WP0A 3V1YA 1NC1A 3LIIA 1FU4A 3PQEA 2QWXA 3SSOA 1Y1KE 1TK3A 3KUXA 4R2KA 1KOGA 1DDOA 2XTJA 2H51A 2VSFA 3GNQA 2D3WA 1P8AA 4LQLA 4PEVA 1VE7A 1KI3A 1OZAA 2XMGA 4MPJA 5DHRA 1XA3A 1TQ6A 4HQ0A 4B6GA 1CY2A 3OZWA 3K0EA 2JGIA 3PC8A 5KSWB 1RHQA 4RTMA 5KCZA 4JJIA 5CW1A 3ZHXA 3W8EA 5AUOB 4O2BF 2VDNB 5G2OA 4BNDA 5BN4B 1APBA 1KJIA 4QPPA 1ABFA 3ANTA 5ENDA 3EASA 3RQSA 4U8GA 5ALIA 3NT2A 4BLOA 4R16A 4R8RA 2XMPA 2IH5A 1AGPA 5T5QA 4PV7A 5C1IA 3C3YA 3T7AA 4R7GA 5J4VA 5HUHA 3UWMA 2Q5FA 1HWYA 1M6WA 2EFJA 3E18A 3I5AA 3MAGA 4HZUB 3IQHX 3SQOA 3DLCA 3SY8A 3VQTA 4ZTZB 1GRRA 3F98A 3W1VA 1R4NB 1GA4A 5AQEA 1BXGB 4H1WA 3QKWA 2FPKA 4R1QA 2OCAA 1GV1A 3A4YA 3S27A 3SS8A 1VIVA 1UC8A 1Z2OX 2QNBA 1OU4A 2JD1A 3IOMA 2NOAA 2CSUA 2XB6A 3PR2B 3KYBA 1CJUC 1OSNA 1I5RA 2QX8A 4JMLA 4AKHA 1GQSA 1MA0A 3PNYA 4MWTA 1EPUA 2I9KA 1DOHA 2H1HA 2WHPA 2O5EA 1T8SA 3ADPA 4M8KA 1KKMA 4QOEA 4XVCA 4BB9A 4CTOA 3VGJA 4CTNA 4CEJA 1PR2A 4KYVA 3EX7C 1MKYA 2FY8A 2V7XA 4IO1A 3SHFA 3OCVA 3CF0A 3CMMA 4QOSA 3PYMA 1Z5OA 3FMFA 2ZSHA 2JVKA 1BS2A 3ZQ4A 1FVFA 2D1QA 4MW0A 3W5DA 3B1VA 3GLQA 5AM2A 3VYWA 2CN1A 2G8NA 2PMEA 1RWNA 5IFLA 5ALQA 5TXGA 3D5TA 1X1AA 2ISQA 4MRSA 1KGSA 5C34B 2QMZA 5K99A 3B82A 3SFZA 2G4VA 4XGQA 5JQGF 1CUZA 3H16A 5JSYA 4L9WA 3W7VA 5J5AA 121PA 5EZQA 3PD0A 5LQDA 3GJTA 1QGED 5DYWA 5K3CA 2PUGA 3LUHA 4GRAA 3ZCXA 1J2JA 3A9SA 3CISA 3ILHA 1A3CA 2P5TB 3S1AB 1N33B 1PW7A 1AZLA 3HPQA 3OZGA 3DFUA 3ELDA 4FKZA 2KS6A 4JBXA 1TDJA 1BXKA 5FT9A 3LQ4A 2P91A 1JHYA 5KTTA 1MAAA 1N0VC 3OESA 5KAMA 1WMAA 3CUKA 4RMNA 1PFUA 1VRCA 1TVCA 3OQVA 1JLLB 4OATA 3NDIA 3OEYA 4L75A 4XE5A 5JO0A 1Y9DA 3EXG1 5JD3A 2ZYWX 3R6LA 5B4UA 2ICAA 1KVTA 3KAJA 2LNDA 2X2FA 2ID8A 4QODA 2CLHB 4FX5A 4A8JC 4BVJA 2DUMA 2YV4A 3PIDA 2V8BA 2CHUA 1NX9A 4QQKA 3SIXA 3VJMA 4DSUA 3DUFA 5EZYA 2JLUA 4NECA 1NBOA 1CY7A 5CVUA 5CFPA 1XC7A 4ID3A 4P53A 3ZGNA 5I8ZA 5JTTA 3RUFA 2B20A 4KXFB 1N92A 4BQEA 1R4MB 4AZWA 2WVGA 4F3KA 1RXSA 4YP7A 1TEZA 4X1YB 3RAJA 3NOQA 5JJCA 2GJ4A 5ALDA 2I2FA 1S7GA 3BIXA 3UVEA 1YQGA 1TLTA 3T12A 4EY4A 3W4IA 3DEYX 1QKJA 4LF4B 3AR2A 4YXWA 1Y9AA 4YJFA 5ALPA 1ADJA 1Z6GA 3M7IA 5LQNA 3UWSA 1RZUA 4MQFA 5B2FA 4FEAA 3IESA 3CVOA 4MRPA 4QA9A 3F78A 4TZKA 3UT5A 1HDYA 1K63A 1OASA 1U7PA 3NYIA 3UQZA 1KA9H 3QWBA 3WLMA 3KE8A 1VRWA 1O4WA 4NU8X 4QDOA 3TEMA 5LQSA 1MBZA 4BNUA 1Q0LA 1P9OA 1U2TA 4F1WA 4TYYA 2BJVA 5FBLB 4ZV7A 4XYLA 4BTEA 2ZTMA 3GUZA 1UK6A 4KXWA 2PY6A 5IF3A 2WB2A 1YFKA 3BWMA 1OWMA 4Q37A 2V5AA 1G8YA 1CUYA 1PDOA 1YH3A 2BHNA 3G7SA 4KRGA 2DEUA 1KRWA 5JYDA 5EUBA 2P4HX 2P6RA 4EUKA 2BM8A 1XLUA 3KALA 3S7TA 1GL3A 1H2WA 1F7UA 2ZSDA 4B35A 3OOSA 1VSTA 2DLDA 4R1UA 2HA5A 1UJ4A 1CRQA 3D7SA 5DNVA 2UZ4A 1QG6A 1UBEA 5TQ0B 2Z58A 5AQ1A 4FFMA 1OI7A 1D07A 2PL5A 3GJ6A 2C1EA 4OEHA 1AQYA 5EP2A 4CLOB 1NJGA 3TG2A 2CNWA 2V7QD 2C2MA 4B4OA 1ILEA 1F48A 4DQVA 2LIPA 2VCEA 1HE4A 3AJ9A 3OPMA 5CAEB 1UKCA 3EUWA 3GEBA 5J2UB 2EJTA 3UANA 3AY6A 4WKOA 3RS4A 2BMVA 1KMHB 4TSRA 3S44A 3SC3A 1L5NA 2P79A 4E2WA 2HQ1A 1EFHA 3TOCA 2ZE7A 1DTWB 3B12A 4G09A 3KKMA 5ALJA 4AULA 4EO7A 5HZHA 1X80A 3THRA 1E3TA 1B76A 1M33A 2ZROA 2DPMA 4MJLA 4M46A 1XHLA 3SQDA 1M54A 3GFOA 3BMXA 3OPYB 1SGWA 2Z1DA 1QRDA 2WBLC 1ZIDA 3MWDA 4R84A 2OC4A 5FBWB 1T4BA 4AIRA 3V2IA 4BB5A 2WD8A 3DLPX 2VXYA 2VJLA 4DG8A 2ES4A 3EAFA 4RYLA 2OOSA 1J5EB 2YW2A 3NBYC 1J06A 3WWZA 3THXB 3PU6A 3JX9A 2A6PA 2WTEA 3D0QA 3I2FA 3U17A 1EINA 4EFNA 2OA0A 4I1PA 1ZVJA 4JUBA 1FSGA 4D98A 1PTKA 3WSTA 3HP1A 1CIPA 5DTRA 2VTVA 4KC0A 2BRUC 2HK7A 1C7FA 2RONA 4MQEA 4ER5A 4LYDA 2YZGA 4G1UC 4A26A 1ECFA 4CR8A 4M98A 1GOTA 4MW9A 4WLEA 3KKKA 5LIRA 2WJAA 1SCBA 3CH6A 5BMVF 1FYVA 2B2CA 1Y7HA 2AJ8A 3BAZA 2X0EA 4DQUA 2JHAA 1D7AA 4XLTA 1ESDA 4GL2A 1HE1C 5IDXA 1KK3A 1SUFA 2ZIXB 4JC0A 4G89A 3CX3A 1XZNA 2HJ9A 2HHAA 3WBKA 3AOGA 5AUNB 2A5GA 3WE7A 3BB1A 5IH7A 3QE3A 3UYKA 4D3SA 4JYZA 1CR4A 4EHHA 4KPEC 5BRJA 1NJ8A 2C97A 3SAJA 2Z5LA 2ZWVA 1NNEA 5A06A 3DFIA 3EF1A 4ZVMA 5TV2A 1JMVA 3SZMA 3ZS8A 5JJBA 3IUJA 1VG1A 4C0AC 3NHWA 3LQYA 2VJPA 3FSEA 1PBTA 3JQ7B 4KE7A 4FGSA 3BHIA 4DZRA 4UM9B 1JQ3A 1Y3CE 2IC5A 3CEJA 2IE0A 4BKOA 5F64A 5FV7A 3VBEA 3COZA 1WHTB 1TYCA 5LR6A 4HDKB 1VZ2A 3BHJA 5DBFA 4B5LA 2GF2A 3RI3A 3WKEA 3ZE9A 5AW6A 1XROA 1MIOA 2A9FA 3M82A 4M76B 3LBAA 4QYIB 5ELXA 2B8NA 2CJPA 1JTFA 2KBFA 5DI9A 5EP3A 3U16A 5HMMA 2Q4TA 2AOVA 4IUYA 4MCJA 1DRWA 5K4GA 1T1RA 3T9CA 1R0YA 2CLKB 1KYYA 2G0AA 3OFKA 3V4FA 1JLRA 4BZWA 2I66A 2ZRIA 2C03A 4IQFA 4EG8A 2YJZA 1X1CA 4LJ6A 1KMHA 1N2BA 3TI9A 4UM5A 3VNAA 3BFJA 5J9FA 1C2TA 1GZ3A 1OX4A 4NYMR 3FXAA 1YQWA 1P5RA 3DBHB 5K3FB 1T15A 1P80A 1G42A 4G0QA 3VVBA 1L7DA 2HHCA 3E1GA 4JXJA 3AQ4A 4Z51A 3ZG6A 1ZM4A 4J0JA 3JVEA 3K5PA 2GXSA 2NSDA 2YRXA 4J7AA 5GONB 1G2QA 5H80A 2NU8A 5D6OA 3SYLA 1YI0A 2HHHB 2TS1A 3EVGA 4KRFA 2Q21A 5LU8A 1WNFA 4OFZA 1E2DA 2PUAA 3ZKAA 5EVJA 2ZWAA 2BP7B 1UPBA 2RB5A 4YCSA 3HYSA 2ZIVB 3OTHA 3TTSA 1K5DA 2FN7A 3FN4A 2IZ6A 4HMPA 5K8CA 1C50A 3GLIE 1Y80A 1F0PA 2J08A 1XEAA 2EWMA 3T34A 4M1TA 5JSZA 2AMFA 2QL7A 2JAQA 4OKIA 3ORHA 2H9IA 2J3QA 1QIFA 4GNRA 1J1IA 4F56A 3I4LA 4F84A 4D8WA 3STVA 2CLCX 4YT2A 3IMKA 4JX8A 2PDAA 1YIAA 5ICGA 2ZRGA 4NATA 3S2GA 3G49A 1ZH8A 3OKCA 5HM6A 1A9XB 5HKBA 4NEQA 1T8TA 1UWVA 1ZS9A 2GASA 2BGRA 3WK5A 4BX9A 3SQWA 4ALIA 4RV5A 1LF0A 3PF9A 4PHHA 5CX1A 3U44A 4BMCA 5DNEA 4YP1A 2BGWA 1E8NA 4NXNB 3VNVA 1UMCB 2QGZA 2QLLA 2O3UA 2RBEA 2RK4A 2YC4C 3DFKA 3O90A 2QPLA 5COQA 3FRJA 2Q2WA 4RIFA 3QYJA 3NXKA 4MVJM 5CVJA 3FFBA 4ZOAA 3L7CA 2AUTA 2P1RA 4HDOB 4DRYA 1NW6A 1AKYA 3P9RA 3ZV4A 4X91A 5B7QA 1FLVA 1LZLA 3CUSA 1E1QA 2M2IA 3GD7A 3IVXA 2VJKA 4FFNA 4I9HA 4X0EA 1AKWA 3E7PA 4JSTA 3RC3A 3AEUA 1W4ZA 2ALJA 2I3GA 3F71A 3GZJA 3I4CA 2JIRA 2H1SA 1ADCA 4ILKA 3SKYA 2OT3B 4B7ZA 1RP7A 3IDZA 4L8WB 1FU8A 4UASA 1FLNA 3H5WA 2QLTA 3TLEA 4CFZA 3TPFA 3FVVA 1EJ6A 3IPXA 1BGXT 1HNXB 2WHQA 3ZWVA 4CMAA 5EINA 2VPIA 3BULA 1BX0A 1ORIA 4NE7A 4KITB 1T36A 1WOYA 3EG9B 2JGKA 3N2ZB 4LHYA 2I62A 3E9RA 3FNBA 4AP9A 1BIFA 4LOLA 5IC6A 3RHFA 2FRDA 3VR4A 3CZ5A 3G23A 4V0MA 4AW9A 1JIUA 3EXHA 1U0BB 4DV3B 1Q1EA 3ZJVA 5HS6A 2QN9A 1JU4A 2WF9A 1BVRA 3WJAA 3VH3A 4QTYA 3HNOA 3QLUA 3RTAA 3ADBA 2XBMA 2AZDA 4IHAA 4JT8A 2ZIZA 4DA7A 4DDHA 3U7HB 3KC2A 3E7DA 5EKXA 1Z33A 5EE1A 3U7FB 4FR5A 2XMBA 3MRVA 3B20A 3PNSA 4UOEA 1JV2B 1E77A 1ZVVA 5AK3A 5FD8A 4HDMB 4AJLA 4EW3A 1RRCA 3E1KA 3Q7IA 4ZZIA 4WY5A 1HRDA 5LCXA 2ZSAA 4L16A 4JFAA 1CJMA 4RTOA 2AS0A 3CUTA 5CM2Z 4DUPA 2QVZX 4MO9A 2B8WA 1CDZA 2WVJA 2Z5VA 4NZ9A 5LYYA 2JCVA 3QZUA 1TQDA 4J3NA 1VE5A 4BXOA 2BZ0A 4URVR 5DBOA 3MJRA 2YJ6A 3T1VA 3CNHA 1HNNA 4IIGA 1QVWA 2IHKA 2W6PA 3W06A 2P5YA 3FCYA 1VG0B 3B6KA 2VJNA 4ZQEA 3L6UA 4UUNA 2JGDA 2VDVE 2MYNA 4EGJA 2OBNA 2XA1A 2IF0A 1YZYA 3REFA 3FMGA 3WRXA 4E5MA 4JLPA 1G5PA 3TFWA 2HCTA 3HA3A 3P20A 4QYTA 4ND1A 1QB8A 4HNHA 1K66A 3VSDA 1Z35A 3UAGA 3VR3A 3MB5A 3LC0A 3MFQA 5ECWA 2Y9PB 2ZKIA 1QIHA 3K5IA 4I5EA 3P9CA 5CGQB 2CXPA 2ON6A 5F23A 3G85A 1Y6QA 1V8PA 3M1LA 2GILA 1YZKA 1VM6A 5EIWA 3SYTA 1P2UA 2P2SA 1NW9B 3FJ1A 3G5AA 1G6HA 4JKOA 3PEWA 1XRPA 3EUFA 5F35A 2GM9A 3FPHA 3HO8A 4HRYA 1FZQA 1C8VB 3F7TA 3SC2A 4DJFC 4JKYA 4ACBA 5KVSA 1QRSA 3DMYA 4KMSA 3OE7A 5LL6P 5AT1A 3HTXA 1V1RA 5CA0B 2GXUA 2WJIA 3C97A 4MEBA 4LGCA 1A7KA 1ZGJA 4HDAA 5KTKA 1FFWA 2I7TA 1VJGA 3F49S 3KPVA 2C5SA 4MV3A 3AF6A 5J3JA 1C1HA 2O3JA 4C08A 3QVXA 4WCVA 4GQIA 3REGA 4EELA 4A15A 4HAYA 2PZJA 1JQAA 1PRYA 2GBLA 2HWKA 1Q7RA 2QTTA 2R00C 2Z6VA 3A0RB 3IVGA 3Q5DA 4M1KA 4JP8A 5BW4A 2ZT6A 4CQLB 4FGUA 1JVSA 3OI7A 4XR9A 4ZV9A 4C4OA 3G6WA 3LYLA 3MBIA 3H5AA 5CA0F 1CCWA 1M73E 2HBRA 2VKQA 1SCDA 3MJDA 4OB7A 3RUIA 4ZAWA 2X0JA 2O6LA 4A27A 1G5QA 2OM2A 1JILA 1YI1A 1D03A 2EKPA 4C5CA 4KSBA 3VMMA 1XZHA 4X1IB 3BCSA 4UOQA 3ISJA 4G0YA 4EQ6B 4PIVA 4OREX 1ODJA 3JD3A 4XUCA 4ZAZA 1FBNA 3I83A 3M70A 3TW8A 3M4YA 4FJ2A 4ZAFA 1SOUA 3AESB 3DXXA 4BNWA 2Y2VA 2PN1A 3PC3A 1BZYA 2DE0X 4GMFA 4YMHA 3DT6A 3ABIA 2FX3A 4EKEA 4ERNA 1T0PA 1ONNA 4K2HA 3OEHA 2D2VA 4ID9A 4M7RA 1SBZA 1YZLA 3K96A 4KPGA 4R7ZA 2QL9A 3W8NA 4TKVA 5HQ3B 2HF8A 3O9MA 2PTGA 3DNMA 1I2AA 2GSWA 1DFGA 3ICWA 1CWUA 2FCRA 1X2EA 2XB8A 4KNYA 2VHTA 2VNIA 3JPYA 3NDRA 2BW0A 4N6NA 5KOIA 1BMFD 4LV6A 2DULA 1L5RA 2Q3BA 3WV5A 1EAYA 1QG4A 1MO3A 5F78A 3CVVA 2D00A 1A27A 1UK8A 1YHNA 2YFYA 4CV0A 5JD5A 4MUGA 4PNPA 1VKJA 1UM9B 4N5HX 5FFFA 4UAUA 4M1YA 1WZEA 1CDEA 3I8OA 1LXCA 4HLQB 1YUMA 4I36A 5FPSA 1MG0A 2Z2JA 4RHTA 1C3OA 5A3VA 1FVHA 1KDPA 5IVKA 1EWYA 3PITA 1OU0A 1RQPA 1UDWA 4J6EA 2PSSA 4Z7NB 3U3RA 2Z08A 3NWPA 2V3WA 1KTVA 2IRWA 4PGFA 1NT4A 5DBHX 3U40A 1MT3A 2C04A 3UAYA 2AF4C 2PH1A 2XQKA 2XUKA 4BTVA 1IBMB 5SYNA 2QLNA 4P3KA 2KHZA 3L8GA 2B6NA 2AV6A 2OLJA 5GOTA 5CIYA 1H1LB 4Z3KA 1RAGA 1U7DA 2I7DA 3OIGA 5JBNA 3GGGA 3E9NA 2MT9A 1L4FA 3MQ4A 4B80A 3PC4A 3WL6A 3GU3A 2GB4A 5A9SA 2X8JB 4RY2A 5DTIA 1L4EA 3HU2A 1C81A 1U3TA 4F7WA 4C0LA 4YHHB 3NCTA 1MJGA 5FUVA 1K6IA 3ZVLA 5J23A 4W5OA 2AJCA 4O4HA 4F6CA 5I3CA 2NNWB 1WEKA 1GUZA 1T9GR 1XKTA 4PYRA 2Z4SA 1VYTA 4RVFA 4TVKA 1TEXA 4EG7A 1EP9A 1GWNA 1QS0B 2C7RA 1G8PA 1Q0UA 1RHKA 3K4HA 4RHXA 2IDMA 1UFRA 3T5MA 1P4SA 1Q20A 1VL8A 2OV4A 1K5GA 1SG0A 2AC4A 3BMOA 3D6NB 2XOKD 3ZLTA 4E07A 1J42A 5D5QA 2TYSB 2D2IA 2NZYA 2GRJA 5SYMA 1HNZB 3KJFA 4KH1A 1TO6A 2WOOA 2WLSA 4TTIA 4NJEB 3LUDA 1J2YA 3TIIA 4YJKA 2BD0A 1X1QA 1WQ3A 1B6SA 5DGXA 2ACEA 2WKQA 4BATA 2I22A 5ALRA 1Y34E 2JNWA 2REBA 1PJ3A 4MWOA 3U3KA 3ZY3A 5DMXA 3OY2A 4G4GA 2UZ1A 2PBRA 3BGIA 3IOYA 1XMPA 1AKMA 3AQIA 1YDMA 3KCNA 3DF9A 1Z0DA 2R68A 4KSYA 1T6NA 2WV7A 4MS3A 1SAYA 1EMDA 2D0DA 4ESOA 4HTFA 1O8BA 1TYBE 1XVTA 3F4KA 4KFSA 3I6QA 1NJ1A 2W6NA 3P7MA 2YWGA 3D6JA 4OXIA 3TD9A 1YDWA 2JAHA 4RIIA 4ZHQF 4OLHA 3O8CA 1O2DA 1QORA 2OHFA 4C0HA 1U7HA 1P5ZB 3GPBA 4NBTA 1ZUNA 2Q4EA 2TMDA 3OQJA 3TUJC 4EVIA 5C3MA 2AN5A 2G9VA 1Y0BA 3FGZA 4R9NA 4HNSA 4N7RA 3TZCA 3TB6A 4EUSA 3GJQA 3DV0B 3K1ZA 4KDEA 1LSSA 5TE9A 1MC8A 3F6PA 1HKHA 1F2UB 4YA6A 3LHDA 3U3JA 3WNQA 5KJCA 2QBYA 3GT0A 5IHXA 4QNNA 1H69A 3CJQA 4Y2JA 1OQAA 3QLJA 4P3OA 3DWGA 4G4SO 1S8FA 1V6SA 4E5VA 2JHCA 5DTMA 4A9AA 2FKAA 3SIWA 3QFHA 1ZKMA 3F7NA 1XWFA 1U7XA 3FWKA 1RPZA 1BRMA 2CV0A 1U8UA 2WJ4A 3LC7O 3TTTA 2FW8A 4BLWA 2CF6A 4B73A 4LZZA 3PX7A 2AOUB 1VMKA 1BKYA 3D02A 2QTBA 2WE7A 1D2RA 1I1OA 3EXG2 4NZYA 4UQOA 4KUHA 1ZD1A 3WJ2A 5LUBA 1TOAA 4Q1FA 3RTBA 1OH7A 2VZEA 1RYHA 2UZ0A 4HRAA 1P9NA 3D3KA 4XFDA 4NK4A 5HKOA 4Q1VA 4AJOA 1HZZA 2OESA 5ED4A 2I6GA 4IDPA 1M1YA 5K8VA 5KJEA 1E2HA 1I0ZA 1G2IA 2PR2A 3GVIA 1RP1A 7MDHA 2PD6A 2QT1A 4FT2A 1GQQA 2RGGA 3STUA 5B12A 1H1LA 1IN4A 2RGWA 3B1WA 2YYSA 4HJRA 3OOWA 1Q0QA 3GLGE 1CZOA 2HADA 4MNTA 3KZOA 1KL7A 3BCUA 2XBUA 2EBUA 1QVVA 1Z4JA 2UAGA 4B3XA 4EHIA 2Z6AA 3BTUA 3N0VA 4EMTA 5LMUB 1T3ZA 2A9VA 3W6PA 3WFJA 2ZXEA 1ZM7A 2PLRA 3LFUA 1MJ5A 1U7UA 2X9NA 5D5HA 1QE0A 4NOKA 1NE2A 1TFUA 4DV1B 3QEAZ 2PJUA 2Z3WA 4RGQA 4HV4A 4JYMA 3H84A 5FL7A 3UV6A 2NSYA 1C1XA 1NBWB 4Q4JB 3LQRA 5ALNA 5EXEA 1T5BA 2POCA 1U7ZA 4AO8A 3MQFA 2VEDA 4MW5A 2FP4B 4L6IA 8ADHA 4ND4A 2DLNA 2PD4A 4DCOA 5U4QA 1U9IA 2J59A 5LB2A 1M34B 2X40A 1OXUA 2I2WA 2W2XA 3G88A 3HSSA 2WAAA 1FK8A 3TQOA 2IBMA 2P9TA 3UKOA 3L8MA 1OD6A 4IIJF 4E7PA 3UMYA 1ZC3A 3DR3A 3KXDA 5H9WA 3V7WA 1RNLA 3KSRA 4M55A 1WBJB 1GP2A 3GLHA 3HPRA 5JIBA 1NVWQ 4CDGA 3DWFA 4OYRA 2BFEA 2ZWOA 1N5MA 3OKFA 3OE4A 2WNIA 4HX2A 4O4HF 5GAJA 4TKVB 1YR8A 1N6PA 1I4WA 4OMFG 2FPIA 2FUKA 4MQMA 4N18A 4ZYVA 2JFPA 4GXNA 3PUHA 3L49A 3KWJA 3ZZMA 2F9MA 3H86A 2CKDA 1L8LA 1QYXA 1WMEA 5DCWA 1EGMB 5KMGB 1JG7A 1T4GA 1EIWA 3MS7A 2GEVA 3ASVA 1J90A 5KTPA 1JHOA 2WKPA 2NU9A 5CDFE 1MHTA 4IOJA 2OMEA 1T9AA 1X7XB 5B6IA 1S9DA 5BSGA 3C8DA 4BLUA 3EZYA 4F8YA 1HX7A 5IARA 4DREA 2MTBA 2O1XA 2G1UA 2WJ6A 4AU1A 4CNQA 4FYJA 3ADOA 2P2YA 3WL5A 2GPSA 3OECA 2Y4OA 1W87A 4LYHA 2C3PA 3CE9A 4EJSB 3VSCA 3P0RA 1EBUA 2NZWA 2B4QA 4AJNA 2G72A 1FJXA 2ZBPA 3I9OA 4AJKA 3GFFA 3RSCA 1NU6A 5AJHA 2JI4A 2JAUA 4LF5B 1E0SA 1SXJB 1AZSC 4QOHA 1AE1A 1ZOOA 1L4BA 4Q01A 3W5UA 4UM8B 1DB3A 3BL6A 4KGXA 1ONBA 2HPVA 4LUCA 4NV3A 2QR5A 5UKDA 5KUTA 1ODLA 3VFDA 1MFZA 2HRZA 4IRUB 2E1RA 3EIUA 2I78A 1KP9A 5IG2A 1KZ7B 2P8JA 2APJA 4F4FA 3P71T 3D7LA 3D0KA 3TS1A 1F38A 1TW3A 3LP6A 1IK4A 2O57A 4C7KA 3MMZA 5EJIA 4M99A 2X13A 4AAYA 2II6A 1QHXA 2B9EA 2FR0A 2WQZA 3H83A 2XNHA 3PSHA 2OXFA 3CLTD 3EA5A 3ZHVA 4OH1A 2CE7A 4KH0A 3UTDA 1Z5UA 3QKSB 5BNWA 4MPDA 1VLHA 3G9ZA 4N5LA 3R7BA 3ZW7A 4F3YA 4HXEB 2AOXA 3A9VA 1ZVKA 3HNPA 2ZT5A 4HNGA 4M87A 4NESA 4XQGA 3WFIA 4LVCA 3R7AA 4JR0A 1WBBA 3FFWA 5CFQA 2KWIA 3BK2A 1K5PA 3CBGA 4X20B 2WUFA 1OFUX 3OQIB 4I1VA 5E7IA 4ZCLA 5CD1A 2AX3A 3M6IA 3H4TA 2W0SA 2P6MA 3IAHA 3VNRA 3DEZA 2JJ2A 2ZYGA 2DP4E 3R9XA 3NB0A 4N0MA 2GPWA 3C6BA 3FBGA 3O5AA 1HG1A 3CO5A 1Y7LA 4PPNA 4M8SA 3EIHA 3QVVA 5EKUA 1E96A 3ZI0A 4PX5A 4UC0A 2V1UA 4XWAA 5BVGB 1MC1A 2V3CC 5ALXA 1IY9A 1NMXA 2VJCA 3QLVC 3G7NA 4RLHA 1F0NA 2FJUA 4BNJA 4EFKA 3UJDA 2J9XB 1XNGA 4JLWA 2AKAB 2IYAA 3K16A 5EP4A 1PR5A 3VOBA 1DXYA 3BXGA 2VYFA 1E7SA 1MGOA 2REQB 2YY5A 2PEYA 1HK7A 2P40A 4XOUA 2NO5A 3Q2OA 2OCBA 1Q16A 3WK9A 4UHJA 1YSCA 1IXRC 4TWJA 5EXDA 1KEUA 2QAIA 2Z0MA 3CWZA 1WXFA 1ESEA 2O1WA 1XEXB 4EKIA 5F3DA 4PSUA 3JD0A 3HKCB 3SEQA 3E8SA 1XLWA 4HFNA 1I3CA 4XJSA 1N5DA 4DVJA 1ZA1A 4AYXA 3EXHB 4AF8A 2IH2A 1E4EA 3RD5A 3MGKA 2C3MA 6REQB 4WJZA 3NMUF 1RMTA 3RARA 3ODPA 5IVHA 3S28A 2QN8A 4F4IA 1TMYA 4ZPJA 5LB4A 3OWHA 4FZ3A 3FWZA 2MYPA 1PNTA 1RKBA 3E9YA 4GM4A 2HHLA 1XJ0A 4MV5A 1XA4A 3EEYA 4KR3A 5JBQA 1KO1A 4YREA 2ZULA 2TMKA 2H5EA 2P4UA 5LIPA 5BUZA 5AW2A 3U1TA 4OQZA 3TD6A 4YMUA 4BLVA 1KI4A 3D1LA 4YCBA 2PGXA 4EI7A 1PG0A 3AK4A 1HOXA 3QEMB 3PE4A 4L8LA 4BN4A 5BNIA 5IYZA 4Q3BA 2ADMA 5DM60 3LLSA 2PGLA 4UNSA 1XZJA 5A1TA 3EZ9A 2Q7XA 1SM4A 2EBHX 1IHDA 4D4KA 5IABA 2QE7D 1WO8A 4ESEA 3PT5A 3OJFA 2X1LA 3B5IA 4WFKA 4W1PA 3SSNA 5AVKA 3OM9A 3B3FA 3PZRA 4J9VA 2FG5A 2OFOA 1QYWA 3L1VA 1E5DA 2OO3A 5LOVF 2HLPA 2RC6A 3PFNA 1UXHA 3H9CA 3R7FA 1V39A 5IU6A 3D3JA 2EYQA 2I9PA 3CTMA 1JKJA 1TM5E 4UVHA 5T8KC 4BHTA 2UYHA 3WGKA 3RFVA 4Y0NA 1W44A 3Q8XB 3H9UA 1E7RA 3X1DA 1A2OA 2HA6A 2MSWA 4EA6A 1XZMA 1XFDA 2NQ8A 3VUFA 3WYEA 2YIMA 1QIKA 4LIPD 3COVA 4K2AA 4U00A 5DHUA 1RC8A 3GJ0A 4ZEVA 2ZS9A 3QVMA 1ZJYA 3OP4A 3F5FA 4K9DA 4BMVA 2NYVA 3WV4A 3RUEA 4UTNA 1I36A 1NURA 1JHDA 2WZDA 3HBLA 2Z3ZA 1TF7A 2ZS7A 1Y81A 2W2MA 4A92A 2J31A 1NQVA 2IZ7A 2WG0A 3OZUA 4XEHA 3ITDA 3E8MA 3I30X 4P4UA 2AK3A 3RANA 4MUNA 1UBOS 2PMBA 3KEGA 2K6GA 2H92A 1TMKA 1VOTA 1NQOA 2G07A 3ND9A 4TSFD 2ZI9A 5I9MA 2BYTA 4OY3A 1I6LA 1VSBA 5EFZA 1S3IA 5CP8A 2CLFB 4V39A 5AVOA 2PSDA 3UPDA 4DJAA 4AZ0B 2G1PA 2ZB3A 1PIWA 3ZQKA 1N5JA 2XUFA 4AJPA 1EH5A 1H0RA 1SH7A 3M6AA 1LD3A 2AYYA 2B82A 4J3JA 2ID9A 2IK8A 2J4DA 3EA4A 1N1GA 5E2IA 1R0KA 2R1VB 3IPRA 3WGHA 3E7WA 1Q1ZA 3AR8A 5G02A 3HZRA 1HLPA 1VSVA 2RGBA 4WADA 5FIUA 4ZVSA 3JSAA 4IZHA 1N3LA 2G8LA 3HC7A 5FWAA 3LCJA 3FYDA 2G06A 3JS5A 3NTVA 4AUMA 4MUBA 1NVEA 3AGQA 3ZHBA 3U81A 4MZXA 4QYIA 2WFLB 3RUHA 3LXXA 4GI2A 2DMRA 4W6QA 3TQQA 3ITEA 3D0RA 3H05A 4HB3A 5FWXA 4B40A 2QS9A 3TIGA 1KHTA 2IZZA 2PRKA 4RHYA 1TZBA 5KYVA 4M0EA 1OZHA 4U1RA 4WESB 1LBEA 1W59A 3OCYA 1V35A 1G8FA 2JAOA 5DBGA 3V8QA 4AY5A 3FFXA 2VQEB 1SCKA 1F20A 1TQ4A 2DR0A 2H48A 2Y1OA 3BSYA 3UFXB 1TJYA 3F47A 5KNCA 5U4XA 2LE0A 1JSLA 2OFXA 3DGEC 1MRNA 4EHLA 5AXBA 3K09C 1WD5A 2BUBA 3IPYA 3FVRA 1ZSNA 4BEVA 1ACLA 3ZUGA 1GEEA 5F5XA 1AD2A 1U98A 3RSZA 1QS0A 3GCGA 5F5NA 3VYRB 4V1CI 2WTXA 3K5HA 1W94A 4YP5A 3FI9A 3ZE6A 5IKXA 1JIIA 1IEVA 1Z15A 4CN8A 2G80A 4UMFA 3V1TC 2OYRA 4X9XA 1F0YA 2W4IA 3WB1A 4PN3A 3SQNA 3LUAA 1H66A 1DGQA 1PR0A 2J0UB 3L6EA 4A2WA 1RBYA 4RF5A 4BMYA 2PMFA 2XA2A 4QRDA 1M0EA 3C3PA 1KSGA 1CNFA 4DANA 5FO1A 1M9NA 5DNWA 2A0UA 2B5OA 2WIGA 2I7XA 4KZKA 2PYIA 5JV5A 4LHEA 3IS3A 2ENUA 3KUCA 2B8EA 4M7OA 4U5QA 5KVCA 4X62B 2V7WA 4X63A 3RFUA 1COWD 1GPDG 1LQ2A 1EE9A 4RSGA 4MKXA 3O3MB 1EP2B 1ZH2A 4PYNA 4U7JA 4DLVA 3HLYA 3E22B 5BV8A 3FF1A 1DJOA 5DASA 1DLJA 1GRNA 5BYKA 4EHNA 1C3OB 4US2R 2I2CA 1E0DA 2I4LA 9LDBA 2Y1DA 2X22A 3OPVA 4MAAA 4CEIB 2XCLA 2BGNA 2O2YA 4QQFA 3SNHA 3GAMA 1U0NA 2GPNA 1DBWA 3O4FA 3LBYA 1B00A 3BMCA 4ZPXA 4C4RA 5KYUB 3R5SA 4HWGA 4J2TA 2P75A 3EY4A 4WKBA 3LP5A 4TMWA 1P72A 4DSZA 4V0QA 2NU7A 4BMNA 1MX1A 1KI8A 4DZTA 1HV8A 1P1HA 4BFZA 3CG4A 2VO1A 2BR4A 5EE9A 1S3GA 2IYZA 5F3RA 2P11A 3TLXA 3NFRA 1CY8A 1FTGA 3MMXA 4FDAA 4G6ZA 4N39A 3TLAA 3O8QA 3GUUA 3Q7TA 1VLJA 4K3VA 3IMEA 1PG5A 3ANLA 2XTMA 1SOAA 3HCAA 3ILYA 3UOWA 1DAOA 1N5LA 1XLTC 2FX2A 3BTVA 4G5FA 4A8TA 5J2TA 4FFLA 2Z8YM 1P9WA 1SKYE 2CNOA 3L9XA 3K70B 5KQRA 4BP3A 4W9MC 2G6BA 1JPJA 1ZX1A 1XSEA 2PXCA 4A0QA 4JJGA 3HCDA 2P3QA 3JVVA 3TNDA 1IPEA 2JVIA 1BX1A 2EZ9A 1O97C 1Y5LA 3FAZA 2OMKA 2VWGA 2ZE8A 4FPXA 4MCIA 4RUKA 1OPRA 1N36B 4XZ3A 2WHYA 4Z9BA 1AVTA 4CR7A 5ERXA 3NEJA 4FGKA 2IODA 4XCVA 4EPWA 4B45A 1SUIA 1AS3A 3L8DA 4NIMA 2HYDA 3C7CB 2PSHA 3Q5GA 1AUQA 2PMDA 3DYIA 3QQ5A 4DC1A 1ADYA 2P9QA 3G79A 2ZUDA 3KR1A 4LV8B 4QXPA 1Y8QB 3A7DA 3M9WA 2G7ZA 4RD2A 4TV8B 4RESA 3DAFA 3Q4GA 4OKNA 4QFCA 4S0XA 3SZUA 1NR7A 4DYVA 2ZE6A 5L4LA 2J7KA 3I0MA 4MWBA 1U2ZA 1F2TA 4XJXA 1M2HA 3A58B 3T9DA 1GUYA 3IERA <