5KBDA

Structural studies of transcription factor p73 dna binding domain bound to pa26 20-mer response element
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
201
structure length
201
Chain Sequence
b'HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein p73
publication title Structural Studies of Transcription Factor p73 DNA Binding Domain Bound to PA26 20-mer Response Element
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kbdA00
3US1A 4A63A 4MZIA 2MEJB 3VD0A 4IBZA 1UOLA 1KZYA 2XWRA 3EXJA 4IBYA 4IBSA 3TS8A 2RMNA 5LGYA 1T4WA 2YBGA 2VUKA 4IBTA 2ADYA 5AOMA 5ECGA 1LJMA 3WTSA 1E50A 2J1ZA 2J1XA 3D0AA 4L0ZA 5G4OA 4AGMA 4GUQA 2P52A 2BIOA 3KMDA 3D09A 5AOKA 1H9DA 2AC0A 2WGXA 4AGQA 5AOIA 2PCXA 3IGKA 1IO4C 1HJCA 2J21A 1HJBC 4LO9A 3KZ8A 1EAQA 3WTTA 2ATAA 1CO1A 1GZHA 3EXLA 4IJTA 4MZRA 1HU8A 3QYMA 1GZHC 2GEQA 2J1WA 2BINA 1CMOA 4AGOA 2J6WA 1YCSA 3WTXA 2X0VA 2BIPA 1EANA 2OCJA 3WU1A 3D08A 4IBUA 3D06A 2XWCA 4LOFA 5ABAA 4IBVA 5AOJA 3QYNA 2X0UA 5AB9A 3Q06A 4LOEA 5BUAA 4KVPA 3IGLA 4GUOA 3VD2A 2BIMA 4XR8C 1TSRA 2J20A 2X0WA 2IOMA 2BIQA 4AGPA 5G4MA 2J1YA 3VD1A 3WTYA 2AHIA 5LAPA 3WTWA 4L18A 3WTVA 2FEJA 4HJEA 3ZMEA 4IBWA 5G4NA 5AOLA 4QO1B 5KBDA 3D05A 3Q05A 3WTUA 3US0A 1TUPA 5A7BA 2IOIA 4AGNA 4AGLA 4G82A 4G83A 4L0YA 1EAOA 2H1LM 3D07A 2IOOA 3Q01A 4IBQA
chains in the Genus database with same CATH superfamily
3BZDA 3KLAB 3BH8A 2F8VA 1BD2B 4PCYA 2XX1A 3K3QA 4GW4B 4D94A 3EDFA 2BRQA 1NICA 2VISA 3VXQB 1XMEB 3FAWA 1UT2A 3VTTA 5JLZB 4P3WA 3NJGA 1BW8A 1E8YA 3VW3L 3V4LA 5KYWB 1DQQB 4M8RA 1I1YA 4AENA 3X11B 3SOBH 1NCHA 1Q94A 4UI2A 4OZFB 4P2CG 4PY7A 3FQWB 1BZOA 5INCA 3IFNL 5CCKL 4JFYA 1YDPA 3TTSA 3FL7A 1HINH 5FYKD 2BSEA 4GIAA 1T1WA 2FO8A 4JKMA 4H88H 5T3ZL 1P5UA 3OVUB 1XMWA 4FFZL 4KK9C 1BD2D 1BVLB 1G9NH 5E5RB 4CW1B 5LGKA 1AXIB 4YOKA 1W0WA 4JFHE 1G6RB 3EJYC 1PX8A 1MXGA 1FORL 3ARDB 4Z9KB 3L08A 2CK0H 4TLTA 5EO1A 2FZ3B 5EZOL 1ZLUH 4CVZA 1T1XB 2W60A 3NFPA 5HVFB 3RIAK 4QLWA 4L37A 1CVRA 4JO1H 4Z3IA 2N7SA 4V33A 1WICA 3HS0A 1BVKA 5BV7B 5GGRA 4PJGE 3CHXA 1A6ZA 2F15A 3MLTB 1XTMA 4XAWH 6FABH 3G5VB 4I0PA 1A6VL 1A7PH 2C3XA 4I2XE 4LSQL 2E6PA 2H26B 5IW1B 3DIDA 4UZGA 4NQDE 1XTLA 2YLKA 3IJHB 2XPGB 3PHOA 4Y5XC 5FUOH 4LVEA 4M29A 4P46B 5LNEA 1AP2A 3WJJA 3S8WA 5IR1B 1U3YA 1T0MB 2P7TA 3AG2B 4N28A 2FJFA 2ESVB 3CSGA 3ARDD 5ABZA 2EKJA 2P47B 3AQYA 3FQ2A 3VFMA 1FYTE 1YPZB 1TO4A 3OG6B 1SUJA 1U9KA 3ME0B 3RWGA 1Q9LA 4FERA 3SPCA 3FSOA 3G5YA 5EUOE 3TN0A 4AT6B 3K2UH 3M17B 4EEEA 4AJYV 3PNRB 3FCUB 1UCBL 3EZJB 4OFDA 4OBSA 2ZWYA 3HR5A 4P46D 4X4XA 4NQCE 3D69A 5LNDA 5K9OA 2NW3B 5T1MA 3RP1A 2ESVD 1IAMA 2BVPB 4MXWH 2QVFB 3B9KA 3HZYB 4FQHA 4MB4A 2XN1A 4KO6A 3SKOB 4YHYB 1N9PA 2FX9L 2Q2EB 4XBEH 1ZHLB 1U58A 2GJZB 4FP8H 4NSKA 4Q6IB 4ZW7A 4DPBX 4YXLL 1K4DA 1QASA 1CF1A 3VYNA 2FJGB 2MRYA 1Z0MA 3A23A 1QW9A 3CJJA 4C58B 3PUUA 2PO6A 1LLAA 3MGOB 5FB8A 2AQ2A 2VAAA 2FO4A 1T7XA 2I27N 1MI5B 4HS6B 4ODVL 3VACA 4X9FA 5JHDA 1GGIH 3OAWA 4YDZA 4ZTPH 1OAJA 3EG9B 2HRPL 3L9RB 4GXFA 1JF1B 4H5SA 2GTZA 3T04D 1YMHA 2H6OA 1MCHA 2VNCA 1VFOA 3F7KA 3SPHA 1B4JH 1GH7A 1U3HA 1L0QA 3ZGIA 4PG9B 3WKPA 1KGCD 1CU4H 2AJZB 2NY7H 4X5LA 1KPUB 2DV6A 4FF9A 4EN3C 2AQQA 3OAYH 4G6AC 2KKQA 5G5DA 3ARGD 4WSGA 5JQIB 3M88A 1MI5D 4NENA 2MQCA 4KDWA 4EUPG 1JV2A 4DJMA 1L3WA 1FJ1B 1E9OA 1HSAA 5D4QA 3ZKXB 4HXAH 3KLHC 2E7MA 2XQBL 3F05A 4I5BA 4LNVA 3HCVB 4MMYA 1RZPA 4HLZH 4ZW6A 1GJWA 3APDA 3L4CA 2FJHB 5EOQL 3N91A 3BPLB 5EPMB 2EDYA 1CICC 3NABL 1TZGH 3CXFA 1ZVSB 4Y2DA 4PY8J 3BDYL 4ZUVA 4U6YB 5TD4A 4X4YB 1NFIB 3PIQA 2WYIA 4M03A 2AV7B 1P7HL 3VM5A 1YEIL 4PJCF 3HLAB 3Q5YA 4PWEA 4NB7A 5DQDH 4FNTA 4I13B 3HMWL 1MAJA 4P2RD 5DZNA 2IDTA 1T89C 1CXHA 3O8XB 2OMYB 4UINL 1RY7B 5FO8A 1QI4A 1H5BB 3QO1B 4LL1A 5F8QC 2BVQA 3G3LA 1RSYA 4JRYB 1TSRA 2NY0C 2X0WA 5AZEH 1TPXC 2FTAA 2B4CH 4PJEF 4KUZH 2XA8L 4GRMB 1LEIB 4YDMA 1HOEA 1O6TA 1I8MB 4DPCX 3O8XD 4K5MA 2EVIA 2X4UA 1CLZH 4RQQA 1ZSDA 2NSMA 3WCYA 4JJHA 2WPGA 3K6SB 4HJGB 3D4YA 5DRWB 1HL8A 2OYPA 5DSCB 1WFOA 1NCWL 5HGHA 3ZKND 4JRYD 2PETA 3I85A 3WN6A 4OM0L 1FLRH 2NY3C 3H9SA 3PV6A 4F7CA 3MRHB 1V54B 4GMSL 4Y1AA 3U7YH 4Z3EA 3LPWA 2RR3A 1KLGA 2QVIA 4ZAKA 3TM6A 4KVNL 1SN2A 2LE9A 2ICWB 4Y0GA 5EU4B 2X4OA 3BP6B 4U7KA 3VRLF 4BH7A 3C5ZC 4FHKA 3HNVL 1V5JA 1MCCA 4MDIB 1P4IL 1AZCA 2D7PA 2JIXA 4WAFA 4ISVA 1DJGA 4APQA 3AREB 5DTFA 5I1HH 1CLYL 2HKFL 4PBDA 2FIRT 2K8QA 3FT1A 3J8F7 5E1GA 1CFBA 1AD9A 1SYVA 2VWEC 3MXWL 1XCTA 4D0CA 3PFUA 1KJ2H 3PWLB 3AUVA 1AI1L 2G3NA 3UH8A 1MH5A 4WW2B 5G4OA 4B3VA 1E5ZA 5CZVH 1CFSB 3N1PC 1QFWL 4EI5A 2NSQA 1NEZB 2V8MA 4M5SA 3VXRA 4NFBA 2PUQT 4A39A 1UKTA 2VLJA 4N0UA 4X6EB 3UACA 4ANKA 1R3LB 1CFVH 4NZTH 4DGIH 5IT2H 1L7IH 2J8UA 5E2JA 4F2EA 4XBGA 5IBLD 1BF8A 1MJ7L 2KLSA 3RKDD 3TCLB 3H7BA 5F70A 5AUMB 3HNTH 2YD0A 3KYNB 4PJCE 4G6MH 1JWMA 4G8IB 4TQIA 3GXMA 3MXVH 2BJMH 4HQQL 4TNVK 5I1EH 2AJVL 4M6NH 1HKLH 3VGAC 3TNNB 2CDFA 1ZTMA 2O26U 4XHJC 3VFVA 5CLYA 1FNGA 3ESPA 2P5PA 3K80A 3BSZH 5AALA 2AQ3A 2OYMA 4MWFB 1YEFH 2PTTB 3N9GL 4X4MA 5JYMA 3D08A 4A6YL 4M1CD 3MRPB 4B9PA 3AWGA 4Y16B 4R96A 2EUWA 5DYOA 1KZQA 3VG0H 3U9UB 1DQMH 3CXHJ 3BKCH 2HLAA 4LPVA 3TCTA 3T8MA 4CDHA 4HG4J 3PP3H 1NCTA 3TT1L 2CDEB 2QVKA 4PJEE 4JRXA 1ILSA 3CLFL 3IVKA 3GHBH 3VD2A 2GJ6D 1NIFA 3ZMRA 1JIBA 5CEZE 2PTUA 1NCAL 4TV3A 5DHXB 1MWAA 1GGUA 2ITCA 5JIPA 3QNFA 2GUOA 5CJOH 4YC2C 1S7VA 4O51A 3LCYA 1WG3A 4N2IA 1V55B 1OGTA 5LQBL 1DSFL 2CLVB 3FFCB 4Y16D 1C5BH 5E6UB 3W82A 4HJEA 1CURA 4XAKD 1N12A 3F6LA 4XMUA 1RZ8A 3KPQA 3P11H 1ADWA 4S1RH 3B1TA 5JTWA 3HOGA 5KYUA 5C0AB 5C6PB 3T5WA 2EADA 3DRTB 2M1KA 4I1PA 5GS0D 2HAZA 1N3NB 3VRLE 1IM9B 1TZ8A 2VWEE 1YY8A 5ID0B 3QFDA 3HRZB 1A6UH 2PP8A 4LDOB 4NCDA 3WHXB 1BJ1H 5HGAB 3SDYH 3CMGA 4N20A 5ANME 1E8WA 4XGZA 5I6XB 3D6GA 5IFJB 1L9QA 3FFCD 4JO3H 1U33A 2XQYA 2BNRE 5B22A 2OR8A 4YHLL 1I7TB 4F2MB 4ZMYA 3QUMH 3VWKA 1S78D 3ZL4H 2CRYA 4HK3N 2R1WB 4NQTA 2F53B 2OMBA 3UTZB 4XMLL 4DVBB 3V79C 1RZGA 1MFAL 2QQLL 3B7SA 5CSGA 1CVSC 5ESQA 2P5EE 2XICA 4LSPH 4K7FA 2D2OA 5D93C 2QKIC 4OBRA 5D7SL 1IM9D 4WO4C 3DV4A 1E50A 3KXFA 3QI9A 4OIIL 3D9AH 5IOPB 1KGXA 3GTVA 3QZBA 1MIEL 1YEKL 3AGVA 2R1XA 4UZUA 2EZ0C 3VFTA 4EIGB 4PWKA 4NPJA 5AOZA 1UTDA 1Y1UA 5DO2D 1YEJL 2DMCA 3ZE2B 4JHWH 4YHML 2A4EA 4LBEB 1DQDL 1LO3L 4KQ3H 1NDGA 2F53D 1N6QH 2PCFB 4KRMB 1RIVH 3PXJA 5GS1B 3QR1A 1RZQA 1DLFH 4MJ4A 3WTTA 4CC0A 5DJYA 2ARJB 3C6SB 4CILA 1DVFB 4QWWC 1XGPB 3RURA 1WZ1H 4ACTA 1D5RA 2QVTA 1BXXA 1PVHA 1G6VK 1N5AA 1QX1A 2WLYA 3G9AB 2YAFA 2KS0A 4YBQC 1EUTA 4G8EA 3L5XH 2ODIA 1BV8A 2HA1A 3WDJA 4F3FA 5C09A 3ZN6A 2CUAA 2ROXA 3WEXA 1C7TA 1YEDA 4PS4L 2BMKA 3BP5B 3IS0X 4KNSA 4OZ4B 4FEMA 3J7HA 4JPVH 3QNXA 2Q76A 3PWUA 4BH8A 5BXFA 1DVFD 4EIZC 2CNYA 1FV1B 2FUQA 3ETBF 1YAZA 2VE6B 4MAYB 1NC4B 1Z5YD 5D1QB 4BZYA 3UAJD 5GRUH 3GLAA 3MV7E 4BE6A 3KVPA 5LBSL 1BZ9B 3O2DH 4PR5A 4S11A 1OAXH 3QCUH 4K9EL 3TFKC 3C8KA 2X41A 3G08B 1MZYA 3N42B 3LNEA 5HYJE 2XU9A 2V9TA 4QUOA 1GY1A 1QQDB 1SXSA 1LHZA 3S36X 3DGCR 3ZZLA 1ZGLA 1TUPA 2EVHA 2Y0SA 2QMJA 4IGBC 1JDAA 1NC4D 3L54A 3BAYA 1E6OL 2YEQA 4P2OB 4RAUA 1SMOA 5D1QD 1YEEH 5J6HB 5L8KB 1HAUA 3C6LC 2X70B 4KFMA 3QORA 2JKJA 2AAAA 2ADJA 3HS8A 4HZ1A 1WYJA 1ICTA 3G7TA 4Q2ZA 1UA6L 4AQ1C 4I77L 4DO6A 4BZ2A 5HI5C 2UZXB 5HHPB 2F2HA 3PWPB 1E2VA 1RZ7L 3QJSB 1X9LA 3B7TA 3QJRB 3SGEH 3H56A 4PJ5E 3FQ4A 1QFHA 4OCWL 3OB0K 3ZUCA 3VFGL 3EYQD 4NRYB 4P2OD 3DSNB 2WBWB 4PJDA 4KZEL 3TNMB 4NQQA 2MOVA 3GF8A 2NQCA 4YQXL 1PZDA 4S1QH 1NAMH 3D2UA 3QQ9D 2ED9A 1MY5A 4A6YB 1Q9OB 4ZQKA 4U49A 3ZDZB 4PJBA 3MC0A 5B3NA 4EOWH 3MNDA 2J4WH 5I8CA 4AEIL 3BLKA 1XR9B 5JHLL 1JV5A 3IXAA 1VACA 2QFPA 3HNSH 3QYMA 1U8IB 4MGXA 1MREH 2IANB 1U92B 4OKDA 2X6AA 5T33H 1QTYT 1U36A 4G8GB 1PNDA 1UA7A 3UG3A 2XNAA 3ZOAA 2WQSA 1HIML 4XE5B 4BWWA 5DD0L 4MD5B 4E9XA 4GUCA 3LZRA 1IAII 3BT2H 3FW6A 2CO2A 3TVMC 1QPKA 1IQWH 3RHWK 1JGDA 1TDQA 1PPIA 4LXFA 4M7LL 1W6LA 2WIIB 3D3VE 3H85A 4LOEA 3F5WB 1A1MA 4XX1E 2O72A 5F7EL 4PJ6A 5FYKH 3GSNA 2IAND 2HSIA 2EDHA 4Z7VB 3CDGA 1D7CA 4G8GD 4MMZC 3WD5H 2FIKA 4UIKH 3T9WA 4RZKA 1KJVB 4TPRH 2UY7A 3WFBH 3IJEB 3V5HA 2XBTA 2OYLA 4Y5YB 1SJEB 4JAMB 1INEH 2I24N 4WEUD 5FCSH 5AYUH 1YPZF 1VPOL 5ILTH 2B1HL 3FU5A 4TS6A 5F0JB 1JS4A 2H7WA 2XX0A 4MDJA 3VA6A 3VFSA 4U7SA 4XZUA 2W94A 1C1EL 4GB9A 3GI8H 3HKFA 4WUUD 3TLRA 2PYEA 5FX3A 3MV8B 4GQ9H 3SO3B 3V7MA 2XVLA 1G6RH 1RZJH 1X4ZA 1SOXA 2ICEA 2FEEL 1PGRB 3BKML 3CZKA 3QWRA 1JG9A 3RDTA 2NY2B 1CN4A 2XKUA 1T4KB 1ZPLA 3DPDA 3DIFA 2A77H 2H3XC 1G7JA 3DNKA 3EHBB 4UAOC 5BV7H 2K4WA 1X5YA 2DWXA 4KKAC 5T3XD 5LBGA 1JPFA 4RGNC 3K1DA 4ZT1A 1HN1A 2C9VA 4NC0B 1DQTA 4S2SB 3IF1A 3HS9A 4DESA 4LHUB 3WS6C 5DS2A 3U79A 3TEXA 1BD2E 4PJ9C 5AW9B 1CF8H 1D7FA 1RMFH 4KKRA 5DR5H 3U2JA 4L8BA 1F4YL 2NY2D 3CPUA 4XP5L 4OV6F 2Q6WA 3VVVA 1JPGA 2F1AA 2DWEB 3WEAA 5KJ4A 1PCXA 1HSBA 3WG7B 1J1PH 1OP3K 3EHBD 1CL7H 3HC4L 5DFWH 5CBEA 3M07A 3QFGA 1GA2A 2OK0L 4JFFB 1S9XB 1NSNH 2LV4A 4U2YA 5FLUA 1FO0L 2AEOA 3NCMA 5B39A 4P99A 2ITDA 4L5FL 3WFDL 1EGJA 2HZHA 4LHUD 4RRPA 1HZKA 4KJWC 1Q72H 2ZOKA 2QHLA 4N0FA 3SZ6A 1AO7A 3DDFA 4BBWA 5E6SB 3QRBA 5C6TH 5KSUB 4WGKA 4UDUA 3OKOB 2HFEB 2RGSA 5I1CL 1J10A 4R97B 1KFAH 4PSPA 4FFVD 4RAHA 3DURB 3O9WB 4MQTB 5DUBB 1IAOB 4IRSC 4UT9L 3U4EB 5GZOD 1MJJB 4JFFD 2WBJA 5AYQA 5MP6H 1PZ2A 3FHQA 1P5VB 3MRBA 3MLPA 1HI6A 1MCNA 4M1DL 3MNWB 1AGCB 4NJAL 1CFQA 4XCCH 3THMH 4XNQB 4H44C 5JPMA 4R2GC 4HEMA 2WNXA 1A4AA 3QFJB 3EO9L 3KPTA 3N85H 4JGMA 4AE1A 5HVHB 5I2IB 2BS8A 4KAQH 4XO4A 4D8PA 2EH8L 4W9EC 3MLSH 1JGLH 5BO1L 5C8JA 5L4MA 3LS4H 1KT2B 1YPZE 5FXCH 3MRDA 3BGFB 1OGAA 3DHUA 4BSJA 3GXUB 5DJ8A 4NO2A 3ZMEA 1T0NB 5DO8A 2QHRL 2ZKHL 3UMTA 5KTEL 4CGUB 5DZVA 5K1VA 4NKMB 5AKRA 2ADIB 4WFGE 5F1NB 4RNRA 3GMRB 43CAA 1TEYA 5BS0A 3EDJA 3QFJD 3NCCB 4QHPA 4XCEA 4HHGA 4Z8FH 7PCYA 4NNPH 3SDCC 5DS8A 2NW2A 4ZW8A 3GRWH 4HF5H 3UTTA 3VI3E 4KGLA 3VG9B 2ZICA 3GXPA 4APXB 5T1DL 3WI9A 3LAFA 2DS4A 4KZDH 3NFNB 1Y0LA 1KCSH 2FQGA 3EJRA 4LPXA 1D3CA 3VXOB 4Z7UF 4WU7B 5CN1A 5CXPA 2CU9A 3NA9H 3TBWB 3K2KA 2G60L 4J3UA 2B5IC 3ZL2A 2DLHA 2H8PB 4HWBH 5A16A 4M4RB 5IV2A 3BVNA 2ZOTA 2X6BA 5EUKA 3LRSB 4YHKH 3UXFA 1N68A 4H1LG 3ZU8A 4WGVB 3CIQA 4D9QD 4XPHH 1GGBH 2HWZL 5A2AA 3WNPA 4NLAA 1WFJA 4IK7A 1RVFH 2EH7L 3C5XA 1TXKA 1I85A 3IDGB 1JTPA 1BZ7B 4JO2H 2BDNH 5GSVB 4JKWA 5CJQL 3HIZA 5IJBC 3MUUA 1OE1A 3B2VH 3BN3B 4FYTA 1JYNA 4FFWC 3JTTA 5D8JL 1GZPB 1ZIBA 5I28A 4M6ML 3DSFH 3AREC 2BHZA 4XC1L 4MA3B 1M7IA 5F1IB 1TLKA 3IJYB 1FRGL 3HMXH 5F97E 1AR1B 2YMXL 1RK0B 3N0PB 5ESVB 1ZJBA 3KBFA 4L1BA 3LKQA 1S7TA 3VNYA 1CBJA 4DNLA 4OT1H 3IPEA 4UQCA 1LGVA 5E4EB 4KY1H 4ZXBB 2E27H 4CMHC 3V7AG 1F58L 1NDMA 1RK1B 2DD8L 2VYRE 3L48A 3MV9E 3WL9B 1PS3A 2X6CA 4TUUA 1C16B 3EJYD 4FFZH 4XTRC 2FBOJ 3RX7A 5FO2A 2IG2L 1UJTA 3C9NA 1MOEA 4U3SB 1S7RA 2WWKO 5F7NC 2WZ5A 3X14A 5EZOH 1AR1D 3H0TB 4U1NA 3SQBA 2ZZUT 3PE9A 4MXQD 5IB2B 3MLWH 2VCOA 3NJKA 4HH8A 4NFDA 3WLBA 3ZRCC 3ILPB 1U4EA 3PGCB 4AM0B 4ZX5A 4ZXBD 2CA3A 3VCLB 4PJ7A 2AZAA 2ZUXA 3WTUA 2CIIA 5EFIA 1U8MB 4KY2A 1YN6B 1CD1A 1D5BA 2JKWA 4XCFH 4XHQA 2LVCA 5SX5H 4D9RD 3KWUA 1J8KA 3VI4F 1PKOA 1A3LL 2YA0A 1NGQH 1TF4A 1ZHNB 3Q9QA 4GBXC 3NCBB 2CM6A 4U31A 3K5SA 3FO9A 4IRZL 2AERT 4YE4H 3T4YA 3UPCA 2R39A 2XI9A 1EHAA 2A7BA 2EDFA 4NWTL 3P4OB 2MCAA 1XIWC 3WY2A 4Z7UE 5D1ZC 4QRTA 4UOW1 3ULUL 1T6WA 4N5UA 3LDBB 2Q8BH 1MCIA 3H1ZA 5DK3A 4FTVA 4BM7A 5F3HA 1R5VB 2MPAL 4OUOA 4Z7NB 1I3GL 5GJSL 1BGXH 1S8DA 1CCZA 3BMVA 1C12A 3WTSA 5D7LE 4B0MB 2Z8RA 4MYWB 2FX9H 2R1YA 3CFJB 3BPCA 5B21A 3U7WL 5HY9B 1UH4A 1IGTA 2HKHL 3NTCL 1TTCA 5L0QB 4NKOB 4OAWB 2MCMA 3T77B 4ZUTB 1XGRB 1XH0A 2YK1L 2KH2B 3IJSA 4PHXA 5IOKA 4GQZA 1AXSB 3MRLA 4B0MM 5L4FA 1UWEH 3MI6A 5IESH 3EH1A 4J28A 3CZFB 3AY4A 1E9PA 5I1AB 2O1AA 5GS0H 5E2UL 2FAUA 1OAKL 2RALA 4U0RB 5CP7A 5TK2A 3CFQA 3RNQA 4ODXA 4JDZB 5IFHH 3MZTA 2NNXA 3OZKA 3GEFA 1CLVA 5A6LA 3QW9A 2MCG1 3BAKA 4EJ1C 5C2UB 4UANA 1MSPA 1UD8A 5KYYA 2W9EL 5FV2A 4QRSA 2O6CA 3D06A 3I9GL 1K72A 1CGYA 4PHZA 1OTTD 2WTPA 3N1GC 5EZJB 2YFOA 1EDQA 3OKKA 5AB1A 1AKJA 4GUOA 4Y89A 4KROC 4AC4A 3FUKA 1V3JA 2AMUA 5CKGA 4NPYB 4KNQA 5CKAA 1D9KA 2WTRA 1XF2A 3VB9A 2WXPA 1A9EA 1KEGL 2X9YA 3QHFH 3PF2A 5FYJL 2XQBH 1BQHG 1UD4A 3WEOA 3FUMA 4FA7B 3PABA 3PHQA 2DL9A 2BOCA 2OJZL 2ZX9A 4H8VA 4HIIA 2CH8A 4I3GA 3MBWA 2VERN 5EORL 1SF5A 4HUWA 2WSDA 2BC4B 3CK0L 4G8FB 1X5MA 3TIDA 1OARH 2YOAA 3RVUD 4NUQA 5TDOB 5C9JA 1S7XA 1UFUA 4PBXA 1F4XL 4WY7H 1OTSC 2H6PA 4UINH 4EVNA 3HHRB 1UD6A 2W38A 3ASWA 4FLRA 4GAJL 3CSYB 1WBXA 2VLKB 4NEHB 3WYRA 5F96L 1G0YR 4WW1A 4U6HA 3DPBB 5FGBA 5JO5A 2XWRA 1TG8A 1PZ5A 2XBDA 2CUIA 4MAYC 4GQPH 4BKLB 5C0AE 3FFDA 2VDRL 4HD9A 1DLHA 3RWIB 1S7SB 4ELKB 1NEUA 3GYRA 3BPOB 1WC7B 4XPAL 3V4PA 2NY4C 1KC5L 1W72A 2Q0ZX 1F4WL 1AHWB 5FK9B 4HU8A 3LZPA 2IALB 3R0MA 5MI0C 5CINL 1JYXA 2VDOL 3QUXB 4HGWB 3RPKA 4BQBA 2CHXA 4HVBA 5MENA 3U1SL 2VLKD 3WN5C 3MVSA 5KUKA 2CCVA 3QDJA 4FEIA 5L2KB 2BNQB 2DQTH 4QRRB 1CFTA 1WH0A 2JJSA 2AKRB 2BPBA 3OAUH 4LLWB 3RWFA 3VYOA 2VSMB 3CDZA 3JV6A 4K15A 3MAWA 4OM0H 4RA0C 5HD8D 1EAQA 5FGCE 4GMSH 4ZFOB 4KVNH 4Q58C 2ZQKA 1QLRB 2LLGA 3QUXD 4OTXL 3QQDB 1X7QB 4O2EA 3HNVH 3SDXB 4JKPH 3W11D 1V7NH 1JYVA 4E9TA 5L2KD 2NPLX 4QRRD 2EUVA 5C0GB 3P77B 1D7DA 4L3EB 2ZONA 1KTKE 1YNTA 2A2QT 2DM7A 4KI5F 4MJIE 3ZDZF 2R4RL 2E8YA 3FYEB 4Q89A 5EZLB 2YOCA 2FQFA 4Y19E 5C71A 1J7VR 1LO5B 4HWZB 1AI1H 3VMOA 3ASNB 4K8RD 2ZSVA 1R9FA 3BVVA 1J05A 2L7EA 3RWCB 1T5WA 4KI5C 3QDGB 1UADC 3FO1B 1YQVH 4HFWA 1KXQA 1ZMYA 4HJ1A 2A6DB 1I4FB 3KCWA 1E4WH 2X4SB 3FTSA 4HBCL 3BAEL 5D7IB 1NLDL 2VDML 4PRNA 1V27A 1SEQL 4JJ5B 4L3ED 1MJ7H 1Y1DA 5DJXB 4MNHB 5KS9B 3B9EA 4P9HH 1MDAA 3E6FA 4Q14A 4HIJA 4XHJD 4W93A 1PLGH 2F6AA 3L3OB 3QULA 2NSXA 1KIRB 4HQQH 4JFOB 4QRAA 4AG4L 2AJVH 1UEMA 1XSKA 4EDXA 2EABA 4XPGL 1A4CA 3CZSA 4AK1A 4G7YL 1ZHBA 3FB8A 3DVGB 2W65A 5CJBA 3S35H 3UPRB 3N9GH 5FDYA 4KH9A 4R7VA 4A6YH 1FQ9C 2GK2A 3N3EA 3HB3B 4LCUA 3G9VA 4FQIL 2NXZB 1PKQB 1Z9NA 4BFBD 2VQ1A 2B39A 2VRKA 2YFNA 3ULUD 1G7MA 3TT1H 3WNIA 2C8NA 5DCCA 3CLFH 3KWTA 3VXPA 4IBYA 4OCSH 2OR9H 1TQUA 2G2RB 3II3A 4N2FA 1KYDA 4MS6A 3DO4A 3DX3A 3AT9A 4MZ2A 1IQDB 5H4YA 5J11C 1EHKB 1QUPA 2ZG3A 1DQQA 3HB3D 4XBMA 5LQBH 3X11A 1DSFH 3PYCA 1A7NH 2P24B 2NXZD 2XFXB 3FQWA 4RZCB 4U6XB 3RVVC 1YUKB 1UHVA 3PWPE 3X3GH 4MA7L 1FFTB 3MFFA 2Y6SC 5EO9B 1E4JA 4FABH 2YPLE 4KJPC 4MD0B 2MOGA 4AYDC 4KKPA 1EVUA 3T3PB 3VXSB 3BD3A 3FCTA 4KVCL 4M8QA 4DFIA 4QY8B 3O6FC 1TTAA 1F4AA 2FZ3A 2BCKA 3L7EB 4R7NB 1KN2H 3LKSB 5BRZB 3NIDB 2C3WA 3VFUB 4PP1D 3MRFB 1MWOA 1U8HA 4KI5E 1JVOA 4YMPA 2XWBA 5HYSA 4ERSH 4ECNA 3ZDZE 1GJIA 4HU2A 3FUFA 3G5VA 3STZB 5IW1A 2H26A 1MFAH 1HEJC 1PLCA 4TTDD 3IJHA 2XPGA 2HVJB 1MVYA 3NSJA 3PWJB 4FQXC 4RFNC 1CD0A 3KPOB 2Z31C 3LHAA 5T3XH 2NDFA 3VXSD 1T0MA 1WK0A 4OIIH 5JW4N 4JBSA 2ESVA 5C7ZA 5I18L 3ARZA 4N3UA 1RUQH 5GXBB 3UBXA 3FAXA 1X4YA 5FYJD 5BRZD 1FVCB 3GSUB 5LUMA 4B5ZA 3KLDA 4C56B 1YEJH 2R59A 5DK2A 3WTWA 4AT6A 1DQDH 1LO3H 1RJCA 2WUCL 5D2NA 1BQRA 3M17A 2XKSA 3LB6D 1PY9A 1K5NB 2RIKA 2Y5QA 3BWZA 4OLXL 3ZSSA 4DKDC 2E9BA 4NUGH 3V9CA 1JD7A 2B59B 2IJ0C 1BLNB 1SUHA 3NCFB 3MCLL 3MN8A 5TF1H 1GOGA 2NUTA 1W91A 4X7SH 2NW3A 1JWSA 4X6CB 5J3HC 3FMGH 4F5CE 1ZLWH 3SKOA 4M93C 4F91B 1GYWA 2X2UA 4GMTL 3CH1A 2DL2A 1ZHLA 1D7BA 1H3TA 1QP1A 2I9LA 2VDOB 4R90L 4C56D 4Q6IA 3O9WC 3UZVA 5KSAC 5EOCJ 2WVVB 2BFVL 4BQ6A 2FJGA 5HPMB 2XQYK 4PS4H 3ZKMC 1G9MC 4N86A 4P5MB 4WEBH 1JNLL 5DLMH 4O2CB 4DO5A 2QT6A 1HL4A 4ZODA 3ARGA 3IAQA 3MUGB 2IQAA 4O2FA 2JI3A 3EO0B 1MI5A 4HS6A 2KT6A 4BFFA 4WNQB 3QIBC 1ZSHA 2OMTB 3FQXB 3O2VH 2AEPL 2YD4A 2ZWKA 4WI5A 4XZ4A 3REVA 2Q10A 4LLQA 1LK2B 3L9RA 1JF1A 3MV8E 4NIYE 5BCAA 2X10A 4K9EH 4F7MB 1ZY9A 4DCQA 3WFEL 3GSWA 3WIFB 3ARUA 3MRKA 4KKBC 2AJZA 1H0DA 4TN9A 2Y72A 5IKCB 2BSDA 3TF4A 5DF0A 3A6OA 1DDHB 1KBBA 1ZD6A 3WXWL 1AVAA 4TXVB 5JW4R 1EZVY 4ZSOE 5C7XL 1RAMA 3C6LD 5JW4Q 3MUHL 3W1ZA 2OMWB 1BZDA 3TA3C 4PRPB 2NTFB 1FJ1A 3SYPA 4ZX3A 1W0YT 4P2RA 1UZ8B 3GRWA 1WE5A 2GHZA 4JPIB 3OMNB 4GKNB 5DD3L 1UA6H 4I77H 4BK5C 3KPSD 5HYEA 3TZVB 5CSZB 4L4TE 4KO9A 4K7PX 4KKCC 3HC0A 2VZUA 1RZ7H 5EF3A 1U8OB 3QPXH 3MHZA 4XC3L 1BXAA 4X4YA 1AR2A 2X4QA 2AV7A 3PDDA 4IIQC 4OCWH 1JFQL 2JELH 4OZIB 1AS6A 4HWBA 4PRPD 4BHUI 2Y2WA 1X6NA 3FNKA 3LN4A 2K8MA 2NX5E 5D5MB 4KZEH 3TEZA 2EIDA 3Q7JA 4E41B 5JW3L 1FGVL 3MLYL 4DP5X 4L8DB 5A2IH 2EO9A 4WV1A 1IX2A 5AG9A 3TZVD 2BIQA 1U8LA 2HFGL 4WFHE 2FX7L 1I1AB 3OLEA 3VFNB 1J0IA 4J8RB 3DHPA 3JWNH 4JRYA 1P2CB 3P9LA 2R9HD 3BP7A 4TUJB 3GIVB 4GRWF 1JUFB 2C4XA 1ZE3H 1YQ2A 4OGXH 3KWXA 1T21B 3GDCA 3P0VL 3AM8C 4N8VG 4E41D 4OLWH 2WZ6A 3UC2A 1FP5A 3QFJE 4AGNA 2XPZA 1IIIA 2LVEA 3NCXA 4ENED 4HJGA 1HHKB 1I1AD 3L3IB 5DSCA 1JZFA 2N59A 3B56A 1JZ3A 3L7FB 4BSWB 5J8OA 2VTFA 3OKLA 1AGDA 2QR0B 3MRHA 4YIQA 5CLXA 3UJJH 4FFZA 1XCQB 1NJ9B 5F7EH 3BH9A 2WO4A 3H2PA 3S3PA 2ICWA 4HKJA 4E9LA 3GJFK 4M48H 4JPKH 4MDIA 3MOQA 4L9LB 3EF7A 5ECGA 4TLSA 2NY1D 1MG2C 2GBAA 2OA9A 4J27A 1WCBA 4WEEA 2XZAL 4FAAB 4EUPB 3IE4A 1GXEA 4RBPH 5CGBA 3F6IA 1GC1L 1ASOA 1VEOA 1Y18B 1VPOH 3DETD 2R8SL 4GSDH 1AE6L 5JIIA 4M7LT 1M9SA 3SJVB 2JFCA 3V4VL 1Q0YL 4W6WB 1C1EH 2WZ0A 1QBAA 4WW2A 2VITB 5DD1L 4KJYB 1SMDA 5AOIA 5CJ5A 1IAIL 4N8UA 3MBEC 2Z7ZA 3RFRA 1BYPA 1CFSA 3S37H 2YD1A 4P4RB 3UPAA 1FFOB 1F2XK 3T6XA 1NEZA 1NGZB 3GO1L 1F00I 2DI9A 4JHVA 3MLZH 4X6EA 4GJTB 4GRLC 4GW1B 1E5CA 5DVMA 2F54E 2QZ5A 3HHSB 2FWOA 1HL9A 3RVXD 4KRPB 2VLLB 2Y7QB 3SJVD 1Z66A 4MAUH 1UM5L 2GJ6A 1T2XA 2VABA 2WBKA 4QT5B 3T6ZA 3QZWA 5E2VL 3EBHA 1RJYA 2BSSA 2FJSA 2FYYB 4FKKA 3TNNA 4PJ9D 5C97A 1TZIB 1BVZA 1B9KA 2LGNA 3NQIA 2YEZB 3V9FA 3IMTA 4B7LA 1NGXB 4KKLD 4GG6B 5IQ7H 1QACA 2DEXX 4XI5D 1CYGA 4NN5B 2AXJA 4L4VA 4BGDA 2WO3B 3BUPA 2UWEF 1ZLUK 1F4YH 4Y16A 5JQ6L 2GABA 2E5EA 4Z7AA 1LP9B 4HMCA 1FA4A 4KRPD 5HYQA 2NY5L 2P4AB 3L4UA 3B5HA 3Q2LA 1W8NA 3ZTJH 4OB5L 4IRJB 2FUTA 4KNUA 4K3GA 1QLEB 1IGMH 4KJWD 3V95A 4LGRB 4I7ZC 5D96C 4A7UA 1KLFB 1AMXA 3ISRA 4TF4A 5JDSA 4FXKB 1N8ZA 2IMMA 2OMUB 3AXLB 4X98B 3WKYA 4H8UA 4K3HA 1LEKB 3N04A 1U95A 2VZSA 3K4ZA 3NK4A 3TYFA 1UGKA 1GGYA 2A73A 3CHSA 3MROB 5ICXB 2O5YL 1O5DT 2F08A 4MD4B 3EF4A 3O11B 4AZ8B 4QTIL 4JDTL 4IRJD 2ZCKH 1N3NA 1KFGA 2BZDA 1BWMA 1RSFA 1A47A 3EJZD 3VAEA 4AMKL 4LDLB 1KGUA 3I02B 4M1DH 4NJAH 5ID0A 2AXGA 3HRZA 5EZIL 1PJWA 5IGXH 5HGAA 2XN2A 4HSQA 1S3KH 1RPUA 3EO9H 4R4BB 1J87A 1RL1A 2EH8H 4JY6B 5BO1H 1I7TA 4F2MA 3N41F 4K94C 4YGAB 2C7UB 2G5BA 4KXAA 4YPJA 2OX5A 2R1WA 2F53A 2WYTA 4YR6B 4BRJA 2IBZX 3MZGB 4HKBB 2OW7A 2QHRH 2ZKHH 3ARTA 5EF1A 1NCDH 2COVD 2WXFA 3BRGC 3EOYG 1RZKC 4LCYA 4AJVA 5CN3A 4R4FL 5AW0B 4HS8L 4OQTH 1FE8H 2WKOA 2J6EL 1XL4A 3OPUA 1HJCA 2D3LA 4K2UL 2WLIB 1ODUA 2A9NL 2VQTA 4NGHL 4Z7NE 4EZMA 4S0SD 1OB1B 3SE9L 1QNZL 4LIQL 3RYMA 4PQXA 1MF2H 1BA9A 2HT4C 1F8TL 5GRZA 4NQEA 5GRVL 2EVFA 5CSBA 1QEWA 5T1KA 1MAKA 5IEHA 5DZAA 1FN4B 2Z35B 4FXGB 4U3HA 5IVXB 4GY4A 3REWB 3HG3A 4W9GC 4PUBL 2RFXB 4Z3GA 5CM1A 1HKFA 5E6IA 3L95A 5IVZB 1S9WA 2ARJA 5E8NA 3EJJX 1V7ML 2IPKA 3JWDH 5MEQB 1S9VA 2FEDC 4QKTA 1DVFA 3BKYL 1ONQA 2JB5L 3BPOC 3BX7C 2VIRB 1RUAL 2ZXWB 1MHCB 4QI3A 2Y3AA 3OAYK 3GMNA 4LLYA 3UAJA 3QZPA 2YD2A 3RBGA 2G60H 4NLHA 4URTB 2UWEE 3DMMC 2CRIA 4QXGH 3SY6A 5ANHA 1T6VN 2XHNA 3U9PL 3SE4A 1MNUL 1AZUA 1FL5B 2NCEA 2JJVA 3VD7A 2J20A 4KNTA 3X12B 2ZCZA 1HH6B 2LLLA 2AK4B 5G4MA 4DGYH 1NIDA 4OZ4A 3GUTA 4Z0XB 2EH7H 4FG6C 1DVSA 1EEZB 2HJLA 3AROA 2MHAB 1FV1A 1A4BA 4OKVA 3VJ6A 3QIUB 1CDIA 3T0VA 2LAGB 3FQUB 3RI5K 3TCXA 5CJQH 1H8OA 2OMXA 3B7RL 2OSYA 3Q8CA 1BZ9A 4DVRL 3UEQA 1WSST 2WMPB 3G08A 2P8MB 2ADGB 3L4ZA 4XODA 4M6MH 3KPRB 3QARA 1MFBL 4XC1H 1PD6A 3QSKB 25C8H 2NRDA 3ZQXA 1A6PA 1DHKA 1G7HB 4QTHA 2AK4D 1MELA 3AADB 3BAWA 2WK2A 3C09B 3OC8A 4OGYL 5IHZB 1I1FB 4LSDA 3H9YA 1DL7L 1JN6A 3II2A 3QIUD 1BZ8A 5D7IF 4FLSA 4JGJA 1QHPA 3KEDA 2YXFA 5CMAA 1SJVA 2X70A 4I3RL 4PJIF 4FZEL 2AW2A 3C6EA 4K8RH 3D4GA 3LEYL 5CILH 1YMMA 3HI6H 3GBMH 3KPRD 4ANWA 5CZXD 3MRIB 4P9ML 2YN3A 4OF8A 2V7NA 3V0VB 2YA2A 4NZJA 5CCHE 1IAIM 4HJTA 4XCYA 4LLAA 3VWJC 2R0WL 1CR9H 2E9GA 3A0OA 2W91A 5TF0A 4ZBJA 3RIKA 3QJOA 3GKWL 3L3OC 5BVJA 1QR1B 3SD2A 4HMEA 1NFDA 3MRGB 3HI5L 3QDMD 1A8JH 4KPHH 1OAYL 4Q0XL 1FAIL 2DYPB 1KG0B 4A6YA 1Q9OA 1A3LH 2OSLB 1P6FA 3U46B 4PSRA 3E7JA 5DD6A 4HJUA 3ZSTA 1XIWD 4PW3A 2J5LC 2UZYA 4Y2LA 3ABGA 1IKNA 3IMRA 4NWTH 5ISZB 2ZG2A 2BNQE 4QRRE 3L45A 3NZ8B 5DVLA 5LBVA 4LOVA 2J72A 3VRJA 2H4EA 3OD3A 3ULUH 1NQBA 2DMBA 1U8IA 4J2XA 1HXMA 2DQCL 4PJ8B 4QKXB 1SNRA 4B3EA 2AVFA 1BM7A 3CDCA 1H15B 4G8GA 5B7EA 3A6CL 1VFBB 1I3GH 2CLZB 3DHMA 5GJSH 3WGUB 3WIHL 1HDMA 2YQ2A 5E2TL 5BUAA 3WUZA 3T3PF 4MRCA 3RILA 4GAAA 3NTCH 4WUKH 2GT9B 4Z3HA 5ACZA 2NQDA 4QGYA 5ISZD 5HHME 5CWSB 4IQHA 4YXKH 4GAFB 2WIIA 2YK1H 1HCFX 3NIDF 3F5WA 3WEBA 3CSBA 4YZWA 4JVPA 3LKOA 4PJ8D 1WF5A 1R3IL 4Z7VA 1XAKA 4WUUA 1T03H 4X4ZA 4HAFA 5E2UH 1OGPA 2P8LA 1ZT4B 5ADOH 5HHXL 3LRGA 1YYML 2NDGA 5ESAA 1KJVA 1OB0A 3QDGE 4O58H 1TTFA 5CFAA 4L2YA 1UM4L 4Y5YA 4JAMA 2W1NA 3WXVH 2JI1A 3T1FA 4U0QB 5LNGA 1WGOA 3Q2WA 3QCVH 4HCRH 3MV11 3BWAB 5D7IE 3T8XB 1FNSH 2W9EH 3N1MC 3VFOB 2YXMA 4P23B 5MEOB 1A64A 3I9GH 3PUCA 3G6AB 2YAHA 3PP3K 5JDJA 5EEWA 4KROD 1HNFA 2HH0L 4PJIE 3H2QA 3LPGA 1OVZA 2Q7AA 3GSOB 4PGEB 3IDIB 3W3BA 4POZC 4I4WB 2X9ZA 4JO5A 3UO8B 5LDUA 4UM8B 4K71C 4D9LL 3C5JB 4KO7A 2DF3A 4PTUA 4TM9A 4OUUB 2NLJB 5I9QB 2VR5A 4HPOH 1SVCP 3WIIL 1PD0A 1MKFA 2GFBB 2MH4A 1T4KA 4JFDB 4M6OL 4FYSA 1XD1A 4MQ7B 5FYJH 5B38B 5BOPA 5L4JA 1H3XA 2H32A 2R0ZH 1RHHA 4N2EA 5EO0B 2EYTB 3S88H 2AJUL 2HG5B 4WKZA 2WXNA 4P23D 1SVBA 2OJZH 1PKQE 1Q1JL 35C8H 1R5WB 3CGTA 5AVUB 5GGVH 1M4KA 5H37A 2HX9A 5CJXC 1AD0B 1OCWL 4PGCB 4S2SA 3CVBA 3CK0H 4P05A 3IU4L 3IEAA 1JGEB 1NCGA 1WFUA 1PMYA 4Y9EA 3UZQB 4AGQA 2VUOA 1IFHL 3RZCB 2X12A 3UJTL 3L13A 1BPLB 1E3XA 4JFDD 2DWEA 1T22A 1T0PB 4MZRA 2C5DC 3NZUA 4MJ6B 2CO6B 2YQ3A 4XWGL 4ESKA 1BOGA 1MLBB 2AJ3B 3KBHE 5GZOA 5FW8A 1XGQB 4OCMC 1IUZA 4W9IC 2KPWA 3NIFF 4Y5VC 4OFKA 3PGFL 2WNKA 1OTUD 3UG4A 2VDRH 3F7PC 3HE7B 3DUSB 4EZLA 1HQ4B 3FU9A 1XF4B 4W9ZA 5LBSA 3T3PE 2MTAA 2CLRB 3I75B 3RZCD 3VXSE 3QYNA 1BXVA 1F4WH 1EFXB 1X7TA 2X05A 3S35X 4UU9B 3DO3A 2N1TE 3TESA 2VDOH 1CFMA 3QUZC 3WUWA 3SY0A 4WNJA 3KE0A 2R29H 3DURA 2RA1A 2QADB 3F7RA 1KTBA 4YDVA 1PX3A 3DI2B 3NIDE 1X5JA 3U1SH 3U4EA 5J6GA 1MJJA 1H3PL 2ERJB 4WHDA 3M6DA 2GTWA 5DFAA 1OSZB 1XZ0B 2CGRH 4FG0A 2X1WL 2J1YA 3IMUA 2D7NA 1IL1B 2HUHA 5F9OH 2MMXA 3FO2B 4TUKH 4LVOC 1NM9A 3GSRA 1OXYA 3U83A 3VGDA 1KY7A 3MRCA 3DXAA 1NCNA 3HTLX 1YN7A 3ULVF 1EFXD 1JK8A 5DHVB 4ZOBA 3LNFA 1NUFA 3KLLA 2WQAA 4OTXH 3ABLB 3T65A 4PGJA 4LSUH 1JXFA 5HJ3A 1M57B 3FU7B 2QADD 1FVDB 3WS3A 1CFNB 2JJTC 2JKIS 1PLAA 3A6BH 5D5MF 4C56E 1T0NA 1SJHB 3ULVC 4WTZA 4GAGL 5F7YC 3U0WH 3E6HA 3A4DA 1EAOA 1FYTA 1O6SB 2D3VA 2H1LM 4L2LA 3NBNA 3HC3H 2E7LA 2ADIA 5I76A 5F1NA 5GPRA 1E90A 1EXGA 3TV3L 2WHVA 3GMRA 3KH3A 3NEXA 1HQRB 3UBGA 4A63A 1A25A 4OGAD 5H94B 2YUXA 1K8DA 3MCKA 3WJLA 1G1CA 1S7UB 1E4KA 1UFGA 1ET5A 1GYUA 4NQCA 2B0SL 5D9SB 4APXA 1MFDL 2FDBP 4JRFA 3W0WB 4Y9GA 2OP4H 4ZS7H 1PU0A 5JHLA 3HJEA 4X8JB 3VXOA 3GPEA 1TTRA 4C55A 5AAPA 2O5ZH 3VE0B 1KTJA 3D09A 1EMTH 1MRDL 4YHZL 1UZ6F 3V8CA 4KHXL 1U2CA 4F7EB 4XPGH 4G7YH 3KJ4C 2CO7A 2VXQL 3CXDL 3NRFA 3VXMB 1A3ZA 3VMPA 2P48B 1NGYB 3NIFE 4A7GF 3RIFK 4JZJB 3OF6A 4LEOB 2NYYC 3LN9A 3RAJH 1SFHA 4P3DB 3W0WD 4BQ8A 4FQIH 3SBRA 2C3HA 4PLKD 3HN3A 3IDGA 3EW3B 2ORBL 1M71B 1ETJA 5FKAA 2E8ZA 3L17A 1EH9A 3SOTA 4MNQE 4XXDA 3P9WB 4PFEA 1FSKB 3LIZL 4IMLA 4D3CL 2BHFA 5DURB 2B8OT 1A8ZA 1QWNA 2ZPKL 1AS8A 3Q6GL 2YJQA 4Q7DA 4MA3A 3IDUA 2Q3XA 4HKZA 1UCTA 2DM3A 3IJYA 4Y4KC 3VXMD 4HJJH 4N1HB 1C08B 2YGPA 4DN4H 2L8AA 3IRPX 1HOCB 4WTXA 2WZPD 4L8SC 5HP5A 3WEMA 3RTQB 1B3JA 2NZIA 1PZ3A 3UADA 4YL9A 3CFUA 4F7PA 5CCKH 3BQUB 1RK1A 4GUPB 1JDDA 5BW7C 2OKMA 2OZ4L 3SDDB 3D50A 1C16A 4YNYB 3B2UC 5DURD 1ASPA 2XN9B 5FYKU 4N8PA 3WELA 1BBDL 1AGEA 4P57B 1E67A 4QD2E 5GSRB 1ETB1 5D5ME 4A7VA 3H0TA 2WLJA 2EE0A 4NN7B 3LZFL 2JJUA 5IB2A 1CXFA 2E9JA 5HVWA 5B8CB 3CFCL 3ILPA 4I1RA 4PREB 3RTQD 4EUPH 2PXYB 3PGCA 3UAEA 4AM0A 1GIGL 3AXIA 3VCLA 4LCCB 1JK9B 5A3IC 3BQUD 1OQOA 4OLVL 3SDDD 4CN1A 5E94B 1U8MA 1LP9F 1YN6A 4HPYL 2XN9D 4XB8A 1X44A 3MLXH 2ZUUA 1T04B 4RMBA 1ZHNA 3QJQB 3LD8B 4M56A 2HKAA 1DBKL 2TSBA 4G7VH 4IBSA 5AW4B 3SN6N 5GGSY 1GPOL 2VZ1A 4ATWA 1EXUB 3QUYC 2Y7SA 1VGKA 5FDWB 5DRXB 2GC4C 2GC7C 4XMVA 5DGQA 4NN6B 4BQCA 2K9FB 2PXYD 1F6LL 3P4OA 5D1XC 1N7ML 2WUCH 3AY2A 5KG9B 5GGUB 1QO3B 1AOHA 3G6JB 1FO0A 4LLDA 5I74B 4H1LB 5JMRA 4PRIE 4PV8B 3FB6A 5J3HD 4WI0B 4ODUA 4HJIA 4QHUB 3GM0A 1R5VA 1UZ6E 1KNOB 1QSEB 3MCLH 5E9DB 5HHOE 4GP5B 2AF2A 1T5XA 1WDAA 3CCHB 5FUZL 4XVTL 5AOKA 2QQKH 4R8WL 2ENYA 4LMQI 4PVBA 4XO8A 3AACA 5KAQF 5EU7C 3IGKA 2V4LA 3E8UL 3KL3A 3HPJB 1II4E 2IWGA 3CFJA 3VFPB 4R90H 1YUHB 2XWJA 3NA4A 5TPWH 4PJFF 5AKVA 5EBMA 3IETB 3T77A 4F80A 4UT9A 2BFVH 1P1ZB 4ZUSA 5CS7A 4EN3A 1B2WH 2H0JA 4GP4B 3PG2A 2Z4QA 4FFYL 4MVBD 4W70A 4TSAL 4NHUB 4ICXA 4MCZB 2F19L 2A83A 2M2DA 3S4SG 5D2LB 1QLEH 4A66A 4M8UA 4HH9B 3BZ4A 1P7KB 3DX9B 4B9YA 1N0LB 3ML8A 3S6CA 3CVIL 2FX8H 1YHPA 3LXUX 3HG1B 3BN9C 1HYSD 4OLEA 3UEZA 3QVAA 2E76C 3SBWC 4KJQC 4PB0H 3F6JA 3I6GB 4K5NA 5L88H 3WE6A 3T3MB 2AJYL 1RZKL 1XGZA 4H13C 5DWUH 3UOAB 3LNIA 4OQTA 3HZMA 4UOQA 5ICYB 3VYPA 1D5ZB 2KUTA 1JDCA 3GGWB 4HC1L 4NPYA 1I3VA 4NT6A 2NZ9C 3O41A 1T89A 1THCA 3QWOA 2VLRB 3HZVB 1UASA 3T6VA 4YSEA 4BRVA 2V2XB 3O3EB 3DDGA 1M05B 1FFQA 4GG6E 3HG1D 2V7HB 3KDMA 4GT0A 4D7BA 3SGDI 3ULAB 3ZX1A 5DJ6B 3BYTA 5JHMA 1WS7A 2HX8A 1LP9E 2WIMA 5ETUB 3DI3B 2N56A 3ZLQC 4XC3H 1BAWA 2Q8AL 1U6AH 2BC4A 3EO1A 5D1XE 3S5LG 1JFQH 5DFTA 4OI8A 1A6TB 3WNNA 4HHAB 2VLRD 5TDOA 4FQ2L 4UB0L 5CD5D 1A21A 1M7DA 3S37X 2BWDA 5T5FH 3KH4A 2IAMB 3SE3C 4QOKE 1HE7A 1GSKA 1PG7H 1TQBB 1TFHA 4DP0X 5GGSA 3ZIMA 1F86A 3MLYH 4LLMA 3CSYA 1NAKH 5DJAB 5C0IA 2AITA 2VLKA 2HFGH 3OKDB 4MX7B 5EIIG 2FX7H 1IC7L 2V8LA 2WINB 1Q4NX 1S3RA 2BIHA 2UZIL 2GVYA 3BEWA 3DPBA 1MW1A 3ECBA 4XVUC 1RJZA 1ASQA 2IGFH 2CKBB 4BKLA 4Z77B 3OV6A 4U1KB 2EQDA 5C0EB 1NOFA 2HVKA 1S7SA 4ADGA 1WC7A 4R0LC 1TJIL 1NMBH 3C5ZA 3L3DA 4XVSH 3V0DA 1MRFH 2IAMD 1AHWA 1MXDA 5TK4A 1I8KB 5EU3A 5IROC 4O02L 5BOZG 3QUXA 4PJFE 1HH9B 3KM2A 2YAOA 3UBXG 1MLCA 1SDAB 1URLA 3SKNB 2PN5A 3CZJA 4GSQA 5L2KA 1DJXA 3TASA 1BQSA 1M6UA 2R56L 5ICUA 2LR4A 4TNVF 2GK0A 4M7KH 3WLWD 4DPRA 1RUPH 3O2WH 3APFA 1VDGA 3TYGL 2A74B 4CSSA 3L4WA 1LWHA 1TYJA 4LSRH 4G9FB 1MCOL 2CK2A 3JV4B 4LVHB 3WTXA 3BHBB 2PCPA 3OKNB 5BZDB 1QRKA 3TH2T 1QLRA 4P5TD 2QQQA 1QBLH 3F7VB 4YSUA 5BJTB 5C3LD 3E9UA 2OXHA 3DHJA 4OZGA 3SDXA 2BSTA 2A0LC 4XNZB 3IDXL 4Z0BL 1R24B 3EJCA 2EIJB 4AQEA 1FZJB 2F5AL 2NR6C 3F58H 5LXVA 3GHEH 3BH8B 4L3EA 3OSKA 4OJYA 4RFEB 1FZKA 1IB5A 1GC1H 3Q3GB 4OD1L 3APNA 2OTPA 2R8SH 1K4CB 1SQMA 4G9FD 1A3RL 5DQJA 1AE6H 3ZHFA 2IPUG 4HWZA 3RL1B 4TYUA 1CGXA 2AHIA 1I1YB 1Q0YH 2CO1A 5T5NG 5DD1H 1GR7A 2FBRA 1IAIH 3I3EA 5C0DA 1Q94B 3IYLW 4LCIH 3M7FB 5JW5B 5FHAL 1NCOA 5INCB 2A6DA 4Z7WF 1YDPB 3L3HA 3LKNA 3GK8L 3GO1H 1T1WB 5GISH 2L3BA 2DLTA 3PL6D 1TETL 2G5RA 3AW5A 4UTBL 5FPIA 3BH4A 1HVXA 3HVNA 3RKPA 3RUGF 4J8QA 1OT2A 2AXHA 1ACCA 5DJCA 2W0PA 4ETYA 5KS9A 1W0WB 5EO1B 1W2KT 4LCWE 4CVZB 5KSBF 3IU3B 1L9PA 4ZPTA 4BELD 1J5OH 4ZK8A 1IEBA 2XCMC 4L37B 1NCBH 4WJ5A 3AZUA 1MCEA 3HS0B 1BVKB 1UD5A 5GGRB 3B8SA 4FQQA 4LDEB 4I0PB 5GGQL 4DGWC 3NGBB 1WA0X 1DBBH 3ABZA 3I6KA 4JFXA 2NXYC 2GYSA 3KYMB 3X13A 3WMSA 2P7TB 1HXKA 2NY5H 4KTYA 1EDYA 3KJ6H 3AQXA 3U30B 3O4LE 3VFMB 2XYCA 4GI8A 1J1OL 5F9WB 3BEVA 4FZ8L 5HYJA 2EE6A 4OB5H 3ZIYA 3I9PA 1UJ3C 3N6YA 5JYLA 1Q9LB 2JV6A 3E8VA 1IQDA 3G5YB 3GXDA 4BA8A 4I0PD 5SX5K 2VC2B 5CR1A 4AW4A 5GRYA 1JHKL 1D6VL 4X4XB 4PI0A 2RJMA 4HCRA 4B50A 4LQFH 2PR9A 5J4MA 5K9OB 3I84A 2VN4A 4GFTB 5T1MB 2XY2A 3NH7H 3B83A 3D39E 2QKIA 5EO9A 1WA1X 4NKIL 4UQEA 5F7WC 2B2XH 3KPLA 4JDTH 2W92A 1F2QA 1F56A 1F6FB 2FK9A 2FLBT 5CHNB 4NSKB 3BPNB 1BVOA 4ZO8A 1CZ8L 3DTUB 5DHDA 3FTZA 3QIWC 5IMLA 2DAVA 2DQHH 3L7EA 5DU7A 4R7NA 4HIQA 2AS5M 5BRZA 3VI3F 1G4MA 2VAAB 4M62L 3DUUB 2FO4B 2LAAA 4OM1L 3N2JA 2MCPL 2UY6A 3IGLA 3UO1L 1A6WL 3V0WL 4ZS6D 3FB5A 5JHDB 3RX8A 4AVKA 5KBKA 4WCYL 4NZRH 6TAAA 2HVJA 1UM6L 2APBA 4E9WA 5KJRH 1MCLA 3KPOA 4H5SB 3SODB 1IZKA 3I50L 3RJDA 1HILB 2D0FA 2VQUA 3PJSB 4Z7WE 1U3HB 2J6EH 1MJUL 3LEXB 4CADB 2AQTA 1GS8A 1XF5A 2A9NH 2X1PA 3H4HA 3UBXI 1FVCA 2Z1PA 3SE9H 4Y2NA 4LIQH 1F8TH 5FCUL 1G7LA 1H8SA 5G5DB 2FHFA 5GS3A 3RUGE 1K9TA 4UYQA 2F18A 4NENB 1O9WA 4LHQB 5KSBE 3BVWA 4PUBH 5K9JL 3AJ7A 3ESMA 2FGZA 3SYQA 1BLNA 1E9OB 3H9HA 1TEFA 1V7MH 1M42A 3KYKH 4I5BB 2JB5H 4MMYB 4X6CA 4LVNC 3L5HA 1U3HD 2VQ4A 4Q9BA 3BDXA 1ZANH 12E8H 2YQBA 4RH4A 3BUBA 4XO3A 4Y2DB 1EDHA 5SV3A 2EP6A 5FA4B 4ZUVB 5KN5B 2HRGA 3PIQB 3HAEA 2Z3FA 4N2AA 1CBVL 1DN0B 2P5WD 4AVJA 4N8CH 2BP0A 1ZVYA 4X80L 3S8FB 3KVDD 4Y4HC 3C6LA 3VSUA 1MNNA 3P0GB 3FQXA 5FM8A 5B3JF 3TWYA 1WEJH 5TH2B 1YZZA 4DEUA 3OXRB 1JGIA 2FGWL 2K3TA 3QEQB 4Y2DD 3NJLA 5EC1A 1FGNH 1A7RL 5I82A 2J88L 3WJMB 1L7TL 4I48A 4AEHL 3Q48A 1V05A 3KPSA 3ULVL 3PAZA 4JFDE 3MJ8A 2MOQA 2XTJC 2ATAA 3HE6C 1DDHA 1D6EB 2WQRA 1P6WA 2ZG1A 4OGYH 4DSYA 4ELMF 2X4UB 3BESR 4I87A 2XKNB 1ZSDB 1XQ4A 2OMWA 3MYZA 1NGPL 1FVEA 3NEOA 1FLTX 2DTML 4PRPA 2NTFA 1YCSA 1KTCA 2CXGA 1URZA 2ED7A 3ARBC 1OAQL 1ZJAA 3HG0A 3QEQD 4I3RH 5HTSA 2Q86B 2DLFH 3OB0H 4WWKC 4FZEH 3ETSA 3LY6A 1T3FB 4HHWA 4W4OC 3SSGA 3X1BA 4BFNA 5EF2A 3CVCA 5DHVH 3RHWF 2HJKB 4BCXA 2A9BA 4FHJA 4XXWC 3FO0H 1PW3A 1X6LA 3HUJF 3H9SB 4MLIA 5CSZA 2X09A 2Z9TA 3PV6B 4F7CB 1AJ7H 4AXWA 4Y1AB 4R26H 2Y1YA 3FKUS 1D5MB 1KLGB 4ZAKB 4Y9FA 1WBYA 3L3JB 2PWFA 1YECL 3Q2NA 4BH7B 1KWGA 5HYFA 1ZAGA 3GKWH 4LKCB 4E9SA 2EDWA 2JIXB 4OZIA 4ISVB 4I8DA 3H42L 2GSMB 3U1PA 3FU0A 5DTFB 3HI5H 4JNXA 4UTAH 5DZJA 2HFTA 4E41A 2R0KL 1U0QA 4YBLB 1AD9B 1G94A 4L8DA 1SYVB 5AB2A 2V9RA 1FL6B 4ODHL 4P2QD 4WFFE 1VENA 4NHCL 5AVXB 3X2QB 1UWGL 5I24A 2PP9A 2Y1VA 3P3SA 2VR6A 4ZAKD 5HDWA 1KJMA 1M1SA 1MH5B 4X5WA 5IJCC 2Y7MA 1M3JA 5IWLC 4HIXH 1I8UA 1OZTG 2WCGA 1BCIA 4O4YH 4OD3L 4TUJA 2ZAIA 3GIVA 2C4FT 4MAZA 4EI5B 2JIXD 3L8QA 5HHQB 3WDIA 4HFUH 2D3JA 4MMZA 1HESA 4QNPF 2DQCH 2IIJA 3IGUA 4KK8C 1FZOA 5C08B 2G2PA 2BO0A 2VLJB 1XO8A 4N0UB 4YSOA 3N06B 3FF8A 3OAZH 2J8UB 5JR1H 3A6CH 2R83A 4KK5C 4XBGB 4ONOA 1ZLEA 1WTGT 1J0YA 3H7BB 5DFVD 3WIHH 2PABA 5LG6A 5E2TH 1RLWA 3L3IA 4JFPA 1DDTA 5A43C 5PCYA 3AVEA 3II1A 5KVFH 3A24A 4M3KB 4GW5A 2IC2A 3MRRA 4MQSB 1IMHC 2HTKD 2APWA 1B4LA 4JHAL 4EI5D 2R2BA 1WUNT 2FT8A 4KWUA 5B3JE 2XTJE 1YJDC 1RPQA 1SEBB 5C08D 1M6OA 4R96B 3JV5A 5DYOB 1FFRA 1ADQL 4CSZA 4K55A 3HFML 1DQJA 3WFCL 1L6XA 2YPVH 1YYMH 4JRXB 4QHKI 1KGWA 3QNYA 1XWVA 4YH6A 1NCIA 3IVKB 1MCBA 4G3YL 4X6DF 4EUPA 1UM4H 1SLVA 1VFUA 5I1KL 2Y1AA 4YFLF 3TJEH 2B9BA 4ELME 1Y18A 2GUOB 4YGVB 1S7VB 3KDPB 4ZFZB 4O51B 1UURA 4NRZA 4P2YA 3SJVA 3ZXAC 1J12A 5ITFA 1RULL 3OHXC 1OGTB 2HH0H 1PZCA 1W15A 5D55A 4BZ1L 3N1FC 2FSEA 2WV3A 4PJ9A 3KPQB 1S6NA 1XFPA 4P4RA 4JM0A 1FFOA 3TO4C 3PS6A 3HUJE 1OK8A 2FWSA 5TE6L 4JRXD 5KYUB 4B9FA 1IBGL 1O5PA 4ONHA 4DGVL 3BGAA 2I07A 4HWEL 1DUYB 3FOMB 4IBUA 1DR9A 5DRZA 4M6OH 4JZNA 3HHSA 3VXME 3GSQA 1YY8B 4KKQA 1B2YA 2BY3A 2VLLA 2Y7QA 3QFDB 4XNUL 5J12B 4KKZA 2G2NA 4OZHF 2L7UA 2VB5A 4XGZB 5F89A 2QV4A 4G5ZH 1OCWH 2FECI 2J2ZA 2EICA 2NNFA 2YEZA 5I6OA 5TQ0H 4ORGB 3IU4H 2X2JA 2HMIC 1N4XH 1QSFB 4RGMB 5I73C 1QTPA 4DOHB 2JCCB 4QRPE 3UJTH 1QFUH 1MUJA 2FEJA 4IRSA 4K7FB 2DQEL 2QJDA 3ZYZA 3DV4B 3J07A 3KXFB 2X6UA 3QI9B 5CP3H 3VM7A 4N8VB 2WOYA 4FTDA 2EDTA 4WSJA 4LP5A 4UBDC 2R1XB 3ZRFC 4QNPE 5D7JB 3E0GA 3EYUL 3LXAA 3WKNA 4H1LH 3INOA 3ETTA 1E40A 4HJ0D 3ULSB 3FTWA 1NDGB 3RA7L 1JNJA 3CG8A 1QSFD 3G5WA 3AXLA 3T3MF 2KLRA 4ODWB 5IUSA 2LU7A 5IY5B 4LASL 4XNMB 4CC4C 1XSIA 2EEBA 5FECA 3MV9A 3CN3A 3KXFD 3QI9D 4NM4H 1U93A 1BEXA 3IT8D 3TEUA 4AZ8A 5D71L 1N5AB 2MIZA 5D7JD 4J3WA 4NPKA 3ZDYB 4ORZC 2Y69B 1RD6A 2VMEA 5AVQB 1A2YB 4G8EB 3JBG7 2PPEA 2X1QA 1VCBC 3ZT7A 4JDVA 2BHYA 3C2AL 3WEXB 3FS9A 4DFHA 4BFOA 3RNKA 2BMKB 4JFVA 5GHWL 4R4BA 5K69A 2AQ1A 2BIOA 1RIUL 4X6DE 1Z9MA 3X1FA 1DTUA 2Y36L 1OK0A 4RWHA 3US9A 3QNXB 3PWUB 3FT9A 4BH8B 4ZX4A 4AL8C 5BXFB 2W9LA 2XN0A 3D34A 4H2CA 4YR6A 2VM4A 3STLA 4HKBA 1IKFH 2IEPA 1G9HA 2CHNA 1W16A 4PR5B 1F1AA 2DYRB 5E0FA 1QVOA 5T8IA 3EJUA 2O30A 4I9WD 3UBHA 4R7XA 2VKXA 4NO0A 1SM3H 1UXMA 4PJXB 2WLIA 3CUPA 1Y07A 5I30L 1QSEE 5E9DE 1OB1A 4FS0A 2N7AA 4J3OG 4UQ3A 3DIVA 1IGIL 1YEGH 4UIMA 5JMOC 4MQXC 1ZVNA 4ODBD 4PS7A 5IVXA 2LLNA 4KTGA 3REWA 4FE9A 2Y2YA 4N2MA 2VMCA 4RAUB 1G0XA 3SCMB 1JERA 3LQMA 3QPQD 4OZHE 3X1EA 3T09A 4J6RH 5MEQA 5FGSA 3AB0B 3QORB 3K8LA 4Y4FC 2ICWJ 3RDJA 1MHCA 1KCRH 4U4IA 5ALCL 3BKJH 2I25N 4HDIB 1NIEA 4HD5A 2ZXBA 4JN2B 3FT4A 2DIJA 4QHKJ 5EA0H 4JFEA 2ISDA 5G55A 3C08L 3ZDXF 1FL5A 3H3BC 4AUYA 3GD1C 4KHXH 5EOCH 4PGDB 3A22A 5F6HJ 5FFLA 4GPVA 3FQYA 3X12A 2EDMA 2Z92A 4OSUH 4KOBA 3SCMD 2DMHA 1HH6A 1X5AA 4XMWA 2AK4A 2O6DA 4CN6A 4PRDB 2A74C 4Z0XA 3GWJA 3QORD 5I5RA 4B97A 3D2UB 4R7LA 4LVHC 2KC0A 4HPHA 1J8HD 3T3ME 2A5UA 5GGTH 3RB5A 3T2PA 4TNGA 4ZQKB 2VDLB 2VJXA 5B4MD 2OL3L 5H37G 3EYVB 1GGTA 1Q9WB 2WMPA 1GW0A 4FXTA 2P8MA 4HT1H 1ZK9A 4QCIA 5ES4B 5FLVA 2ZPKH 3OZ9H 3Q6GH 1DYZA 4M02A 2CJ3A 1XT5A 4FFTA 1QW8A 5E24E 1HK6A 1F5WA 1M1XB 1ZT1B 2EO1A 3QQNA 5IHZA 5DHMC 3S48A 5B1JA 4POUB 3MJ7A 3QYCA 4YK4B 4ZUWA 2YBGA 3V4VA 1T2QH 2DQFA 3FHAA 3E2HC 1G1YA 3GZQA 2OZ4H 3VXUA 4TNFA 5HVGB 2FNBA 2PPAA 1RURH 3QGVA 3QDMA 3PXHA 4AV0A 3R06B 3GTTA 1QYGH 4GBXA 4PYGA 3CFDA 4XXCC 1QHOA 1NBZB 1QFWI 4KXZI 4QHNB 4GSXA 1P5UC 2EDLA 1TVBB 3M1BA 1A1MB 2MQGA 4P5KA 1NPUA 3VI4A 3BCFA 2FQEA 1XIWA 3GSNB 5F0PB 5D1ZA 4ZZFA 3IDYC 3MRQA 3QHZL 4J5VA 3QNZB 3W2DL 2VH5L 1I9JH 2FIKB 4ZTOL 1GIGH 1QR1A 3HI1A 4HIEA 4MJJA 3BVTA 4IJTA 4BSVA 3OLDA 5DGRA 3WMPA 3MRGA 2UY7B 1G9EA 4WI3A 3HS0C 1GCFA 2OMZB 1BG9A 4XVJL 4HPYH 2DIAA 4XPTL 1ID5I 1F11B 1SXNA 2R51A 2VXSL 1KG0A 1ZXQA 1ZVHA 2DEYX 3NFSL 2OSLA 2R23A 5F1SA 4MDJB 4GKOA 2E7DA 5LHDA 3FN0H 3WJJC 2ZWZA 3VFSB 1JNNH 4GS7B 5AW3B 1DO6A 2XZQL 5D7KE 3TJPA 1L6PA 1TVHA 2FNWA 2PYEB 5ISZA 2JQZA 3QJTB 3NZ8A 1N7MH 2YUWA 4QHLB 3PP4H 4RBPK 4CVUA 1VESA 3WY1A 4MS8C 3NZHL 2IWFA 4PJ8A 3ZDXE 3TN0C 1H15A 3ZL1A 4HOXA 5I6KA 1AQHA 5CO1A 1VFBA 5FUZH 2CLZA 4FQCL 5DMGC 3BC9A 2XV6B 2YGOA 3FT0A 2P80D 2AVGA 1PG7X 2WNWA 5C07B 5KBNC 3D0LA 4N0YL 4B9KC 3I6LD 2PYED 3B8YA 3B9KC 2DEWX 2KZKA 4JFWA 3WDHA 1SZNA 4J6IA 3WNJA 5C9KA 4YFEA 3LEVL 1ED3A 4FFYH 2R2HA 2XJLA 3G6DH 4W6XB 3QWRD 3NCWA 3B2MA 4ALAH 1SHMA 4F33A 2BFGA 3KGUA 2PF6A 2Q6WB 4QLRA 4L3CA 1JPGB 5AW7B 1ZT4A 2ZUWA 1HSBB 4YE0A 4WWPA 3DOSA 3BVUA 2NT1A 2PO6C 3IPFA 3L5WA 3OMIB 4H0GA 3DJRA 4QRBA 5IBTL 2IWKA 4FULA 5C07D 2ZE0A 2XZCL 1Q0XL 4H26B 5B39B 1VRSA 4MZIA 1J1XH 1G87A 4IKKA 1TJGL 3BWAA 3T8XA 1KZYA 1JHLH 1EXHA 4PVNA 4P49A 4HX1B 2ZOKB 2HLFD 4N0FB 1JI2A 1AO7B 3MJGX 4FJYA 3LN5B 1QLFB 3IDIA 4UDUB 2J6EA 4I4WA 4PM1A 2XFGB 1L6ZA 3L9EA 4PV9B 3CX2A 3C5JA 2B3IA 4HC1H 2K7QA 3GM8A 3JZYA 3OJVC 1AMYA 3UGEA 4OCXH 5D7HA 2WBJB 2P52A 4JJOA 2GFBA 4R4NC 7FABH 2HPTA 1CD8A 5DUPL 1HI6B 4Y2OA 1K3IA 2EYTA 3RFZB 3MACL 5JPMB 5DVKA 5DA4A 2WGXA 1JZ5A 1L9OA 3SE8L 3MR9B 1AO7D 1MVFA 4D8PB 2VJ0A 2JJWA 3CHQA 4R5TA 5C8JB 1CGWA 1OT4A 1INDL 4MXVF 4PGCA 5I1DB 3MRDB 2Z93A 1OGAB 5I71C 2OFQA 3QZNA 4NO2B 3RZCA 4G80A 1EEYB 2IQ9H 3QISA 4F57H 2ZD0A 3LNGA 3DX0A 3Q0HA 4PJAB 5F88A 2X53A 4MJ6A 5C86A 1DVXA 5KVDE 4Z3TA 1MLBA 4ZW5A 4RNRB 4Q9QL 2CM5A 1AGFB 1SY6L 1OCCB 4X83A 3TWCL 1JVKA 3NEEA 1WUZA 4WDIA 2AEWA 2UZIH 4XCEB 4G2AA 2DBJA 3WKMH 5IEKB 2GY5A 3FQRA 5BOJA 3NAAL 4C8XA 5DS8B 5FW6A 2AK1H 5SX4I 3PWVA 2ZAGA 2ALWA 1IV8A 1XX9C 2UXTA 4LSVL 1TJIH 4G59C 4IS6A 2QGBA 2WQXA 1Y0LB 4WIQA 3MLRL 1OHQA 4ZMLA 1LL1A 1CI3M 2YPLA 4JN1L 3QWQB 4UV7H 2QSTA 2K6YA 1X5FA 2XOTA 4AJWA 1H3VA 4IJ3B 3DGDA 3WTVA 2R2EA 3BO8A 5HI4D 1CDJA 4KK6D 1XZ0A 2VN3A 3N43F 3V0GA 3GBNL 5A16B 3INUH 5IV2B 4QR7A 1HYRC 1F41A 2QSQA 5JHDE 1EHLL 1J8SA 3BCDA 5JUEL 1NMCB 4LNRA 4RGOL 3TBVB 2VJ8A 1EHXA 4QJ3B 3KW7A 5FFGA 5L4IA 1I1CA 4G72B 1S9KC 1OZUA 3F7YA 5DUMH 4N9OB 4OIBA 5KBPA 1AZNA 3FU7A 5F6IB 5CGYC 1AZVA 4ODSL 5TJWK 4NKDB 1E43A 4NO5A 1VZIA 5CFHA 2F5AH 2V9QA 3Q5TA 3JTTB 5JOFA 3BE1H 4FMKA 4CN4A 1U2HA 2AJSH 1CE1L 1HQRA 4APQC 1EBAA 2NT0A 1A3RH 4YDJB 1IC0A 4ONGL 4YBLC 4TSBL 2LABA 3FTGB 2D03H 3ILEA 4PRHE 1ACYL 4H0LC 2BP8B 2DDQH 1S7TB 1NLBL 1P7QB 4M7ZC 3ARVA 4KX7A 3VQ1C 3L6FB 5JOPE 3GK8H 4L3AA 4BQ9A 2H3NA 4PW4A 5C0ND 2JKTM 2ZXQA 3NN8B 1JPSH 4MXVE 5EEUA 5CN2A 3C9NB 3FTVA 4M1GL 3L1OL 3BAIA 2JKSA 4LOUC 3VE0A 2BXZA 4YHOL 2DJMA 4U1NB 3SQBB 4GI6A 4N87A 3G5ZA 3EAKA 4NDMA 2I85A 1CQKA 5J6SA 3WIHA 3WV0A 1P7QD 4PWHA 1JZ2A 1XB3A 1IRAY 4PJ7B 5HGDA 3S5YA 5KVEH 2EDEA 4JZJA 4IHBA 4TULH 5F8RC 2WZPA 2CIIB 1OW0C 2PWDA 1RP8A 1CD1B 1D5BB 1UKSA 4YDLB 2YGVA 5AOJA 1M71A 4RIRB 2B1AH 4A2LA 5I15H 3KPNA 2HYMA 1QBMH 2X9WA 1BJ8A 1YJDL 3JWOH 5L9DH 5K59F 4FZ8H 3FO9B 3O6FA 1TNNA 2IH8A 3TC9A 1JGUH 5JIHA 4XR8C 4A7SA 1KGJA 4UCFA 3EOAA 5F7MC 5JIKA 3ZT6A 4OFPA 3M1CA 4NNYA 1HOCA 4JM2C 1JHKH 1D6VH 1R33A 3KL5A 1YY9C 3Q9PA 4FTVB 4XNYH 5F3HB 3H9SE 2GUYA 4EDWL 2H2SD 3QXAB 4Y1AE 5HJGA 4ZW3A 1FIGH 4FQXA 1S8DB 2I5YL 2Z31A 1C12B 3BQUA 5K93A 1NKRA 5K9KB 3QO0A 1FHNA 4NKIH 2YHGA 2GIMA 2R1YB 3BPCB 4L4TA 4Z18A 2XN9A 3P40A 1IGTB 1JL8A 4JG1H 2B9AA 4TSCH 5D4JA 3T6WA 3VFRA 3QWNA 5GSRA 1ZT7A 3IJSB 3BISA 1YRKA 4MA8H 3P1VA 5DT1L 4X0NA 2H1PL 3SGJC 1ZEAL 2YXVA 3ROLA 5F7UA 3L2LA 4JZOA 3NCEB 1E9PB 4PREA 1Q8MA 1BYNA 4M62H 1G7IA 3U0TA 5CP7B 4AW7A 2OMVA 2MCPH 1QTSA 1A6WH 4H8WL 4WTQA 4ODXB 3RNQB 1YSOA 3ILQC 1HC1A 5E94A 2ZX5A 5SV4A 1SBBA 2DM2A 1UM6H 3VWKC 3VH8G 5EDSA 4NJ9H 5DZPA 3I50H 2ZYSA 3K6DA 1FH5L 3GXIA 5KYYB 2O93L 4BIKA 3VXRE 4QRSB 1MJUH 3FZUC 2NNAA 2VLJE 4OGQC 5J13C 4EBQH 2J8UE 4F15C 2R0LH 2Y07L 3CFEA 5FDWA 5CP3A 1AKJB 1I8IA 1A7OL 1GYCA 1HL5A 2EDBA 2V3EA 1DQVA 4U1GC 2JLPA 1SHWA 1IGFL 5KG9A 1KCVL 2HT2D 4UILL 3UYPA 2IADA 4AKPA 2WTRB 3ECVA 1XF2B 3L1FA 3G6JA 4G5AA 5K9JH 4J3OC 2HFFB 1OAUL 4WI0A 1UUNA 1L9TA 3QIBA 2JQAA 4MMXB 5EWIL 1XB8A 4L3FA 2EXWD 1VFAA 3AWEA 2BRRL 4X4ME 3PABB 3C60C 3BUQA 2BOCB 1R19A 3OJ2C 4ENZA 2GPZA 1Q1PA 3QRFM 3QUKB 3H53A 4HIIB 4OF7A 1PNCA 3LRKA 3RX5A 4BFIB 1AKJD 3U6XS 4UOZA 3KBEA 3CZGA 3IETA 3MBWB 4JRXE 4ANVA 3TIDB 4NHUA 5C9JB 5K59E 2WP3O 1FCGA 4FYRA 4BUHA 2H6PB 1YAIA 4CKQA 3TA3A 2GAZB 32C2A 3TBYA 1FBIL 4TTGA 4PWGA 1XH1A 3B2DC 1WBXB 1WZAA 2FATL 1P7KA 2BK8A 4WW1B 5IHUH 4OLYH 4WF7A 1DBML 5JO5B 5LXGL 3EOBA 1A7RH 3HG1A 3QDHA 1MCQA 1J0HA 4UT6L 2P43B 3FFDB 3HE6D 4HUCA 1DLHB 4GSRA 5ABDE 3I6GA 5C3TA 4J3SA 3V4PB 4IIQA 4AKOA 3P2BA 4YXHH 1W72B 4JM4H 3ZE1F 4BWUA 5ICYA 1CJYA 4V1DB 4YSQA 5F3FA 3V6OC 2DQJL 3GGWA 1DVQA 1XXDC 4WWKD 5LGHH 2VLRA 3A3YB 4J23A 3HZVA 3LXCA 4DP4X 1VKXA 2DTMH 4GXUM 4PLJC 2V2XA 1CFTB 2Z7WA 1OAQH 4GG8B 3EBGA 3O3EA 4N5EC 1M05A 2FQDA 2HUEA 2OCFD 4U4BA 4F8TA 5HXMA 3SDAB 2V7HA 1AH1A 3RWFB 1JVLA 3D07A 4FHBD 3CDZB 4BFJA 1P6AB 4DOHE 4NP4H 3Q01A 5AENA 4B6ZA 5DJ6A 4BXSV 4XOBA 5HJDA 1Q90A 1PZBA 1PDKA 2EKSB 5ECJE 1JZ7A 6PCYA 1OPOA 5I0DA 4GO8A 1YECH 1X5XA 4V1DD 1OAZH 1VLXA 4O2EB 3WFZA 3RWEA 3NJFA 4PGZA 5AD0B 3AM8A 3EH5B 4HHAA 4PJDF 1BG1A 3LVTA 3H42H 4FL4B 2ARJQ 3MREA 4BWTA 1WD9A 1WGVA 3PQYE 4WJKB 1YNTB 3SDAD 2B3RA 2VXQA 4ODHH 2EXYC 2Y06L 4PJBF 5INDA 5A2FA 2VDQB 4EZJA 1V8HA 4MX7A 2WINA 5F9DC 1EJOL 4L1SA 1MQKH 2ZSVB 1IFRA 4U1LB 3H9ZA 1XCWA 1T5WB 4Z77A 1N8OE 4U1KA 5GZND 5C0EA 1RH8A 2Z91A 5GGTA 5A2BA 4HFWB 1JCVA 5ICZA 5AW5B 1ROCA 3CBKB 2CGZA 2E9IA 3I9AA 3LIZA 3NJXA 2A6IB 1GZHA 4BZ2H 4PRNB 5C09E 3AXHA 3KS0J 4P5TA 3QG7H 1HH9A 2VXTL 3JSSA 4AYID 5IBUG 3H2WA 3L2NA 4KTDH 3GI9L 1T83A 3SKNA 3MOBL 4UYPA 3OPZL 4A7TA 5KSVB 3E6FB 1NMAL 4HIJB 2JH2A 2B14A 3QULB 4N0CD 2E75C 3QT2A 2G75B 3SPVA 4EDXB 1VHPA 2VZ3A 1WZLA 4JO4L 3FB8B 4HYTB 2Z0BA 4G9FA 2OZ4A 4HOWA 5EEXA 2W65B 1MFUA 3N44B 1AAJA 5C0CE 3VGEA 3M1OA 3BHBA 4KQ4H 2VZVA 2VDLH 5BZDA 3P0YL 4RSYA 4YPGA 2AI0H 2A9ML 2MPVA 1N5YH 3F7VA 5BJTA 4UAHA 1ADQH 3UIYA 3V6OE 2J8HA 2D0GA 3IJ7A 1G9NC 1GW6A 1KB9K 4GRLA 1G7MB 4NP9A 1T7ZA 2XWZA 5JXED 1MCPH 1KCUL 4ZOCA 1FZJA 1OP9A 3PL6A 4XX1G 4EMZA 1BAFL 5IFAL 4G3YH 3HAEG 3FONB 4KI1A 3ZE1E 2DJSA 3OMAB 1JF5A 4RFEA 3UP6A 3Q3GA 3T2QA 3S9DB 1CGTA 2OSWA 1K4CA 4DHLA 1BQHA 3DTXA 4LP4A 3VMNA 5CUSL 3RL1A 2MJWA 3D05A 1CXIA 3TO4D 2I26N 2OPCA 1OLZA 1U8QA 5JW5A 2QEJA 5FV1L 2GBUA 3MFFB 2WBXA 4PAZA 4S1DC 1ESOA 1Z3RA 4H0IA 4LP8A 4JCMA 2JF1A 1JZDC 3DOHA 3GSNH 3DX7A 4O5LL 5ALBL 4AEFA 3FCTB 4M8QB 2ICEC 2XVKA 5EN2A 3RDTC 4ZFGL 4L0PB 1N64L 4PJDE 2BCKB 3IU3A 4EN2A 4OLZL 1E3FA 4JPQA 3BIKA 2OTUA 5KVDL 1HXYA 3BWSA 3U4KA 1Z9SA 4MSWA 2HMID 5GIRB 5E99L 1U8HB 4G9DB 3P9MA 2FL5A 1IC4L 4OJFL 2XWBB 5HYSB 3LS5H 1AG6A 5F7HA 4PJBE 2EUZA 5LO7A 3CHPA 2XC8A 1Q0EA 3BGMA 4FN0A 5EEVA 1YEHL 5AZUA 43C9A 4OY9A 3KNBA 1OPGH 4OU3A 2Y7LA 3KYMA 2Q2LA 1E8XA 4FFYA 3CSPA 4DEPC 1J11A 5E8DL 3QZOA 5DDHA 4XP9L 2I60L 2O5XH 3UBXB 3OX8A 1LE5B 2OS7A 5DK2B 3GT6A 4Y88A 2I32A 3LZQA 8PAZA 1MEXL 3Q5OA 4B60A 2WVUA 5D2NB 5A6MA 1CUOA 4X7EC 2OBGA 4RDQG 1NL0L 4PVMA 4NNXB 4LASH 4LAQH 4OZFG 2VLMD 2GG1A 2NUTB 2NQ3A 1JWSB 4DQOL 3LQZB 2FECL 1IVTA 2DQIL 3WU1A 3UTSE 3CH1B 4J4PC 2XWCA 1NANI 2I9LB 1TTUA 5CHNA 2JWYA 1GGCL 4X5XA 5IB3A 2Q9OA 4HC1A 3UZVB 5IMMB 4HEPA 2WBJC 2O61A 2KERA 1RZFH 4HIHA 3GINA 1LO0L 2KZ1B 4ZFFB 4NWUH 1RIUH 5I17A 5CEYA 3D52A 1KXHA 5IMOB 3ARGB 3DUUA 2IQAB 3EOTL 3R4RA 4O2FB 3K74B 3CN4A 1YNLH 1JPEA 1U2YA 4NO0D 3VD4A 1EGJH 1F13A 1OY3B 3NQKA 3RI5F 3REVB 1ZKAA 3HRPA 4DN3H 4LLQB 1GZQA 4ADJA 4G6JH