5KAMA

Trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with inosine 5' monophosphate
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
182
structure length
158
Chain Sequence
TSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypoxanthine-guanine phosphoribosyltransferase
publication title Crystal structures and inhibition of Trypanosoma brucei hypoxanthine-guanine phosphoribosyltransferase.
pubmed doi rcsb
source organism Trypanosoma brucei brucei
molecule tags Transferase
total genus 47
structure length 158
sequence length 182
chains with identical sequence C
ec nomenclature ec 2.4.2.8: Hypoxanthine phosphoribosyltransferase.
pdb deposition date 2016-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00156 Pribosyltran Phosphoribosyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2020 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kamA00
4M0PA 3DAHA 1QB8A 1HMPA 1V9SA 1VCHA 4P82A 5IPFA 3DEZA 4FYMA 4RADA 1TC2A 3MBIA 4PAWA 1MZVA 4WN3A 1XTUA 2P1ZA 1DKUA 2YZKA 4RACA 1L1QA 2WNSA 3GGCA 1NULA 1G2PA 1P18A 1QK4A 2C4KA 5HKLA 4QRIA 1IBSA 4PFQA 5BQPA 2JKZA 4LZNA 3DMPA 1R3UA 1P4AA 1QK5A 4RHUA 4RQBA 3LPNA 4QYIA 5KAMA 2H07A 5BRNA 3ACCA 4KN6A 4RHYA 1ZN7A 2AEEA 1AO0A 1ECCA 1UFRA 3G6WA 5BQOA 1HGXA 2EHJA 1OROA 4F8EA 5BSKA 1A97A 1ECFA 4RHXA 2JBHA 1G9TA 4P3KA 1DQNA 4RAOA 1W30A 1Z7GA 1ECGA 1A95A 4LYYA 4P80A 1ZN8A 1DBRA 1ECBA 2PRYA 3LRTA 1CJBA 3N2LA 1O5OA 3OZGA 3H83A 1GPH1 2JI4A 4JITA 1UPFA 3ACBA 3MJDA 1U9ZA 1ZN9A 4M0UA 3OZFA 2E55A 1LH0A 1OPRA 3EFHA 2H06A 1DKRA 1A98A 2IGBA 4LZAA 5KAPA 1I13A 1VDMA 2XBUA 1XZ8A 4RAQA 1L1RA 1I0IA 5E38A 1QCCA 1J7JA 1WD5A 4X44A 4ZFNA 1BD3A 1U9YA 2PRZA 5IAOA 4P86A 4OHCA 1FSGA 3QW4B 4QYIB 4RQAA 3KB8A 1Y0BA 4Z1OA 3OHPA 1QK3A 4TWBA 1P19A 4S2UA 3NAGA 3GGJA 4LYGA 1JLSA 4LZOA 1G2QA 1P17A 1PZMA 1QCDA 1XTTA 3M3HA 3HVUA 1A4XA 1DQPA 2GEBA 4RHTA 1JLRA 5ESXA 4JLSA 1G9SA 1TC1A 1QB7A 1I0LA 1OREA 1D6NA 1NONA 4RANA 2PS1A 4P81A 1YFZA 1STOA 4RABA 5ESWA 4P83A 3O7MA 1UPUA 4RV4A 4P84A 4WMLA 5K51A 1XTVA 1XZNA 1GRVA 1BD4A 1BZYA 2JKYA 4IJQA 5JV5A 5EUCA 5JSQA 3S5JA 1I14A 2H08A 4X45A 2FXVA 2VFAA 5HIAA 1A96A 3GEPA 1O57A 4M0KA 1A3CA 1VSTA 4MB6A 3ACDA 1I5EA 2HCRA 2DY0A 1ECJA
chains in the Genus database with same CATH superfamily
1UBUS 2R00A 3ONWA 5KYXB 3VTZA 1H0HA 3SIRA 1GGVA 2Z4TA 3P2IA 4C6HA 1POXA 2VUUA 3FIUA 4O4HB 3AFHA 2CBZA 2BEUA 2LKDA 4UXJA 4DA9A 4DFDA 3OCCA 4HDNA 1NI3A 4AX4A 3KVRA 1M8PA 2W2VA 4K2HA 1N75A 2IDZA 1ZU4A 2PUTA 5JW6A 4URXR 3TLGB 3GVHA 4I8DA 2OECA 4Z4CA 3FCCA 1SULA 5JDCA 4YV1A 1S5PA 1R0KA 1C81A 4MQUA 1E0AA 1RDFA 1FZTA 1CXZA 4ASUA 1GNTA 2PT7A 2VOJA 4UBNA 2Q2WA 3DTVD 4WEQA 3N8GA 5FLXA 3STHA 4G4SP 1TK9A 3SSNA 2I1WA 2JLAA 3I5UA 3KT8A 1VPWA 4F21A 3EXAA 1C3XA 3HK2A 2IX3A 2FWPA 3MAGA 2LWIA 4BMYA 5LKRA 5LQCA 2QLTA 4OSOA 4X64B 1EDZA 1MFZA 2C2MA 3QIAA 3ZGLA 3V9PA 4DBLE 1IK6A 5LYJA 2JD2A 1C0IA 1XSEA 2PANA 2PX2A 2X8AA 3GJYA 1XTZA 4DUYB 4N5NA 2I22A 4UHFA 2EJUA 3KJXA 2GN9A 3L7YA 3SC4A 3KQSA 4W9RA 3AJAA 1U11A 1ULSA 1WXFA 1ZITA 3E2PA 3LDFA 4IDQA 4ZXFA 3IUQA 3DAFA 2EGHA 2VH5R 3OC6A 3T9BA 1W5FA 2PUHA 1KMCA 1UPFA 2DX7A 2UZ0A 4Q4JA 3NRBA 2UYYA 1AS2A 1G1MA 4QGGA 4MYDA 5E4FA 2AZMA 4Q3LA 4R8RA 3PQ5A 4LTNA 4O2AB 5ALOA 1BXRB 3ZOZA 3C3AA 2YJ3A 3QPVA 2D06A 4WY2A 2R6GA 4ZVUA 4UARA 2HU7A 4NZPA 4F11A 1Q7BA 1DAIA 1CUUA 4RA6B 1PD1A 5ITZA 4LN1A 2V9PA 3L8ZA 3RIEA 1PIWA 3QFRA 5CYFA 5F1PA 3LC7O 3WLQA 4MB2A 3L3BA 4IM7A 1P0PA 2PLAA 1QU2A 2BJWA 2PM8A 4BO5A 4FGSA 2QV7A 3NC4A 5HE8A 3M6VA 2WFAA 2VHCA 1C9YA 2GNPA 3WTCA 3W5UA 3EW9A 4V38A 4V3CA 4JP8A 3QYFA 3KSZO 3QXSA 4XGKA 4DRZA 3DDHA 1KU6A 2V9ZA 2AR7A 5ALQA 5FL3A 3HCFA 5SICE 3ISTA 2GOYA 1ZK2A 1AHNA 1NU6A 1KY2A 1ZCBA 1ZL0A 4XYMA 5TEWA 3V4OA 1LK0A 3LCJA 1QIDA 3C7KA 2CL6X 2ZWVA 5AJVB 5LP6A 4LXUA 2QQGA 5EQTA 1WF6A 3RABA 2Z5VA 2LTAA 3AKCA 3SZLA 2V8BA 2CVHA 3KZMA 1P7ZA 2V7UA 2B7BA 2ROQA 2CMKA 4YO8A 3FPJA 3WE7A 3ZWKA 2JAPA 1WU8A 1XWWA 1OW3B 1XQ6A 5DPMA 4P84A 2HU8A 3E9YA 4LQDA 1J0BA 3WO0A 2QL7A 4AZSA 5KQRA 4BIMA 3AM1A 4RK0A 4MWSA 3SNHA 4EI8A 3AY0A 2C4VA 4BNZA 4D6PA 4ZAXA 4C78A 2VNSA 3WO1A 1XJWA 2W2XA 3IPCA 3AO0B 3ZIAD 5IBCA 1T5IA 2FSIA 5EPUA 1VBFA 1S2MA 1VFPA 3R5HA 4FEEA 1LB1B 3W7AA 1P9RA 2ZT5A 1SVUA 2X6QA 2DGDA 3F0TA 4ND4A 5E4TA 3FOCA 3RV4A 2E3JA 2AKAB 5J63A 5I7VA 1XD2A 2VYVD 4BJ1A 4MULA 3QKIA 2FZLA 4L76A 4AULA 3R77A 3EA0A 5M5BA 1CRPA 1YBHA 4I81A 4N9WA 3V8QA 1U02A 1B3BA 4FDVA 2ADFA 5KJ6A 3KQPA 4DGQA 4QUIA 1G8KA 2A0FA 1IZYA 1TT5A 2PWPA 3DWGA 4FWIB 4GRIA 4JYCA 1E2DA 3SIPA 2O7SA 1SC1A 3WWYA 1QXSA 1I3LA 4OVKA 1OV4A 4JMPA 2NUPB 2HBYA 2V9CA 3JQFC 3OBIA 4HPXB 3WNCA 4HDSA 4UBKA 1RKVA 2DFDA 3V8RA 4UTPA 2GBLC 2F1OA 1TMYA 4W8OA 4PLFA 3O74A 3NJRA 3A3KA 1UFRA 3E4CA 1J8VA 1WY5A 1ZD3A 3VHRA 3VVMA 3BULA 1V47A 1RRCA 2XCSB 2MSWA 4BZXA 1IONA 3DFMA 3P2KA 3KYJB 3IAM6 1UEXC 3PT9A 3PDHA 4D96A 1TJPB 1SD5A 1WEHA 4ZCPA 5H16A 1XB2A 3NWJA 4NSNA 3PUHA 3QKWA 2Y6UA 3T3NA 4JKOA 3SZ3A 5JYBA 3HLKA 4R0NA 2QNIA 1PNTA 1WSWA 2AJDA 2IF2A 2IF0A 3Q15C 4ONEA 1GAWA 4JYPA 4B5KA 3QEKA 5IVDA 1INLA 1VLJA 1IOVA 1MW8X 2CSXA 2YZ2A 3M2TA 5BSMA 5K6AC 5H80A 4DQKA 1F7VA 1YHZA 3BIOA 4WIAA 3PHIA 1XRQA 2IK8A 4C6RA 2BZ1A 1M6VA 4HDAA 1HFWA 3O93A 3PEVA 3VHLB 2ZB4A 5FIUA 4WLNA 3OMXA 1IXYA 1CUFA 2WUEA 3OOYA 1G20B 2XQIA 3LRPA 1EFLA 5JJ5A 2IXFA 3AF4A 3R3JA 1I0IA 1CFZA 1J07A 2CKMA 2PSFA 1HV8A 1QCCA 2BFEB 3AEZA 2MCFA 4C0AC 1QQ5A 3NGXA 1EUQA 3I9NA 1F0KA 3P9CA 1E9AA 2X7JA 4S1VA 3N87A 2D2VA 3K0KA 2V74B 1A1VA 1JR4A 4C2AA 3WLTA 3UXHA 2J5XA 1D5CA 1DAPA 4LSMA 4U7FA 2OLEA 4MVJH 3P9IA 5EI5A 1BXZA 5ALUA 1YI1A 4MLCA 4X41A 3HLYA 3WL8A 1SR8A 2FFRA 3LIIA 4LZWA 3PWZA 2ZBQA 4GMFA 1T8PA 3GRRA 3Q7PA 2QRQA 3KHKA 4JLSA 4WXPA 4EL5A 4BXOB 3L7NA 5K03A 3QKSB 3HPQA 4LGYA 2QHXA 5L45A 5LL6P 1JAXA 4HX2A 3SKXA 2ZI3A 3DAPA 4UZFA 3C6XA 4R8VA 1B6GA 2J3HA 3RJ5A 1CR6A 3H1EA 3ZWPA 2XCUA 1HNNA 1W88B 2KQUA 1MABA 3HL4A 3LT5A 4IDDA 4K26A 4AT1A 1J56A 5H4HA 4WZBE 3OTIA 1EFVA 2DPGA 5T7BA 2CXHA 2WEKA 1KZYC 2P3OA 4MCAA 2QD2A 4I9HA 3ZWYA 1ADJA 2GXAA 3QBJA 1EQUA 2E18A 4QBKA 1FFWA 1L5KA 3FFAA 1Q95A 2BZ0A 2CLCX 3OC0A 4KGZA 5TF0A 1L5SA 1JA0A 3BB1A 3EISA 3V7NA 2FUKA 1YIAA 1MRZA 3AJRA 1EGMB 1U8CB 3DHYA 3ITEA 4FCCA 4DQDA 1NUQA 3X1YA 3LQRA 3BL6A 4CYMA 1A9TA 1CJVC 1R6TA 1SHKA 2D5BA 1GPJA 2HO5A 4AUMA 4EW1A 5I45A 4LQLA 5ENZA 1XAGA 3Q6MA 1WCV1 2UXCB 3JAWA 2VPXA 3E1KA 4RLFA 1KRHA 2ET6A 3UKDA 3V6MA 3VUFA 2XCQA 3ZKAA 1PDOA 1CNFA 1YQTA 3DAYA 1XZLA 2OCDA 3OLCX 1I4LD 3FPFA 2VJAA 4JH0A 3WOHA 4HNUA 4DUZB 2IYLD 1I4EB 1DKQA 4ZOBA 4Q9AA 4PHFA 2CJWB 3U44A 4BLWA 5FNZA 1U0NA 2JGIA 1XQWA 4Z49A 5BUCA 4TXLA 1Z73A 1RTKA 3C39A 2QG4A 1XTKA 1Y6JA 2C92A 1QIEA 3N5CA 2DR0A 1G6HA 3MNFA 1BDHA 4GLOA 1BOFA 4DV3B 1KY5A 1Z5GA 2H85A 2P2DA 2XYRA 3LY7A 1T2AA 1O54A 2AQHA 4C4XA 4XIIA 3OQMA 3NHYA 3HE3A 4IF4A 3KJHA 5IW8A 3GLTA 5K0GA 2C83A 2YMLA 2E4VA 3QJGA 2B36A 1UPCA 2QGFA 4C2TA 5JZVA 3CMCO 2PG3A 5C5DA 3SIXA 4YAFA 4AP9A 2WP0A 3ELUA 1W85B 2EDCA 2CGEA 3FWNA 5CR9A 2EFYA 4DDHA 5I3ZA 2SECE 4PLVA 5LMNB 2EG5A 4JR1A 4ZTUB 3CUWA 4BO8A 4AECA 2X42A 3C3BA 4MA4A 1AY0A 2IKQA 3QEOA 4YT8A 5DLPA 1PL7A 3FDIA 3PIIA 2WYVA 2PT5A 4MI1A 1RHJA 3P9QA 4L0CA 2YYZA 4X44A 2VHVA 2WWRA 1YCGA 3N2NA 4ZCQA 1OX5A 4QRDA 3FRJA 4QTYA 2Q6OA 2YV4A 3WL4A 2MSNA 2W70A 3ZH9B 2A6PA 2G08A 4HWPA 4D3YA 4ZO9A 4DCSA 3E15A 1XTPA 1KZ9A 2AOTB 2FDRA 3DEFA 3QXJA 4C2BA 3QHAA 3V48A 2ECFA 1QGOA 4MKIA 2VA9A 2I67A 1O0CA 3QSGA 2W58A 1RM4A 3O90A 4WK2B 3H5NA 4EO9A 2DT8A 2HQ1A 3E7FA 4H1UA 4U3JA 3KE9A 3RD5A 1JKJB 2F3RA 4BP1A 4RABA 3VMFA 5F7OA 3OEYA 4FB5A 3I32A 3UJDA 3MYRA 1E5XA 3IVXA 4DV4B 3MOGA 3MCZA 4BNTA 3H4TA 1V1MA 1W5EA 4BFWA 1J7KA 1Z0UA 1VRVA 1OXXK 2ZVDA 3S5JA 1U2DC 4YQYA 3NVAA 4ND2A 3IOEA 4BKUA 3O8QB 3A10A 5CT5A 5CB4A 3ND9A 4OYLA 5H7XA 4EZEA 4EY6A 4IJVA 1Z4QA 2Q9CA 3D54D 1EUCA 1L4LA 1UBMS 3N8DA 3O26A 3TQOA 4JP2A 3TS1A 2XE8A 4HNGA 4RD6A 4PZ0A 4RE6A 4YK7A 5LLTA 3N74A 1RE0A 5WRFA 3TQTA 3UOGA 4BE9A 4D8UA 1GRRA 4K40A 1JHPA 4L50A 3M2PA 1SC3A 2CFIA 2FPMA 4D3SA 1MA3A 3INTA 1T3GA 1GN8A 1CZKA 3QELB 4ZT6A 3TLMA 2RAPA 3CW2A 4MS4B 3IO5A 3W2FA 1O95A 3BFJA 1JHMA 2GTIA 2QENA 4D9GA 5ARDA 4BATA 4P2BA 5KPDA 4W1QA 4B6OA 3IQEA 1N0HA 4FQ7A 1WUJS 3U3JA 3UWPA 2W6JD 1LRLA 4Q34A 4HVLA 1T0PA 3EZ7A 2BCJQ 1XVIA 3MPUA 2RGNC 4OJMX 3WLOA 1EWVA 1SBZA 3U3ZA 3HCRA 2WKQA 3JVDA 5PGMA 3RS7A 3SDSA 5CNKA 4HX9A 5JSYA 2X22A 3AZQA 1F06A 4DR4B 2A5JA 1W2WB 1YBFA 5BRNA 3LBNA 3RAJA 4UTOA 4F4HA 4JA0A 5AHKA 3R0XA 4EMSA 4CMIA 1OJ7A 2YNMC 5EQFA 4JI7B 3NHUA 5L3RA 1DELA 1P0MA 1MU0A 3ANLA 4X6YA 1W94A 1YDEA 5HKKD 2JVJA 4OF4A 4YDSA 2YVUA 3RAFC 2IU3A 4PZDA 4Z9AA 5HS6A 1OFUA 3OX3A 5I9SA 3VNBA 3NHSA 2ID9A 1C41A 3PKJA 4HWOA 4IQFA 4BKOA 1FBTA 2FGKA 4M9CA 4NMXB 4OCZA 1ZOPA 1QVRA 4RK1A 3I6IA 4X61A 5CA0F 2IHNA 4KH0A 4RL6A 1F8GA 4QM7A 4DR1B 2ZRFA 1RR6A 1ZFNA 1P2BA 3JYLA 3NI2A 1QIKA 2Q0XA 3GJ3A 2R7NA 4DJFC 1JEEA 3B1KA 3ZWVA 1FVOA 4A92A 3NEJA 4PEVA 2PTHA 3D7MA 1KP9A 3NYIA 5BWNA 2PE5A 4HFRA 1ZVQA 3EVGA 5A06A 4D0SA 2CL7X 2RHWA 3UWMA 1RVV1 2H5JA 3S44A 1WUTA 5KCMA 3VO8A 1RM5A 3O8BA 2XOXA 3ANMA 3IB3A 5BO5A 5AM3A 3H5OA 3JAKB 4IO1A 2HBQA 3P9ZA 2WTNA 3VR2D 4PSAA 1SJ9A 1TK2A 4KDRA 3ZNOA 2ZETA 4MLDA 3F4KA 5F4ZA 2RE8A 1KEVA 5J2TB 1Z5UA 3KR0A 4WXEA 1AZLA 2IBSA 2VZLA 3EZGA 4EFKA 1UT6A 2ORWA 1MH1A 4AZWA 3K9LA 1Y1LA 4OATA 5DLYA 2FB9A 4HDOB 1K97A 1TZBA 3LKZA 3URMA 3AR2A 3O92A 2GZDA 3MMPA 1VP3A 3U9SA 4ZYWA 4TYYA 1XWIA 1JHZA 5I7HA 4HK4A 2B2NA 4B81A 4MICA 3KT0A 2B7CA 2X1MA 1KFKB 1DBSA 1M1YE 2QN3A 2WE8A 3I23A 2O5EA 1J00A 2JNWA 2O7RA 1QIFA 2C9OA 4ARCA 3A2MA 3HDYA 2DUMA 2GM5A 5IAKA 1RQPA 2R8PA 1N77A 3VKGA 2NZUG 3BREA 4TYPA 1KK0A 3DR5A 3QVLA 4C5AA 1QE0A 2NQ2C 2XKBA 1OBVA 4XLTA 4F6RA 2WNIA 4UAVA 1QRUA 2VBIA 2W4QA 5IUKC 1SVWA 3OQ6A 3I01A 5KOIA 4OXYA 1TADA 4WN9A 4TT8A 3C4JA 4BFCA 2IZ5A 5EXTA 4R0MA 3BWYA 2IHZA 3F49S 5AP9A 1NJ2A 1PJLA 4TWZA 4LHEA 5FUQA 2A5LA 1MJ5A 3WQRA 1PWHA 1JIXA 1K7CA 2PA3A 4QGAA 1S2LA 1C1XA 1JXOA 1T4MA 2ZRHA 1N6IA 4GMXA 3FW1A 1SXQA 5H4GA 4Q3OA 1O89A 2WKSA 3GX1A 2ZT8A 3M6WA 4K0KB 3FOBA 1BX0A 4HR7A 3KOWA 1LPPA 1VE3A 1L1EA 4K9RA 2PEZA 3UQYS 2G77B 1PG5A 1OLUB 4YMHA 5KDOA 2C7QA 1E2LA 1C3OA 2I7CA 2LDXA 3QPCA 4LJ4A 4QJ5A 4TL6A 3GLQA 1L9KA 5E9JA 5EHGA 3TI7A 1DFIA 4CIWA 2GLTA 2M1XA 3H86A 4TMYA 3TX2A 3ZHXA 4EUKA 4GE0A 1NAIA 2BGTA 1VM6A 2HJGA 2HMTA 4Q4JB 3IEXA 3ZK9A 1GLVA 3DG9A 5KWSA 4Y2YA 1VHDA 2GTPA 2GGSA 2REQA 4GOLD 5LZ8A 5JAPA 1XE3A 2QSJA 5TSDA 5BQ3A 3OM0A 1O8BA 2J45A 4WVFA 2A30A 3ASZA 5BR8B 5LMCA 3FNFA 2IIQA 3HCNA 5FWDA 3VJLA 1Q0PA 2AZDA 4EPVA 5IT0A 2PT6A 2WICA 4C4TA 2J0SA 1LXCA 1N2CA 2I3AA 2NZ8A 2VSYA 4NBSA 4LOIA 4YRKA 5HF8A 1W44A 1PJ4A 1II0A 3O47A 3PDWA 4N5LA 3GPBA 1XZIA 4GGOA 4QAJA 5KYWB 2ACWA 2AMFA 4HRVA 1KR2A 3WLLA 1EFCA 4CLEA 2EEZA 1UAYA 5I7AA 1LK7A 5IKOA 1BXKA 1OYWA 3IC5A 4WNCA 4A3SA 4C9BA 2ZJ2A 3WBKA 3I9V6 2P7IA 1SEPA 4L3VA 4CIYA 3ZJ5A 1ZX1A 1LEHA 1RYMA 2IYTA 3B5EA 3ZGXA 4EX7A 1BRTA 2BMEA 1J23A 1LBSA 3UC9A 2J41A 4W5OA 3NCTA 4L02A 5DN9A 4MP8A 4KX3A 1W34A 1NJSA 3PXAA 4WKCA 4R81A 1SUDA 3JYPA 3RQIA 2OPBA 3CLUD 4AZ3B 5LIRA 3LXUX 1HY3A 2J09A 4O4HF 1UZAA 5IX8A 4JLMA 1ZXXA 3ADPA 4FDMA 1P5HA 3UIEA 4XCXA 3GFOA 3ASUA 1W8DA 1C1YA 5B58T 4P86A 3F6RA 3TOZA 3ZTYA 4BO1A 2AI1A 5HOQA 4OYRA 3HL0A 1GTMA 5IXJA 4RTQA 2FA9A 4PNEA 3BG5A 4AUKA 4K9PA 3WRVA 3H7IA 3OJOA 5DTJA 5FBKA 1OGJA 3DYVA 5FPHA 4DTCA 3HGQA 1U99A 1N7IA 2HDHA 4ZOAA 4B80A 4A0GA 3W6ZA 2Q9UA 3UKOA 1LQUA 4DLTA 1PO7A 2JGRA 2WF9A 3HXTA 4Q03A 5TJHA 2C1XA 3G0OA 3L0DA 1TC1A 1QSGA 2QXUA 2AC7A 3NV9A 3HNOA 4MJ3A 2ZUFA 1KJQA 1M33A 2QIPA 3ND7A 4PYOA 4D9HA 4KMOA 2C31A 2OHFA 1Z47A 3GG2A 3VVCA 2ERXA 2DQSA 4EB3A 3OIUA 1C80A 4JYAB 1E9EA 2GBFA 3GROA 4GX2A 3KJZA 1PLLA 1ZSNA 3PHJA 4WBNF 4MCHA 1FDIA 2P91A 1XEFA 3EEIA 4KUEA 5FEUA 1Y1SA 3QMWA 4K87A 1SC6A 4HC4A 3INYA 1THGA 4ZQEA 2W2PA 3AYZB 1QC5A 1G19A 3ZE9A 4LA4A 1RYZA 1YJXA 3NBYC 4B73A 2N1MA 4YRJA 1SD1A 1QBKC 3TFOA 4AVYA 4DLPA 5E3IA 1W1UA 2ZJBA 3NM5A 2C4TA 3ROPA 1GAEO 4RPLA 5HF6A 2XLCA 2P6NA 1EFHA 4HNAA 2HJ9A 1RAFA 1X38A 2GUGA 4K1XA 3T4XA 2P4UA 3BWCA 2EBHX 3GJ0A 4NH0A 1HLGA 4R1OA 4XUCA 1BVUA 1JEDA 4G5SA 4IF6A 1E0DA 5DULA 2J5BA 3CNNA 3C16C 4MUXA 4NCKA 3BBLA 2B21A 4HQ6A 2WMOB 4BNDA 1PR9A 1PTJC 3IR6A 2PAFA 3L7CA 3F8SA 4G0OA 4QFDA 2CE7A 5D6NA 1QYCA 2DUNA 3RVJA 4E5UA 4KPEC 1A76A 1H2ZA 2QE7A 3B36A 3H7AA 3GBSA 3H6KA 1ETHA 4HUQA 4NXNB 1RC1A 2QM3A 2H1FA 3PJGA 4TXJA 4W7HA 4YAKA 3SEZA 1M6VB 1NPYA 4Q1DA 4O1HA 2H07A 4IDCA 5FOTA 1X94A 2QDXA 5TMPA 1OBFO 4KMRA 4L8GA 3TUJC 2WIGA 1N2SA 4BNFA 4EGSA 5FXMA 2PX0A 1ZUIA 3FTQA 1XC7A 3BL5A 1ESCA 3DNPA 1Z7BA 2XKAA 3C7AA 3ZGOA 1MDFA 3BJMA 1MJHA 3IT1A 3WGMA 4TWJA 1WNTA 1GKLA 5G0WA 2WFZA 4Q16A 4WNAA 4OH7A 3NXSA 3LA8A 2EZ9A 3KYDA 3E3LA 1F5SA 4UD2A 4CIVA 3ZEAA 2VJLA 3H6HA 4OBWA 4UOZA 5LPNA 3GFTA 4NS4A 3O8RA 2HCJB 1CUAA 3KK0A 4OHRA 1J49A 5LDDC 1WLYA 2FVXA 4LHSA 1NQUA 1OY1A 4HAWA 3K0HA 2G1AA 2HSEA 3RSCA 2C4NA 3UWOA 1JAYA 3MXTA 1FCJA 5EHNA 4DMRA 3JQAA 4J0FA 1TZCA 4BJ5A 2OBLA 1XYVA 3F7MA 2MSCB 4CFZA 5HILA 4W9NC 5JISA 3T9AA 2GH1A 2W2TA 4S35A 4KV9A 1J20A 1PHRA 4YRFA 1MABB 1RBYA 3R74A 3UGJA 3C7DB 2B3DA 3FSGD 3O2NA 3HRHA 3RRJA 1AMNA 1NUTA 4LOKA 4RTJA 1YRAA 3OURA 4KO1S 2YXLA 1RKUA 1W5AA 2IXBA 2P1RA 2EJVA 2W2QA 1THTA 5KYTA 4H7HA 5JPDA 3QFSA 3ZDFA 4JNKA 4GPD1 5BW8A 4NICA 3TCXB 2GWHA 4BB9A 3FFTA 4IGAA 1V7CA 4OFXA 1X0VA 2H54A 1IZ7A 4XWTA 1AKVA 2QUBA 4QPJC 5EJ9A 1E2NA 2RB4A 4GBMA 4OHMA 4ZI5A 5GINE 1IM2A 3K6JA 1WE2A 2VP5A 1IWPB 6REQA 2COUA 2UVPA 4HEA6 4F2PA 2PS9A 2CK3D 1M34A 2QEQA 1NVUQ 2ZTSA 3EDRA 3OFKA 3V1LA 3R8CA 2BC9A 3PZRA 1N9GA 1U5CA 2JH9A 2V54A 4IUCS 3T5CA 4B9AA 4K2AA 4KXYA 2YQ5A 1DC5A 1GPWB 3ZQ4A 4KQ9A 2C2BA 5FLEX 2JFQA 1YE8A 3GDHA 1QLHA 4TS1A 3LYHA 3F8TA 4L16A 3SJAA 5FWYA 2ZBDA 4PO3X 4WLOA 1ZNQO 1ESDA 1O57A 2JGNA 1J2EA 1T0JB 3FPSA 3JZFA 1SHZA 4R9SA 4C43A 5U9CA 5BR7A 3R24A 2RFLA 2NV6A 2ECOA 2HMYB 1FYDA 2Q5QA 3PDIB 4QQKA 4A6EA 2IOYA 3L41A 2ZRKA 3LO5A 2WJGA 1F8YA 3ME5A 3D4NA 4B31A 1D09A 4CJXA 5C8YB 3PCXA 1VCHA 5FPKA 4LJ6A 3E05A 2ZYHA 1EVZA 4MZXA 4YAGA 1L5LA 3R7NA 3CVWA 3GJZA 4KXWA 4Z7QB 5TF4A 3SX0A 1QWOA 3UMBA 4GGPA 4WFIA 2HCFA 1COWA 4HRAA 1E89A 1JHVA 3P2MA 3IKJA 2P3QA 1SOMA 2OCKA 2DM6A 3BXEA 3USCS 5BVHB 1IHOA 3A0UA 4FGZA 4HDQB 5ITVA 1HRKA 5FTMA 2W43A 2FLKA 2I29A 3LVBA 3E70C 3D8HA 4EYSA 4KITB 5DGDA 3X1DA 4A82A 4KQXA 3DZCA 3U7GA 2JLBA 4XLLA 4RHYA 3V55A 1CRQA 2PSEA 4F6CA 3CF0A 2WJWA 4BQRA 4E2FA 2E9SA 1F0NA 1HKHA 1NUHA 2QTCA 3EUAA 2AI3A 3TSOA 1M9NA 3LF2A 4MVWA 3WISA 4BPRA 2DAPA 2Z58A 3RSOA 2AVDA 1AMOA 4CHGA 1WIWA 1QG6A 1WQ1R 3V1KA 4BN4A 3L77A 3FSRA 3N28A 2OAGA 5JATA 2EFEB 5DK4A 1NASA 3O2QB 3AFMA 3OD5A 1ZGJA 1EGQA 2HUPA 2O2YA 2W6IA 5L53A 2AKEA 3D6TB 3MWDA 1SHJA 3HU3A 5CLHA 4XCQA 1W6UA 3SEQA 5KNDH 1EJ0A 3D5QA 3JY6A 1XZEA 3JD0A 2O0LA 4H17A 4P2GA 4TTTS 3AHJA 4FW9A 1JR6A 4GNKA 4PZCA 4M0UA 4KQEA 3JQBC 3O2SB 4HEQA 4I5IA 1A8UA 2FWIA 4NOKA 5DYIA 2ZDHA 4HSGA 2F1IA 1H6DA 2IXDA 3LBYA 1A98A 1DRJA 4K88A 1E6LA 1X8LA 2DBRA 2PCJA 2RGBA 2WP8J 2YC2C 3TLZA 4EEKA 2P8SA 2RAUA 3V46A 2ODQA 2IUTA 3DQQA 1I1QB 1BHO1 4QAQA 3TL2A 4Z5XA 3VPBA 1TO1E 4BNHA 1F2DA 1F4PA 1IUOA 4BVHA 1V1MB 2WINI 3NRJA 2PJRA 1RC8A 4XJSA 3CMMA 4X3PA 2BFFA 4PYNA 1OZGA 2WKWA 2X77A 4RQAA 2R6HA 1Z8HA 1VKRA 3PCTA 3HR7A 3D4LA 2G8LA 4F85A 3ICEA 2Z1NA 4JLOA 1LGYA 1D8AA 2VNAA 1PVOA 1ZICA 3B6IA 2XYPA 4FU0A 4DWVA 4FDAA 4I9UA 5JPIA 4AUEA 2RI0A 1V96A 3SSAA 4XCVA 5K8JB 3PX2A 3GH1A 1IUKA 1ZD5A 4Q24A 4WOPA 3S3TA 4YN3A 4LGVA 4CTKA 2OORA 4OUDA 2O1SA 3M6UA 1OBOA 2Q62A 4KPUA 2NU9A 3KYCA 3NYWA 2OOKA 3ZDYB 1D6NA 4TRMA 2BUCA 1GCIA 3I72A 1C9MA 3CO0S 3VOBA 1G59A 3LNCA 1X19A 1L4NA 1XO1A 2J33A 4ESEA 1DQRA 1CUWA 3CCFA 3KQTA 3O5AA 3W1WA 5JCJD 2AE1A 4PSUA 3NATA 4PZEA 5FULA 2CDAA 1HSZA 1KPIA 1U9IC 1QG2A 3EAGA 4RIEA 3H9QA 5DX1A 3KUDA 5HZKA 2PJUA 3JSAA 3MWEB 2UYOA 1ODLA 4DMMA 4AYTA 4AY6A 1KQFA 1EXVA 4HADA 1WMDA 1X7ZA 3QYPA 5B2FA 1ODCA 4MRRA 3GFFA 2W7TA 3AFIA 4KP7A 3IAEA 4BC1A 2BN4A 2FP4A 2SCUA 3OWOA 1IVSA 2YCBA 1HL7A 4RK5A 4ZAWA 3VQTA 2QTRA 1ZQ9A 3NU1A 4OHUA 1EIWA 1FXUA 3PDCA 3TQSA 4C4AA 1YCDA 3FVQA 1SQ5A 4YHBA 5CB8A 2II6A 4Q1EA 4RENA 2W93A 1VYUA 2DQKA 4KBFA 5K0NA 2CLKB 1QGAA 1T8RA 1PUIA 4L15A 3ES9A 3AC0A 3MQFA 4S1TA 1RSZA 5KYKA 1J22A 1FUUA 4P8RA 3TIXB 4ZC1A 2WWIA 2RSLA 3PXGA 1LC3A 4B8ZA 3P2OA 3PK0A 3H4VA 4AZVA 4G63A 3MTJA 2OY0A 2FMFA 3NWPA 3WL5A 3TDMA 2OE2A 3SVZA 1ETUA 1BWSA 3S1AA 2J3JA 3ZY4A 1OASA 1UUFA 4UUOA 3C8MA 5I4BA 3ZQKA 1QRTA 2FAXA 5IDYA 3NX4A 1R66A 2A92A 2V6IA 3EHEA 3NH6A 2PMWB 3P71T 3QOYA 2OPHA 4PZYA 2WM2A 2AOUB 4WZAA 1YFJA 2NN3C 2A9VA 3LLVA 4W8HA 1FUKA 5FOXA 3FOZA 3OH8A 4FBGA 4RVFA 4I1PA 5EEGA 3DXZA 2J4DA 4G89A 5JCZA 1V8OA 1ISPA 2QU8A 4W5HA 2FKNA 2Q8PA 3D6MA 4PF1A 2GPJA 5F2EA 3EQZA 3EZ2A 3PNMA 1XTIA 5JVDA 2X2OA 3PX7A 1NUPA 2D1RA 2BONA 4UAUA 2VN8A 3ED1A 1TVMA 2XQKA 2JD1A 2J5QA 3H1TA 4XVHA 4MR9A 1P62B 3ANXA 4OXKA 3DM5A 3I83A 5FD8A 1NLMA 4D97A 2GCIA 5B3JA 1MX1A 5K3OA 1FNMA 3FUXA 4D41A 1QTIA 4EG6A 1HL3A 1V6SA 4MRSA 1FFYA 2QMEA 1YRBA 1ZA1A 4F6RB 4MV6A 4X62B 1KZ1A 3IT2A 2XWJI 4UM9D 3SXPA 1OV6A 3CB4A 3ZS9A 1KEEB 2Z6QA 3OX1A 3WXBA 4LWOA 1FFAA 2FWAA 1OQAA 4NYIQ 4A8JC 4F12A 3VR6H 4P32A 1QAOA 2FPSA 3WGJA 1OX4B 4ZANA 1ZH4A 3GZTB 1MW9X 2IE0A 3HCWA 1Y0BA 4G0YA 1AKRA 1MEEA 4NYMR 1P1JA 5B2EA 3JRWA 4DT1A 5C3MA 1PNRA 4JI8B 4LFBB 1A2QA 3AFOA 1GRQA 2PKWA 2CXPA 2YBEA 4YJGB 3JYQA 2HIMA 2PH5A 1S7GA 2NVUB 2C5LA 2XEDA 4B9EA 3ZIDA 4EG0A 4IZHA 3BA1A 4HZUB 5J5AA 4BNIA 3C3WA 4MUNA 5AI5A 4JXZA 5BQ5A 2HT6A 3GLHE 5CT6A 1R5OA 2A5DA 2GCNA 3OEED 521PA 4DWOA 4BFSA 4Q7QA 1TMGE 2GCGA 1VIVA 3H42B 5F98A 2MWMA 5AM1A 3JQEA 4RULA 2IYAA 2HKIA 1BZYA 1J2UA 3U4DA 4LC1A 2O1EA 3X3HA 5C81A 1B6RA 1DHRA 4KLNA 3TJRA 1PR5A 4OMUA 2O3UA 4CPDA 3C3YA 1EG2A 2ZAIA 4JI2B 1S89A 2J6BA 1QP7A 4QQFA 2WE7A 4GT1A 3ETNA 1DV1A 2O9JA 5EIFA 1D0SA 2XZPA 1KEUA 1RRFA 4L74A 4N8DA 5EHIA 3VPDA 3P0HA 4U00A 1V41E 1SWVA 2WTAA 3ISVA 3Q11A 4TRNA 6ADHA 1HTWA 4IXNA 1CD5A 1RYBA 5F1OA 4LHYA 2O50A 1PW5A 3VU8A 1VZ3A 1H05A 3VKHA 3LDAA 5J2TF 1OGYA 3UWKA 4IR7A 2H5IA 5CU7A 1R74A 1FRQA 1P0QA 2CUNA 2ZR0A 3F47A 5GQSA 5F73A 3I73A 2LKCA 1MBZA 1NKSA 2IS6A 1MT0A 3VU0A 1EWYA 2NLOA 3UB3A 1THMA 2O2DA 2IFTA 3IOMA 3KNZA 4AJHA 4D0NA 4BVBA 6REQB 1MRNA 1S1MA 3EQ7A 4RHCA 1UC8A 2EHJA 7REQA 3V4LA 4MCJA 1XYYA 3EXFA 2WWTA 1VHJA 5CJ2A 3TM4A 3UJNA 2RI6A 2EBFX 2JEYA 4AJ9A 4KIGA 3HXMA 5CA1B 3L9WA 4P4UA 5GZ1A 2V65A 2UV8A 3A9SA 1Z3IX 2F1JA 2RJNA 1JA9A 3BSWA 3FB1A 3ITDA 3H9CA 4YFVA 1Y3IA 4YXWD 4AJ2A 1XVAA 2Q5FA 1J8DA 1YB7A 3G2QA 1CQZA 1Z0FA 4PVDA 4E6PA 5CDUA 1M75A 1ZD8A 1VMIA 5DBOA 4BGDA 3K4QA 2VTVA 4JBHA 1G8HA 4MRNA 4DSUA 5JSZA 1OVGA 2HC9A 2XVZA 3EFOB 3IH5A 2PUGA 5AIAA 4Y9DA 4UHJA 2DR2A 3P9NA 1TK3A 2HPZA 2WTEA 1Z8FA 3A6EA 2GPBA 3MWFA 4ZJPA 4A8HA 4ID9A 3IT3A 1F60A 5AI6A 1B43A 2VJQA 5LYJF 2B3TA 1D1TA 1BFUA 1VE1A 2DQ4A 4B6SA 2HWKA 4YRQA 1K0UA 4ALJA 3WHLA 1WL8A 4R1UA 2P3SA 4F4JA 4LECA 3ZUGA 1RJGA 1QU3A 2R7AA 1V16B 1AM4D 1ZHOA 5IWAB 3ZE7A 2OFWA 5P21A 3LBFA 2HT1A 2FE1A 4LK2A 1QHHB 1WZCA 3KFLA 1QC5B 4BVKA 3GVPA 5L3SA 4LY0A 4QG7A 5IEJA 1QH0A 2Y1FA 1EAMA 3HYRA 1N0UA 3LOUA 1QHEA 2UAGA 2ZQZA 1ZK3A 3SBDA 1B2LA 1U28C 5FBHA 2AF4C 3RSFA 3IRVA 3B9QA 4B3FX 2XNHA 3ICCA 4ZRNA 2HIHA 4QDKA 4IUBS 1M2VA 3D8RA 1QCYA 2W6QA 1DG9A 2Y77A 3S27A 4CEHA 5BN5A 5K3FB 3V1UA 4BZPA 1N6LA 5J4HA 2Y0BA 5AJHA 4FYKA 1HNXB 3UOWA 4BNDB 3BAFA 2QTHA 4IVPA 4L51A 2X0JA 3W5VA 4N5DA 4BMDA 2B8TA 2NVOA 2XT0A 3IO3A 1IWBB 1HLFA 2BV3A 1W9HA 1XF1A 2JANA 4FFNA 1M2GA 4HUQB 4HZGA 1DJPA 1E3TA 1OKKA 2VLIA 3EIEA 3HADA 2XF8A 4OLJA 1PL8A 3I92A 2FN9A 2P77A 3SHOA 5DLQC 1PT5A 2OFPA 1P1KA 2JDIA 1DKLA 2CMDA 1AXGA 3L8YA 2RJ3A 2IWHA 3J80A 3KJFA 4B3SB 2HX1A 4F5YA 3RYFA 4J16C 5DM60 1MNAA 5EIXA 4IFEA 2OD7A 5LP6F 1X7WB 2HZ7A 4KQJA 5DYNA 3VH3A 2HW8A 5JAOA 4PLHA 5JRJA 3KQWA 3UB2A 1MF7A 1T26A 4R31A 1PS9A 5DCUA 5DP2A 3I2KA 3UUGA 2DHQA 1KSGA 3WLKX 4QWWA 2AFIA 5L4NA 2ISQA 3OZRA 1FTSA 1NR7A 1PJ8A 3NHBA 3OLVA 2G1KA 4HB2A 4HH4A 4U9UA 4QT4A 3IAFA 2XOKD 1U1GA 1U2QA 3D0RA 4OK5A 3C43A 3AG6A 2ZKLA 1YIOA 1C9JA 5HDQA 3H5TA 1J0DA 2VQ3A 3SOPA 1YK1A 3I3OA 4L9WA 3DL7A 2ZWPA 1KETA 2AA3A 1HRDA 1LNSA 3BILA 3JQAB 3B1ZA 3Q9LA 4ILEA 5AQEA 3CF4G 4M0EA 2JFHA 4RCZA 3A9RA 4B47A 5JJKA 2FW1A 2JEZA 3HB9A 4JBIA 5HRAA 5I8WA 4YJ2A 1ZSYA 1V7ZA 1Y7HA 3UMFA 2CXOA 4BLQA 1US8B 1KK3A 3M8KA 3DBOB 2PUFA 4IH4A 2OG2A 1P5FA 4H15A 2CHUA 1YQXA 2ZSAA 4F2DA 3OPQA 3ESRA 1QP4A 2NSJA 1OBCA 1ZH2A 3FHJA 3BFXA 2GFIA 3ZBQA 3GT7A 1M67A 1W6RA 2X58A 1VCNA 1VIYA 1RBZA 2PIAA 4JUFA 4NYIR 4A10A 5JTUA 2FV8A 2X0IA 1IAVA 1PU2A 2V4UA 4QBHA 3GZNA 1T5LA 1MEJA 1ZCAA 1EU1A 1KVQA 4X1IA 1DJOA 1S0UA 1Z18A 1C29B 5G41A 2DKFA 5IAOA 5KJFA 1V26A 1XVLA 1E5LA 5B4TA 3F4LA 1JXQA 4YI3A 3T7RA 1ISGA 4MYRA 2VT3A 3Q7TA 3T1VA 2OQ2A 4BP3A 4KR9A 4YCDA 1DFGA 2XIJA 1N9GB 1E2FA 1TYEB 1E1RD 1OLSA 2WHPB 3H2BA 3RW9A 4YQFA 5B3KA 1RI3A 2B1JA 3SLRA 3BWDD 1J09A 1WUHS 2Y05A 1PJRA 3D4PA 2R4TA 2HV9A 3A1UA 3KSDO 1ZI6A 1A4RA 2BR4A 3BXXA 1PV4A 5K7SA 1AZSC 1WCIB 3ZJ4A 4HLQB 2X9NA 5FWYB 1DIHA 2RHOA 4DOMA 2RD2A 4S1WA 1DAGA 2HJSA 1AK2A 1YR7A 2G7ZA 4NCIA 2QX7A 3U7JA 1AKNA 1SCAA 2Y1GA 3G6KA 2FPIA 3C6KA 3OAAA 3FGZA 5TXGA 3RB8A 5B1YA 3REQB 1Q57A 3N2ZB 4Q1AA 2E7ZA 3S2FA 3U31A 1OZFA 1SBTA 4B45A 5LNK6 1MX9A 1P5JA 1O3YA 1JB9A 3ZNQA 3FROA 5E7JA 5FBLB 3RI3A 4DB2A 3N6XA 4PG5A 1CDOA 1QJCA 1XRPA 1YH3A 2Y27A 4B6RA 2H3EA 2IS1A 3T0FA 1XU7A 2DG2A 1Y7PA 4FP9A 2GARA 3REGA 3RF7A 2ODTX 1Q44A 1UXIA 5G0TA 1KVRA 4N7RA 1OR8A 3TQFA 1EIZA 2PZLA 4DA7A 5HP4A 1DEXA 3A1WA 4K86A 4KIJA 4PCAA 4EFNA 3L0SA 4M0CA 4NARA 5EUCA 2OVBA 4KREA 1V6CA 4ZYXA 4DZZA 1WOMA 2V7XA 4CL0A 5CDSA 3C15C 1FRFS 5JWRA 1AGYA 1T5SA 2Z5FA 1UBCA 4MI9A 2Y4OA 4PG7A 1I7DA 2YXDA 3EBLA 2Z1MA 1B76A 3OZTA 1GZ5A 4M1SA 2HLHA 2WWXA 2J9FB 3ZWCA 1DLJA 2EQAA 3P0RA 1C9KA 5T4HA 5ALMA 2YZMA 1H9AA 3F1KA 1USGA 5TPZD 3ZE0B 3L6BA 2BP7A 3RT1A 2JAHA 3WADA 3MWDB 1ICIA 3AUTA 3MT0A 3AVUA 1M74A 2JFBA 4R51A 3MWYW 5LBIA 1NQ5A 4OHOA 2J5RA 3WYBA 2FSPA 5EJAA 4E2WA 4F1JA 2A3NA 3HRIA 5KNCA 4MO9A 4MUKA 1ZDMA 4HL6A 3FYTA 4CMJA 3O8CA 1GG2A 2VP9A 3WMFA 1ECCA 1SRRA 5CVEA 1OROA 2WSLA 2ZI6A 5E0KB 5A6SA 2I8CA 3GFSA 4W7IA 4CKCB 3RDPA 3LY8A 2HMWA 2NNLD 4MWGA 1WY7A 5BN3A 1KOFA 3FMVA 2P6OA 1KAEA 4IOLA 1Y3BE 1KP2A 1PP4A 2X9VA 2PXAA 1NN5A 4JJFA 2BFFB 2VHUA 2XA2A 4EY5A 1CTQA 3LLSA 2H5LA 4YY3B 2EX4A 4P0TA 3D0OA 3GU3A 4HWKA 5BV8A 2QRLA 4FK8A 3DF7A 2E49A 3GB9A 2CNBA 4YP5A 3D2AA 1C8LA 1KYVA 2B2CA 1A9SA 3DO6A 3OJFA 4G1FA 4JLNA 4YA6A 1T8UA 4IILA 4MVJP 1HI9A 4RFSA 4E7PA 1JEYA 1NAHA 2V7QD 2A9RA 1KTVA 3M49A 4BLRA 1Y1PA 1CIJA 1RWOA 5H70A 4OUDB 4D79A 2CVFA 1RRKA 2GX6A 2QUAA 2A14A 4DS3A 3KYCB 3CEAA 3HB7A 4Z8YA 2NU9B 5CCDA 4F5EA 3P32A 3NAQA 1FYWA 1JWLA 2QUJA 2RHRA 2PXCA 3V1TC 5C8YF 1UF9A 3IKLA 2GK6A 1UPXA 1N3LA 3HDGA 3GLIA 4J43A 3L4KA 5T4EA 4P98A 3ICWA 1NC3A 1Y9EA 4QGFA 2R00C 2PBZA 4B83A 1K06A 4DRYA 2XJ9A 5F7XA 2PZGA 2IL1A 1TFRA 5DCYA 5J4KA 1REQA 1X1QA 2V59A 3Q8XB 2YFHA 3R9IA 3U0VA 3T5PA 3DEKA 5ITSA 5KJ1A 4L8YA 4BV9A 2GM3A 4IXMA 5JDCC 5KVCA 3QV1A 5ADUS 1PYGA 4H6PA 5HTOA 3IERA 1M8KA 3ZE6A 3FPHA 2FWMX 4BKRA 1Q77A 3AT1A 2ZGVA 1WXGA 2WA1A 2PMDA 2ZBUA 5DSXA 4JELA 4MW7A 5A3SA 4KDCA 4J3JA 4PSVA 3RROA 4E13A 4ENQA 4B32A 2J87A 5EMLA 1ACLA 1X2EA 3F46A 4L28A 1C4KA 2PKCA 4K6MA 4Z9FA 3RC3A 3R9XA 1JDBC 4ATNA 2WM3A 2CY0A 3H5IA 3IILA 4OQ4A 3WKAA 1MFPA 3R5FA 3FUTA 1Q3KA 2C04A 1TO2E 3DT9A 3IRUA 3JPWA 4RW0A 4WXMA 4XIJA 2XYGA 5JE8A 4D5EA 1EVYA 4R1NA 3ND5A 3L7IA 4Z54A 3RSLA 4CQJA 4N8SA 1KOGA 4X00A 1N9ZA 3VV3A 4FEYA 3H6GA 1E8MA 1RAGA 3GGPA 3LQKA 3I8XA 3CJRA 1LDBA 4G26A 1D4AA 4I50B 4YLEA 2HZBA 3J7AC 2OSBA 2WIFA 2J3EA 4N0DA 3TZKA 4BX9A 3I01M 5CFMA 5F3DA 1TIPA 1WSAA 2XW6A 3MGKA 4L4SA 2RK4A 3QBTA 3VM6A 1RJWA 3OT4A 3S99A 5T41A 4XWOA 4HDKA 5JRDS 4WZ6A 1ANKA 3ORSA 1JHUA 3KHUA 1F20A 2PSDA 1R50A 2HOQA 2XNSA 4LFAB 1XK7A 5JVDB 2P9QA 2BE7A 3UXMA 4E94A 2VC2B 3HFRA 4DW8A 3TEFA 2D1YA 2FMIA 1SU4A 1XHEA 2I4LA 2PV0A 4AN1A 3FHTA 3NEYA 5C4GB 4EGQA 5CB4F 1UJNA 3QPBA 3IDZA 5EP1A 3UAXA 2BFPA 3MJSA 1WCXA 5DNYB 3CVVA 4LUCA 1E1NA 1XROA 1S3FA 2BM9A 2X41A 4TLBA 4XQ9A 1H94A 4D1YA 4CM5A 1FW6A 2GCPA 3H8VA 3KKLA 4R7TA 4A5OA 5K0BA 3ESZA 4QYMA 4CMAA 4GZ5A 1UKBA 2F1HA 5LFAA 1V8DA 1OE0A 2ODNA 1ENOA 3C8HA 4FT2A 3Q3HA 4IMPA 3RLFA 3QVWA 4V1CA 3ZV5A 4W5QA 1W52X 4E0BA 1E3WB 3DE3X 1U7OA 1G8MA 2WJ3A 4MHSA 4WW0A 2NT4A 5DNCA 5LBTA 1UMBA 1U8XX 2ZP1A 3N2LA 4IFIA 4DEVA 1EK2A 3A8TA 2P9GA 3HN6A 3ONEA 4R5HA 4BFXA 1KY4A 4PG8A 4DT1B 3CVXA 1E32A 1LKZA 1C3EA 5JMPA 3SHTA 3B82A 1N3BA 1ZZEA 3ESAA 1RQ2A 5FRDA 4F3YA 1CETA 2R8YA 1L5FA 1RAHA 3CZAA 5KC8A 1KF0A 1N0IA 1GPMA 1ZLYA 3ZXIA 1J5EB 3LVQE 5C9ZA 1FP4A 2I2AA 2IQ5A 4R2XA 1X0XA 1A4IA 1Q17A 1T8TA 2B35A 3A27A 1HA3A 2IPMA 2O0MA 5F78A 4FYPA 4H08A 1MO6A 4DLUA 4XJTA 5IARA 1I9CA 1KDVA 2BBWA 2V0GA 5DX0A 3KKOA 1N8NA 3AB3A 2E6KA 3EY9A 1QX3A 1Z17A 1SN7A 3FUUA 3G5MA 4G5FA 1BA3A 1L5HA 3VNRA 3OTHA 4BRSA 4CKWA 2V5VA 2XGMA 1JU3A 3R7WA 2GYWA 2C7BA 1ZD9A 1Q0QA 4E2XA 1JG2A 1X7DA 4C1NA 1G4AE 4UJ3A 4BP9A 4FZ5A 2ASVA 4LRSB 4Z3OA 4D8XA 5AKYA 3L1HA 1CS0A 2FFBA 3RCBA 4ZMRA 1H1TA 1C9NA 1D3AA 2TMDA 3K4HA 3AVQA 2O0KA 3PUYA 3ZNNA 4LV5B 5FNVA 5B4VA 1CDZA 1XTRA 2PZBA 4PQYA 2Y0EA 3DAOA 3HCEA 4PLWA 5ESXA 1L7AA 1X8KA 2JIDA 3TOSA 1F51E 5FO1A 4MVJG 4Y18A 3JRNA 3RANA 4X3OA 3T5AA 5GPBA 3SG0A 5BNFA 4BJ3A 4M76B 3UM9A 2ZI9A 3PDJA 5A5VA 1SUFA 4HNSA 1Z6PA 4L6CA 1DS6A 2WWHA 1C0LA 4XVQA 4D9IA 2JKYA 2VDOB 5AO9A 3QEBZ 2IS4A 3C3DA 1JHXA 4URZR 3C2QA 1G8FA 1E9VA 3VR4D 3B3FA 3FPCA 3EF3A 5GY7A 4F5DA 5CFQA 2RGAA 1TPZA 2REXB 3PFNA 3VDXA 3O1JC 4Z1MD 2IYOA 1KAQA 1II8A 2H2FA 2C2HA 1YT5A 1DSSG 3EXFB 4G6ZA 3DAHA 1Q11A 3EG9B 4HJXA 4YAOA 4ENVA 5B1EA 1R18A 2XXAB 4CM3A 2XYVA 3CVOA 2NSHA 3WGOA 2ZTLA 3ZPXA 3DDUA 4PRLA 1GXSA 4KHPB 2IJGX 1N5RA 1KIAA 4IMJB 1GV1A 4Y1RA 3KQQA 1XZJA 1U9JA 5E2BA 4Z4QA 5HKAA 5JSZB 2DUWA 1A71A 4RACA 4OHYA 2DR3A 3LC1O 1GGMA 3WFIA 2WMYA 3BMCB 4PVCA 1Z4PX 5ARBA 5JH7F 3UPTA 1EHYA 2KPOA 2VDWA 3PQ7A 4M1ZA 4KKVA 1GGKA 3RBZA 2EYQA 2V97A 3IDOA 4LGCA 4K9SA 3TZ6A 2Z6UA 4A7PA 4YUYA 1R64A 2FW0A 4L0QA 3K73O 5C1BA 2CMHA 2PWAA 3MHTA 3OOSA 2HK8A 4I1SA 1GWNA 4IHAA 1YVPA 3WIOA 3EEOA 4HO1X 3LLMA 4EG5A 4MVJD 5KDLA 2RHHA 1QHNA 4AP5A 2QJOA 1Z7GA 3KSRA 2GYYA 4DMLA 3LUAA 3UG6A 1NF3A 4XWYA 1L5VA 3U4QB 5JZOA 3LCCA 4C03A 1GSIA 1L4MA 1OWMA 1HWYA 1Q7EA 4ITVA 4RDHA 2QBYA 4XOIA 5GJBA 3OQOA 2ZXFA 2VSXA 1MD9A 1P91A 1SUPA 4REMA 4UVIA 1RWKA 3A70A 2P78A 4BQOA 4OA5A 4CL8A 4NP6A 3REOA 3RYTC 4HNTA 3DZGA 1PQ4A 1TEXA 4PZ9A 3L0ZA 5H9VA 3M5PA 5IT5A 1M2VB 3PJDA 4H3VA 4YALA 1V8FA 3HUDA 2GHIA 2VTBA 2V7BA 4CEHB 2QMQA 4FCWA 2HREA 3TSAA 3ZXYA 1JU9A 1QFYA 3UJPA 2O6LA 1Z4NA 1TZMA 1ZWKA 3M6XA 3ZJTA 1S3IA 1V3VA 2H9AA 2I34A 3B70A 4M83A 3RTGA 1IHPA 3MJTA 1ZHFA 2C2YA 5KTOA 4CEJA 3NBZC 3WKDA 1GO2A 2JCVA 4RK7A 4F5WA 2YJ6A 4HXGA 1RC0A 5F9MA 4XUDA 4CLRA 4DCJA 2XE7A 1IB0A 1G63A 3M6MD 2QRZA 1ZNZA 3QPUA 4NCJA 3K5IA 1MQSA 1YS1X 1W73A 4RSRA 5CX4A 3RYFB 4RKWA 3WC4A 3WRWA 4MIOA 2GZ3A 3DVRX 4L9RA 4UULA 3V00A 2FF5A 2TECE 1P2UA 5CGQB 3QXHA 4XVCA 4H7PA 4JBNA 4KPFC 2FWJA 1KDZA 1K66A 3A6DA 3R6GA 5FPPA 1P31A 1TRKA 1UINA 3FLMA 1Q0UA 5CA1F 3CG4A 5HWSA 2FPKA 1TJ4A 4FGWA 2UU9B 2DHCA 5B6PA 3L1VA 1FRZA 1KNQA 3H9UA 1NW5A 3AFNA 3AVVA 2YX1A 3OQPA 5JV5A 4NVRA 3WGZA 2ZU0C 3CLRD 1EPUA 3Q0EA 5K09A 2WVJA 4P5PA 5E3HA 2C20A 4LDRA 2FX3A 4K9DA 4CXMA 2Q7DA 5LZ7A 3SHWA 3FGNA 1BX3A 4EG8A 4RKEA 3I12A 4TN1A 3DPUA 2X76A 3V8EA 1GGNA 2QMZA 2AEMA 3HCPA 4CF6A 3TFQA 1KU0A 1DBQA 4DCUA 5T67A 4K9OA 3L5OA 2OP1A 4O4JA 2QN9A 1UJ6A 4OSEA 1WPQA 2GILA 3COZA 4ZI3A 4J9VA 1KHTA 4IDEA 4YUXA 2ZDGA 2JFVA 2XB9A 4ILKA 2A2ZA 4H3KB 3ODGA 4YJFA 1KTIA 4JSTA 3UVEA 2OILA 3EGEA 1R9NA 4G5XA 4EB6B 2IZ6A 1XCGB 2QLBA 4L8WB 4E31A 4ZKDA 2W2KA 3V6LA 3Q7IA 1RCUA 3MJHA 4LAFA 3HV2A 2P9FA 3LIPA 4D8WA 4MRMB 1PEDA 3PPYA 4MGYR 4QUBA 3SNKA 5G0VA 3O4RA 3U4CA 1SU6A 4AYWA 4FB4A 1JSRA 1GTRA 4AMYA 3SC2B 3ET5A 2VDVE 4NBRA 2RGRA 3F98A 3T52A 3OA0A 4INOA 1K68A 2X15A 3U1BA 2YNMD 3ZDBA 4EOGA 2XMDA 1WBJB 1H8EA 4E7OA 2OGSA 1YZ3A 4F7WA 1S9HA 3EGCA 1CZHA 3QI7A 5EMNA 5A1JA 2FPIB 4XEHA 3L4BA 4F8YA 3N7AA 1DAOA 4XVRA 2NZXA 4CG0A 3T3OA 2W5UA 2G9NA 2PSSA 4G8JA 1G5HA 3OY7A 3GMTA 1E8DA 2LNDA 2VYCA 3Q98A 3WYEA 2DJ5A 2I7TA 5ENVA 3TB4A 1P73A 3MERA 2I4MA 2GPSA 3CONA 4X6UA 1NW4A 1L5YA 1IPEA 4JA2A 2WOOA 1FUIA 3O8DA 3JTMA 1U90A 4JR0A 4DDMA 4QGBA 2IPXA 4Q6BA 4AI6A 3JARB 5DTMA 4MUBA 1MXHA 2ZJZA 4Z3DA 4RLHA 3I64A 3SAJA 3LW7A 3CXRA 1MB9A 3AF5A 5DLDA 2IUFA 4B71A 3FXAA 5D5QA 3MF4A 3FSJX 3NAZA 1RYHA 1NVKA 1N34B 2JRLA 1YONA 4NMHA 2P90A 3SYMA 1O95C 4J3FA 3TCKA 3WLNA 4PANA 4H0NA 4C7BA 4GOOD 1R27A 1Z6QA 3JPYA 4KQFA 4B44A 1CBUA 1IBKB 4LHVA 4J6EA 1P17A 1JUDA 2H4JA 2M1ZA 4EVRA 3P4UA 4BQFA 5C2JB 3T1YB 3DFIA 5IJZA 1L7EA 4DR3B 3W34A 3UK1A 4DYVA 2J08A 2NTJA 1OREA 1CUHA 2YWDA 1H23A 4NE7A 1B16A 4I1UA 3C45A 3DA8A 3GLFB 4OQEA 3SZMA 1V8BA 3LE8A 4D9CA 3DOJA 3EGXA 2AJLI 1IUNA 1NSTA 4EGJA 4MNTA 1NSFA 5E1DA 2ZK7A 1KYWA 4F92B 1B8UA 1EBFA 5J2UA 3M9WA 4S05A 3QVKA 1GHTA 1NQTA 2Y92A 3ZCQA 2NSDA 3MSXA 1HNWB 2PKRA 2R65A 2WMNB 4CKEA 3NDJA 4E08A 2XMBA 5CDTA 2CV1A 3DZJA 4YRIA 1OYVA 1EFUA 5C3UA 5BN3B 1U7UA 5HQJA 1R0RE 5C1OA 3IPLA 1AHHA 2C1EA 3LUKA 3LUJA 3WLPA 3IP6A 2G83A 3NH9A 4I9FA 1QG0A 1JILA 2PS3A 2C98A 1DKOA 3G2LA 3ORQA 4JGIA 4ZODA 4EJ2A 3O9MA 3M1YA 3EG5A 2QGZA 1TJ5A 2AQ8A 3MUOA 4Q4LA 1DP4A 2G4LA 4Q47A 3U1VA 4K9MA 2YRWA 2H52A 3GLGA 1KC1A 3TRIA 1JEYB 2FSFA 1J2TA 2BI4A 1J1UA 1R10A 3G7UA 4QBGB 5DEOA 4UZSA 5HQ3B 4FFOA 4CM9A 2JHFA 1FFSA 2QOEA 3JZDA 5HUQA 1NNEA 4ZGGA 1ZMOA 1H69A 5JNVA 1CDEA 2HF8A 1FYFA 2RI1A 4MPJA 1VP9A 4QFMA 4CQMA 1LVHA 2XZLA 4S2EA 4KRXA 4RPCA 1RFLA 3GLIB 4Q9LA 1XZDA 1D2MA 4FYIA 3DAGA 5I7RA 1UDCA 4CIXA 3EBPA 1LSUA 4J0QA 4ZVSA 3GAAA 2VF8A 3H2KA 3JTEA 4NF2A 1KJYA 3IBFA 4B74A 1GGHA 5CIWA 5K3CA 4AD8A 1PHPA 1REQB 1XBTA 3RSZA 3W9UA 2G88A 2XMCA 4J7UA 1CR4A 2PKQP 2PVSA 5CLLA 2VSNA 5B1SA 3TECE 4EVQA 4F2WA 5CAEA 4BMNA 4QULA 1KBOA 4EDHA 3QPAA 5CBKA 4NZZA 2WF6A 3IDSA 3NTXA 4GGMX 5KVSA 1RZ3A 2H3HA 2IS2A 5CRIA 3WDKA 2X5OA 3L0IB 4PLGA 2BLLA 2YINC 1NDQA 2F3QA 4YPFA 4DLAA 1RPAA 4ZI2A 4RTSA 3UJ3X 1T2CA 4K7JA 4DCPA 3R9XB 1N2EA 4AF6A 2NXCA 1XP8A 2HXSA 2QMHA 3QQPA 4COKA 2JAUA 1PDWA 1PFYA 5A5GA 5EWJA 3S68A 1GV0A 3A6FA 3PEEA 1BE0A 1GITA 1UFQA 2ZIEA 4GRAA 2FYTA 3O4JA 4L8VA 1ZD4A 2NTNA 3GHHA 4M46A 3T7AA 1W47A 4HGQA 2ZTHA 1M0TA 2GJKA 2GN0A 2O3QA 2OXTA 3HNRA 1FSGA 4EKEA 1FMFA 3RJ9A 5DHQA 5A4MS 1QRRA 1T3LA 3EZYA 1K08A 4W5TA 1N33B 1MC1A 4AC9A 1SD2A 1L4YA 2QORA 3QH4A 1JYSA 1Q91A 3AINA 3FYUA 4TRRA 2IYUA 2H1OA 2DF8A 2QZSA 3U3KA 3HM2A 5FTWA 1UOPA 4KVZA 2IEYA 2WD8A 1WDTA 1YC2A 3CR3C 3MOSA 4HDKB 2WRZA 4QVGA 2C5BA 3L0CA 5JJBA 2YXEA 3ZD9A 5LJLA 2LCIA 4CUJA 4Q66C 3TQHA 4BRZA 4E88A 2BZGA 1H4VB 1W5BA 5TS2A 2J46A 3K0FA 5C5CA 2IV7A 4DAOA 2XUIA 3AM4A 2XTMA 1IB6A 1JJ7A 1QHFA 1UQTA 3F3KA 2PN1A 3GGDA 4JP3A 1ZGCA 4ZZ2A 5BWBA 5CFLA 3N0WA 3BEDA 1NF8A 3BZBA 2ZROA 5BN1A 1RXIA 1NVWQ 3CQ9A 2Q07A 1AN0A 1UBHS 1M5TA 1XZQA 2KLHA 2VWHA 1CIVA 1F2TA 1L5WA 1PDVA 3LUBA 3PC4A 4FFWA 5C18A 3T94A 2I54A 3TFWA 1FL9A 1ZRHA 3OQ1A 5KWJA 3COYA 2ABWA 3HEMA 4V1CB 4D4GA 1D2NA 4G5GA 1DAEA 4MA5A 4L1KA 1OIWA 4I7EA 1M2OB 2Z83A 1UMBB 5E1OA 4A1FA 1RU3A 3T1QA 3L6DA 3LY5A 5ANRB 1P8AA 3T5TA 3F97A 3EIOA 3JASA 4WY5A 1F7UA 1JQDA 1PQWA 1VPDA 2E4ZA 2ZG6A 4UBJA 2F8LA 2GJSA 3OSUA 5IDVA 1Q20A 3GP3A 1Y3FE 2EKLA 1BJKA 3IFSA 4Y2UA 1W36D 2ZSIA 4MARA 3ZCXA 1PF7E 4HGNA 2IHVA 3KJIA 2Y71A 4P5DA 4JOSA 4M9XA 2MDTA 5AW2A 4E5KA 2Z6AA 4C4RA 3BD7A 5F7ZA 5CFNA 1X74A 2XRYA 2OHIA 1I7PA 1T9AA 1FDWA 2I91A 3K0SA 1JQBA 1GYQA 1N5LA 1TDJA 3HQ4O 5CTAA 4E6EA 3R7SA 2MR5A 2GT1A 2RIPA 1JQKA 2J7PA 5H59A 2DFPA 3M9XA 4MGEA 4WOJA 1Z88A 3BTVA 1P39A 2XUJA 4PFKA 5KTMA 1I30A 3LHDA 2VNIA 3EGOA 4PSKA 1KDYA 5AJWA 4NPHA 1QH1A 2Y9MB 3QNUA 3MB8A 4AXXA 4DILA 4XUEA 4RFLA 3TNJA 2WU8A 5IJ9B 4AJPA 2OHOA 4TYWA 3CJQA 2D2IA 5HIJA 3R6WA 1LF5A 1S2OA 2HNKA 2C7VA 5ERGB 3HNPA 4I50F 4B7XA 4L7QA 4LPSA 4KWIA 1JG7A 3AJDA 3EFHA 1E96A 2D00A 1ESMA 1A2BA 1Z2PX 3G8YA 3H9JA 5DM1A 3ETLA 1C1DA 1JX6A 2RG7A 2WC1A 3H05A 4Q3CA 2JI9A 4A2QA 1NLFA 3BX1A 4WAUA 2BF7A 1NYQA 4F5ZA 1U2PA 2C9BA 3OFSA 3O4FA 3WMXA 2R8OA 3KDAA 1BDBA 1Y3DE 4LQCA 4DJJA 3PWSA 2DRIA 4U0KA 4XLZA 2C9ZA 3T54A 3INNA 2Z2IA 4QEDA 1GYPA 1K7SN 2VP0A 1A5SB 5THKA 2EVWX 4JUAA 4XE5A 4B75A 1TLFA 2BAGA 2UXBB 5CB6A 1PWYE 3RTAA 2Q0SA 2W6NA 2XZDA 2JJ1D 2YMPA 4JU9A 4QARA 2C42A 2OFFA 4UCFA 1J4AA 3OJ0A 5IF3A 1GIAA 2QQ5A 4DWJA 5CH3A 4ARBA 4H16A 3SCZA 3IV9A 3IUMA 5BOVA 4F9FA 3NT2A 2RGXA 5JECA 4N47A 4YX9A 2DWUA 2Y3IA 1A4UA 3RWOA 4JKIA 1F9EA 4HOYA 1EX9A 3E58A 4ND7A 3OF5A 3R5KA 3RAGA 4B7CA 2V7PA 1GXSB 2CHEA 4C01A 1DQZA 1E94E 4Y1RB 3FLBA 4ON9A 2Z56A 3HEAA 1STOA 2AEFA 2DUUA 1BCSA 1A7UA 2D74A 3B7GA 3GJXC 1HURA 2WD7A 1PJQA 3JD1A 1GUYA 4JFRA 4MUMA 2R8RA 1QHGA 2ECQA 3RBAA 2YKGA 4OOFA 1HLDA 3ILVA 4O1MA 1E3SA 1FQOA 2WU3A 5FDFA 1SH7A 2JJ2D 2OGZA 4MGZR 4JL6A 3EIXA 3VU1A 2BFWA 1DRKA 1KHHA 2B94A 1OWOA 2W37A 3BRSA 3E3MA 3NS7A 4H7IA 1U1FA 1XRSB 2R44A 3B2EA 3FZGA 4DARA 2PUEA 3HVKA 3K09A 4D81A 4MYUA 1Z06A 4P6VF 2I65A 1Y7TA 3AY6A 4MR7A 3L7DA 2O19A 4LTDA 2X0KA 4TMKA 4OIFA 3I0ZA 1JQLB 2FQWA 2H51A 3DE7X 1H2FA 2HLPA 5JJLA 4H18A 4UEOA 2QRVB 3UWSA 3ZZ0A 4R16A 3W0LB 4OBEA 5JPCA 2FX5A 2JLVA 3GRAA 1J99A 1NFRA 3L1IA 3M81A 2QRGA 3WIVA 1JG3A 3BL8A 1XR3A 1DINA 3K0BA 4L6AA 5AJTA 5AVKA 3VA7A 3WL3A 1HH4A 2Q0QA 3KXLA 4S1PA 1YHNA 3OWHA 4H7FA 3A06A 3AB8A 2AZ4A 4ZHQA 1W0KA 2H0AA 3G17A 5BQPA 2MINA 1VG9B 3U16A 2GM4A 1NL3A 3AL2A 4EJSA 3EPKA 3PF8A 3QIVA 3MBKA 2ZJ7A 4QLOA 2I4IA 3GFRA 2GD6A 4MSUA 4NNPA 2PWZA 2QN1A 4KLRA 4JL8A 5HS4A 5IBQA 3T7TA 4LZJA 5BXQC 2F4VB 1U94A 3L8MA 1BXGA 1J9EA 4UUAA 5MGBA 2I7XA 1QO9A 1Y98A 2EYUA 2FOLA 1UFVA 1M66A 5AVSA 5LA6A 4CEJB 2FRDA 3TMKA 4Z53A 1KO8A 4F9GA 2O7QA 4FHFA 5AW6A 1J8YF 2I1QA 5GV7A 1XZHA 1AQYA 2P35A 1SM4A 2QROA 2XJ4A 2FWNA 3NDPA 2JFGA 4FE7A 3HDQA 3UYKA 1OZHA 1WF3A 2CD9A 3BC1A 1JBQA 3DBLA 4DMCA 5K0CA 5KTKA 2ZE6A 3NBXX 1DRVA 1HYQA 1EE9A 2CLIB 2IZOA 2FPWA 2ZQYA 3SX4A 4DEYA 1KJZA 4OPMA 3EJ6A 4GMGA 4LRUA 4AQ7A 2G70A 2HF7A 5TT0A 4KXQA 4M60A 3IHWA 4O3MA 1L8QA 4QOHA 1XPUA 4CF3A 3GJ4A 1ZI9A 3PEWA 3O9ZA 4S24A 1E77A 1RKXA 1QYRA 1BMTA 7ADHA 1TLTA 2PYZA 5ADHA 1J0EA 2G7MC 5FYDA 3AKDA 2Y0CA 3L84A 3QUBA 2VHEA 3AFGA 4OKIA 2VP4A 5BN4B 5DYGA 4UHCA 3CRQA 3TZEA 4B1FA 3RPEA 3NETA 1L4EA 3GJTA 1WB9A 2GA8A 1TAQA 3NPMA 4JJEA 1XA4A 4Y9RA 1Z68A 3CV3A 1NUAA 3KOUA 1E0SA 3A3YA 2WWFA 4EX6A 4LF9B 2IODA 1KPHA 1H5QA 2QN2A 3CC8A 2KHZA 3LBIA 2O3RA 5B3LA 5K8CA 2ZI5A 4IHKA 2GD2A 2G5PA 3NAGA 1SGWA 2AW5A 1I1OA 1IN4A 1UXOA 1VKJA 2WHXA 3QWIA 5F33A 2PK3A 3JRXA 4O2LA 3VR1A 4C7KA 2I2CA 1U81A 5EJGA 1O5TA 4EATA 3ZVNA 4HQKA 5KCZA 1EINA 4O4JB 1AGRA 5EL0A 3TAXA 4FM9A 2XA9A 1RVDA 2V4ZA 1CY7A 3CLHA 2C2GA 3IJ5A 4NTZA 1DG3A 4MUYA 5EPOA 1TYAE 1KFEB 2FEKA 3JWGA 4LVOA 3RF6A 4EW3A 3PFKA 5MFPA 4OD0A 3B13B 1P60A 3DYIA 3PL1A 4YJFB 1NBMD 3ZHTA 5KQSA 4BB5A 1X1BA 4ZTZB 3ZD6A 4URYR 2FDXA 2QK4A 2H57A 2HMVA 1E61A 1YZQA 1DXHA 2W2KB 1D9XA 4B4WA 1OLXA 4QLAA 4X97A 4B3HA 1CQPA 1YS6A 1VKOA 1Y80A 2VRNA 1SZPA 1MIOB 4M98A 2XX3A 1FEZA 3U7RA 1O5IA 2ZSUA 4ZOLA 3F5FA 2HA6A 4J1QA 5AK0A 3RU2A 2J9XB 4R1TA 4A36A 1UBFA 1FUEA 2H06A 3UV6A 1Z6TA 4AURA 4JQOA 3DJFA 4OQNA 4LXXA 5D7NA 5T3UA 4YUAA 2BBTA 4OM8A 2BUBA 5KNDD 3PSAA 3SF0A 5HIKA 4CR6A 1KI8A 2G9VA 2WU0A 3KSUA 2R1TA 4HTAA 5D5PA 5DHUA 5THQA 3OTQA 2KWIA 1GZ6A 3X44A 3R8FA 2VDNB 1PZEA 4UREA 3EDYA 3WLMA 1U8EA 1UR5A 1RRVA 1S02A 4DY4A 2IHYA 3MAAC 4HYEA 3O82A 4UATA 3TF5A 2C99A 2R48A 4UNSA 4ER5A 4BKQA 1MGOA 2BEVA 4N4AA 4YRPA 2YV3A 4AJOA 4D74A 1P2FA 3P97A 4C7XA 3RUPA 5ICMA 1QUFA 3CEJA 4RJ2A 3VJRA 1K5GA 3UAWA 5AW8A 3G2IA 1CYDA 3VSEA 1M2NA 3G3EA 1MZPA 4B2YA 4U7PB 1JHRA 1Z15A 3OU7A 1UBJS 4Y9UA 3X0DA 4F8EA 5E7MA 1VJ5A 2DLDA 1IHYA 2H31A 2AG6A 2ODEA 4Z2YA 4ZAYA 3UA4A 3QNWA 3NALA 3P52A 2WJYA 3FF4A 5L6MB 4ROTA 3LK6A 1CC1S 4ALKA 1WX1A 3PDUA 2B4YA 1S8FA 4KOAA 1T5BA 4RY0A 3B9BA 4YRGA 1X3SA 2O5CA 1ZN8A 4HGPA 3A4TA 4IINA 5AICA 4RVDA 3PC8A 4HWRA 1GKUB 3JW8A 4ZZ3A 2I1LA 5I4KA 5JY6A 1OSNA 2Q4TA 2VCHA 1F6DA 3DLBA 2E55A 3BDIA 3HA7A 3SXUA 3ICQB 1U3WA 4QDUA 1ZRMA 2PL1A 1PGQA 3A1DA 4RPGA 3DE1X 1H6BA 1B2RA 3ECAA 3NM6B 2VDRB 2EF0A 1O1YA 1BJTA 1HT0A 1K4MA 2YHUA 5IHPA 2AG5A 2PLWA 1LZKA 3HY6A 4I5GA 5B7GA 2O8DB 1GZUA 3DO8A 1X1CA 3EGXB 1LLDA 5K0TA 4WKBA 3F2VA 1GKYA 4PX9A 3A4LA 3IXLA 5J2UB 1KS2A 1N2HA 2VYVA 5AI9A 1XD8A 3UJ9A 2VSFA 2IPNA 4D0LB 1X1SA 5EIHA 3P26A 2FEAA 5HIMA 4HRYA 4R05A 3F5QA 3AOGA 2HRDA 1EJ6A 2QWXA 4TMXA 1ZK0A 5ALKA 2E87A 2NG1A 3QG1A 1GTSA 4ADSG 1IBLB 1CZOA 1HFKA 5JEEA 1CF9A 1VKHA 4AWBA 4KFRA 4CG2A 4CMEA 5IAAA 3WB1A 1Y89A 1XD9A 3S2UA 1ZCJA 2GEBA 3KPJA 3HKEA 1WHTA 2BJHA 5B6IA 1G7SA 1HZZC 3A1SA 1FFDA 2XCLA 3IGFA 4BO4A 1W59A 2FJUA 1AS0A 4ZYLA 1JFTA 1GQQA 3OO1A 3F90A 4W4TA 1JR3A 5BV1A 3OIYA 3N0VA 4PBSA 2XT9A 3QMMA 3W4KA 3PGKA 3PNYA 3S0JA 1ISFA 1GA4A 1NP3A 1IY8A 1VBMA 1Z83A 2A0WA 2FSHA 2XDQA 3F9IA 3N3BC 1G291 5DTIA 3A1CA 2OZEA 1JHQA 3GJRA 1OAKA 1UEIA 2DFLA 4RD1A 1EX6A 2Q5LA 3D1JA 5AI8A 3RASA 2VTEA 3V7FA 3EVTA 2W9XA 1EP1B 3W2EA 2MIIA 2WJPA 3R0ZA 4R1QA 3RFFA 4UTRA 3I2YX 3TH5A 3AJ9A 4DLWA 2GVZC 3BMXA 4CQMB 4OJQA 4RSHA 1MV8A 1MC5A 3B38A 1TW2A 3LY9A 1C4XA 2HSGA 4R9RA 3UAZA 4E21A 4HNRA 5JZSA 1VJRA 4DNFA 5CEJA 5HJEA 1QDUA 1IN1A 1VL0A 3CU5A 2YXBA 2Y67A 1A2OA 1W9MA 1UK6A 3BFPA 1CG6A 1USUA 3D3NA 1KEWA 4EAQA 3UMYA 1CEYA 2KLBA 3WGUA 1FXWA 3UFXB 1AQNA 2OV4A 2IP1A 3P27A 1SIBE 3PEUA 3BZUA 1M72A 4ML3A 1EI9A 2A57A 5I47A 1Z5VA 4XIFA 4DV2B 1H1DA 2JGMA 5B57C 2HGSA 1TYCA 4NBUA 2WSSD 1IOWA 3KQHA 4WXHA 1LPOA 4N40A 1LNQA 5KYVA 3LU1A 2YJ4A 4RJKA 4ID3A 4QU5A 3X43A 1XTQA 3C1UA 2Z2ZA 5H3LA 1A8HA 3VHXA 2C7GA 3UJCA 3I2JA 1OJLA 4WI1A 3VR6D 1UBOS 3BZWA 1IATA 1U7PA 3C3CA 3QKUA 5KHOC 1RP1A 1SXJA 4D9KA 4MKGA 1WEKA 1XP5A 3VPSA 2L2QA 3SWWA 1RBMA 3QLTA 1YB1A 1I7LA 5EWJB 1SQSA 5IANA 2P0AA 2G6BA 3BHMA 3NYQA 3PTZA 4EA8A 4YAWA 3WJ7A 1W30A 1P2DA 3OFVA 1I6MA 2DPHA 3N8NA 3QEJA 5CVUA 2IEBA 1Z8NA 2TMGA 3H1AA 1Q92A 4RHFA 3C6BA 4WWHA 3KC2A 2CVZA 3AQ4A 1D4ZA 2YFKA 5K3AA 1Y8RB 4LISA 3HYTA 4BLOA 4EMBA 2V3VA 3FYUB 1DCMA 3NWOA 2ILVA 1ZVJA 2ONKA 3ELDA 3LV8A 1PFUA 3G5TA 4P4SA 5I7UA 1OI4A 3AW9A 4XWKA 3A36A 3PGMA 4QNNA 4ZTBA 4OL9A 5FI1B 3WMWA 4NOJA 3GAZA 3VNQA 2QAGA 1VDMA 3UYLA 4WCFA 1QO0A 4HQNA 1NMYA 2A7QA 4M0DA 3PRYA 3KTOA 2G06A 4IDFA 4Q4HA 2BY4A 4UD6A 4C76A 5CDFE 3A32A 3CW9A 1DIBA 4HQLA 2QAIA 2OA0A 4QKQA 3MT8A 5C1IA 4ZZ1A 3MEQA 3QTLA 2XKKA 4IIJB 2HFJA 3WRXA 3FHOA 4QSHA 3ZU4A 4HMPA 1WDWB 2FE4A 4ZJYA 4DJAA 1UIRA 1HX7A 1QUEA 1I2DA 2A58A 4FPXA 4M7OA 3WK6A 1LSJA 2XCOA 2J85A 4JJ7A 4IQ8A 3DNMA 2DBZA 1W46A 2ZIAA 3FX2A 4CIAA 1JSCA 1UANA 3WK4A 3ZQJA 1KKLA 1ZRNA 3L2OB 3RYCA 1U0BB 3L7LA 4JJ8A 4GWKA 4EQ6A 5ALXA 1QYXA 1PR3A 3AM5A 3JASB 1E1CA 5DF1A 5EYPA 1T43A 3I9KA 3UMMA 1UAGA 2BJVA 5DWQA 1ZMTA 5IK2A 3IBSA 3ZXUB 2P67A 5K0FA 3AEYA 1FP1D 5J9FA 3I9LA 5EIBC 3RS8A 2PD4A 4IEEA 5J43A 2ZUWA 4M8NE 4IUYA 3TAUA 4LZZA 3P1JA 2FEWB 3ZJUA 3OESA 5JO0A 1MOPA 4ITRC 4J9UE 4YREA 5DXAA 4JQSA 3WVNA 4RXUA 5I5GA 5C4IA 4LZAA 1LS1A 2LXNA 2PA0A 3D02A 2JI7A 4GOJA 1FSPA 2XD9A 2WIDA 3NTRA 4MOWA 2E4XA 4XRRA 4H1HA 3E53A 1Q15A 1XF9A 5DYYA 1GQ2A 1WD7A 3WWPA 3B78A 1NU8A 1NJ8A 1QH1B 4NU6A 3ZWDA 2JIPA 3SYLA 1G5RA 1EFDN 3W78A 1E0KA 2I9KA 2O2XA 4GXNA 1A50B 3TTXA 1VPTA 5BPFA 3K92A 4DRXA 2E21A 2JCXA 4PYMA 1CLUA 3VKUA 4XIYA 5L4LA 2EARA 3GGCA 1GPAA 4FGJA 4KNYA 3GFPA 3AR5A 3IBCA 4QL3A 3U7IA 5L8VA 3PI7A 5AFSA 4CL3A 1M73E 2ODPA 3EZXA 1EZ1A 3FOEC 3KVNA 3U9LA 2OYCA 2BH9A 4ABYA 4KN8A 1RXYA 1APBA 1G8PA 3W3AA 5AM2A 4D3FA 1QF7A 1S8NA 2GTHA 2P4HX 1E5TA 3ND6A 2ZS9A 4NH4A 3U1TA 3WI7A 5LNK1 1R0XA 3ZLUA 1FDVA 5FUXA 1V4VA 4ZIRA 4EI7A 1ODFA 2O23A 1FVFA 3LDGA 4GPEA 5CBPB 3OZEA 5KX5A 2RHBA 1BU5A 2OK7A 3MMZA 3JQ9C 1OI3A 1SUSA 1XJ5A 4YP6A 3RHFA 2QW1A 4EPRA 3DXYA 1JEQB 3FZEA 4Q4CA 1QFJA 2IXGA 3NHZA 5DT2A 1XVUA 2R6R1 1ZBDA 2H8GA 5COQA 3GJSA 4ZP1A 5E6SB 4AF7A 2V98A 3K1TA 3VU3A 2C2ZA 1M1UA 2WYUA 1C7RA 5HPYB 5JROA 1QIGA 2NU6A 1A9XA 4HPJB 3KR2A 5F3WB 4FLEA 4NRDA 1PKXA 4NHOA 5HKBA 1V7PC 1AZTA 1GZ7A 1BWRA 1YVUA 2W83A 4J4TA 3P8ZA 3UICA 1PE0A 1IJKA 2GNAA 5IEBA 2FJPA 2CLMB 1BCSB 2G72A 4NI5A 1RAEA 1RI5A 4IIBA 1GAQA 4KQ1A 3JSXA 1M6HA 2CB0A 2WD7B 4MQ5A 1P2TA 1DWUA 2YXPX 3MILA 4MUFA 4BQEA 1QE3A 5JHHB 1UKEA 5GIOE 4PGGA 3QXCA 3KV3O 3JCZA 4Q3EA 3KKQA 1HETA 3FWHA 2QVGA 3MRXA 1BYUA 1R4NA 3PR3A 4RGVA 3URKA 1WULS 1XMVA 1QDEA 4XZ3A 2VK4A 2C9CA 3MTQA 4O4IA 3KETA 5EMHA 2G40A 4B40A 3CUUA 3HCAA 1P19A 4JVSB 3L8HA 4NWIA 1FQKA 3V8NA 1NMZA 2O3TA 3FPEA 5ER9A 3R3ZA 2VJPA 4OKSA 1Y4AE 3WLFA 2O8BA 1MB4A 1L7OA 1G64A 3ZHOA 3K0AA 1FSSA 1YZGA 3HO6A 5HUHA 4V0ME 1VRWA 2I76A 3KHSA 1G21A 1XRNA 3FY4A 3NFYA 5JUWA 1AV7A 3W2GA 2NVWA 1NM5A 2H1WA 3N05A 4QDOA 4U5XA 4I4CA 4XWAA 2H4XA 1LVUA 3DXFA 3K9FC 4MKHA 4RV4A 3Q8LA 4RTLA 3AGPA 4Q3BA 4ZAZA 1VI2A 4AMZA 1T2UA 1QVVA 3J81k 2O07A 1T2VA 2MINB 4KJXA 2I62A 3OZBA 4B3JA 3IIJA 3D3WB 3R7FA 4K03A 4X71A 4A9AA 1D1QA 1U7ZA 1F0PA 1TM4E 1I5EA 1W87A 2FQQA 4HAOA 2OM2A 3ZEIA 4LHWA 5FNVF 3RK4A 1BXGB 1E3QA 2Q99A 3OLQA 3D5TA 1GR0A 2VHXA 4E2YA 3UK6A 2RBGA 3CTPA 4WTOA 1YVRA 3ZYZA 4C29A 2HJRA 5JQGA 4AS1A 1JKXA 1D2AA 1H2WA 3OCZA 5AVTA 1C0PA 1FSZA 1V5WA 1R3DA 1K6MA 1RLMA 1SKBA 3LXMA 3PQ6A 1OT3A 2EGGA 1DKUA 4DLNA 3THXA 4UHDA 1OWLA 2WJJA 3DBLB 4GYJA 3W8RA 1CNMA 3EFEA 4B8WA 4EY4A 1PVVA 4GE3A 3WWCA 2VCYA 3HXPA 2CYCA 1YL6A 5LWQA 3STTA 3CKKA 3B6EA 3C48A 1J24A 3KT6A 5J4LA 2QN7A 3I3SR 2V45A 4QPNA 3LCUA 1J70A 2CUZA 1MKYA 3F3MA 3PUWA 4IKPA 5GM2A 1NZJA 1W1WA 1VG0B 4C0BA 1DTWA 1KRXA 3G0DA 5GMOA 2AJCA 1E2BA 5C7YA 4BLVA 4GI3A 5TLSA 4PONA 3ONNA 4QOFA 4E15A 1UQRA 3EVFA 1Z33A 4LJ7A 3V80A 1NGSA 3ZBTA 3GG9A 4RMGA