5KBDA

Structural studies of transcription factor p73 dna binding domain bound to pa26 20-mer response element
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
201
structure length
201
Chain Sequence
HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Transcription Factor p73 DNA Binding Domain Bound to PA26 20-mer Response Element
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Tumor protein p73
total genus 32
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kbdA00
4QO1B 2X0WA 4IBTA 2AHIA 2J6WA 5LAPA 5A7BA 4L0YA 4AGMA 2H1LM 4IBZA 3US1A 3EXJA 4LOFA 3D07A 1EANA 5LGYA 5AOMA 4IBWA 1E50A 5AOKA 4IBVA 4LO9A 4IBYA 5AB9A 3US0A 5AOIA 3KZ8A 2ATAA 2J21A 3KMDA 3ZMEA 3WU1A 1UOLA 2J1ZA 2OCJA 5ABAA 1IO4C 4XR8C 5BUAA 2BINA 1H9DA 4A63A 5KBDA 3IGKA 2RMNA 3WTTA 2IOIA 2GEQA 3Q05A 2IOMA 1KZYA 2BIPA 4KVPA 2J1WA 4AGOA 3WTSA 5G4MA 2BIMA 2BIQA 4LOEA 3QYMA 3D08A 3D09A 3D05A 3VD0A 2IOOA 1HJCA 1LJMA 4IBSA 2P52A 4L18A 5G4OA 3WTWA 1GZHC 3D06A 1HU8A 4IJTA 2PCXA 3TS8A 3Q06A 5AOJA 1TUPA 5G4NA 4AGLA 2ADYA 4AGPA 2J1YA 2MEJB 3WTYA 4L0ZA 4HJEA 4G83A 3VD1A 4MZRA 3EXLA 3QYNA 1CO1A 2VUKA 1YCSA 1EAQA 4AGNA 2FEJA 2X0UA 2BIOA 2XWCA 3IGLA 1GZHA 2J1XA 2XWRA 4GUQA 1T4WA 2YBGA 3WTXA 2J20A 4IBUA 3WTUA 2AC0A 4AGQA 2WGXA 5ECGA 5AOLA 3Q01A 1EAOA 4GUOA 4IBQA 3D0AA 4G82A 2X0VA 4MZIA 1TSRA 1CMOA 3VD2A 3WTVA 1HJBC
chains in the Genus database with same CATH superfamily
1NCJA 4OFPA 4N3TA 3UP1A 4PWEA 1J12A 1F45A 3MRGA 2C3HA 1U8HA 3L5HA 4HXAH 4UDTB 1HXYA 4N0CC 3K3QA 4OLUL 3EKCA 3FCSB 1JYWA 1XCXA 4ZPTB 2ADJB 4Z0XB 2ZWYA 5F9JB 3MBEA 4R7NA 1QFPA 3U7YL 4LEOB 3ZL1A 4JY5H 1Y6KR 1JGEB 4XP9L 5DJDB 4C57C 3FO0H 1CLOL 3L08A 3N42F 4KVNH 1J8HD 3VB8A 3BQVA 1FNLA 5F97E 3TYGH 4K94C 2ITFA 4EN3B 2RBLA 4M8QA 4TM9A 4P5KA 3UTSA 5C6TL 1I9JL 5TE6H 3Q2LA 1T1ZA 4KQ3L 2ESVE 3FSVA 4E5XB 3ULVC 2X1WL 5C3LD 2F7QA 3BGFC 3DX1A 4F57H 1IX2A 4R7VA 3G3LA 2AAVA 2CGZA 1SBSH 1MFNA 4YQXH 4YE4H 3TU6A 4YIQA 6PAZA 3NZHL 1WF5A 2D7PA 4W4NA 1XQ4A 2YPKA 2A9BA 3FDWA 3K4DA 4N8VB 1LL1A 1U8PB 4B9PA 2BDNL 5GGQL 3TV8A 1ZT1A 2ZSVB 2OX5B 3CD4A 2CXKA 3MNMA 5EFIA 4RAVB 5EOTA 3FQTA 1U93B 4R7LA 3I3DA 3FK3A 4NRXA 5AD0A 2OQJB 3LKRB 5AENA 4QXVA 3VXNB 1X3DA 4WNQB 1D5IL 2NX5B 4JQVC 2EDEA 3W9DB 1TUPA 2Y3AA 4JKPH 1T5XA 2WUBL 4C56A 8CGTA 4PJEF 1UZ6F 4BQCA 2D0HA 3ARXA 3EFFA 1ZJBA 5IB5B 2FO1A 2A4CA 3F7VA 4KXBA 4BKLA 4CNIA 3BLKA 3KVQA 4GG6E 5E9DE 3SYQA 4WFGD 3VXUB 4UOQA 2I25N 3BPLC 4LSUH 3VGAC 4IRSC 1W2KT 2NQDA 1RIHL 3G6JB 3GRBA 1K4CB 4FFTA 3VM5A 2UZXA 5I1HL 3B9KD 5LBVA 1WHOA 5C6TH 5FKAA 4HGKC 32C2B 2MQ3A 4V1DB 1K4DB 2J55A 5C2BH 1N3NB 3LVEA 3QSKB 1J05A 1FIGH 4HF5H 3VFMA 1BVNT 5F7DA 4BK5A 2GK0A 3AQZA 2LLNA 3ECUA 3KYOA 5GZOA 1GMIA 4BBWA 4M4RB 2Y7MA 3WBDA 25C8H 3BRFA 2Y06L 1OGTB 1S78C 2E7HA 4X6DE 1TSRA 2ZXBA 3GMNA 2J6EL 3T77A 4BZ1L 4XRCA 1A2YB 1XXFC 3F7RA 1O5PA 3P69A 1UASA 1ADQL 2Z1PA 3DIFB 4UT9A 1OXYA 4GRWB 4WUKL 1CFVL 1FG9C 3GRWL 2A74B 5M7QA 1OGTA 4JL1A 5D4HA 4Y19A 5FKPB 2D7OA 1T03L 1FGVH 3OPZH 1G9HA 4NQDD 2JIXA 5HPMB 3ZOAA 1S9YA 4P99A 5G5DA 1J05B 1KC5H 2OFQA 1AIZA 3KLKA 1BFSA 2IH1A 2JB6A 4O02A 3WE6B 2FTAA 4APQA 3RFZB 1XR9B 3L3KB 4CJ0A 5IJVB 3GZOA 2OJZL 4WK2B 4RBPK 4ZMAT 4EI5D 1GZPB 3HZVA 4WI0B 5HXMA 1C5DA 2CGYA 3MZTA 3ZHLA 3KPLA 2FYVA 3L3DA 1J0YA 4JM2D 3IJHA 1SEQL 1XGPA 2CQVA 4BH7B 2F74A 1GIGL 5DO2C 2WXOA 1OANA 1BIIA 2Z7UA 2VT0A 4FXGC 4ZOEA 1TZHB 4XB7A 1KYOJ 1TEYA 4F5CA 3BO8A 3WV0A 5C0IA 5AB0A 5AYTA 2W0PA 4OCWL 2CHZA 3SQOL 1NGQL 1MCBA 5DRZA 3KPOA 4GRLD 3QAZB 3FFOA 3LSOB 4R4BA 2VDLB 3A4FA 1OM3L 4A2DA 1GPOL 1MQKL 2D2CC 4MAUL 4R26L 1MEXL 3KS0H 2DDQH 2IV8A 5IG7A 1YY9C 1CFQB 2J8UE 2YRLA 4QEGA 2FWSA 5B3JF 1BEYH 1KLFB 1NZRA 4PJFF 2N3JA 4ODTH 5HJ3B 3KLLA 3AACA 5CBAA 3F7QA 1YN6A 3FAWA 3JWNG 3L3GA 1GSMA 1JWSA 3QK0A 2D7TH 4NLHA 4Q6IB 1Y1UA 3V0WH 3HG1D 1TVDA 3LMJL 2XWJA 1QD0A 4WWKA 5D7IA 3RKDD 5FCUH 3MZGB 2XWTA 1ZCRA 4FA7B 4UTAH 2GTZA 3G5VA 1J9RA 2WXJA 3O0RL 5E8PA 3WYRA 4JJ5B 3B7SA 2VITB 2ZKMX 2G5BA 4NHCL 5E7BA 1WISA 3BEWA 3II2A 4QRSB 3RTLA 4HOWA 3MPCA 4PREA 3NBNA 4A6YH 1A6TB 1MH5B 4XBEL 2ZUSA 2EEDA 5HHOD 4LB8A 4NQEB 5I1DA 4XVJL 4H44C 4UQ2A 4OBSA 4HUKB 4K4KA 5E94B 1OGAE 2JWYA 4MMXB 2NY2B 4HWUA 1PAZA 3IJ9A 2BP5M 5CUSH 2WUBH 4MDRA 3VNZA 4N2CA 2DI7A 4TOYH 3MXVH 5J12B 3OJVC 2DJMA 3MBWA 1GOFA 3VMPA 1JZ3A 1MFUA 4XVUC 4BA0A 5KS9B 4A2GA 2J8UF 2XN9D 3WIIL 5ALBH 4F2MA 1RULH 4I18C 1AIFB 3QHZH 4ESKA 2H32A 4KROC 3GMRB 3IDNA 3H9HA 3LKQA 4HEPA 3IJEB 5E08L 3CVIH 3RI5F 2EO9A 5D2LF 5CGYC 4X98B 1N0LA 1UFGA 3B3IA 5E8EA 4L0PB 4KZEL 3HG5A 1NMCB 3U9UB 4OCSH 1ZLUH 1NBQA 2HFEB 3G9AB 3W81A 2CG9X 5I0ZA 1EBAA 1NCTA 3NSCA 4TQHA 5E8NA 1I8UA 4XXWA 3FBQA 4DKTA 4JUTA 3N91A 1MG2C 2XIDA 4K07A 4DN4L 2PCYA 1KBGH 5F71A 4HUVA 3WFDH 4XN4A 4NIYE 1FNSH 3QO1A 3HE7D 4FZ8L 1WBZB 4N2IA 1IM3B 4L5FL 4U1KA 1SEBA 3FO0L 4DGUA 4Z76A 1M1XB 3WELA 5CGMA 4HUVB 5GZND 4YPGA 2XV3A 5DJZB 5ICXA 1WS8A 4Y5XA 4NYLB 5FM8A 1UG9A 5IJCC 1IM9A 2HMID 3VFGL 5G4MA 2R9HC 3FOMA 2ZX9A 3W2DH 2A6JA 1KUMA 2X38A 2NXZC 1NBVL 3V7AE 4YAQB 1UD8A 1FJ1B 1HL9A 3QUMH 3GBML 5I1IL 2FNBA 3KH3A 2ICEB 2ESVD 5LWYH 1MIEL 3QFJD 1TVHA 3VGEA 2TSBA 3BP6B 4A37A 1G84A 2OMUA 2XY2A 1SOQA 3OG6B 5HHMB 3S3CB 2WLMA 1Q72H 9CGTA 1OP3K 3FOLA 1EAJA 1U2HA 2QMJA 4YFLF 3LZLA 1SJHA 3MFGB 3DJ9A 4KKBC 2ZUVA 3ZZSA 1QHQA 4NP4H 3BQUC 4H8HA 3C6LC 3L4ZA 5T1LD 2BVYA 1YCSA 4Y2NA 4YSTA 1JYNA 5MI0B 1KTDA 4HIHB 3TCLB 5GRXG 1NGWA 4K7FA 1MEXH 5FGRA 4FERA 2WIMA 5IGXL 4N2FA 4ADGA 3IEAA 5D2NE 5I15H 4NBXB 4U1HB 4WEMB 4YBHA 4A67A 3RAJL 3ZBMA 5CN1A 3M7OA 4MDJB 2F15A 1JSYA 3T2LA 2EQDA 2XA3A 4PJHE 4AUUA 4JVPA 4QCIA 4YHNA 4ZAKB 3AC0A 1A6TA 1MH5A 2JQMA 3ARTA 4QYAA 2ISDA 1OQXA 2D03H 4DT2A 1QRNA 4XNUH 3VXPA 2A5UA 3D8MA 3QC6X 4UTAA 4WLCA 1NCWH 5E5MB 3GXMA 4IJ3B 1JK8B 1U30A 1QW9A 4KTDH 4AW7A 2HWZL 3HAEA 4I3RL 5CM1A 2BRQA 3RRQA 1KJ2L 2ICCA 2BVQB 3ZTNL 1G7LB 5FC9A 1XGQB 3ME0A 3NJKA 4FXGB 1XMWA 4LASH 1DFBH 3F62A 4X4KA 4M6ML 1ED3B 3LZFL 3PHOB 4L29B 4RZKA 4AM0A 4HA1A 5A3IC 2AW2A 3FH5A 4JR9L 4UILL 1YECL 4WFFD 3TO4C 4EI6A 5TDOA 1EZUA 3QC5X 3GSXA 4XNZC 1JTTA 1PYWB 2GT9A 5F0JB 3RG1C 3PQYB 1OF2A 2R2BB 1PZBA 2XKSA 5ITBH 4FNRA 5CZRA 2O5XH 3U2SB 3LY6A 1A7RH 2YMXH 4PJ9B 4JRYD 5IG7B 3WE1A 5IREA 1NAML 5JIPA 1Y0LB 2HVJB 2FQEA 2J5WA 3JWOC 1H15A 1ONQA 5JLZA 3BQUB 1CG9B 3QEHA 3AG1B 4MS8C 1MJ7H 3UGXA 1A6ZB 3QUHA 1SHXA 1WZAA 3CFJB 4GNKB 1DCLA 2ZCKL 1IC1A 4MMYB 1ODAA 4GAAA 4ZSOE 5I1AA 3MJGX 2IOIA 3CFDA 2FEDC 1YEEH 2KLTA 4D0DB 1KZYA 3EH3B 4F7CB 5GISH 5IOPA 2P9RA 5MHSD 3T9WA 1VLXA 2E9IA 1CL7L 3O4LA 1ZVHA 3N06B 3FO2A 4ZS6D 3N2JA 1CLOH 1X6NA 2BW4A 3BFWA 3OLIA 4ZK8A 3FQ1A 5FV1L 3B5GA 1EEZA 1E5YA 2NW3B 4NDMA 4IKJA 1PKQB 3DPBB 3KGUA 4EIGB 2HRPL 3ULUH 1W80A 1OP9A 2JJUA 5EU7E 4J3OF 2PXYD 1BAFL 5DRXB 4IKLA 1DYZA 4E9RA 1A4JA 4QNPE 4KO9A 3T2OA 4Y19B 5FKPA 5I1CH 1WSST 5L2JA 3LS5H 4N0CD 2LFGA 5KSAD 4M7JL 4PYGA 4AYGA 2XPGB 5IEKA 2PR9A 2XFGB 2PWGA 3H9SE 2LV4A 2GIYA 4P3DB 4OT1H 4IMLA 5KG9A 2FUTA 4TVUA 5BZDB 4JQXA 2RQ8A 4PY8I 5LUMA 1EXUA 2H3NA 4MD4B 3OX8B 2WCSA 1JS4A 2H7WA 5AB1A 4W6YB 3BVDB 1BZEA 3JT2A 3PABB 1X5XA 3QA3A 1RSYA 2BZCA 2VO8A 1NGXA 3CDZB 3R1GL 3FU0A 2VN6A 4UUJB 4X0KB 4OI7A 3QRLA 4NO0D 4PG2C 1BZ9A 4AYFB 5CD5D 4C4BA 4FA8A 3GSWB 1X5HA 4OB5L 4XMWA 1OAJA 1WIUA 1OK8A 3IDYB 1BJ1J 4AL8L 1BFOB 3P4LA 5FW6A 1BD2B 4U4BA 5D4IA 5CJBA 2MWCA 1PLBA 4KRPB 1ES0B 1AE6H 2XPZA 4UM9B 3OKOB 3Q48A 1N6UA 2BNQD 1OAYL 1CLCA 4JL2A 2MCPH 4HD5A 1TTCA 1E3ZA 2DV6A 1UB5A 1YEFH 3ARBC 2BOBB 1L9QA 5FYLH 1RFDH 1GC1L 5IBUB 3HVDA 1JGIA 5DD0L 4BD4A 3VM7A 1E9PA 1YEHH 3H7BA 1OB1B 1NMBH 1P2CA 1CGXA 1U0QA 1QWUA 3BH8A 2ODHA 1DSYA 4POZC 2P5WD 1UKQA 4UIKL 2X89D 3NABH 1CD9B 5EFIB 5EOTB 3N55A 3SDCB 3SGEH 5HBBA 1OE2A 1U8QB 4N1CA 3BO8B 2VLJE 4MAZA 4BE5A 3NSYA 4LVHC 4PJAB 1ZE3H 3ZKMC 3BGAA 3LPPA 3CTTA 5J0BA 2DMKA 3EJYC 3U36B 1EO5A 2VLRD 3CFMA 3E6FB 4QRRB 5AYUL 3UERA 4HWBL 4IRSD 4N85A 4MMZA 4OZIA 4KQ3H 1Q0EA 1TCRB 4PJXA 1LYQA 4NM4H 1CFMA 1PIGA 2YPVH 4Y19D 1VZGA 1ZLDA 4J3UA 2JQAA 4X8JA 3EOBB 3ET9F 3P02A 2WLLA 1P84J 2BSSB 1CCZA 1E42A 3GGWA 4YE0A 5DVMA 4EZMA 4HWEL 2YEVB 1USZA 3EOAB 1SPDA 2ZG3A 5GQBA 4QXGH 4X99B 2ZWZA 1A3ZA 1BG9A 2OSLA 4PRHD 3D1MC 3TS8A 3I02A 1KCBA 4F7MA 4IRJA 4PRIE 4XAWH 2VQUA 4HUNB 2EZ0D 3ASWA 3G7TA 4LEOA 5EU3B 4XO9A 1RHHB 1OTSC 4Y4HD 5J6GA 3CE1A 5T3ZE 1JXDA 2P5ED 1NC2D 3BIKA 5D2NC 3FO1B 2DMCA 4JW3A 4ADJA 3VSTA 1A9EA 1MIMH 3IE9A 4R4FH 4Z0BH 5JZ7C 2Y5QA 2GY7B 3PAYA 3SQOH 4UIKH 2A6KA 1B9ZA 3WENA 1W0WA 2W9DH 4QOKA 5CEXA 1XR8B 3NDYE 5JW3H 1KDIA 4JRYB 4Y9BA 4HAGA 3HS9A 1K4DA 3BUIA 5GZNC 5FM5O 4LNVA 2AMGA 3K81A 2VZOA 2YQ2A 3ECVA 3F12B 3H2WA 3GXNA 5D1XB 2HMIC 3PUCA 1JFHA 1MUJB 4M5YH 1AQHA 3NFNA 3B9AA 4AK2A 4JM2C 4WQOA 1YYLL 3NA4A 5B22A 1AD9B 4GRWF 4JDEB 1RP9A 3S96A 3QXTA 5AZ2H 4K9EL 1IKFL 4MZIA 3A6CL 1E4WL 1INEL 3RE0A 1TITA 4WCYH 4TL4A 2CSPA 4U1NA 5KVFL 4R7DA 4HJGA 4KVCL 4ZW8A 4F7PA 2EP6A 2QEJA 4OD2B 4ZFGL 4XN8A 3LZQA 3K71B 1NDTA 3S7GA 1KYDA 1ZTXE 2D3NA 3BKCH 3UTQA 3BQUD 3P0YH 4HSAC 1KJMA 1JPST 1OCRB 3D07A 4YHKL 1UM4L 4J6IA 4OGYL 4F8TA 3BWZA 3R19A 1MW3A 4PJ9D 4RAVA 3DUUB 3DRQA 4LCCA 1P7QA 5DZ9A 3RTQA 2KPWA 3WJJC 2C9PA 2J21A 5F8QC 3LB6C 4WI3A 5GSVB 4N8VA 5BMFH 4Y8DC 5HYJE 5DK3A 2EJ1A 4HALA 4LSQL 4CRPA 2XJKA 3H42H 3DXAA 1E43A 5BUAA 4FEMA 3M17B 1H9DA 1T0OA 5DURD 3ATEA 4FFZA 1PAMA 4TULH 1FO0A 4JCWA 3DJRA 4ZO8A 5GSVA 3EOYG 1T1ZB 4IRZA 3SY6A 4JPVL 4QTIL 4UQEA 2BIPA 1MCLA 2KHAA 4JRXD 3TF4A 1VF5C 1C16B 1ZWIA 4F9LA 1UD3A 3MO1A 1CD8A 2VLJB 3PLYA 4QT5A 3LKNA 2ESVB 1QEWB 1J0ZA 3RNKA 1W0YT 1M05B 3U4EB 3G6DL 4YL4A 5C0JA 2DYPB 3C2SA 2AERT 3SPVA 4JO2H 2F58H 3WS3A 2YKLL 4YE4L 1NUGA 4U1NB 1XZ0A 5I5JA 4R4ND 4PLOB 3OKOA 3DI2B 1PCSA 5KSBA 4ELME 1N9PA 1LO4L 6PCYA 3DGGA 1U8CB 1UFUA 3QRBA 3UAJC 1FNHA 1KGCE 1BREA 4LLVB 4AIOA 4YHIA 5LLIC 4R7DB 3D2TA 4GXUM 2WSPA 4MS8D 4XBPB 3N1GC 3MAWA 1ZS2A 1XGTA 3UEQA 5KYUB 1TENA 4OBRA 2V9UA 3GM0A 4K23H 4KDTA 3U30B 3RP1A 1U3HB 1B0IA 1BOYA 1BAFH 4KU1A 1J5DA 4CN4A 2WMPB 2OMVA 4L8CA 2ZF8A 2UY7B 3OKMA 3RWIA 4YXLL 1GOHA 4M43H 3AJ7A 3ILQD 4XBEH 2C9QA 4NO5B 5I1KL 4RMRA 3QDGD 3KPQA 3P9LA 3UMTA 1TNNA 3MLYL 4A1RA 3X13A 4WVRA 3HE7C 2AJYH 4AXWA 1QR1B 3Q2NA 3VG9C 5IKCA 4PGZA 2ZKHH 5HHVL 1S9WB 3F85A 1G7JB 3GSRB 4XBPA 3ZU8A 3JVGC 4D3CL 2Z91A 1QLRB 1OSZB 4Q56A 1SXNA 4WFHE 3HE7B 3SY0A 4QR7A 2R9HD 3JWDC 1A4JB 3B56A 3OZLA 3SD2A 2V17L 5EUOA 3EO0A 3HPJA 1GA2A 1JZ2A 1AACA 4J3SA 1GGBL 2VW6A 4Q4EA 3Q1SH 3U0PA 1UXSA 2XX0A 4U3HA 3MGOB 3MJ9H 2AQNA 4A7TA 1U3HC 5M94B 4LDLB 1ML0A 4PBXA 3STLA 4ONHA 4ZQTA 2LU7A 4FD0A 4XCYB 5FM5M 3UO8B 1DLFH 4GI8A 3TA3B 3PNWA 1E27B 1GMEA 3A4AA 3C6LD 4FP8L 2DOCA 3RURA 3VA2C 1T03H 1PZ3A 5JXEC 3APNA 1KN2H 3S4SG 2N0KA 5I6PA 4ILDA 1PJ9A 3C6SB 1KNOB 1YNTA 1IAKA 4ZUWA 4NPYB 3WXVH 2F19H 5BUGA 5IQ7L 2PETA 1D7DA 4Y19E 5CP7B 4MJID 1LD9A 3PHQB 4GS7C 4L8SC 4KUCF 3QUGA 1E65A 5IJDC 6TAAA 1NC4D 3OWRA 1L0QA 3ETBJ 4OKVB 2Z7YA 4XXCC 3RTQB 4AYEC 1U8JA 5AG8A 2ATPB 3AZUA 5E2JA 1KV7A 2GJ6B 3QDJD 4I48B 4GP5B 1GJWA 1FZKA 3IWUA 4PGJA 3UADA 3EYUL 3HLAB 5IW6A 4F15C 3TBTB 2ED9A 4LL9A 5I1GH 5L4FA 3CFUA 4NN6B 3MRBA 2F54E 1B0RB 4POZD 1DN0B 1U8NA 5E4EC 5J56B 3WAJA 4PJFE 1BZQK 1AOZA 3OGCB 1HEJC 1AFVH 3FAXA 4WSJA 4Z77A 1G7IB 1WICA 1MF2H 3RUGF 3PWUB 4FMVA 5IB3A 4HJ0C 3SQBA 2VR3A 3TO4D 4KNUA 4MJ6B 3F5WA 4R7XA 5GGVH 5TGBB 5HDBE 5D7HA 1QUNA 3CU7A 5F7WC 2DLFL 4AENB 1OZTG 4HSQA 3QUZB 3NFNB 2BNQA 5HYEA 5E8OB 3W1ZA 1CICB 2XWRA 3L54A 4EUPA 1D9KB 5CLXA 1HESA 3GB7A 5LHDA 2V5SA 3O0RH 2YBGA 3P3TA 3MLRL 4IOFC 5L8KB 3Q8FA 1FFPB 5T1KB 3EF7A 4XP1H 4A39A 4FYRA 4FLOA 3F7KA 1W0WB 4Z7QF 1AGCA 3M1CA 5ERWB 5GGUB 1RHFA 2IWEA 3CDGB 4GRLB 4JFHE 1AQ8A 4UB0H 4HPOL 1XSJA 2NY0B 3R7RA 4AW4A 4ZO9A 5J7CC 2X0WA 4ODHL 1QFWI 5I1EH 2APWA 2BSRA 3VJ6B 3KJ4B 1YYML 2EZ0C 3EJPA 4HW6A 1BVNP 1INDL 3BEVB 1OTSD 3AAZA 4F7MB 3AG3B 1YNTF 1KELH 1G7PA 3LKSB 1NFDE 1DVFB 5JQHC 4HHWA 4LAQL 5IHZB 1OGSA 1YVLA 3HN3A 3LZFH 2QPFA 4E9QA 4NWUL 3KPSA 3RIAK 5J3HD 3W0WA 5FX3A 5AVZB 5AZ2L 2A73A 2R69H 4JE0A 3KZ8A 2P24A 3CK0L 1IT9L 1CD1A 4KROB 5MEQB 4DEPB 2JCCF 4LAJH 4XCCL 4XP4L 1A1OB 3O4OB 3QHZL 1E8XA 1BJ1H 2Q5BA 5IVZB 1HHIA 1OTTC 1M6UA 1OAUL 4OJFL 4PI2A 4XNYH 4D0DA 1E67A 4WW2F 4LBAA 2WCPA 1TQTA 3II3A 4Y4HA 2NY3B 4LCWB 3O6KL 3PPEA 1IEAA 4J7RA 4L8BA 5L6YH 5EUOF 4FQXA 3NH7L 2JKJA 4UV7H 3GSXB 4PJBA 4HVBA 1N0LB 4MB4A 5T3XL 1YUKB 5IQ9B 3RVVD 5DZPA 3QYMA 2C1PB 5ID0A 4KPHH 1XF4A 4D9QE 3KGTA 3MRRB 3VGGA 1YN7A 2PTUA 1U21A 4L3CA 4TSBL 1OWRM 1Q38A 3MJ8A 4EMZA 3GXDA 3IS1X 3O9WB 4FQHB 1WE5A 3DETD 1NM9A 3F65A 1IBDA 5CHNB 1A4BA 2EDHA 2OL3A 2X5PA 1KYAA 5ADOL 4Z7WE 4OSUH 5DHDA 3QGVA 1IAIM 4IU2A 2AITA 4XPTH 2X1XR 4NBYB 4FC3E 1Z2KA 1RERA 3X1EA 4K8RD 3RL2B 1EK3A 1EAPB 4RDBA 2G0LA 4OF3A 5LAXB 2B1AL 1UEYA 4WHYH 4XVJH 2UXFA 2A99A 1HH6B 1JL8A 2HLAA 2DYPD 4OLZH 5ILTH 1VRSA 2YPLB 4IQHA 2XYCA 1JI1A 3QWNA 4YHNB 2XXGA 1C5CH 4A6YA 4XE5B 4TUOB 1ZKAA 4KMQA 3ARBB 4WFEE 4G43B 1B9KA 3TPKA 1J9TA 1DSFH 1UWEH 3ARQA 3DV6A 2WYTA 3UZQB 3FHQA 3WNKA 2H3NB 3UTSE 1EAOA 1UJ3C 3CPLB 2DQHL 3LRLA 2DIEA 2HTLC 4ZAKC 6CGTA 3JV6B 5DD1L 3SDDD 3CJJA 4M7LT 3P11L 4IMLB 1UOVA 4R4NC 3GJEB 4LESA 2O6DA 2NLJA 1HOCA 3LOWA 2IH3B 5I75C 1KEML 5CINH 4BE6A 5LXGL 3FJTA 1PPIA 2Q8AL 2GCYB 3EUDA 4QRBA 1X5JA 3NACH 3O9WA 2HPTA 1ZA6A 4N6QA 1I7UA 3BAWA 2C1OB 2JQZA 3AW5A 3VQ2C 3QO0A 2BPBA 2DW5A 4E9VA 5ADOH 4K2UH 2IPUG 4NWTH 1TJMA 2NW3A 4AH2B 1ITBB 1U4FA 4IKNA 5D5MF 1N6QH 4GMSL 2GBAA 2AEWA 3SYAA 1HXMA 1OWWA 2OLDA 3FB6A 5ALCL 1VENA 1DL7L 4Y4HB 2F74B 1IM9B 4N68A 5ABAA 4PWFA 1IO4C 5DJZA 1JF1B 4DPRA 4OLWH 1HHGB 3JYCA 1Y6NR 2OCCB 1LDPL 3IDXH 3FCUB 3NZ8B 2Y7OA 5HI3C 1MWAH 3TBVB 4MAYA 2RHEA 4WKXA 4Y9GA 4XCFL 3VX0A 1RZGB 1MJ7L 4LPCA 3L9RA 2ZSWA 3EJUA 1JHKH 3IDNB 3KW8A 5SX5H 2FH6A 3UC2A 4JFXA 4CVZB 4Q9RH 4G11A 4Q52A 4PWHA 5DJCA 3VRIA 5F7EH 1RU9H 2EEXA 4AQ1C 3ZT5A 2IH3A 1NLBH 2DEXX 4LSQH 3RY6A 3W56A 1ED3A 4EBQL 2EACA 4BV1A 5G4NA 2AANA 2DMGA 3T3PE 5I17B 4AQAA 4W9LC 5DDHA 3OG4B 3HAEB 5CR8A 3TP4A 4XBGA 5EF2A 3SYOA 4F7EB 4PJGF 3WMQA 4YSSA 2F53A 4CC4A 3UYPA 1T0NB 4JPIA 4AGNA 4NC2B 2VCOA 4W9ZA 4PJ9C 4N90E 5CUSL 3DK2A 5I1DB 5DLML 1E28B 4Y1AD 3T1FB 1HINH 4ZW6A 7FABH 3L1GA 3S36L 4LCVA 3MV9D 4QRSA 1VKXB 3UJTL 1KF9B 3MRJB 3KLSA 5JW3L 3QEQE 3L3IA 4AENA 2JLLA 5AW4B 2H5UA 4A68A 1QSFA 1J8HA 2VISB 3WHXA 3V55A 4JHUA 3VFRB 2FHFA 3FT9A 1AZBA 1KJ2H 2VE6B 5F89A 2HVKB 2R8SL 3NRQA 4GP8B 3VXTB 3G5XB 2BMKB 5GSRB 2PCFA 4DKAA 4I89A 4GJTB 4G80B 1RUPH 4FQHA 2VYRE 4LZKA 4OM1H 5SWSD 2CE6A 1NUNB 4F2FA 4RX4D 2YEZB 3APDA 4Z7NB 4P9HC 2B5IB 4HFWB 3KXFD 1IZKA 3U1SL 3W11D 3DX6A 3DMMA 5EZOH 1UA3A 2ZAHA 3DVGA 4PJDB 1AHMA 3K6OA 3KPOB 1ZT1B 2ICES 4PRNB 4B9KC 1R34A 4LLQA 1TO4A 1SFHA 1U8LB 2ZYRA 2P48B 4YBLC 2KZ1B 3NZSA 4HS8H 2MNUA 4IOSD 1ORQA 3G6JF 1PG7X 3I50H 4PJ7A 5I19L 5ACLA 4JFUA 4PG9A 1WDAA 4DUWA 5K1JA 2Y2TA 5E9DB 3CZUB 5FYKH 1DEDA 5KTEH 4S1RH 1E4KC 3NJNA 5EBMB 3G5WA 4GUPB 4EE2A 1S8DB 5C2UB 2DBLL 1MFMA 4Y5YA 5JNYB 1SLVA 4G7YL 2E3VA 1MQKH 2B3IA 4FJ6A 2XZZA 3EYFB 1B3JA 1OAQL 4DHLA 4OR1A 4JRFA 4FAAB 3HB3D 4P5TC 2B16A 3ZHNA 4HOZA 4BINA 1AP2B 2QVFB 3VDBA 4L4TA 3X3FL 5DC4B 5H35A 2GBTA 4HWBH 1D5RA 3Q0HA 1MFBL 3LZNA 3PWPB 3CHRA 2XT1B 4HBCH 4TKWA 5LN8A 2IMMA 5D7LE 5D55A 1Z9MA 5J3HC 2EEBA 1NFAA 5K93A 3PWVA 1JVOA 1A3RL 3Q6GH 4S0TD 2BCKA 2WQ8A 5K9QG 3N9GH 3NH7H 5I76A 2Y9RT 5F7DB 4PJDE 4KHXH 4ZFFB 1T89C 1OTTD 4FNLH 4I85A 4Z7VA 3HI1A 2AI0H 2WQXA 5FUZL 5KVEH 5HYJB 3HC4H 2RCSH 3WL9B 4XZUB 1GZHA 2DQTL 4FG4A 3NN8B 3IDJA 5F7EL 3QQNA 2WV3A 3V4VH 2QFPA 3DX2A 4IBUA 2FBJL 1A1MA 3FB8A 3GTTA 4TVPD 5DZOA 1FLRL 5J1SC 1FHNA 2O4EA 4OD3L 4RA3A 1X5KA 3EZJB 5FKAB 3PWUA 3EADA 4M43L 2NW2B 4GSDL 3CC1A 4APQD 1NCNA 3ZHDA 4PG9B 4U49A 3CC5B 1IAOA 5KW9H 1JFQL 3WUWB 4G82A 2W80C 2X0VA 3AB0C 4KK9C 3ZN6A 5E8PB 2JXMA 1HJBC 5K9JL 3F7VB 2HKHL 2I9LA 4UMSA 4TLSA 5D1ZI 3VFUB 5D72H 1MI5B 2DKSA 1P4UA 3NEOA 1FHGA 1JE6A 2J73A 4NRXB 5AD0B 1R46A 1QNIA 2OSYA 2VNCA 3MBXL 5DD5H 3WS3B 5AFAA 4JY4B 2VXSL 5CBAB 1FFTB 3RVXD 1TXKA 2ZUQB 3QISA 5C07D 4K0OA 3U1PA 1WD8A 4K3EL 2XKNB 4OCSL 5CP7A 5EWIL 3S9DB 3BKYL 5FWRA 4YIQB 4J3OG 3Q6FB 1ZHNA 3DBXB 3E3QC 5F1NB 3H9ZA 2EICA 2ENSA 1BEYL 2FX8L 2WNXA 3NJFA 1SMOA 3BRDA 1M2OA 1LHZA 2ZSVA 2X88A 4MKTA 4PJ8D 3NRFA 4XN1A 2O6EA 5GRVK 2OL3H 1BA9A 1H5BB 2Y5EA 1T7YA 3PWJB 1EJOL 3ETSA 1RZ7L 3S5YA 4EN3A 3ZYIA 2HTLD 4JREB 2CUHA 4BZ2L 5IEHB 4AEHH 1S9VA 3OHXB 2YMTA 4K2UL 2FBJH 4NWTL 4O2CB 3QEQB 4LQFL 1SDYA 4E5XA 5IJVA 3F6JA 2P49B 1KIQB 3QRGL 3WY3A 2DQIH 2AJ3B 5D1XC 4OM0H 4R96A 3RWDA 3ROLB 1DL7H 1K9TA 4HLZG 2C9XA 2FWOB 1MCIA 2V5MA 3FQNB 2MCMA 5J57B 3FCSA 3HNSL 4KK5C 3D5OF 4O58H 1RV6X 1VJSA 2H9GA 1M7IA 1PQZB 4EVNA 3F7YA 3DURA 3QI9C 1JGEA 4YUEL 3P73B 3K8LA 3MBXH 1XMEB 1F6AA 1EH9A 5D2LB 4N4YB 2VL4A 2Q76B 4HJJL 3THML 4H1LB 4A66A 4PVBA 2P43B 1XD1A 5FW8A 5JW4Q 3BOVA 5MEOA 1RZKH 3BUYB 2FJSA 4M1DH 1FVEB 4FQXD 4ZTPH 4F80A 3Q13A 1TZIB 2C4XA 3BPNB 3GHBL 1BQLH 1T6BX 4JO1L 4KFZC 3TH4T 4WDIB 5GS1B 4D8PA 1JZ5A 2Q86A 1DANT 2WIIA 1I9JH 2KDYA 2IPKB 4BYHA 4JZJC 2YRPA 4ICXA 1X9UA 3EFOA 3FCGA 3QG6A 5FA3B 4OV5B 1LLAA 4WUKH 5F7LB 3B2DC 2E7LC 1F6FB 4KI5D 3FTSA 3S3JA 1E7VA 4RGOH 4QTHB 4UAOB 4XNUL 5A16A 2RIKA 4UANA 4TUKL 3Q2WA 1QFUH 3VG9B 5C0AA 2R4RH 4HFUH 3FQWA 1IEBB 3NG5A 3O6LL 3NSFA 5KANG 3VVWA 1KC5L 1NL0L 3IRZA 3SPGA 4APXB 2XIIA 4LASL 3FQ2A 4OD1L 3F6IA 3RBGA 1Q0XH 3WD5H 2OV0A 1FIEA 1KACB 3BUPA 1T21B 2Y7NA 2WVSA 3M88A 2DYPA 2DQDL 3SPVB 2PMZA 3GYRA 4D9LL 3W9DA 5BV7H 3PWLB 2AF2A 1F86A 3D0VB 4MHHG 2ZKHL 1JPFB 2YOCA 1KBWA 3O6FC 5IMOB 1SYVA 1NLDH 1VFUA 1AQKL 2PABA 3KPRB 1BQKA 2OX5A 1KB5H 1WBYB 3BZEA 3BPLB 3VGAB 5EZLA 1JWMA 3T0EC 2W5PA 1PEWA 3FT3A 1A9BB 2MPVA 1SBBA 4J6RL 5E9AA 2AV7A 1TF4A 4IW4C 2HJKB 3C5JB 3KXFB 5DFVC 5D7KE 3HFML 5FLVA 1UZGA 4JFDE 4P8QA 4YS4A 3T04D 4G43A 4KXZH 4OZGA 3HE6A 4YK4C 1NGPL 4I5BB 1MAKA 4NP4L 1T20B 4U1MA 2ALAA 1X4ZA 1KLUB 4QHNB 3FUHA 1CU4L 3WMPA 1Q94A 2X4NB 3MACH 1DLFL 3QORA 2P5PA 5I8EA 4BHUI 4AMWA 2Z92A 1FSKB 4LLMB 4NZTL 4HHAB 1N6VA 3EJZC 4B9CA 1KXVC 3T0XA 3MYJB 1SY6L 1DLHB 3N1QC 4H25B 3HAEH 4PBDA 3R8QA 4G1MB 2ATKA 4DO6A 1BFVL 3V9FA 1HE7A 3ZLQC 1AO7B 1Q0XL 3WD5L 3KM1A 3NIGF 2Z8VC 1WWAX 3ZGIA 3MBEB 3QIWD 5JPMC 4QRPA 5IIEA 4JDEA 3S96B 4JLRB 4QMEA 3NT0A 5CD3A 3L1EA 1DEEA 3MUHL 3DNKA 4LE8A 3HS0A 3MXVL 3O6FB 5GGVY 5JHMA 1FL3A 3L1OH 2X53A 4UAHA 4UDUB 1B0WA 1QSEA 3R0MA 1XGUA 5DGQA 5I8CB 4TTGA 2ITDB 2V9RA 5I1KH 4F57L 3SBPA 3HE6B 2DQEH 3IDGB 2XWEA 2WXQA 1NWOA 1FZJA 1C9SA 3QS2A 2VDMB 3E2HB 3N41F 3V0DA 4Y88A 5F9WB 5C9JB 5DYOB 2M1KA 1NLBL 1NDGA 2WZ5A 4OQ1A 1FF5A 2ZPKH 3I75A 3QT2A 4PJFA 4HJJH 2WO2B 4BWUA 1ZHBA 5LG1A 3Q8AA 2WZ6A 2XPGA 5IEKB 4GAFB 4KK6C 3D39B 4MNGE 2DTSA 5FUZH 2IGTA 3WAKA 3L4CA 5D5MB 1R19A 3WEBA 5MHSE 5KS9F 4RRPG 4ICWA 5LCVA 2VMCA 2EH7L 1PKQE 1QABA 1MFEL 3CLEH 4LEBA 1FLRH 4IYKA 5FYJL 2JKNA 1AHWB 1TMCB 1XGYL 2VXQL 1I3RB 3CUPA 4X8JB 5GZOD 1P5UA 2NXYC 3TZVA 3LQMA 5AW8B 2YN5A 2I27N 1F2QA 3GBNL 4HKJA 3US9A 5AB9A 2W95A 5E2VL 2ATAA 2X4TA 4OZIB 3T0BA 2YD4A 3X1GA 3W57A 1R3JB 1U6AL 1WA0X 2JK5A 3EHBC 2FSEB 3MLTA 2QVKA 1SOKA 3E6FA 3N0PB 3GHPA 3QJFA 5FK9A 2CLVB 5HHNA 3L3JB 5KAQF 2G0KA 3GSUB 1RURH 4HUCA 3TBSA 1L3NA 4Y4KA 3QG6B 2NX5D 4HGMA 1PEZA 1YY8B 4XNDA 1UXLA 4L3EE 1KPUB 4IEFA 5I0WA 4W1TA 1I3GL 4PB0L 4JK0D 1FL3B 4UDUA 1V3KA 1GCFA 1EZVY 4GW4A 4FG6D 3ZYZA 4ELMF 3NAAL 1X9LA 4E9YA 2J6EH 2JI2A 4X6CB 4KGJA 4M48L 3QIBA 1IGTB 3BSZH 1KFAL 5KSBF 1XCQB 5GS0C 5EU6B 5FWQA 3GJFA 2I9TA 3VE0A 3RVXC 2LFEA 2OTPA 3OV6A 3ORJA 2X3BA 5K39B 1CFVH 3GRWH 3VXUD 3D06A 1Z3GL 4YWGH 4AK1A 4H8PA 4ATTA 2Y5TA 4H0LC 3E2HC 4KKLD 3BUTA 2YMOA 3NPSC 4NO3A 4K23L 2EE9A 4ZFOL 1VSCA 2D4FA 1BFOA 1DBAH 3H0TB 4JN2A 3UDWC 1IBFA 3CSYB 2UYLA 1KYOK 3WIHL 1RUQL 1RJLA 4LK4A 4WTQA 3CIAA 3HI6L 4PJ8C 3DX9B 3IJSB 4MJ5B 2QQNH 1G0XA 1CXHA 2RJMA 3ARYA 1SUJA 1EGJL 3TX4A 2ED7A 4S1SH 4XPGH 5IB4B 5E2VH 2WVUA 3OJMB 4JFYA 4X6CA 2G4EA 2NUPA 4LHQB 4WW1B 3VXME 1Q4NX 3ZDYE 1S7QA 5HHVH 2FQGA 3QZPA 3LN4B 2V5RA 1ZXQA 2AEPL 3JWNH 5E99L 2HJKA 3C5JA 5DZNA 4FTVD 4LSTH 1CDCA 1S7RA 2I07B 3WTXA 1A6PA 4YNYA 4KJPC 5CWSA 1QLEB 2ZJSH 2E8YA 3LVTA 4L9LA 4P2YA 1WRFA 3QFJE 4U6XB 5IJBC 2CJSA 4NZ8A 2MIZA 4YDLC 5IM7A 1JNNH 1DQTA 2LTQC 1U8MB 4NPJA 4PJDF 1IBZA 3PXJA 2GB2A 2XN1A 3QNYA 2OK0H 1NMAH 4TNVF 2IFFH 4P59L 3GBMH 3WNIA 2GJ6E 1G5GA 4U3XA 1MFCL 5K59E 3RZCD 3K74B 3OF6D 5IVOA 1Y7VA 4AT6B 3DSNB 1O75A 2P8MB 2X2UA 5C0RL 1JV5B 3BXNB 5IB2B 2CRIA 1I1AC 4PLJD 1A6VH 5EC1B 1T2XA 3WSQH 1E50A 5F3HA 3DVNB 3QDMD 5AW6B 2DQ6A 4AJ0A 5CLTA 4HU2A 2R0LH 3FTUA 3KBFA 3AUVA 3CFDB 4RAHA 5I66B 1IQWH 1EX0A 5I1AB 1JGDA 4X7SL 4I1NB 4P46A 3HKFA 4NQXA 4Z6AT 4Z78B 3CFCL 3U25A 1HSBB 4JDVA 2D3VA 2DI9A 1NIFA 5JOFA 3I50L 5I19H 1E6OH 4H5SB 3V6FB 3ALWA 2FRGP 5L8LB 3MRMA 4UOZA 1FZMA 1GAFH 4WK4B 3HKZA 2JKLA 1XIWA 2IMNA 5HVHC 1BECA 4UIMA 2PYED 3D25B 4YHLH 2G3XA 1K8DB 3S3BB 3KPPA 3OMIB 1QSEB 5I0DA 2BSCA 3ARFC 5T1KD 2PN5A 2IANB 4YHIB 1HHKA 3L5XL 1V55B 1MWAL 1AKPA 1CXFA 3O6FD 1BF8A 2WINB 2WJ5A 2FLRT 3I9PA 4XC1H 4PN6A 3WEAA 2V3FA 5HHOE 3EGXB 1VCAA 1MHEB 5AALA 4X8GA 1SBSL 1Z9SB 3QPQD 5B39B 3QJTB 1NPJA 3CFIC 2VO5A 4ODUB 1GS6X 4LU5L 4NN5B 5IFJB 2AEQH 4Z3EA 5ITFB 2H3XC 3ASOB 5E94A 3BC9A 4G6JL 3X2QB 3WEOA 1UWGL 3EBHA 4K94H 4TV3A 4YHKH 5DJAB 4A7GF 4XNAA 2AK1H 4HH8A 1IGFL 3GSVB 2VZTA 3EJZD 2EDWA 4YFLI 4X0NA 3H9SA 4LBEA 1V7NH 4GLRI 2IH9A 1EZSA 3C6EA 3IVKB 1OAZH 2XFXB 3LRHA 3D9AH 2GTZB 2NY1B 3T0DA 1R0AH 2EVIA 2AV1B 4FQPA 1J18A 1W0VB 1BVKB 3BN9D 1M9WA 4EO5A 1TVHB 2X44D 5DCCA 2DDQL 4HK3N 2WPGA 4ZFZA 5IMKB 1R5VB 1PGRB 4N25A 5AVWB 4Q74A 5DQ9A 3VX1A 2EUVA 4MRCA 5E6ID 4DP4X 3NJMA 4KK5D 3D4CA 5IESL 1EANA 4F3FA 2F08A 1I75A 4AMKH 5DJYA 4EDXA 4E0RB 2NY5L 5AW2B 2BVOB 2MQ0A 5HY9B 4MD5A 4OZHA 5J11B 3V6OE 1CBJA 3KPNB 3ZSTA 4PGDB 1I4FB 3V4PB 5BQ7B 1P5VB 1C08A 1K3ZA 2R27A 4XXDA 3GSNB 5C92A 1KY7A 5ANMA 4NQDE 5AWNL 3OKYA 5LCVL 1TQBC 5HI5C 4AQ1B 4XZUA 3HZVB 4WI0A 3WCYA 4KTEL 3LEYH 1UWGH 2X40A 5IY5B 3VFOA 2AEIT 5MERA 2FATH 3F12A 4PPTA 4WTWA 1XR9A 3L3KA 4OF5A 2ZWSA 1IFHL 3B9VA 2B77A 2K45A 4OLVL 2Y7SA 2VM9A 2KZWA 3FQUB 1XR8A 3KAAA 4IK6A 3B7YA 2MPAH 4Q97A 4KI5C 4L2LA 3GSQB 4ZMWA 5EOCL 3ESUF 3ZDYF 1I8KB 4Z7OF 3MCG1 1JXJA 3MXWH 4JO5A 2DIAA 4WSKA 2P80A 2OMZA 3I6LD 1XF5A 4HDIB 2Q76A 1F0LA 4Y2DA 4OI9A 1UWXK 4O58L 3B37A 3N3EA 5ID1A 5MENA 2P1YA 1M7IB 2WLHA 4EVNB 4BM7A 1DVUA 1EJ6A 1T6WA 3WFHA 4LSRH 2Y3NA 4HZLB 4X7CC 3W39A 5E08H 4YSCA 2Y0SA 3THMH 4ODVH 2GW5A 4JDTH 1H0DA 1NANH 3FQUA 1SJXA 3PJSB 3S6CA 2NY7H 1UADC 2VDPH 2FX9L 3QIUA 4MYPA 3RB5A 3OZ9L 1YZZA 2WCGA 1GH7A 3GHBH 2WZPD 4DO5A 4U6VH 2N7AA 3OHXA 1TCRA 4FG6C 4KHXL 3WXWH 4YHOL 4X5WB 2VITA 1GYAA 1GZQB 2R8SH 1EVUA 2BSDA 3WY4A 2JJSA 5AVTB 4I0PB 1UCBH 4UTCA 1N2RB 1HCZA 2RCSL 3F01A 1DJXA 3P0GB 1DQML 3KYMB 4HCRL 5EU6E 4N2KA 5KVDL 2DRUA 4LP5A 1EFXA 3HR6A 1C1EL 2AGJL 5J9PA 3U1SH 4PJDA 4M56A 3UACA 3ERXA 3QZWB 2PNDA 4R5TA 2IDTA 4C4UA 5SWQA 1FL5A 3IMWA 4QXGL 1E90A 2DN7A 2ZIDA 1B4TA 2ICWJ 3MV01 1XV8A 2IO5A 4YXHL 1S9KC 4NOFA 4M8VA 1OIOA 1VPOH 3RUGB 4XAKD 2PCFB 4JY4A 4Z7UF 4GH7B 2HKHH 2VXVL 3BW9A 4UZSA 1U8PA 1NDMA 2XXMB 2OW7A 3IT8D 15C8L 1IC4L 2GIXA 2OXGB 3QIWC 1DHKA 4I0PA 1BYPA 5C7XH 2VH5H 4BFIB 2APTA 4S1RL 1QSFB 4FEIA 4B0MB 2J2ZB 4ERSL 1UM5L 2VMEA 1LO3H 1UWYA 8FABB 4XO4A 2MKWA 2FECL 4Q6IC 5KAQG 4XMVA 1R6VA 4PMFA 2CK0L 1AFVL 1EUUA 2ADIB 1PD0A 4HKBB 1BQHA 1ZE3C 5IGXH 3DPDA 1A7PL 2O30A 1RMFH 4APQB 2NZ9D 5GJSL 5IFHH 1IGYA 2BSEA 4Q7DA 4XWOC 5LQBL 4MJIE 1ID2A 5HYJA 3IJYB 4NENB 2NCEA 1DVXA 4ODUA 1EXUB 2F8OA 3OXSA 3D05A 2C26A 4D0CA 2ZXCA 4LEEA 1CQYA 3RGBA 3QR2A 4GXFA 3EGXA 4WWID 3PDDA 3KVPA 4FTVA 3A5VA 3HCVA 1SFDA 3QUYB 4X9IA 3OPUA 1KGIA 3ZQ9A 3B7RL 1S7VB 2OMZB 4XNQA 2WTPA 4DO4A 4RFEB 2Q1EA 3ULSB 4JS7A 3LS4H 4R8WH 1EERB 3TTYA 4UYPA 1YECH 1OHZA 1OPOA 4GW4B 1NFDB 4W9GC 1N64H 1HSAB 1AH1A 4JKLA 3RIFF 3KPPB 2DD8H 5GRUH 4KMTH 2VUKA 4XPBL 4X9YA 4N8VG 3TBVA 4YBQC 1CGUA 3E8UH 4FNSA 2DEWX 1NMCC 2E9GA 3KYAA 1TPXC 2V7NB 1PNCA 4A7SA 2VDQB 2V9TA 2F1AA 1BOGB 4FI6A 4Q0XL 2K9UA 4QAWA 3VXUA 2HTKD 3W9EB 4ETYA 3PE9A 5I18L 4ANVA 1N5AB 2ZXGA 1CF8L 1HCFX 4LNRA 4PRBA 2WC7A 1ZGLB 1MWAA 1WFJA 4ZSOA 2DZEA 4F5CE 1A1OA 4LDEB 4NUGH 1TVBA 5IK3B 1EZVX 3NCCB 1NCCH 3ARDD 2P24B 4ZPVB 2GQHA 5JOPD 3DROB 2VXQA 3WTVA 3K6IA 3A22A 1MCJA 5F7MC 2F5BL 2CCLA 2ZZUT 5BS0E 3FNKA 3LKRA 4ZO7A 5EC1A 5DUML 2MRYA 4F37F 5BVJB 3UL4A 4QI3A 4QRRD 4X6BB 3TASA 3O6KH 1L9RA 3FRUB 5GS0D 1FFNA 1XX9C 3QPQC 3IBOA 4HGWA 2CMRH 1IJNA 3ALXA 3O6LH 5SWZD 5GJTH 5I5IA 2PYEA 2ZICA 4DK5A 2WLJA 5BPPA 2PW1A 3ES6A 3T2NH 1LNUA 1XDTT 4MCYA 1XGQA 2QTVA 3ME0B 4ZODA 3ARPA 1QRKA 1PY4A 3BGMB 1FVDB 3ESPA 3GBDA 2FECI 3NFSH 1E3FA 5TD4A 2NSXA 3UZQA 4D7PA 4GG8A 4LRNH 4QRQA 3V0IA 5EIIG 1I85C 2MQCA 4ABQA 4JBSA 3WIIH 4PTTB 1ECZA 2W91A 1NJ9B 3VFTA 4AQOA 4WWKD 1EDYA 1D9KA 2OR9H 3HZMB 4DP6X 1XEUA 2EKSA 3I6KA 3KWWB 3ARRA 3L45A 4NC1C 1AMXA 2FGWH 1FH5H 1VPOL 3BAYA 5EU5B 4L8SB 4X4XA 4KZCA 1RIUH 5IROA 4P4KD 3F5WB 3OJ2C 4H8UA 5TGBA 2X4OA 1BGXL 1AO7E 3MV7A 4N0FB 4AQZA 4AL8H 2IOOA 3VQMA 4Z95L 3RIKA 1RJZA 3HG4A 5E6IC 2IC2A 2VZSA 2J8OA 4ZPTA 5F9JA 1MFAH 4Z77B 3OKLB 3H0TA 4JN2B 4R84A 1FNAA 3BCFA 3DJSA 3NVQA 2GEEA 1DLHA 2VC2L 5IWLA 4KRNA 5DK0A 1R47A 4JO4H 4XH2B 2NY3C 1KJ3H 1SRDA 2XX1A 1IKNA 3V4LA 3BKJH 3ZKXB 5I5RA 3QPXL 1SY6H 3VFVB 3GJFB 5HHME 3SDDA 1GAFL 2MPAL 5FYJD 5AAPA 1G1CA 3O11B 3W2DL 3NIFF 5CEZE 4JEGB 3WFBH 2VDNL 2QR0B 2NXYB 1NSNH 4JFOA 4MA7H 3S34L 2A6JB 3B1TA 2IDUA 1AHWC 3C60C 1JV2A 3FT2B 5C09E 3L9RB 1D6EB 4CW1A 5TTRA 4ZX4A 4WU7A 1KMGA 2DM4A 5DJ2A 1HHIB 3ULUF 4K8RL 3SCMA 4LDOB 1P9MA 4U1KB 1NH6A 4Y4KB 3U79A 4F8OA 5BJTB 1XGZA 1HZKA 1E4HA 2EYSA 3CFKA 2X4RB 3GSOA 2X10A 4JAMB 2W65A 3VXQB 3GMMB 4CVXB 5A2CA 3T1WA 3HC3H 3N1MC 1U8IB 2K4WA 1TJHH 2E46A 4XCYA 1T2JA 2P8PA 1QFWL 2A6DB 4XP6H 4C56D 1TDQA 5L7XH 1LM8V 4OT1L 4LLDB 5AKTA 1HXMB 2XZQL 3FB6B 5IHZA 2VLKA 2N56A 4HWZA 2BP0A 2XG5A 3TWYA 5DVLA 1BXVA 2VDOH 1I3RA 3B3IB 3DSNA 4L23A 4OAWB 1ZLWH 2AAAA 1PDKA 2OK0L 4M5ZL 2VLKB 4OCRH 1ZHKB 2XQBH 3AM8C 1AZRA 3KYKH 1CVRA 2VDQH 3FTVA 3SY0B 3ZE0E 3GS7A 3RWJA 2VR9A 3OKDA 1CF8H 4MXVE 2XC8A 4ALAL 3X1NA 3H2PA 3U4KA 1MF2L 2Y2WA 5IVXA 1ZHBB 3IF1B 2UUDH 2P80D 4TMPA 1QR1A 1NOLA 3ZMEA 5JPMB 3WN5A 5I6KA 3G5YB 2XVKA 1KGWA 3MBWB 1TTUA 2WIIB 3D6GA 5D7LD 2A83A 2ZX5A 4YSPA 1J5OL 2YN3A 4QD2E 2OM5A 1H8OA 3GM8A 1CFNB 2GVYA 2NTSP 4PH8A 3SKNB 5FB8B 2UY7A 3RWIB 1PW3A 4TUOA 4J2QA 4H8WL 3HHSA 1AD0A 1C12B 3NCWA 3MRIA 3BJ91 4G8EA 3WJMB 2UY6B 5LBGA 2C9AA 3OAWA 4Z3IA 6FABH 4DP7X 5B7MA 1T4KA 1T83C 2ROXA 1YEDB 3OBAA 1DUZA 4QGTA 5TE7L 3L8QA 3UO1L 2X1OA 2CPUA 3ABKB 2EE2A 4GRLC 4MGXA 2YJLA 4PYHA 3NABL 3E7JA 2QSQA 5EEYA 4FHJA 4QRPB 5EEZA 1XF2A 1RJYB 4Y9FA 1HWHB 1R3IL 3SO5A 1OD7A 2XWTB 2DLIA 1IC5H 4YEEA 1F90H 4Z7UB 1BQLL 2CIKA 2IXQA 1CICC 2GJZB 4CL7A 4K5NA 1KCKA 1N67A 3WLBB 1DQQA 3IGAA 1D2OA 4GIAA 1KIQA 3IDIA 3O6MH 3QUMB 5HDWA 2Y72A 5TJWK 3QJXA 3I6KB 4PJCA 4UINH 4H1LG 5K1NA 3D3VD 4YWGL 5CMAB 5IEHA 3VWJC 5EIQA 1EAQA 3MO1B 2YGPA 4MS6A 4LVOC 4Q8BA 4AVIA 5F1OB 5SWSA 2IF7A 3KXFE 4FHKA 4I3GA 3A0OA 2AXFA 3IGLA 2DJ4A 4LU5H 1W72B 3EOTH 2VZ3A 3B8YA 1OVZA 4DNLA 5K33A 3QEGH 3M17A 1J5OH 1S7TB 5FECB 2X4QA 2YD0A 1IGFH 5MEND 4XVTH 1CGSL 4AIZA 4KMTL 4M29A 3K2UH 1VZIA 2TAAA 3MX0A 1ZY9A 4Q9BA 4HISA 3CUPB 3EYUH 2E9WA 4F91B 1ECYA 3MV9E 1MJJA 5BOZG 1YA5A 2YAPA 1KEGL 3WEMA 1N19A 1NOFA 4HF5L 4F27A 5KZCD 3HNVL 4IGBB 3ZHKA 1U58A 2IAMA 4I9XA 4ZPVA 1QRND 2MCAA 2PYFB 2YOAA 4G9DA 5E6UB 1N68A 2FX8H 5A6IA 4YBQD 2JJWA 3L81A 4M5YL 4MQSB 4PJ5D 3V0EA 3K4AA 1NCCL 3CCHA 5D96C 4HBCL 4BDVB 1YMME 2OI9B 2HTKC 2MOQA 3WY1A 5DMKB 3T3ME 1EJFA 1HVXA 2PXYA 1Z7JA 3P2BA 2EDYA 3U9PL 1P69B 3UBHA 1RU9L 2XCMC 1YPZE 3QEUB 4BQ8A 3BVTA 4DGIH 3J27A 3SPCA 4YJZL 4XX1G 4G6FD 2I7OA 2F53E 35C8L 1AGDB 5L2KA 5CJXC 2OXHB 4CU6A 4DN4H 4LHUG 5J8OA 3ARDC 1K5WA 2RA1A 2B08A 4ELKB 4FNLL 2GUOB 2V8LA 2FO8A 3TIEB 2KQMA 4DH2A 5G2NA 4U2YA 2L7QA 1E4XL 3C09B 1F8TL 1JZFA 3O2DA 4RFOL 4AX3A 4Y1SA 3BUQA 4YEFA 3SJVD 2NR6C 2F7IA 4K5OA 5JIDA 4DTGL 1GVIA 2H1PH 4TTDC 4NUQA 4AYBA 2NXZD 3QUZD 2BNRD 2A6IB 2WTRB 3EJCA 2R29A 4D3CH 3KPMB 3VXOB 5D2LA 3D33A 2EXYC 2GIMA 3MA7B 3VNYA 2PYFA 1XGRA 2BOCA 2V8MA 3HVNA 3HNVH 2GHWB 1GGTA 2ADYA 3BWAA 1P4IH 3QG7H 1HC1A 3SDCC 3TT3H 2EADA 3K72A 1Q9OA 4PCSA 2CDFA 3NSDA 4H8WH 2BSED 3EO9H 4JPVH 3T5WA 4V1DE 2H0EA 1IC7H 1H3TA 5E99H 3SE3C 4R2GC 5EO1B 4X4YB 2WLKA 4ZX5A 2XBTA 4GBXA 2KPNA 4NO2A 2Y24A 2YPKB 3QDJB 3FKUS 3ARGA 2X4QB 4V2CB 2WUCH 3C6SA 4JFZL 1X5AA 1QACA 4ZNCD 5FDYA 2E9JA 2KL6A 4JFQB 3GMOB 3OZ9H 5HI4C 2YBRB 3WGVB 2Q6WA 1K3IA 2E7DA 1JWMB 3AADB 3MC0A 3RL1B 5J89A 2BLFA 3BZEB 4TVPL 4A04A 3HRZA 3KJ6L 1PVHA 2XXFA 3ZHFA 3DUUA 4MVBC 3DMMB 1WFUA 1ADQH 1BG1A 1I82A 4KH9A 1T1XA 1T1WB 2IJ0C 2YAFA 5DS8A 3WS6A 4D9LH 1SM3L 1OCZB 3D0VA 1H5BC 2FJGB 2VUOA 4GRMB 2EDXA 3FUNA 5D7JA 2H1PL 2ID5A 1JP5A 1A5FL 3U6RB 3QFDB 4PVNA 5CSBA 4JM2B 3US1A 1ET7A 4WGVB 5GSRA 4DPCX 3G5XA 1R0AL 2XNAB 4YXLH 1KTCA 3P77B 3HNTL 5KSVB 2FLBT 3JWDL 5ICYB 2FLMA 3ZDXF 1G7MA 4QXUH 5IROD 2X70B 2VISA 3WHXB 2XTJD 1SF3A 4PV9A 2XWXA 1R5WB 4E41B 3CC5A 4HIEA 3LQAH 3MOBH 5BVPL 1T22B 2J1ZA 4PJEB 2OMTB 4PRHA 5JQIB 2XICA 3TIDB 3TO2A 4ZDHB 3EH5B 4AIEA 3UBXI 2CJUL 4AEIL 1OGAA 3S36H 3EBGA 4JQVA 4QF1A 1RZKC 5DC9B 4ZUUB 3S35H 4Z7VE 4ZUTA 3O41A 2FQDA 2WQRA 4NM8H 2FEDD 4P2AA 5HJBA 2PWHA 2XV2A 1A9EB 1SVZA 4QHPA 5FFGA 5AAMC 3LZOA 3MNZB 2NCMA 1YEWA 3FTWA 3SGJC 3AT9A 5HYSG 4MCZB 2DIBA 4L1TA 4YMPA 3T2NL 1UD5A 4N2GA 2F7PA 3RDTB 4N2OA 5ETUB 4IRSA 4OCMC 2V7HB 3FFCE 1Z0MA 4BQ6A 4EJ1C 5F0MB 4RMBA 5E1IA 1AI1H 2OMYB 1PTZA 2ITCA 3HJEA 4QRTB 2GG1A 1L0YA 5D7SH 1LP9F 4NKDB 3MTRA 3ROLA 1KBVA 4PGEA 5I1HH 1SGKA 3OMNB 4BK5C 5HJDA 4UV4L 3BVVA 5CKAA 2R2HB 4QJ4B 2UZIH 3WHE1 3CXFA 5D8JL 5JO5A 4NWUH 2AVFA 3OXRA 3FHAA 4FYSA 5I73B 1PF3A 1KCUH 2ESVA 4XPHL 4P4KA 3JTSB 4LSDA 4MZ2A 1JPSL 3SKOA 4OCXH 2HLFD 3HMWL 1II4E 3UAFA 5FECA 3QXVA 1WC7A 2X6BA 4RZCB 1UXWB 1E2VA 2XWBA 2CLRB 4Q9QL 4OZHB 1N0XH 1H3VA 3BESR 1RXLA 2AXFB 1A4CA 3ELAT 4LCIH 4K3EH 4U3SB 5GS3A 3UABA 5T5FH 1BF2A 1NEZB 5EWIH 4CMMB 5E4AA 3QG7L 5MENE 1ORQB 1ZHNB 2PTTA 3S48A 4G71B 1AKJA 2WO3B 2K6WA 4EQ3A 1VEOA 1C5BL 1M6OB 3UTTB 4GP4B 3J07A 4JHWH 1H6TA 3O11A 2N59A 3IDYC 4JGUA 4GO8A 4ONGH 1G94A 5CNHA 2E5EA 2E75C 3TEUA 3UAEA 4H40A 4FFVC 4BSWA 1PZCA 1XTMA 5DEZA 2C8NA 1MXGA 5CILL 1TKWA 4FXGA 4LKXB 4AZUA 5CCGE 3ARBD 2BJML 3FCBA 2B7DT 1JGVL 4A2MA 3FQXA 3F2LA 1JPEA 4K9JA 3QCTH 3N43B 1BFVH 3NA9H 4IHBA 2VE6A 4FOMA 3GMLA 4KK8C 5D1ZA 2C4FT 5F89B 3TVMB 1JRHI 4BEIA 2H1XA 1JD9A 1GGIL 2AI0L 2J4WL 3FXIC 3GQFA 1SHSA 3L16A 1GPOH 4WTXA 2YPLA 4OCXL 3LRKA 2W0FA 5K69A 2TSAA 4MA3A 1CYWA 1XBRA 1IGIL 3P3YA 4OLVH 4OLXH 5F21B 5F9AC 3LNGA 1MUJA 1HYRC 3C60D 4RQQB 4FNTA 5B8CC 4UNIA 1PX4A 2IFGA 3P4MB 2Z7WA 4I4WA 3EIFA 2LABA 3VXMA 4HIHA 4ZFFA 3DOSA 4RMVA 2XETA 1JI2A 3VRJA 3U46A 3BP7A 4K3JH 3UEZA 4PVMA 1VZHA 2LT9A 4WHTB 2OYMA 2Q7YA 2O6PA 1I1YB 4OIIL 1OTUC 2EE6A 4KKQA 5HDBF 4PY7A 4ORGA 3BKML 5EU3A 2Z31A 1SN2A 3AY2A 4N2MA 5AL0A 2F1BA 2IQ9H 4LIQH 4D94A 5IQ7H 4K3HA 4D0BA 2D2OA 3MLXL 4HS3A 4R97C 5GRJH 4Y16A 3BN3B 2IPTH 3B7TA 3MOAH 1EJ8A 3O3BA 3AU1A 4DCQA 5FYKL 4MNQA 1B2YA 4K3GA 2CUIA 3CFEB 3G04A 4W4OA 3MRCB 3CFKB 4GUPA 3U7WL 3NJGA 1Z66A 1KCVL 5FO8A 3OB0H 2R1XB 2O5ZH 2H2SC 3ATDA 2R0WH 4HS6B 2VAAB 4KC3B 2X4SA 1SLUA 4PJ5A 1MJ8H 3MNWA 2B20A 4GKOA 4ACPA 2BH0A 1KPVB 3BXNA 4H1LH 5B38B 2YSSA 2R59A 1G7PB 1JN6A 2EXYD 2NY5H 5DT1H 3V0AC 1LK3H 4CBPA 3RWEB 3ARUA 3QO0B 1VEMA 3C75A 3ZTJH 3DGCR 3SDCD 4LPVA 2P8LA 4EUPG 3IFOB 3VH8B 2GC7C 4PB9H 3LX9A 2DEYX 2P5WB 3OAYK 4X6FB 5AVSB 4UQ9A 3TVMC 3ZK0A 3KE0A 5CP3A 4ZMQA 2Q8BL 3GNML 3QH3A 2Z8WC 4RFEA 3MUGB 1REIA 5B1CA 3UPCA 2BNUA 5CEZD 4FXKA 1HOCB 5JUEH 4HPOH 2VRAA 1CICD 4QXTA 5T5FL 3SKUD 1ROWA 1J9QA 3MJ7B 3LB6D 5LGJA 4YDVA 1WITA 2OCJA 3K2UL 5CSZA 2CD0A 5GJSH 2MHAA 5IFHL 4G8FA 1QHPA 2VR7A 3CSFA 4OFVA 4A6YB 3ZKXC 4DZBB 4YHLL 5A2KH 1AO7D 1O7DC 3MCKB 4OF8A 2O5ZL 3QDHA 4N5EC 4N2NA 2VR4A 5IB3B 1A6WL 3FU6A 2F53B 3ML8A 4ODBD 5FLUA 2Z6FA 2ICEC 5DMGD 3VD3A 3KLDA 1AJ7H 3DIDA 3KDMA 2B1OA 3LQAL 1FNGB 2NXZB 1GGYA 3IFPB 3K2MC 4ZMPA 5F3BB 1IAIL 4Z7QB 2X4PA 4LSTL 2J8HA 2P8LB 4OFYA 2VUYA 2I69A 3EJRA 4LF3B 3ZUNC 4OZ4B 5A2JH 4HIIB 5KYXA 5JIIA 2YK1H 1GXEA 1KB9K 1CZ8L 4RESB 4W9EC 3TJEH 1GS7A 1QSZA 4TVPE 1X5GA 1BCIA 1WYJA 2R39A 1DJIA 3CXDL 3L13A 4X6FA 3C8KB 3VXRA 1VERA 1Q0YH 4Z95H 1CFSB 4HETA 3UC0H 5D71H 2JVUA 4FA6A 3SD5A 3RAJH 2K9FB 1KY6A 3KW7A 5JTWA 3C6LB 1DQDL 2XPYA 4R4BB 1FE8L 3OR6B 2L04A 4OLYL 3WDHA 3L6FB 5BO1H 1N59B 3DHMA 1MCSA 3GKWL 4TQPA 1QKZH 2ILLA 2D03L 1MWAB 1LP9B 3AXHA 5AVQB 4B96A 3L3JA 2CLVA 4ZYKA 4NQCD 4NBZB 5CZKA 4OIFA 2XU9A 3KJ4C 3BT2L 4OZFB 4PP2A 3IJHB 3ZE2B 4FKHA 2C9RA 3C5SA 1BJ8A 2VWEE 4Y7MA 3SKOB 3CXHK 2R1XA 4PM1A 4OFQA 3SJVB 4HP5A 4JE4B 3GZQA 2X87A 4KOBA 3TEXA 5HVHB 4QHKI 1I31A 3T8VA 3A47A 4DGWC 1OHQA 4UBDD 3HPJB 2GSGA 1U36A 5EUOB 4YZFF 3LNHA 4NUPA 3IMRA 2R2BA 1MFBH 1DQIA 3DOIA 7CGTA 2GT9B 3CZFB 1QLRA 3WO3B 1SLWA 3D39A 2AQ2A 3KH4A 1HDMA 5E03A 1A3RH 4ZTPL 2PR4L 1YQVL 2CKBL 5F3BA 5E5UB 4NFBA 1A7PH 3UBXA 3OXSB 3CPLA 4FQ1L 5AOIA 1YEEL 1DVTA 2Y1ZA 2OBGA 4JFVA 4KZDH 1U3HD 1BMGA 3CDGA 4RQQA 3WDJA 2CDGB 3X14B 3S3SA 4ZUUA 4E9LA 2RQEA 2FHBA 2X2IA 3D18B 2OMVB 1QRNB 2WB1A 4QHKJ 4UT7H 3LQZB 5C0NC 4L8CB 1CGYA 4FLQA 3VXMB 5GGTH 1AQMA 1P7BA 1SM3H 5KOVC 3AGWA 4J2XA 1ZTMA 3ZPDA 3OR7B 3D69B 2ZCHL 4PVLA 5CP3H 3BSZA 4LFHD 2V0AA 4RMSA 5GIRB 1ACCA 2YAOA 3HOGA 2FSDA 4K7FB 1CE6A 4X6CF 3TCLA 5D5ME 3GZKA 4L9DA 2AXHA 5TDPA 3ZKSD 4AKOA 5CCKL 3LH9A 5IFAL 3RJOA 3KPNA 1L9MA 1WQVT 2NY6C 5G4OA 2CUMA 1S5HA 3GEWB 2IADA 2RR3A 3QNFA 1UT9A 2VLJD 2EO1A 1NEUA 1R75A 2JI3A 4RVBA 1TKWB 3HBPA 4TOYL 5J13C 5LO7A 3X3GL 4ZW7A 2CA3A 3L5WA 3BMWA 3FHEA 5FW7A 4CMMA 1JXFA 4XNBA 3MA9L 2A4ZA 5CEYB 3ZT7A 1X4XA 4Y0GA 5J9PB 1FCCA 1GYCA 4XAKE 1I8IA 3BVNB 3INOA 4I3SH 3NJVA 2E47A 1LD9B 1BZDA 2HJLA 2W1NA 3PHQA 4OLEA 1YNKH 3BFOA 5JDSB 4NZJA 3ARZA 4EQ2A 1ZIBA 1EQWA 3RX5A 2Q3XA 3DXAB 3SYCA 1GZQA 4MQXC 2QV2A 1T80A 1YEGH 3VXSD 2AJUH 2ENJA 4MBRA 5FR3A 3V10A 2I7SA 4KO7A 4ZOBA 3ZKNC 1E9OA 5A1AA 1S9YB 5D1ZD 1OTUD 4XP1L 4TRPL 3TT1L 2YD1A 2WWNA 4HZLA 1F4WL 2BDNH 5C0BD 1AS7A 1RPKA 1Z3RA 4WO4C 4X7SH 3P0YL 5JO5B 2F58L 1FE8H 1ZVSA 4XCEB 1E3XA 3MA7A 2WBKA 5FCSH 2VC2B 1K5NB 2Z31B 2KT6A 1CUOA 2H4EA 1YEJL 3H6AA 3KPMA 2A9AA 4NQTA 3QWOB 2BXZA 3FH8A 2BSRB 4KUZH 4GT7A 1F11B 2QSTA 4PS4L 1XF1A 3QJVB 4KX7A 5EU4B 5L88L 4P2OB 3NIFE 1NCGA 2AMUA 4HUXB 5KS9A 3ULVE 2IANA 2KERA 4CSPA 1AGCB 2X1QA 5GGUA 4MWFB 4O9HH 4N24A 2AKRB 3HPLA 4J3WA 4R26H 4X83A 2FGWL 2J1KA 2H2SD 2OXHA 4PS3A 3L3OA 3P4MA 3VFWA 2IGFL 2J8UA 4LSPH 1YNKL 1RIHH 2WHVA 4O2EA 4Y2DD 4WDIA 5JW5A 1JZ4A 1A6UH 4PJ7F 1I9IH 1NGYB 1U92B 2CO4A 5LNEA 4K7PY 4IRJC 1WT5A 2CDEA 3MGTB 2V3EA 3D85D 2AQSA 5ANMB 1OAUH 1OGAB 2AJUL 4JM0A 2YRBA 3GSNA 5IB5A 2WBWB 2OMTA 3PP3H 4PRHB 4V2BA 2I32A 4YVUA 5KSVA 1L9OA 4QHLB 1EHNA 4MNQD 4YGVB 1VFBA 2D0GA 3CZSA 5I66A 1ZK9A 4CU8A 1DN0A 3QFDA 3GK8H 1VFAA 1YJDH 3DGGB 1JD7A 1L5GB 2XI9A 4QLRA 4JY5L 4H4NA 3FQNA 3SOBL 4N9GA 1G1OA 4QYOB 4UT7L 4U05A 3VSVA 4LVOB 3P77A 4NNPL 3VSQA 4L1SA 2AJ3A 2D73A 3FQTB 3L5IA 5KVDH 2ATPA 1R17A 1MHCB 1NEZG 1TQBB 3WTYA 2ZOTA 1E8YA 2UWEB 4LLYA 5HHPB 2DH2A 3IN0A 4NNXA 4X9HA 2MMXA 4XWGH 1BVZA 2YUWA 4JG5A 4L3AA 1IQDA 5JIQA 1S7TA 1KB5L 4PJAE 1EIBA 4BKSC 1U91A 5LN4A 2XZCH 2VMJA 4JPKL 4PRPB 1I8LA 4K7PX 2EYTA 1FN4B 2YJQA 5J11C 2YD3A 4QJ5B 4RNRA 4NKOA 4K9EH 4N5ED 2B1AH 3LIZH 4KK8D 2YR3A 3HNSH 3K6SB 3EH4B 3V5KB 1P4BH 5IW3A 3HFMH 1S5IL 3AWFA 4P2QE 2VKXA 3BH4A 1IQDB 1KGYE 5F88B 3Q6FA 2ZXQA 4XMKL 1WAEA 2CUAA 3K72B 5C08E 5C3IA 3IKCA 4LLYB 1RQ5A 4UM9D 4NGHL 4MX7B 5DD6A 3WLBA 2B14A 4LP8A 5DJDA 5HGAA 4JVUA 5CZXD 2R2HA 1URIA 2DLTA 2W94A 3QWRA 5LDUA 3C87A 3B9KA 2NDGA 4L4TE 1CL7I 1ZOXA 3CGTA 5D1QC 3VXOA 3PPSA 4Z3JA 4L0YA 1KJMB 4HSCX 4M7ZC 4PCTA 4UDTA 2WINA 3WG7B 3MRLB 3MRGB 1X5MA 4DPAX 2E86A 4WI8A 3O0LA 3SDXA 4PWGA 3MV7E 2VMFA 5D6DA 4AI7A 2HJFB 2VDPB 5ALBL 1UWXH 3O3DB 1DUZB 5EUKB 3R7QA 1DBBL 3VFGH 2WZ0A 2JLPA 1O7SA 1UENA 4RX4A 4G9FA 3RVWD 3MRIB 3STZB 3MYZA 2VSCA 1IBBA 5J4MA 3NIGE 2ICWA 3O41B 3OKMB 2GUOA 1FZMB 4GO9A 2J8UB 3M86A 1N3NA 4W93A 4UU9B 2R69L 4WNSA 3VI4E 2CCVA 2DWTA 1L7TH 2K78A 4ZDHA 2AKRA 1YY8A 3BKYH 3HPLB 1ZS8A 4JDVB 2QLVB 3ZQWA 2DQFB 5DEGA 3UAJA 1BBJB 4PS4H 4OZHE 5EMYA 1SDDA 3GS4A 2LOEA 3FO9B 1QBBA 2JELL 4G7SB 3L2NA 3SE4C 3ARFB 2VN3A 3RX9A 5IHHA 1USQA 3GS0A 3PWVB 1U8CA 2AXGA 3TXAA 2HT3C 2ZUWA 2GK2A 3OL2A 1OALA 2AJVL 2VMDA 1T04B 2VM3A 4ISVA 5JR1H 1KSRA 2Y23A 2W9LA 2OPCA 5FUCC 5GS1C 3RGHA 5H35B 5JHDD 2ITEA 4Z5RA 3WSQL 1DUYB 3O4LB 1P4LA 1R1CA 2X7LB 3EOAA 4HLJA 5DLLA 4H8QA 3SBWA 3WFBL 1CTMA 1U3YA 4KV5F 5D2NB 4WNQA 4E5XG 1FG2A 3U30C 5DS8B 1ESOA 3TVMD 1NCAL 2CWRA 1FYHB 5C0ND 5MP6H 2DQIL 4KKBD 4I1PA 2K6ZA 3O2WL 1GKEA 1HEHC 1BF5A 2ZKXA 3S36X 1FC1A 3RL1A 1A9VA 1UOKA 4GO6B 2PPCA 3GPSA 4AIZB 1HIML 2WB7A 2MH4A 1RCYA 4IU3A 2MQGA 2OULB 5CWSB 5DFAA 1INQB 4YNYB 3K1KC 3Q8BA 1CN4A 1QFWM 4EPSA 1KFGA 1O6SB 2R56H 3H2QA 3UTZB 4M4PA 3LN4A 3M8OL 5AVRB 2HSIA 1VA9A 1UD2A 4LLQB 1Z9NA 3MLVL 3MKGA 1MSPA 1CC3A 2QDVA 4F9PA 3EGSA 5CR1A 1MHCA 3CWGA 2BZDA 3EBAA 4FYQA 4FCHA 3SDDB 2IXQB 1MJ8L 1EHXA 3C5XA 4DERA 1FBIL 1K85A 1KJVB 4Z23A 4PJGB 5I6XC 4M6OL 1BLNA 2YEZA 4FQCH 2WSKA 5DMGC 5E95B 2X05A 5J1AA 2FZ3A 4YK4B 4NM4L 4GG6A 1WUZA 2CBMA 1XGRB 4PCYA 4B50A 5JXEA 1B4JH 3GIZL 2BVPA 2WOYA 3DDFA 5C8JA 4KV5E 5DD1H 1Q72L 4W9CC 3W11C 4JFPB 5LGYA 3CAFA 2RTTA 4PJBF 3ZTDC 1L6PA 1W8EA 4XHJD 1KTBA 4ATWA 4IBYA 5C0EA 4L8SA 4X4XB 1SOSA 1AD9A 4I7ZC 5IQMA 4PRPE 1R9FA 4PCKA 2R7EA 3VD7A 4UNVA 3JSSA 4HAKA 5B38G 2XTSA 2GSMB 1IVTA 2OTUA 1E4XH 1YEDA 3QUXD 1H8NA 2DMHA 2VDPL 5E0FA 4DGYH 3R06B 4A2EA 4OY9A 1DQVA 3W3BA 4RBPH 5HPOA 3H9YA 3ZKND 4GXUN 2V9QA 4MWFA 2QDWA 3DC0A 1DSFL 1UWEL 1UZ6E 3NCJL 5IHUL 5I74C 5T3XE 4EXPX 3QJOA 3KXFA 2ROYA 4J5VA 2K3TA 2YIHA 4WO4D 3REWA 1MVYA 3T71A 4MNHB 3MLVH 2DM3A 2FJHA 4PHXA 5IW1B 1IFGA 4L3ED 3DV4B 1D6VH 4IHOB 4M6AA 5EZLB 2WN3A 2YHGA 4IBSA 1GR7A 3HAEG 2E27H 3KYNA 3RGVC 1CE1L 2EAEA 3SSGA 3WLWD 5IVXB 1SHWA 3KVDD 5E1AB 4ZTEA 3CZFA 5DS1A 4BGDA 1NMAL 3S8FB 5FIEA 1TZAA 2G3MA 3PQYE 3TNNB 1D5BA 3SPIA 1RZFL 1QR4A 3MV8D 4Y9CA 1GGCH 1JTPA 1LMKA 5L7XL 1ND0A 2W60A 2XZQH 5KSAC 2XYBA 1JRHL 4Z76B 2BS8A 4E41D 1EBPA 4PMEA 1DE4A 5CXPA 2B0SH 1JPTH 2XTJB 3UYRL 5C7XL 1IGJB 4P07A 1F1GA 4F33B 1ILUA 2FJHB 4Q9QH 3P2TA 1RZ8B 1NDGB 1P7HL 4I0CC 1FNSL 4F58H 4OLYH 2QBWA 5KUKA 4HJ1A 4IRZL 4JAMA 3GKWH 2VZVA 2CK0H 2VZUA 4XZ4A 5F3FA 3GRWA 1AYOA 5ICUA 4JFDA 3DRTA 1OB0A 2NT0A 4EOWH 1CT8A 4G7VL 4FS0A 5BMFL 4KITB 2MTPA 5E6IB 4WU7B 2CGRH 1YEHL 5CD5C 1F4YH 2HH0H 5FHAH 1HSAA 1CFSA 1KJ2A 3FSAA 3OQ3B 2Q20A 3VXRB 1CL7H 4F93B 1ZA6B 2BZ7A 1QSVA 2DWEA 4Z7NE 3QUMA 4YLQT 1TZIA 4ZUSB 3PQYA 3B1UA 2YGQA 4AZ8B 2R1YA 1RUKL 1IT9H 1RZIA 3QUYA 4R3SA 4G7RB 2B15A 1RK1A 3S4SA 1R3LA 3QORD 3TBYA 3VI3E 4XB8A 4TXVB 3ZDZF 3G9VA 2QGEA 2VXSH 2MCPL 5IR1A 2HG5B 1NCBH 1XSOA 3ILDA 2H41A 3JWNE 1QTSA 5F9OH 2WXKA 4NX0A 4UOW1 1IGYB 4DGIL 4F8LA 3POHA 1Q94B 2X4NA 3QCVH 1D7CA 1V7ML 4OTXL 3A4DA 3BZFA 3TT1H 5EU5A 5SX4I 2PKDA 4YHOH 5F1IB 5IQOA 4POUB 4G6MH 4LPXA 3S98A 2MHAB 5T1DL 3IGKA 3SGKC 3EJYD 3GUTB 2F8IA 3UTZA 2A83B 3IXAB 1SNRA 4ODWB 1KTLA 3PWJA 1MDTA 3GBNH 4HCRH 4P2CG 5GPRA 4CVWA 1NJ9A 3VFTB 4PV1C 1XAKA 1MCKA 2AJSL 4AM0Q 3I85A 5D1QD 1VESA 5LGKA 4RGNC 2BS71 2HXAA 5JHLH 2IAND 4Y5VC 3MU3A 4BXVA 2XQ0A 5FGCB 4L4VA 2QHRL 2ZOLB 1DBML 2UZYA 3VCLB 3VI3A 2R0ZH 3I9IA 1NKGA 1CIUA 3KCPA 3GF8A 4X80L 3TT3L 2PYEB 2JFCA 3W5MA 3BP6A 1YEFL 1OEZW 2VLKE 5E6YA 1FGNL 4PTUB 5DUBA 3NCJH 2EXSA 4HWZB 5F7HA 1UJ3A 3BE1L 1T04A 3PY9A 5DEJA 1FO0L 4W6XB 7PCYA 1ZDSA 2AXGB 4KRMB 4GW5B 2HG0A 2VAAA 4PJ5B 1D5MB 3IAQA 1QATA 2W65B 2BNRB 3VXQA 3HBGA 5ADPL 3IDUA 3G6AB 5TH2A 1NCOA 1IIKA 4J39A 3T2QA 3SE8H 2ERJC 4PRID 1WO2A 2N7BA 4JDZB 2J20A 1OT1A 1D7FA 5E8DL 3V5DB 3AU1B 2L7JA 2A73B 1D6EA 1DQKA 2HRGA 5BO1L 4CW1B 5LXGH 5JXAL 2VM4A 1MNUH 5C08D 1H3PL 3X1BA 4JNXA 1CXKA 2HFFB 2P3YA 5BRQA 2BM3A 3MNDA 1ZSDB 4I13B 2A74A 4XBMA 4L1HA 4IBTA 4ZFQA 3QDGB 2HUEA 2WKLA 2BIIA 3HCVB 4MMXC 3N85H 4EI6B 4OZ4A 3LKQB 4AM0B 4HDIA 4P23D 3HLKA 1OT2A 4ORGB 43CAB 4XH2A 4TQEH 1SOXA 2CR0A 2WLYA 5INCB 1T66D 1H6EA 2DQDH 7TAAA 2IDQA 2VLRE 1IUZA 3GMQA 4RAUA 4A7UA 1I1RA 4V1DD 4O4YL 3KYOB 5LBSH 4QRUA 4QXWA 5TF1H 3SO3B 5JW4N 3JV5A 4NZUL 3F04A 4AVKA 1OAZL 3QDMB 4R5VA 3MVSA 1AXTH 4ZBJA 4EDWH 1HH9A 1QFOA 1X44A 2Y25A 2X2HA 4FQCL 2ADIA 1LEGB 4JO3H 3T0ED 3QR1A 3LN5A 4X9GA 3SPJA 1V8HA 4O02H 4G7YH 3R1GH 4U1HA 4X6CE 4K3JL 3SE9H 8FABA 3B6SB 3CDYA 3GIVB 4NM8L 1GTFA 1PKOA 3G08B 4FQIL 1OM9A 4NQEA 4GQPH 4YDIL 4YSDA 2QFRA 5C0CE 3EO9L 4AYSA 3ULVH 3SJVE 4MJ6A 2KC0A 1W9XA 1FNEA 1C08B 2AQ3A 2BP8B 4HKBA 3VACA 1QFHA 5BOPA 5DQDH 5E9DA 1HKLL 2GITB 2G5BB 2WXNA 5JMOC 4KZEH 1U91B 4GB9A 1J11A 5E6RB 2WYHA 1LMIA 5EU6D 1LNUB 3JTTB 4BFIA 3FOLB 3TPUB 1U8LA 2VLRA 4AL8C 2J57A 3KD4A 3QZWA 4HGWB 1RUAH 3L7FA 3MR9A 2GJ6A 4PRAB 5D71L 4KZ0A 1FZOA 5I2IB 2K4AA 1U8JB 3LYRA 3GC3A 3FQRB 1FCGA 1ZHLB 4OGZA 3SKMA 4YAQA 4J8RA 4FG0A 1ASOA 5CCKH 4N9GB 4QYOA 4PBWD 7FABL 4X6DA 5K9KB 2I9LB 3PAUA 5B1JC 5MI0C 3UAJD 2WLZA 2XFXA 1W16A 1J48A 1CGSH 3QUXC 4Y5XB 1OV8A 4HS6A 3SZ6A 3EDEA 3ZMNA 2QKIA 5C0DB 5FO8B 1PCXA 4Y4FC 2W38A 4YGVA 4MBOA 1IJ9A 2OW6A 4HV8B 2AK4D 5HYQA 1JYXA 4LNRB 4PRBB 2OR9L 2Z4TA 1KEGH 4Y2OB 1J8HB