5KBDA

Structural studies of transcription factor p73 dna binding domain bound to pa26 20-mer response element
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
201
structure length
201
Chain Sequence
HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor protein p73
publication title Structural Studies of Transcription Factor p73 DNA Binding Domain Bound to PA26 20-mer Response Element
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kbdA00
3KZ8A 2MEJB 3IGLA 2AHIA 2PCXA 3Q01A 1EAQA 4LO9A 3D06A 5ABAA 4AGMA 2BIPA 5A7BA 1HU8A 3D0AA 3EXLA 2OCJA 1TUPA 2BIQA 4A63A 4G83A 2RMNA 3QYMA 5G4NA 5G4OA 3WTUA 2J21A 3US0A 1IO4C 1TSRA 1HJCA 1T4WA 5AOIA 1HJBC 1GZHA 2WGXA 5LAPA 3WTWA 3WTSA 2X0WA 4AGPA 2BINA 2YBGA 2ADYA 3ZMEA 2IOOA 4AGQA 2FEJA 4MZRA 2J1XA 4HJEA 2GEQA 5AOMA 4XR8C 1EAOA 2J20A 3WTYA 3VD0A 4GUOA 1H9DA 4L0ZA 2XWCA 4QO1B 2VUKA 1KZYA 4AGOA 4IJTA 4IBTA 3D09A 5KBDA 4AGLA 2XWRA 2X0UA 4IBSA 2AC0A 4AGNA 4L0YA 2BIOA 2J1WA 1CMOA 3D05A 3EXJA 4MZIA 1E50A 3D07A 5ECGA 1UOLA 4LOFA 2H1LM 4GUQA 3WTVA 1CO1A 2J1YA 3TS8A 3D08A 4KVPA 5AB9A 2IOMA 1EANA 3IGKA 4LOEA 4IBWA 4G82A 5LGYA 2J1ZA 5AOKA 5AOLA 4L18A 1YCSA 3WTXA 5G4MA 3QYNA 3VD1A 2IOIA 3US1A 4IBVA 3KMDA 2X0VA 4IBUA 3VD2A 4IBYA 5BUAA 3Q05A 2P52A 1GZHC 4IBQA 3Q06A 3WTTA 1LJMA 2BIMA 2ATAA 3WU1A 2J6WA 4IBZA 5AOJA
chains in the Genus database with same CATH superfamily
2DTMH 5IMOB 4BCYA 3SKOA 1IAMA 2VMDA 4BGLA 2PPFA 4AY0A 3VSTA 2ENSA 3MA7A 3WUWG 4NDMA 3MJ8B 1OSZA 2ZWSA 4Q2ZB 5EZJB 3S35H 1MCWW 1XMEB 4I4WB 3EGSA 4HETA 4IS6A 4WU5B 4QUOA 4WHCA 4X50A 2Y7QB 4ZFZA 4O4YH 1PGRB 3R06A 2H1PH 3L1OH 2X42A 3MCLH 3APFA 4O00A 4IHOB 3FSZA 5E1IA 4PJIB 3PWNA 1XR9A 1YNKL 2WKOF 2X1XR 3GMNB 3OSVA 2BSSB 1IO4C 3IFPA 2X40A 3U0TB 1GIGH 3S35L 5E7FA 3SIKA 4A6YH 3TYFB 2VZUA 3L1OL 3MCLL 4FEIA 1KB5L 2XQ0A 4DCQA 2QQQA 3K4DA 4N8VG 3WUZA 3ZTEA 4AEFA 1CDCA 3C6SA 4EQ2A 2X7LB 3P30H 4DUVA 2CGZA 1KTKE 1GIGL 1UWGH 3L45A 4FYTA 5FDWA 3ILQC 2AV1A 4IMKC 5FA4B 4X5LA 3L6FA 3MX0B 4PJGB 1MSPA 1T0NB 4JO1H 3O6LH 5IMMA 1BQ5A 3ZHDA 4EUPB 4HPOH 5F7BA 1O9ZA 2KC0A 1U8NA 4IRJD 1UXMA 3ZK0A 5KSBB 3VI3B 4NNPL 3I9GL 1RZ8B 2QMJA 5KANI 1UWGL 2X9WA 3S8WA 2HFTA 1JZ4A 1GPOH 1I8IA 2EE0A 4JO1L 3QJFB 4ILDA 4A2LA 3OKKA 4QTIH 1RURH 3EZJB 3F6LA 2NNFA 3HHSA 1USZA 1MFEH 4PWGA 1BF5A 1X7TA 5C0BA 3ECBA 2VC2B 3RWEA 1BM3H 4QCIA 1J8SA 1IKOP 4ZOEA 4L37A 1JZGA 1D5MA 1NIFA 2YGNA 2UUDH 1M7IA 3LH9A 4F2MA 2LLLA 1RURL 2WBKA 4JFFB 4Y1AE 4MMZA 4ZFFB 2F8IA 1DJZA 1MG2C 1UOVA 5E8OB 4A1RA 1MFEL 1URZA 4UMSA 2YMXL 7CGTA 3CVIL 4HD5A 2E59A 3OAUH 4X6DA 4Z3GA 2EYTB 4XCEA 3PE9A 5C2UB 2X44D 2MOQA 2ZWKA 1OTSC 1TKWA 2DEXX 3MKKA 1SDAB 3ISWA 4YL4A 3FUKA 4WKXA 1M9SA 1F8TH 4HLZG 4PAZA 5H37G 1WHPA 1LP9E 2ZOOA 4LB8A 2BS8A 3OAUL 3ZOAA 3QUYC 2YA1A 3IDJA 1A1OB 4GQZA 5CZKA 4PH8A 5E6IA 2WXRA 3FRUA 4ZSOE 4DOHB 4KKQA 1JWSA 4XHQA 4C8XA 2QDVA 3II2A 2UY6A 5EO9A 2D0HA 3VVWA 2VN6A 3ROLB 1NCAH 5JXEA 5KVMC 1VFOA 3CBJB 4YR6B 3MBWA 3WDJA 1OAKL 1HCZA 1IBZA 4XO5A 1E8XA 2A1WH 2YQGA 4PJDA 3M45A 3M7OA 1FL6B 1T20B 2WMPB 4X6CE 1YEKH 4RMVA 1CPUA 3RPKA 1T1YB 3I02A 4W9CC 4TM9A 4OAWB 4NQDA 5JHLH 1NCAL 2Z6FA 4PVBA 2Z31D 2WXGA 32C2B 2N7SA 1RLBA 2PYED 3BHBA 3MVSA 1LE5B 1XBRA 5IHUL 3LKNB 4AVKA 1ZS2A 1IGFH 2X88A 1CI3M 5T5NG 2BNRB 4LCCC 5F0JB 5JHLL 5EBWB 4U7MA 5C71A 1S9YB 3FCBA 2UY7B 2L3BA 1DR9A 1WV7T 2OPCA 1OP5K 3O3AB 4I5BB 5SWZA 2RTTA 3FRPA 3RWHA 1JRHI 4A6YA 4BK4A 3LZNA 4OJCA 4MD5A 1IGFL 3C5JB 2EDFA 4JFWA 5EF1A 3ULUE 4GMSH 2X6UA 1R9FA 2YFOA 1MHEB 4D0BB 4Y5VA 2FRGP 2ENYA 3VTTA 3AU1A 2VL4A 1C16B 2VJ8A 5A6MA 1GR7A 3DX9A 3HCVA 5KSAD 4ZO8A 1P4BH 4J1UB 2CXKA 1HH9B 1OQXA 1GGCH 2FIRT 3PV6B 1VADA 5INCA 3WL9A 3B6SB 2AV7A 3KPSD 3DX2A 4GXFA 5IJVA 2XTJB 4GMSL 3IMUA 2B59A 3QIUA 4NIKB 2PTTB 1WA1X 2J6EA 3PQYA 4QXUH 2YR3A 3T3PB 3C8DA 3WJMA 2DY2A 2FWLB 3ARSA 1L5GB 1ZMYA 5F9JB 1P4BL 2B20A 4N2FA 1GGCL 2AAVA 1IGML 1DQIA 4OCRH 5AVQB 3X1EA 4DUWA 1C5DA 4ODUB 1EEYA 3KR3L 1L7IH 1FVCA 3CLWA 5LDSA 1NM9A 2KERA 3B8SA 1L9MA 4XXWA 3CLFH 5J57B 1DSWA 4O2FB 4NC0B 4OCRL 2X6CA 3DUSB 1UUSA 4I18A 4GW1B 4XN5A 5K9KA 3QUKB 3GBML 1L7IL 4X99B 3VH8G 3M1OA 1LDPL 2WBJA 1CR9L 1SJHB 3F04A 4FCHA 4ELMF 2PP9A 4N2KA 5HSFA 1EUUA 2HT3D 2I25N 3G5VA 3KS0H 1INQB 1PYWB 2CA3A 4HAGA 1CFSA 1SN2A 4KHTH 3ARBD 5EIIB 2BIQA 3RVWD 1FFOA 5J89A 3GTNA 2F7PA 4X8JA 4HS6A 1JIBA 2EACA 2BVEA 3R0MA 4LHJB 4NN5B 4NN5C 1RHFA 3CQFA 4ZT1A 5EULV 4MMXB 3D7PA 3L4WA 4K3EH 3VGHA 2FJGB 4V33A 5IB5A 3WKQA 2JTYA 4LCWB 4QJ5B 2VM4A 2OL3H 3HG1A 2DN7A 4IJ3C 2GK2A 4HUWB 4HS8L 1MJ7L 1R3LB 5ACLA 2CK0H 5F6HJ 3V4PH 1RZGA 4MZ2A 4KK8D 2WTRA 4IIQB 1KT2B 1M3JA 4TNEA 1OGTB 1KCRH 5IK3B 1V7NH 2X9XA 4QRRD 2WHVA 2EH7L 2UX7A 2QSCH 3DLQR 4K3EL 4R3SA 4TQIA 4AEHH 3N1GC 3DXAD 3V95A 3FMGH 4HJTA 5JDSB 5FOBB 3V0EA 1YEFL 5BQDA 4JJHA 2PO6A 3TJEH 4IKLA 3BYYA 3IEAA 1J11A 2CK0L 3V4PL 2JCCA 4HGMA 3PGCA 4KVCH 2HP4A 3S0PA 3MLVH 4QHMA 5B39A 1FCGA 5JHLA 1KCRL 4JQXC 3AQDA 2LT9A 3OGOE 1AC0A 3ESOA 1TQVA 3D2TA 3WAJA 3SCMB 5FA3B 5AW0B 1XSJA 1VCAA 4PYGA 4AEHL 1TJGH 1WK0A 1ZHBB 4PW4A 1JPTH 3FMGL 3GMOB 4DHLA 3TJEL 4OZFA 1TZHA 3LH2L 4OZGF 2CUMA 3G6JE 4LASH 1RP9A 3OTTA 3CPLB 2A6DB 1L9PA 1Y07A 5HYIA 1FV1A 5ITBL 4ISVA 4KVCL 5D71H 3MLVL 4KUCD 3GB7A 3IJHB 5KSVB 4GXVH 2NTSP 3VWKB 4JZNA 4XMZA 2XJLA 4EBQH 1TJGL 1D5XB 5DA4A 5K93A 1EJFA 2PCFA 2P5EB 5DO2D 4LASL 2DIBA 4PV9A 4Z95L 1AYRA 4W9DC 5T1LB 1E27B 5EU6E 1TYJA 2XX0A 1I9RH 2XQYK 1DZBA 2YUXA 5D71L 3V5DA 4P2AA 5TPWH 4CUCA 5BS0B 1TNNA 5I15H 1FVEB 1F00I 4HXBH 1HHJB 1I8LA 1YY9C 4GXVL 1NAKL 2DIAA 1GH7A 3JSSA 4RVBA 2J55A 4ODHH 1XO8A 4AJYV 4EBQL 1IBDA 2JVUA 4ZJ9A 2NYKA 4OT1H 1EHLH 1ZEAL 2BS9A 2X9YA 4F7MB 5D93B 1L6PA 5D93C 4HXBL 1INEL 3L7FA 2Y24A 5C0DA 3ZZLA 4WW1B 4UT7H 4WO4B 4Y5YB 4N2CA 5EMYA 4Y5YC 1FGVH 1YUKB 4QT5B 1RZJH 3EO0A 4FXKC 3OGCB 1U8MA 2PWHA 2RAMA 3UTSE 1U8LB 3AITA 3D3VB 3P9MA 3BEVB 2Y7NA 4AITA 1OM9A 3ABKB 3C08H 1IQDB 1QSFB 2NY5H 2QBWA 3D25A 3P2DA 5L6YH 3N40F 3AG2B 1RZJL 3CVDA 3OF6A 3WLWC 3SKUD 5MHSE 5JPNB 3EBGA 1PZSA 3LKSA 1EUTA 4QLWA 1CLCA 2CO3A 3C08L 5F9AC 4ZMXA 5I5RA 2NY5L 4KO9A 1G9MC 1X5LA 4JO8A 1VGEL 1R3IH 5L6YL 4BSJA 3CNKA 2HTLC 4MXVE 4BHUI 1EHNA 1QACA 4ZZFA 1U3JA 2CR6A 4EDWH 4CC4A 4BA8A 3SBQA 5GGUB 4AGLA 1T04B 2I5YL 4DZBB 3F58H 3KPOA 3CFKB 3VD5A 1BJ8A 2JIXB 4BFEA 5BVJA 4FQXA 1R3IL 2WWMC 4W70A 5K39B 4MQXD 4JY5H 2OL3A 3BP6B 3GSOB 3OKMB 1HSBA 4PGDB 3T2OA 3ZT5A 4I2XE 2AQ1A 2GJZB 4MZIA 3SBWA 4EDWL 4OD1L 5D7LA 1WF5A 4GO6B 3DETC 2XYBA 4PJ9B 4U1HB 1Y18B 2D2OA 4BWTA 4XMTA 2W07B 3F58L 1KBGH 3DWTA 3KPLB 4PJ9C 4PJBB 4BFRA 3MBEA 1I85C 2FBJH 2WQWA 3JV6A 4OZIE 4Q6IB 2OSLB 1MNUH 4F9LA 4F7PA 4Q6IC 3VFGH 2E56A 1U58B 3GSXB 2BNQE 2F5AH 2IAMD 3DVFA 5IEKB 2C8NA 4K7FA 2HFEA 1ZT4B 2WLIB 5FK9B 5FYKE 4M56A 1RZKC 5AVXB 2W9EH 4Z3TA 2VDMB 3FU9A 1J8RA 3MJ7B 2WWKO 5E2WH 1MLBA 4M7ZC 2FBJL 3OB0K 2XN0A 1MNUL 2VSDA 3BP7A 4MQ7B 3VFGL 2BP0A 3B7RL 4LLMB 5TE4H 2F5AL 2AK1H 2B3RA 2L7JA 2V8MA 3JXAA 3AABA 3T0WA 1PZDA 1G1YA 1A9VA 1U0QA 5E2WL 3HKFA 3WAKA 3ZDXE 3UFIA 1SHWA 2WZ5A 1BZDA 3V6ZA 1NGXA 2LFEA 4JFHE 1P7QB 5TE4L 5LNDA 3ALPA 3QO1A 1WCBB 1ZWIA 3LRSA 4H8VA 4QGTA 4OBSA 5DGRA 1CFQB 1AGCB 1RHHB 2OKMA 1OB1A 2OTPA 3HW7A 2V0AA 2XZCL 3ML9A 3Q2WA 3QEUB 4HU2A 3NSJA 4WGWB 2VQ1B 4N9OB 1UWXH 5T5FH 3ZO9A 3FOMB 4XNZC 1U92B 1WAAE 5CMAB 3ZTNL 3CMOH 4DWHA 2Y5EA 1J8HE 4PTUA 3REWB 1CYXA 3PIQB 2Y72A 3PUUA 3T0ED 3QSKB 1H5BA 3BGFB 5IGXL 2ICWA 2ZKHH 3LCYA 4YOKA 3DROA 4HHAA 4XMLL 3QORA 5AW6B 4KZDH 1KXHA 5T5FL 4WWNA 3RL2A 1P1ZB 4HF5H 2IJ0C 1AD0A 1IC5L 2IF7A 1B4RA 2XWJB 2F54A 5DZPA 5CD3B 4UQEA 5T1MA 2E75C 3HNTL 4N1CA 2ZKHL 2NNRA 1OE3A 3QNYB 3NIGB 2ICES 2R8SH 5E00A 2FJFB 1UATA 4ZTEA 5HTSA 5GGRB 4J3UA 4UM9A 4JM2F 4AGOA 3IJSA 4HF5L 5C9KA 2ERJB 2ZTBA 1MPAL 2A6KA 3MRIA 1KPVA 2ERJC 5CJ8A 2B15A 1UGKA 2LOEA 5C0CB 1IEAA 4P2QD 1J86A 2EZ0D 2VWEE 4PJIE 5IVOA 5DJ0B 2VJ0A 2Q3XA 1WLHA 3BLKA 4QRPD 3QUMB 2R8SL 2A2QT 2GTWA 1M6OB 3ES6A 1KLFA 4XE0A 5CSZB 5AW1B 1PSKH 3EO1B 4NQCE 2CH8A 1IBHA 4Y19D 5KVDE 2LABA 2YZ8A 1CDGA 3G7TA 2GBTA 2A9NH 5AUMB 3SKMA 3PNWA 4BSWB 3MMEA 2JB5L 5I6MA 3CFBB 4OZ4A 1RJLA 1S3KL 1CN4A 4LOEA 4PV1C 4HKZB 1WGVA 1YYLL 4P4KA 4YDJB 3HA0A 1LL1A 2OTUB 1PSKL 4E68A 4IU3B 4PJGE 1CXIA 3U1QA 2XXFA 4EIUA 3FHQA 4YHZH 4G5ZL 1LE9A 1DBJH 5JW5B 4I77H 3LKPB 5KN5A 3OD3A 4XNYH 4YN3A 3GI8H 4RFOH 3RI5F 1B4JH 5MEQB 3LN4B 3GXNA 4PLOB 3FC8A 3TBVA 1S5HA 3BPCA 2W91A 1I1AB 4P3DB 5JORA 3WFHB 1I1AC 1ZE3C 3RGHA 1XH1A 5DHMC 4X7TA 1T5XB 2XWDA 4H2AA 4I77L 4M03A 4OFYD 5CEXA 3GI8L 2Z0BA 1KTLB 1MJUH 3IGUA 5B3JE 3WNLA 4POUB 4UU9A 2B1HH 1CBVH 3L9YA 2NX5D 1AI1L 3Q6FB 2YMTA 2Z0UA 4FYRA 5IBLC 2I9LB 1KIUB 4X98A 1H3TA 2NR6A 3NSFA 3UTQB 1KELL 2VRQA 4PD4J 3L2LA 3CVHH 3QDGD 1V54B 2MQCA 3HLAB 2B1HL 1CBVL 1GZPB 2Y7MA 5FHAL 4QAWA 2V7HB 4XO3A 1LEKB 1HKFA 3ZL1A 1YJDH 5F9WB 3CHQA 4L1SA 5F9WC 3QDMA 1X5YA 3DJZA 3OX8B 2YSTA 1NM4A 2VH5H 5E8EA 3ZJAA 1EO8H 4G71B 2XTSA 3CVHL 5D5MB 3ULSA 5HHPA 2X4RB 2VE6A 2ZG2A 4G9FB 3VYNA 2WSDA 4RISL 5JO5A 1ACZA 1DUZA 4HX1A 4GRLD 3ETTA 4Y16D 3HLKA 3VFMB 1J9CT 5LGJB 3WFDH 4XOCA 3O9WA 5ETUA 4HDIA 1SF5A 3U7AA 4AENA 2Y1VA 2IPKA 4NZDA 3VDAA 1SXNA 3MREA 5D2LE 1EHKB 4XMWA 3A24A 2V9QA 2YAOA 1EO8L 1SOXA 3G5ZA 4PEEA 1TYEB 1ZT1B 1KBBA 4CMMA 4E42B 3QZMA 2Z31B 2WXKA 2NXZB 2MQ3A 2Z31C 2ZUVA 2E47A 2NXZC 2HJKA 4G6ML 4NZ8A 4WI3A 5IWLC 1HT6A 4HS3A 2RGSA 2NCEA 1Q9KB 2PYEB 3D05A 5KVGE 3HMXA 3NIDE 1DBAH 1NEZG 2D7TH 3BXNA 3I3DA 4H8QA 2H1LM 3UGUA 3MV8A 1CO1A 4K3JH 2XBZA 2AXJA 3AMLA 2IH3A 4W9IC 4Y5XA 1K4CA 2OFQA 3FDWA 4OJEH 1SOKA 3TZVB 4ELMB 1G87A 1OSYA 3TZVC 1RZQA 5EU5A 1UB6B 4HIJA 3MRBB 2HT2D 2FYVA 2Z4QA 4NO0B 3LEVH 3RURA 1DBAL 4WRLA 1VCBC 4K4KA 3AXHA 5D4HA 3SQBA 4EZKA 5JW4Q 5LUMA 5DYOB 3CZLA 5ENWA 4XRCB 4K3JL 1T21A 3QHFH 5D96B 2ARJB 2G5UA 3SPVB 4RWYL 3DDGA 1E5ZA 4HUNB 2WWKT 5KSAC 4OGXH 3DBXB 3LEVL 5ICXB 5H4YA 4D9QD 2WQXA 1XR8A 1Z0NA 4WWKD 4EXKA 6TAAA 4U6HB 1FI8C 4OI9A 2J6WA 2GJPA 4NWUH 1TZIA 2ZX6A 1XCWA 3QHFL 3MUY1 5D1QD 3TGXA 1ACXA 1T4KA 5IHHA 2BHFA 2RALA 5EZLB 1A6PA 4OGXL 2KYIA 4H4NA 4RGMB 3DARA 1A7RL 3RWJA 1OTUD 4KZCA 3CHXA 4OQ1A 3LNGA 4RGMC 5DVMA 1MJJB 3CMGA 3GI9L 5DZNA 4H44C 5TGBB 1TCMA 5I9QC 4DVRL 4FNTA 4UT9H 1PW3A 3H6JA 5CSBA 4BWWA 2C9VA 4NJAH 3EG9A 1XIWA 1M71B 4QAMB 43CAA 3QISA 3CTTA 3ETSA 4JO4H 1WC7A 4L9DA 4OZGB 1WBZA 4ZS6D 2TAAA 5C0AE 4AT6A 2GVYA 4TNGA 4NUPA 5K1JA 4UQ3B 4C56D 3QQNA 4EUPG 4RX4D 3FOLB 2R39A 5DUMH 1ND0B 2JI1A 2WO2B 4UT9L 3LIUA 4GSUA 4B60A 5TH2B 4X5QA 2GKIA 25C8H 2XA8H 3MR9B 3FQWB 3ARBB 4JS7A 5I75B 3ARBC 3UC2A 5C2BH 1DE4B 4HWBH 3RVWC 4YC2B 5BJTB 5EOTA 1PLAA 4YC2C 1B3IA 3K6SB 1AS6A 1QBML 4Q97A 1WFNA 3UZQA 4RH4A 3L5XH 5JNYB 5B3SB 1TQTA 3B1UA 1T89A 2XA8L 4K71B 1J18A 2Q86A 4K71C 2AKRB 1OPGL 4TLSA 3N55A 5C2BL 1NGYB 4HWBL 1U3HA 4Y2OA 2NY6B 1JTOA 4PRHD 2EDDA 4YO0A 5I6NA 1JD7A 2QQKH 3L5XL 3DK2A 3EYUH 2I27N 3SBRA 3Q43A 4W4NA 1JMXA 4FF9A 3I9AA 3KLAA 1E6JL 3EOYG 4WU7B 2QFPA 1V3KA 1IAKA 4BFFA 2HJLB 1KEMH 1QBLL 3KPPA 5IFAH 2YRBA 4Z7QE 4IBWA 1DJYA 4HJUA 5ESAA 1KG0B 1OEZW 2QQKL 3E6FA 3E6HB 4PJCE 3BFWA 1LLAA 1A64A 2JH2A 2NTFA 3EYUL 1CE1H 1EXHA 5AZEH 1XCTA 4ANWA 2WW8A 5C09A 2IV9A 4U3SB 4JG9A 3MOAL 1T80A 4P23D 2Q86B 5JPMB 2VMFA 1KEML 1A4JB 2V3FA 5JPMC 3CHSA 1G7HA 4WEEA 5I6XB 5BV7H 2V9UA 1U91A 4P05A 4BFBD 1KLUB 2CZNA 3GLAA 2K3TA 3F83A 2ZKWA 3HTLX 5LXGH 3RILA 5AZEL 1Z9LA 1IM3A 3QI9A 3SO3B 5SWSB 2WLHA 4YGVB 3SO3C 1YEHH 3QH3A 1XD0A 5KVDL 1JI2A 2VTFA 2H26B 5DO2C 3BCFA 4CVWA 2J8UE 1HHIB 1S7TA 5EF0A 1L9NA 5BV7L 2MWCA 2ED6A 2JSFA 4JDZA 4AGMA 2JCWA 4OI7A 4K94C 4S2SA 3PFQA 1HESA 2JKIS 4DZ8A 2OCJA 3QYCA 4YEEA 4G8EA 5GZOD 1YEHL 1NWOA 1I1YA 3N91A 2C3VB 4M8RA 4C57C 3QG6A 5J0BA 3ML8A 1I8MA 3AAZB 4JY4A 3LXCA 3EZ8A 1QFHA 5FS5A 4WENB 1S3RA 3T65B 1EFXA 1MW2A 3MNMA 2EQDA 5AOIA 1RMFL 4NCC2 2JCCF 3RGBA 4FYQA 3VXRE 1IX2A 5AAPA 3QFJD 2E27H 2PN5A 2A9MH 1C5CL 1YG9A 2PCPB 3VG9B 5J9PA 5JIDA 3TIEA 2NUTB 1DN0A 2Q76B 4J6IA 3VG9C 4L1TA 2A0LD 2KH2B 5BRZE 3QCVH 4M6OH 5AD0B 3P4OB 2NW3A 5EOCH 3FNKA 1IZKA 2WP3O 3FSWA 3K2MC 3VA6A 2WLYA 2ZKMX 3RFZA 4HA1A 5HI4D 2CALA 1R33A 4UT9A 4JR9H 1H8LA 5KZCD 3QUZD 2ORBH 1CE6A 2VDQH 3O6FD 3VQMA 3AS2A 2NSXA 4HP5A 1MFMA 4AK2A 4CILA 2AAAA 1T7WA 3HKZA 4XCFH 3P0VL 3V5KA 5EOCL 4EQ3A 2VLRD 5BW7A 2R1XA 1KCUH 1EH9A 5HYJA 2JKXA 4OCSH 4ZUWB 1HHHB 4R0LA 1ZLVH 1GZQA 2MQ0A 4JR9L 1F56A 4Z78B 2ORBL 1U21A 3I6GA 3LEXA 3J2PA 4DGVL 2ZUSA 2A38A 3C5ZA 1TOXA 2K8MA 5E1AB 5C3IA 4PRDA 4HWBA 1FDLH 1ML0A 2WPGA 5DQ9B 1KCUL 1QYGL 1KYOK 3O3EB 5KAQG 4OCSL 3L3OA 1I7ZA 1FNEB 5G55A 2WLLA 5EPMB 4OB5L 4HZLA 4PRBB 4ZXBB 5I73B 3EUDA 3AG4B 4ZXBC 5I73C 3MRHA 1L3WA 4OCWH 2KL6A 4MQXC 4HC1L 1JF1B 2N59A 4JY6A 3CK0L 4G72B 3US1A 2Q3ZA 4S0HA 2AF2A 4GMTH 4WHTB 4G8GE 3WIHA 1WA2X 3NZUA 4AM0B 1QG3A 3IK2A 2WQ8A 2GI0A 3CHOA 4OCWL 4LNRA 5KVGL 2IAMB 3HB3D 5KYXA 5EIIG 3SPCA 1T5KA 2IAMC 4XPHL 4NM4H 1OGAA 4OGYH 3MDJA 4Z6AT 5HHXH 3CFNA 4QHKI 2AHIA 4AUYA 1O7DC 5FO9A 3HS9A 1MCEA 1RJYA 3APMA 2XC8A 1KPUA 3DYOA 4JM2B 3SGKC 4BFOA 4YHNB 2ATKA 4JM2C 2IIJA 2Y9RT 3RWDA 3D4YA 4QY8B 5IJDC 4EOWH 1BWMA 1RIVL 2P24B 1YPZE 3NEOA 3PHQB 3DTXB 3MV7A 3ZMRA 2EC9T 4HIQA 4CSZA 3FONB 1M56B 3V7MA 3SDAD 4DAGL 2UWEE 4PLJD 5JW4R 4EOWL 1BIIB 1P1VA 1Q1PA 1IT9H 1LHZA 2P48B 2XWBA 5ESQB 3S37L 5ABDE 2FR4A 1XGUA 5EFIB 3D39E 5CN3A 3BPOB 3BPOC 3MA7B 2YN3A 3RY4A 2DL9A 2VDPH 4XCNA 5DTFB 3UZEC 4MGXA 2QVFB 1XMWA 4ZX5A 3WFZA 3BIKB 2QR0A 5KYNA 3S5ZA 3GSRB 3BKYH 3T0EC 3EADA 3IS0X 5AKSA 3C5XA 3D09A 3C6LD 4M4RA 3FB8A 1OT4A 4UDUA 2C4FT 2VLJA 3MKGA 3C2AH 3QDJE 3WEXA 4YMPA 2YPLE 4XNQA 2IADA 5C3LD 1JDCA 4GG6E 4PP2B 3PFUA 3FUEA 4NC1C 2HRPL 3BKYL 1XF5B 2NMSA 2ISDA 4KTGA 4R4BB 2EDBA 4LSUH 4KNQA 1GOGA 1OAQH 1NPUA 1KYUA 4KQ4H 4MJID 4GBXD 2AXWA 2WBXA 5K5YA 1I4FA 3OJVC 4XVSH 1A21A 2QGBA 2VDLL 3WS3A 5FDWB 1Q72H 2AV1B 3DPDA 1JGVH 1IEBA 4P2QB 1H9VA 2EZ0C 4JRYD 4XB7A 3X14B 4LU5H 3H1ZA 1U8NB 3MNDA 1OAQL 3NIFB 5AW4B 4QRQB 4AG4H 4KQ4L 1RLWA 2HN7B 4MQTB 3BUPA 4Y19B 1H3XA 4FNLL 3NGBB 4XVSL 2VCOA 3FH7A 3NGBC 4YHYB 1Q72L 4XMXA 2YAEA 1JGVL 4YHYC 3DIFA 5FF6B 3FPYA 3UJJH 5FB8B 1MAML 3MUJA 5J1AB 1II4E 4MJ2A 2R1WA 1TJHL 2VW6A 2YRPA 1NFDA 3NN8B 4YBQD 4AG4L 3F6JA 3N85H 1H15A 1JPST 1PLBA 1QRKA 1B0GA 3A23A 4PRIA 1NCWL 1UXSA 2RQEA 3L4ZA 4IU2B 3ECVA 3RPBA 4S1RH 4ZPVB 3MV9D 2PPDA 5E56A 4C83A 3RWEB 2HVJA 5LNGA 1I3RA 4ODWB 5B1CA 2VKXA 4L37B 4N0UB 2XVKA 3UJJL 5FLUA 2VN4A 5F1KC 3ZHFA 4JZOB 5HDBF 4F2MB 3QG7L 3GC3A 2ZWLT 4I1RA 4HHWA 4HKBA 1RUQL 3WTUA 4F5CA 5B1JA 3RWGA 5KVEH 5EEXA 2E5EA 4S1RL 2BY3A 3EBHA 2FLRT 1EXUB 1YDPB 3GLDA 4RIRB 4XVJH 4HUVA 2ZOLA 5IKCA 1RAMA 1W0VA 2AK4A 5L2JB 2VQTA 4EI0A 1A6ZA 4HU8A 5G5DA 4KXBA 1QEWA 3BH8A 5LWYH 2H9GB 1LGVA 1DFXA 2ESVD 3U7WL 3TU6A 3L9BA 5HYQA 5KVEL 1CK0H 4WCYH 3N40P 5E2TH 5FUZL 3TA3B 2FEJA 4K5MA 3PP4H 4Y4FA 4XVJL 1PZBA 2B8OT 5F7FA 2BP3A 5BUPA 2WXMA 3FT4A 1FO0H 1URLA 3QDGB 3BN9D 2WP3T 4B9FA 1CTMA 1N7MH 3P73A 4NBXB 2O61A 1KZYA 4WIQA 1PD6A 4UYQA 4WWID 1KWGA 5DJCA 1VRSA 5C0FA 5KBDA 2Z91B 4UIKL 1GYAA 4I3GA 2VSMB 1CK0L 1T7VA 4WCYL 5E2TL 1XSKA 5EEWA 3JTSA 1CLZH 2DLEA 4XP4H 3ZQ9A 3IB4A 1WBYA 1FO0L 4WF7A 2DRUA 4PN6A 5HYSA 1PD0A 1AZCA 2D2CC 4Y16B 1R3JA 5IVXE 4GRLC 4H1LH 4MBOA 4Y16C 3PHOB 2GAZB 5F7DA 4ZFOB 5FO8B 4DFIA 1X4YA 6PAZA 3PABA 2GBVA 3BHBB 1CLZL 3LRLA 1T1XA 3T6ZA 4XP4L 4BZYA 4OLVL 4HJJH 4XP9L 1TYRA 5FO7B 4MB4A 2XSKA 4UOZA 4LDEB 2OQJB 2XN9E 5TDOA 3T1WA 3HBPA 2LFGA 3GMQA 3SE3C 3UPAA 3S3BB 3MFGB 1AG6A 4RAUA 1QFWH 1ZCRA 1PZCA 3ARPA 3W39A 3FFCD 2G9HB 1MN4A 5B8CB 1BCIA 1YLBB 5EEYA 1XZWA 3CZUB 2X2UA 3VJ6A 4B50A 1QR4A 3OPZL 5E9DD 2V5RA 3WN5A 4J4PA 3LKRA 4APXB 4JQIH 1YEGH 4WFFD 2IAND 3JV4B 4MB5A 3VTMA 1ONQA 1NCIA 4M7LH 4FNQA 4Y5VB 4NRZB 2JKLA 1CFNA 4J3OD 2ARWA 2HT2C 3UTTA 1A5FH 4QYOA 1UQSA 3BAIA 1QFWL 2C9AA 2VR6A 5DYFA 2L04A 4FC3E 4UILH 4AI7A 3EDFA 1E5YA 1NOAA 1U8CA 1INDH 1GYVA 3LS5H 3CAFA 1W80A 4XH2A 4JQIL 1YEGL 3NP3A 5E94B 5C07D 4M7LL 2FBRA 5ACMA 4AOFA 1BECA 4NT6B 5HY9A 1AMXA 1A5FL 3D69A 4HIEB 3VXOA 1FNGA 2Y2WA 3WJMB 3VD4A 3I75A 1LK3H 4HAKA 1KWKA 4UILL 5I26A 3D4GA 1HSAB 3SJVA 4EI6B 2GT9B 1UACH 4QD2E 4NBZB 4H13C 2HH0L 1XF3B 3FXIC 2X3CA 3A0OA 3D8MA 5D1QC 1MFNA 1B0RB 3GXTA 3L3IB 3PPSA 4DGWC 4QLRA 1KGWA 4NQEA 1MFVA 3KPSE 2GC4C 1TU2A 1VACA 5L9DH 4QOKA 1UACL 4TL5A 3OJMB 3IJYA 1FGNL 5A2IH 4Q52A 2IBGA 1OF0A 1SZNA 2FVNA 1S7VA 4FMFA 2A83A 1CFVH 4AH2B 3FO0H 4MMYA 1KXTA 4DGIH 4GIOA 4IW4C 4EI5D 3ZY7A 5BZWB 3M86A 4ZS6C 1JXJA 3VGDA 1FFOB 3KWVA 1E4KA 1KIPA 4C56B 5A6IA 5ID0A 3NZHL 3D0LB 5KVFE 2DH2A 3VCLA 1QW8A 2G4GA 1CFVL 2J5LB 3FO0L 1K3ZA 3FB6A 4H20H 2J5LC 2K7QA 3DMMB 4U0RB 3QQ3A 4DGIL 2HAZA 2ZP8A 4U0RC 4F57H 3DMMC 3BP4A 1KC5H 3FUNA 3WTVA 1G7MA 4OLWH 2J1YA 5T1DH 1F4AA 1OZTG 5JHDA 1UXWA 2R69A 3DOHA 1AS8A 4ETQB 4KJYA 3GS0A 4MCNA 3U4BH 1B6UA 3UAJA 2P43B 3BZ5A 1SUJA 3T0DA 4LHUD 5EUKA 1QRNB 2DJ4A 1PG7W 1IGJA 4NNXA 1VPOL 1KC5L 1NANI 2GIMA 1QR1A 4EAEA 3GK8H 2IOIA 4YVNA 5T1DL 3G5YA 1EHAA 2YD9A 1N5AA 2WO3B 4YHMH 2BHUA 4FJYA 1CGXA 2VAJA 3N2JA 4DIXA 4R26H 4V1DE 3T1FB 4MXWH 4Q14A 3ZRSA 2IWGA 4H1LA 4NP4H 3QHZH 1OV8A 1F58H 3LQAC 1FNAA 3JUZA 4WKZA 2G4EA 3GK8L 5FGBA 4K2UH 2H0PA 2OK0H 2P45B 2YJQA 1OF2B 4F9PA 2CDGA 2OYKA 2IWEA 3P3UA 4QRRE 1CU4L 4ECNA 3Q6GH 2GSIA 4K9JA 3EJPA 1U8QA 2B2XH 3KPMB 4LLYB 4WW2B 3DXAE 4FGMA 4JFEA 4R26L 3X1BA 4WW2C 4F33A 5JDJA 1NTDA 1YEIH 4TTDD 2CUHA 4P23C 1F58L 1SQMA 4EIZC 5IEHA 1QQDA 3NMEA 5I5MA 4JHBA 5AVUB 3UP1A 2AVGA 1DDTA 2ITCA 4W9ZA 3ME0A 2B2XL 5DMJB 3V9FA 5L8LB 3TASA 4JANB 4G1MA 1YEIL 2WINA 4LVOC 4RMBA 4CDGC 3GIZH 4Q58C 3NJNA 4AJVA 4Z7IA 4L9LA 4OKDA 4R4FH 1RVFL 1TJIL 5C08E 3BW9B 5D7SH 3RUGF 1CGSH 2PR9A 3LZPA 2L0DA 4UAHA 4A66A 3SDYH 1HTYA 2WJ7A 1W6LA 3ZMEA 1SVCP 5GZOC 1ZLSH 4ZTPH 3LPGA 3L3KA 4MZRA 2SEBB 4XPBH 1TSHA 5KJRH 1Y7VA 4R4FL 1DQJA 4ZMZA 4HUXA 2Y1ZA 2AJSH 4WWPA 1CGSL 2A73A 1R5IA 4E41A 5DC2A 3SDYL 1MVUB 5CWSA 4G43A 1WHOA 1O7SA 2GJ6B 4YBLB 2MNUA 3D4CA 1IIIA 1ZLSL 1UD5A 4WNSA 1QFWI 3RVTD 4Q6YA 4XPBL 1FHNA 3C9NB 1CLYH 4P5SA 3M46A 5KJRL 2A0LC 5IROA 3AY4A 1CXLA 2NNXA 4KOBA 3T0VA 3HC3H 2R7EA 1ZXQA 1WT5A 4GG8B 4NKOB 4WJ5B 5SX5H 2WXLA 5HI4C 3SE8L 2KMWA 3L9RB 3AXIA 4LLUB 2F68X 3X3FH 3W9EB 3O6FC 4LKXA 1CLYL 3GYRA 1CI5A 5I6LA 5C6WH 2VLRB 3QWOA 4IKNA 3S4SA 3KCPB 1HEZA 1XCXA 1WD9A 2CPCA 3HC3L 1EPFA 3CQPA 1A0QH 1MCKA 1Q9LA 3CSFA 3MYJB 3Q8EA 4ODXB 5L2KB 4H0LC 5CHNB 4ZUSB 5EO0A 4Z7VA 3WJLC 2YD4A 2BVQB 3D6GA 4N8CL 3QQXA 1BLNA 5JYMA 3RU8H 4JLRA 5ERWB 3M1BA 5F6HI 1ZHLB 5LNEA 3O6MH 1FNLA 4MA8H 2DLIA 3DYPA 3WU1A 4YHOH 4A04A 2VERN 1T0PB 1IAIM 1GS6X 1JUFB 4U1KA 4R7XA 3HMWH 1M05B 1ORSB 1JAEA 3HS0A 2ED8A 1TLMA 4QTHA 4ZUVB 4RAHA 4N25A 1H6EA 4IDJL 1Z9SA 2MNWA 2BIPA 4G6FB 1HN1A 3MRKB 4LVEA 1BAWA 1G7IA 3DECA 4L2YA 3C5SB 4ZW8A 3GS7A 4ACPA 1VA9A 3QQ4B 4LPYA 4JVPA 4WNQA 5KOVC 1GHFL 3IDMA 3BQUD 3H85A 2BIHA 3I3EA 3RIAF 2GB2A 3ZGIA 2W65B 1B3JA 2BSTB 1TSRA 4MAYD 3TURA 2PYFA 5GZND 3GRBA 2H2SD 1SDYA 1AQMA 4HLZH 1FH2A 4P9ML 5J1SC 5F0MB 1HZHH 1YAIA 4UQ2A 2V5YA 5A7EA 2OLDA 5IQMA 1FZMA 1Z9NA 3QC6X 1JPFB 3GHEL 5LGKA 1Q0XH 1BX2A 3KGRA 2C9SA 5B38G 5JIMA 1HQ4A 3GNMH 1NGXB 2X3AA 3O8XD 1O7DE 2WUCL 1W91A 4Q4IA 5A16A 1SMDA 3GKWH 3QO1B 1ZY9A 1NFIA 1P6WA 4BFIB 1HZHL 1MFBH 2F8VA 3D18A 1JVLA 2EXTA 2PUQT 5HHVH 2UUDK 5EN2A 5DJ6B 3SDAC 3SPGA 1Q0XL 1T7YA 3U9UB 2CKBH 4ESKA 5CINH 2A6JB 3ZTDC 2QGDA 2BOCA 1CJYA 1JNLH 4A2MA 3QNXA 1OGPA 3VXUD 3QJHB 4M8QB 2XXGA 3QULB 4YAQB 1MFBL 1ZPLA 3WUWA 1M1XB 3AG3B 5DJAA 43C9B 1XGYH 3IMSA 3P4NA 5HHVL 4HGWB 5CJ5A 2XJKA 4FTVE 4OFDA 5CP3A 2QSVA 3RB5A 5B7EA 3ULVF 3QJUB 3HRZC 2XPGA 4NO2A 1LTXA 2F54B 3CDZA 1J1PH 4WFGD 3C09B 3C6LB 4DKFH 1EVUA 3TN0A 4ALAL 1MWOA 3CIAA 3C09C 3C6LC 1X7QA 2VXVL 5D2NC 5HDQL 2R23B 1XGYL 5E00B 3ARDA 3TESA 1SLVA 4H8WC 1N3NA 1A6VH 2PXYD 3LD8B 1JGDA 3WFEH 3T0EE 2ADJA 2PCYA 3M8OH 1FL5A 3D48R 4Z5RA 1KCWA 1D9KB 4PFEA 5LGHH 1J1PL 4AYFB 4N8VA 4PGEA 1D9KC 4DKFL 5GS0H 4L8CA 4A7QA 4Z76A 5D7IA 5B22A 5EUOA 4MJIB 4YDNA 5IBTH 1BOGB 4GBXC 3RFRA 3SE9H 2CLVB 2ZCZA 1UYWH 3MGTA 4WSKA 1A6VL 1KLFB 4NC1E 5T3XD 3WFEL 2VW4A 2VABA 3M8OL 2Y23A 3VACA 5MENA 4JFDA 1I8AA 3CZKA 1X5HA 1TZGH 1J88A 3TA4D 2DM4A 3H3BC 1MDAA 3U6XA 1TENA 2DQUH 4BV1A 4UINL 4ZMVA 4FXGA 1UYWL 4HK3N 4NIYE 4R90H 4LZKA 4G80B 4MYWB 4QRPE 5DEFA 1TZGL 1KTBA 3THMH 1PX8A 5GGSY 2MCMA 4GOSA 5CILL 4YBQC 5JXAH 1WFUA 4XN8A 1JZ2A 3BAWA 4IGBA 5HHOD 3MV9B 5JORB 4TSAH 3I85A 1HI6B 5AAWC 1S7SB 1NFKA 3JWOC 5ES4B 1JZJA 4J2XA 3B9VA 3PXLA 5BOJA 4O2EA 1TZAA 3THML 4MNQA 3CH1B 3LOWA 3UYPB 3HVNA 3P0YL 1GC1C 5CR8A 1XWVA 1B2YA 4UU9B 2BSDA 5CIPH 3WTYA 2JLLA 2CBMA 3VTAA 4TKWA 1N4XL 2FO4B 2MKWA 1DVUA 1H6FA 3NSCA 4N0UE 1L9TA 4ODBD 2JELH 5I5JA 1AHMA 1R5WA 4WI0B 1SEQH 3ZXAC 3SO5A 4OZHB 1XXFC 2ED9A 1HNGA 2ESVB 4YDIL 3X13A 5DFTA 2ZCHH 3JWDH 2A74B 2FO1A 5EN3A 4NI6A 3HHMA 3O2DH 2A74C 4JG5A 3EF4A 3A4AA 5E5RB 1F4YH 2JELL 4Z3IA 2XI9A 1KPRA 4Z7UA 1KTDA 4P2RE 1SEQL 4KTDH 3JZYA 2NX5E 2MIZA 2PPAA 5E24E 2COVD 4FAAB 5D1XB 4P46D 2ZCHL 3JWDL 5D1XC 1NFDF 2ZYRA 4YK4B 3KXFD 3SDXA 1ZS8B 2Z8RA 3O2DL 2CKBA 4NQXB 3BVNA 1GJUA 3FTZA 3R8QA 5IV2A 1CG9B 3CLEH 4MDJA 5L8JB 3IFOA 3T0BA 5LJYH 5I16A 4KTDL 3TP4A 4PJ8A 4F3FA 1BD2B 2N01B 4QI3A 4XP5L 3CXHK 5F9DC 5C0IB 1ZA6B 5DHVH 1AKJA 4HKXB 4U1SA 4HIHA 3WTTA 2EYRA 4AVIA 1R0AH 3HUJB 3KBHE 1ODUA 2CDEA 1F1GA 3NA9L 4U6YB 3VE0A 3CLEL 5EZOH 4NLHA 1BFTA 4TRPH 1RJZA 5AWNL 1P84K 3RKPA 3CN3A 1E42A 2QL1A 3GMLA 3KLQA 4P2OB 4HK0A 3U36A 3ZT6A 1JNJA 5EU5B 1H3UA 1MHPH 1I8UA 2JK5B 2NLJA 1U8OB 1R0AL 3FFCB 1YECH 4GRWH 5HI3D 2AXGB 5J3HD 2Y7SA 3CX5J 2AEOA 2FYYA 1Q9WA 1BBJB 5EZOL 5B1BB 1KEGH 2Y5TB 3B4NA 3MGAA 4TRPL 3OR6A 4WVRA 3QYMA 4X4KA 3QXAA 5F3BB 1T21B 1W0WA 2WZPD 2JI2A 4JN2B 1AHWA 1ANUA 1QTSA 4TLUA 4E2OA 4X7SH 8FABA 4FQHB 3T6QC 2H8PB 3MO1A 4L3CA 4Y9EA 5MEOB 4DQOH 2AVFA 4GKZB 5HGDB 1G7JB 1YECL 2D31A 3MFFB 2V33A 4KDWA 2YXMA 2EEXA 3NJGA 4JE4B 5EZPA 1XR8B 2WSKA 4B5EA 1KEGL 2LE9A 3LN9A 3MNVA 3PL6B 2XBTA 3PL6C 4PYHA 4WHDA 1VFBB 1FZOB 3CCHA 4G42A 4X7SL 2AJVL 4JE0A 5FHBL 1O7VA 5EIVA 1MIEL 3PGDA 5BVPL 1EAPB 3LY6A 4MNHA 2XVGA 2GYSA 3AFLA 1MOEA 1DLHA 1MVFA 3FFOA 4PY8I 3S2CA 2O30A 3QXDB 5CEYA 1T2XA 2Z7UA 3FCTA 4D9QE 1FA4A 1YC7A 3FQYA 3HG4A 3IDXH 2QT6A 4X4MA 1S4IA 5T3ZD 4CMHB 4CMHC 2AJXL 5D1QE 1CGUA 2WOYA 3QQDA 3APCA 3G6AB 3VH8A 2D4FA 3O3DA 3UMNA 5J6SA 3GO1L 3HPLB 1S7UB 4LLWB 1X9RA 3IDXL 1A7PH 1NQBA 3FN3A 4ELKB 2X09A 3WG7B 5CIPA 4QNPF 5GS1B 1A2YA 3UTZB 1NEUA 2X38A 4LGSB 4NKIL 5GS1C 1XH3B 4HK3J 2VRKA 3ARGB 3DIDA 3L4CA 5DI8A 3DJ9A 5DMYA 5CGBA 1HE7A 2C3GA 2ZOWA 3EYVA 4NHUB 3H9YA 4WHYG 3BVTA 3UDWC 2I9TA 4Y9CA 1SJEB 1IC4L 1MY7A 1COBA 3ILPA 4PJFA 5E5MB 4XVOA 3UACA 5J11C 1X6LA 4KKZA 3CE1A 1AP2A 3HG3A 2X4TA 4QJ3B 3QWRD 2BRQA 4MDIA 3C12A 3B1TA 5IQLA 3RUGB 4C56E 3PS6A 1PG7H 2FSDA 2MHAB 3BZ4A 2DEWX 4E9LA 1XGRA 3LXUX 5D1ZB 3N9GH 1R19A 2WJ5A 3S96B 4DEUA 4HJEA 4KJWD 4PGZA 5FX3A 4U7SA 5CD5D 3KLAB 2VLKB 1IAKB 3EBIA 1AD9A 5GS2D 3KPRD 2GIYA 3VD3A 2JJWA 4YZFF 3UABA 4JNXA 7FABL 1XTLA 5E03A 5ESAB 4JHUA 3WS6A 4AXWA 3K1KC 4N8PA 1EFQA 4NXKA 5J12C 3ZE0B 3FQ1A 5DHVA 5DVLA 1DHKA 1T1WA 1SHXA 4GI8A 4PRHE 4XXCC 2WD0A 1OANA 5EC2A 2RBLA 2OMWA 1J0YA 1P2CA 1RUAL 2M26A 5HDOA 2G3MA 3BUYA 3ZVVA 4KJQD 3U79A 1YY8A 4HUKB 4AYDC 2EUVA 5HHQA 3KNBB 1T66D 4UI2A 4HWZA 4TTDC 4ZO6A 3DRTA 1Z9MA 4W93A 2ZSWA 3V0JA 1CT8A 2ZXEB 5C0BD 2KLRA 4PGCB 1S7QA 3N04A 5AG8A 1A3RL 2EUXA 4FQPA 4B97A 4BH8A 2EUWA 1EX0A 1EAOA 1AZZC 3A47A 3MOBH 3IDYB 3VD0A 1WTLA 4PJHF 4RMRA 3C87A 3IDYC 4TUKH 1OAYH 3ASOB 1WEJL 1S8DB 1IAOA 4IJTA 2R0ZL 2XY2A 3RTQB 1TFHA 4RA0C 4HPHA 5IJCC 2BP8A 1M4KA 1TT6A 3HEIB 2AEWA 5EEVA 2P8LA 4G6KH 3B3IA 3OZ9L 3IVKB 4FQIL 4YDZA 4L3ED 2YS4A 1CIDA 3MOBL 4R5TA 3RVUD 3DRQB 5LN8A 4F8QA 1UASA 1F6LL 1OAYL 3DJRA 2ZUWA 2VUOA 2BWDA 3QIWB 4LOFA 3ARFA 4DP8X 2D4DA 2A7BA 3QIWC 5J9PB 3PWLA 2E7LA 1DN0B 3UJTL 2ZAGA 4YZWA 5BOPA 3RL1B 4RQQB 1EERB 5E6ID 2IMMA 5LDUA 4G6KL 3CFCH 3QIBD 2JFCA 4Z7OF 3OMNB 2XKNA 1L9RA 1N10A 3CFDA 2EE6A 2HRGA 5DHYB 1I3GH 5JXED 3RVTC 1XTMA 3MJ9H 1D5BB 1MY5A 2F61A 4CU7A 2LLGA 4M6AA 4WEUD 1CYWA 4BFGA 1LYQA 4QRFA 3CFCL 3QFJE 3Q05A 5DC9B 1P7BA 3CWGA 5DZOA 1OD7A 1RFDH 2YKKA 1FBIH 2Y6SD 3WJJA 1I3GL 2DBLL 3BGMA 2ATAA 3FSOA 3G5WA 4Y88A 2FECL 3B2UD 1L9QA 4FQCL 1JXDA 3C5ZB 2P5WD 4P2YA 5AW9B 4MAUL 4R5VA 1K5NA 2Z3FA 3II1A 5IB1A 3G04A 4OKVB 5C6TH 1ED3A 3FUHA 5BPPA 4CAGA 1A14L 1TPXC 3UAAA 4F8TA 1WFIA 4OIIL 4E9QA 1RFDL 3DX6A 3TT1L 1BAFH 1G0YR 3LQZB 3CZNA 3FUFA 4N3TA 2G30A 5BXFB 1LNUB 1RK1A 3AGWA 5SWZD 1AMYA 5E1GA 2OTWA 3LMJH 3LZQA 1JL8A 2J57A 1D7DA 3H0TA 3RNKA 2G2RA 4FHKA 3LRHA 5ANME 2V2WB 2BCKA 1YNTB 2P8MA 2ROXA 3EFOB 3IFLH 4FX5A 2X70A 2F58H 4FFYH 3RDTB 4N2IA 1XF4A 4R2GB 4DJMA 2HWZL 3B5TA 3LMJL 3NEEA 2WXQA 1OP9A 4BRJA 2IAAC 3BESR 5IUSA 5EZIL 1O6SA 5EU7C 4WSGA 4Z0XB 3U4EA 1NCUA 2VISB 3IFLL 4WDIA 4ZPTA 5IY5B 1JG9A 1NIAA 1YEWA 3BQUB 3HZYA 3QIUD 1UZ6E 4BUHA 3BQUC 3PQYD 4FFYL 2ATKB 9CGTA 1UA6L 5M7QA 4MAYC 2FH8A 2Z65C 2DQCH 4IRZA 2P3YA 2XZAH 3PWJB 4JFZL 4WI7A 4MSWA 3LKOA 3HE7D 4QMEA 3S5LB 2Z35B 4XPFH 4HEPA 3AXLB 4ZNEE 4J8RB 3FCUB 5JMRA 3F64A 5AG9A 4X4YA 3T2LA 4Z7VF 3NH7H 5CS7A 1AY1H 1SRDA 3O8XB 3NYKA 1SOSA 4N6RA 2CD0A 1UOLA 3NJJA 3O8XC 4L4TE 2XZAL 4KUZH 4RDBA 3GHBH 4WJG3 4WO0A 2RQ8A 1HCFX 3GJEA 2KZWA 2OMVA 3QFGA 4XPFL 3P2TA 3PWPD 2PR4L 1XGUB 5K33A 2XWEA 2Y4SA 3VXNB 4APQA 2YUZA 3VWJD 1I1RA 2ICEC 2WBJD 1NAMB 5D8JH 1MI5B 4QRUA 5C97A 4UV7H 1E2VA 3NH7L 1AY1L 3IKCA 5KWYC 3WTXA 4P5KA 4KUZL 3MV11 5EU6A 1O9WA 3P9LB 3BKCH 4PJEE 4QO1A 1D7BA 5DMGD 2BERA 1FZJA 4ONGH 1UJ3A 3VFOA 5E2UL 4C4UA 1GAFH 2Q7YB 5I1AA 5D8JL 2LTQB 1VEMA 2WM0A 3K2UL 4FG4A 2LTQC 4UV7L 4ZW5A 4LLVA 3WY3A 3HG1D 4I0KA 4MZ3A 2EDWA 4I3SL 4X6FA 3H6AA 3BRFA 1SM3L 3BKCL 2FSEA 5FYJH 4I85A 4OQTH 3NFPB 1MH5A 3B2VL 1UGNA 3CD4A 4F80A 4ONGL 3SDCA 2B9AA 4ABWA 1GAFL 1YEDA 3SOTA 1XGTA 3MJ9A 2ROYA 5I1LB 5CAYB 4MXQD 4MYPA 5KYWA 2XQYG 4YFLF 1XGZA 5D2NE 4RAVB 4NNYA 1T5WA 2OZ4L 2PO6D 4FFTA 3FQXA 5FYJL 2UX6A 4MKTA 2OJEA 3EJUA 3SOBH 2Y0SA 5DK2A 5I2IA 1G7PB 3OVUB 5FUCE 3MCG1 3WNNA 3U46B 1ET8A 1VIWA 4CKQA 5E6YA 1HJBC 2W9LA 5KBKA 4V2CB 1ZV9A 4FS0A 2QVKA 4WI9A 5ISZA 1JZ3A 1YSOA 4KKAC 3EJJX 4KKNA 4QRAA 1FYTA 3KLHD 3IDIB 4NQSA 4M9PA 3SOBL 3U9PH 2VDOL 2XDHA 1SFHA 5IJKC 1UXSB 4KTEL 4JRYE 1KENH 4GH7B 4H0GA 1CICB 4M1GH 3QK0A 3MSPA 3CN2A 3LKQA 5AVWB 2NQCA 4KI5F 5I28A 2RR3A 4IBTA 3S36H 4DEPB 4JK0D 2FECI 3WKMH 4DEPC 3U9PL 2YMOA 2ARJQ 2LU5A 1BVZA 1H3PH 4EUPH 4G8FA 5B1AB 1XZ0A 3TNNB 4E5XB 3E9UA 5I76B 4F37K 3VXSA 2YQBA 3U82B 2OMXB 3N43F 3S36L 1A6ZB 3EJQA 4LF3B 4Q8BA 4XBGA 5D7IF 5EUOF 1XBDA 1PCXA 4N9GA 4WV1A 1MCSA 4G5AA 2W95A 2O6PA 3A3YB 12E8H 3MNZB 1BQHB 1H3PL 3BRGC 3AB0B 3E3QC 3FYEB 3CDGB 1IJ9A 5DUBB 1F11A 3AB0C 2IG2H 3P40A 3K8LA 5CCGE 1NMCB 1HL5A 4Y4KA 4GP4B 3TPUB 3P2BA 2E9GA 2PP8A 4D0CA 1MLCB 2DQDL 5KBNC 2VC2H 5C0FB 12E8L 3T77B 5DD6B 4RGNB 5AB1A 4LDLB 2FDBP 2FX7L 4HIIB 5LAXB 3UL4A 5IMLB 2G3ZA 4RGNC 1JTTA 1BFSA 3QO0B 2IG2L 4J3VA 1YUHA 1UKQA 4NCC1 3OF6D 1WBYB 5F8QC 1LJMA 1NH6A 4L4VA 1HQRB 2X2HA 3GBDA 3T5WA 1IQWH 1D6VL 2VC2L 5PAZA 3KXFB 4JPSA 4P46C 2Z9TA 4BK8A 3O41B 3HN3A 4X5XB 5HXMA 3PGFH 3O4LB 1JWUA 1A3LL 3BWUF 4PS4L 3KCWA 1A9EA 1Q94A 3H3PL 2OBGA 4R8WL 1KJMB 5GGVY 4ORGA 3TLRA 1UA7A 2D7OA 4OM0H 3QEQE 3MLZH 1NEZA 1WCQA 2C7UA 2CO6B 1RH8A 3GMQB 4FQXD 3LN5A 3PGFL 2CRMA 2LLNA 1FNFA 3NZSA 3U0PA 2XFXB 4PRPA 1WZ1H 1KTJA 4FXLA 1RUMH 2A9AA 3BH4A 3D5OF 4OQTA 3X12B 2BNUB 4LP4A 4AL8C 5LAPA 1T3FA 1ONQB 4L5FE 3MLZL 1A4KB 3EDEA 3MBED 3II3A 5HI3C 2R9HC 3MODH 4LOVA 4U1JB 5J3HC 4PR5A 4JCMA 1P7KB 5CNHA 5IMOA 4AMKL 2X05A 4NUJB 5FPIA 2BOBB 2V2XB 3MJ8A 4XZ4A 4Q2ZA 5EZJA 2UZPA 4WU5A 4I4WA 1G6RH 1GY2A 4P9HL 2Y7QA 3VXOB 3BJLA 5E9DE 3MODL 1D6EB 4AV5A 4QXGH 4WFFE 2OP4H 2IANE 4XZUB 3BC9A 3FN0L 4IHOA 2X4QA 3N5AA 3VRIA 1JCVA 2YLKA 1EZVX 4PJIA 5IP4A 2WVTA 5KBPA 3GMNA 2BSSA 3K6NA 3ZGHA 3U0TA 1EJ6A 2IFFL 1G6RL 3TYFA 3RGVB 4KKRA 1A65A 3MROB 4NEHB 3DTDA 3L5WB 2HFGH 4JHAH 3RGVC 1TTUA 2IV8A 5F3FA 4R96B 2F5BH 3B7YA 3JUYA 4P4RA 4TQ8A 5F7NC 3HVDA 2OP4L 2ZUQB 4UCFA 5C07E 2N0KA 5T5NF 1PKQE 2GG1A 2ZUQC 3TT3L 2X7LA 2ZKXA 1FCCA 3F5WB 2V5MA 3ARTA 5DZJA 4CNIB 5TD4A 4IMKA 3GGWB 3OC5A 2QSQA 5FA4A 3MX0A 4PJGA 2HFGL 1T0NA 4AMXA 2F5BL 3HFFA 4EUPA 2C3HA 1BOYA 4HMDA 5HHMD 2C34A 2LR4A 3HZVB 5KSBA 2FEEL 3UPRB 1A7QH 2R0KH 1OLLA 2NY3B 1WIPA 1RZ8A 4FQ1H 2NY3C 3VCLB 3QORD 4NRYB 4S1SL 1F90L 3BUQA 1F2QA 1X5AA 5ALBH 1H6UA 2F7QA 4HWEH 2AW2A 4XXDB 3MXVH 4P3WA 4FKEA 3KM2A 4IYKA 1K3IA 4WK2B 4DT2A 5AENA 2R0KL 4HJIA 4PJHB 3DOSA 1D5ZB 1AGBB 5BO1H 2J56A 3MRDB 4FDWA 2HKHH 4UM9D 2LVCA 5ALBL 4ODSH 1W72B 2DMBA 3ESNA 3DO7A 2XACC 3H53A 4HWEL 4Z7WE 2WQSA 5GS2H 1HILB 5DURD 4XCCH 4JFFA 3DJSA 4ZFFA 3F84A 5CZXD 3OHMB 1JYWA 4LCUA 2EO9A 3O45B 5E8OA 2QLVB 3G5XB 4KJWC 1P4IH 2HKHL 4XX1G 1DVYA 1D5IL 3QA3B 4TPRL 2EYTA 4EKJA 4ODSL 5C0GB 3KPRB 1ZLVK 4WKZB 1X7SA 1J5IA 2MCPH 1VERA 3IT8D 4FLOA 4FE9A 1MCPH 4QWWD 1QSEE 3P4MA 4U6VH 3QUYA 2VNCA 4CBPA 4P4KD 3BEWB 3L8QA 4JL2A 3MRPB 5KG9A 3SGEH 4LT7A 5AL0A 3GSQB 2J3SA 3JZ7A 2MCPL 2HMID 1PZ2A 3ROLA 3IXAB 1MCPL 2D0FA 2GCYB 3DV6B 3KL0A 1ETB1 4JMNA 3CSGA 4U6VL 1RZFH 1T66C 4YR6A 2EDYA 1Z32X 3L3HB 4JVWA 3ZDZF 1BYPA 4JX0A 1IM9B 4PJ7B 2NY7H 1Z5LB 1AH1A 4MQSB 4AM0Q 1FL6A 1T20A 2WMPA 2DWXA 4FABL 2F1EA 1T1YA 4TNVK 1I3UA 2WUBH 4OAWA 3S34L 2PTUA 4NM8L 3NVQA 1ZV5A 4NPJA 4F7EB 4WTWA 4OLEA 4FP8L 32C2A 5IVNA 2VDNL 2NY7L 4TQHA 1LE5A 4X9IA 3KLSA 1N8ZB 3LKNA 3U83A 3IDGA 2FX9H 1LILA 1LP9F 2OJ1A 3KWWB 2BNRA 1DVQA 4HUXB 4L3EB 2O6CA 4NJ9H 2NR6D 4D3CH 5EBWA 2DQIH 5DDHB 1QVOA 4GLRH 1S9YA 3RVUC 1P7HL 3OXRB 4ZMLA 2UY7A 2BSRB 1UADC 3L1FA 2XKSA 4GSXA 3O3AA 4I5BA 4L8SB 5FLVA 1YMMB 1MFCL 4L8SC 5JIIA 3C5JA 1CF1A 3QIBB 4FFVD 5E6IC 2W8CA 5C92A 2X4UB 2XV2A 3GKZA 4JRXE 4K7PH 3QDMD 3QIBC 4NJ9L 4D3CL 1MHEA 3GRGA 4X6CF 2VIRB 4TF4A 4HFUL 3VG0L 5I1EL 1C16A 4LXFA 4BGDA 9PCYA 1OQOA 2E6JA 1CCZA 5DMKB 4KBPA 4J1UA 2NW2B 5A3ID 1HH9A 2Y2TA 3PV6A 5C0JA 2YUVA 4M48H 3B6SA 4ANKA 1GTNA 4K7PL 1RJCA 4GRWF 4DN3L 1DDHB 1HEZB 3APNA 2PTTA 4JREB 3VXME 5JQ6L 4JREC 3FQTB 1L5GA 2BWIA 5HYFA 2C1OB 4QEGA 3L9EA 1LD9B 5F9JA 2P5WB 3ZKMD 4PJ5D 4M48L 4MA1C 5CF3A 1MZYA 1QLFB 4JLRB 4KAQH 1AHKA 4ODUA 3UBXI 2DWTA 3C60B 4N68A 1HKLH 1KB5B 4XE5B 2Q1EA 1BSIA 3C60C 3CSTA 3P54A 2ZF9A 4WUUE 4RMWA 5I66B 1G5AA 1BVKB 1R5VB 1KCLA 4FQQB 3V6OC 5CJQH 4AJWA 3NSXA 4K55A 3MNWB 4HSCX 5HVGB 4LOUD 5FYLE 3UC0H 4ES8A 3ULUF 1DJGA 3BT0A 2DQGH 4O2FA 3VX0A 2IOOA 2OX5A 2B1AH 2FEEI 2YHGA 3DUSA 3LH8A 4GW1A 4FJZA 4KAQL 3QUKA 3H9SB 5LVEA 4UTBH 1HKLL 4X99A 1KY7A 4NO5B 4FQ2H 5IESH 1OK8A 1G9MH 1SJHA 4H0IA 4EZMA 5CJQL 1INQA 1PYWA 2EIMB 3OLGA 1E4XI 4WNQB 4GSQA 2BSCA 5EIIA 3KYKL 4N22A 5I8CA 4MBRA 4U1IB 4XODA 5EV7A 4KQ3H 2DQEH 1MJ8H 1OE1A 4MMXA 4N4YB 3ZIMA 3QQ9D 5JUEL 2EDEA 2FJGA 2B16A 3QIUC 3N0AA 4ZG1A 5DVOA 4LCWA 4L5FL 1PNCA 1EEUA 2G3XA 2QFRA 4HUWA 4TLTA 3VGAB 3IBEA 1R3LA 1B4TA 5EU7E 3VGAC 3QPQD 2KZ1B 4IIQA 1KT2A 4KQ3L 3HE7B 5I1HH 2HT4D 1OGTA 2DQEL 4XPAH 5FM4A 2QPFA 3HE7C 5IK3A 4PJCA 1Z2KA 1KTRL 4MJ6B 4MHHG 1K4DB 4MJJA 4M61B 5E4IA 3D18B 2XRAH 5CU5A 3DX4A 4OFQA 5JDSA 4ABQA 1JWMB 3I74A 4XXWC 5FOBA 2NY4B 3UROR 1UD4A 4Z3JA 3L17A 4GEJA 1SJXA 1KBVA 2CO7B 2GUOB 4JQXA 3WHE0 3MCKB 4XPAL 2VDMH 2UVEA 5D7JB 3PWPB 5GPRA 5D7JC 1MXGA 3CDCA 5FA3A 4G3YH 3VWJB 4UQAA 1ZHBA 2XRAL 3P4NB 4L8BA 5IB3B 3C2SA 3VWJC 2WBJC 3GMOA 4KO7A 3DV4B 1IE4A 4E9SA 4P04A 3T8MA 1FFNA 1O6VA 2A6DA 2D3NA 3CPLA 4RSYA 1JN6A 2J8UA 4BEIA 2MFNA 3FQUA 1J5CA 1VGKA 3FH8A 3CDZB 4YL9A 3D0VB 2VDML 3P02A 2OR9H 3IJHA 5KSVA 5DMGC 3VWKA 5HBBA 1HFUA 1MKFA 4G3YL 2D73A 1D5XA 4G7QB 1WS8A 2VO5A 5DEGA 5AALA 2X4OB 2P5EA 3SGEI 5G4NA 4F24A 2BHYA 5T1LA 1JGDB 1E27A 3VXUE 5BS0A 1J12A 1U3HD 5DWUH 2OR9L 1FVEA 4LLAA 4MRBA 1HHJA 4NERA 3AUVA 5D7IB 1XB3A 5EUOB 5SV4A 1ZANH 3CU1A 4MNGE 4M5TA 5F7WC 3NK3A 4MXQC 3W0WB 3EH3B 5BMFL 3HC4H 5BRZA 5DUPH 4F7MA 5MENB 2Z93B 2PO6C 4YDMA 4YNYB 3S7GA 5DWUL 4KPHH 4YSAA 3ARVA 1GVIA 3BJ91 5MHSD 1ZANL 3LPOA 4WW1A 2ADGB 1LMIA 4WO4A 2UZYB 4KRPD 4Y5YA 4O2CB 5C09D 1CB4A 5I30H 4QT5A 4ERSH 3HC4L 1MCRA 2AXHA 3OGCA 5DK0B 3UAFA 4FNPA 4JHZA 1GKEA 4GAAA 1U8LA 2PABA 2XWTB 1I9JL 3IS1X 2HLAB 4JJ5B 4XN9A 5TE6H 3BEVA 3BSZA 3QZLA 3RJDA 1JZEA 4E0RA 4GS7B 2OR8A 4JHVA 4KVNL 1IQDA 2B5IC 4IOSA 1QSFA 1PCSA 4GS7C 3KLHC 2IQAB 4XBMA 1IM3D 3QI9D 5GRUH 5I30L 5L7XH 3H7BA 4K23L 4GW4B 5JPNA 2BSEA 3BWUC 3UZVB 3QUMH 3DX7B 2NY2D 4UTBA 1BVOA 3RP1A 2P8PB 3AG1B 4F7TA 1KXVA 2FJSA 3H54A 5DZAA 3EJYC 3E7JA 4BCZA 5EDXA 4KX7A 4ZODA 4B9KC 5L7XL 5T1KB 1Y0LB 2ITDB 2DDQL 1UG9A 4JM4L 3QUML 4NHCL 3KHOA 1IEHA 1MCQA 5GGUA 5AZUA 5HHOE 1T04A 2OCFD 3K7UA 3D9AL 4LSSH 4DZBA 5K59E 5BUAA 2JIXA 1EFXD 4JBSA 2XHNA 2EXWD 4XOAA 2YOAA 5K39A 2WN3A 2H2PD 3KDMB 3X13B 1F1DA 3B3BA 3K4ZA 3BP6A 3GSOA 3OKMA 4PGDA 3BZEB 3W57A 2XCMC 4L1LA 1HOCA 5E1HB 3EXJA 1T2JA 1ZVNA 2GABA 2GJZA 2VSKB 3X17A 1UOKA 3IGLA 2W94A 4PJ9A 3DGGB 4U1HA 3WY2A 1Y18A 4LSSL 2W07A 3LZFH 1I85A 3KPLA 4HMEA 4PJBA 3VFSA 1WYJA 2CGYA 2ZAHA 1ZE3H 4EE2A 4Q6IA 2OSLA 5KSUA 3RIFF 2CUIA 1U58A 2WZ0A 3GSXA 4ZRGA 1FLRH 5IEKA 2O5NA 3BMWA 1ZT4A 1DJIA 3BVNB 4OD3H 2WLIA 4WI6A 5IV2B 5FK9A 4EO5A 3OKEB 4MXVF 3QVAA 4XAWH 5MERB 1N6VA 4TV3A 3QCTL 5KS9E 3PAZA 5HYJD 3MJ7A 4IMLB 2CGRH 2FNBA 3FO1B 3V4LA 1I9IH 4Q6KA 4M8VA 4XMUA 3Q2CA 4MQ7A 5JTWA 4JKLA 3TFBA 3NCJH 4NOBA 4CW1B 2MPVA 3Q5TA 4LLMA 1ID5I 2WNKA 3L5HA 3KLLA 4JAMB 2HFFB 3VD7A 1UEYA 3ZTCC 4K9EH 4EDXB 1J8HD 1BVNT 3ZSSA 3S5LG 1AQHA 3D39A 4CC4C 1MF2H 4WFHD 4M02A 1QO3B 1G4RA 1I9IL 1IE5A 1MDTA 1X9UA 3WXWH 4GSRA 3G08B 2YEZA 3NCJL 4WTXA 1XHHA 1I31A 4X80L 4FQXC 2NLJB 1WCBA 2R0LL 1OVZA 3UJIL 2ZPKL 1CFQA 1AGCA 1RHHA 4OZIF 3U25A 5C0CA 3QEUA 4K9EL 4XVUC 4L2LA 4OLZL 2VQ1A 1N0LB 4RFNB 1MIML 3LNDA 2GY7B 2ZXWB 3FOMA 1U92A 3J8F7 4KX8A 3S3DB 1MF2L 3QXAB 5CMAA 3DX1A 4DW2H 4LDCA 4M1DH 3WXWL 2FHFA 3GF8A 3TC9A 3BPNB 4Q7DA 1AZRA 2C26A 4UM8A 3MBEC 3REWA 4YDVB 4WJKB 3K81A 4J8QA 4DO5A 3PIQA 2D31B 3Q48A 5DZLA 4GKOA 2WQAA 1GMEA 2KDYA 2UZIL 2CHZA 2HVKA 4UQDA 1UH4A 3A6OA 3OMZA 1P1ZA 4M1DL 2BZ7A 4Q4EA 5FYLL 1C5BH 4GAYB 4X9GA 2XWJA 1OT2A 1NKOA 5CD3A 1G0XA 2AQ2A 3PGDB 1JNNH 4XGZB 1OARH 2VERA 3ZDXF 1L6XA 4KJPD 4NQCD 5E6RB 2HSIA 3QNYA 5GSVB 2O26U 2FJFA 1SLUA 5DRWB 3UCRA 1JVKA 1IBFA 2XNAB 5GGRA 2ZCKL 4O9HH 3HI5L 5HDWA 2L7UA 3MV7D 5L4JA 4JPIB 1C5BL 3V5HB 2IBBA 4H25B 1JNNL 4JQVC 1WAAF 3FU3A 5E0QA 3QJVB 1KCVH 2VOTA 5DJ0A 4UTCA 2OW7A 1KGUA 3QUMA 3OSKA 3QQDB 1M6OA 3HJ0A 3V55A 5CJXA 3O3DB 4O9HL 3UP6A 2A99A 5CSZA 1XVSA 2NXYD 3EO1A 1G1KA 4LSTL 3KVQA 2NQ3A 5EWIL 3Q01A 1DQLH 4F1SA 4BSWA 1UOWA 1RIUL 3CZFB 2VN5A 2XVBA 5AZ2L 3S97C 1ZGLM 3GSWB 1KCVL 4GO8A 1B9KA 1UT2A 2DEYX 2EXSA 3OKOB 4BZ2H 4HKZA 4QR7A 4Y1AB 1ZK9A 3B5HA 2MRYA 2OTUA 1U9KA 4YDJA 5T3ZE 5H4ZA 1WISA 2FZ3B 4IRSD 4IU3A 5DCCA 4O5LL 3F7YB 3G6DH 3FN9A 1DQLL 2JKRM 2EDJA 2XKUA 3RX7A 5JW5A 3P3SA 3LKPA 3CG8A 2RCSH 1CLVA 1DEDA 2PP7A 4GAJH 4M5YH 1RZJC 5MEQA 1YN6B 3MACH 1QLEL 3LN4A 3LRMA 1HNYA 4KROD 1A6WH 4M6MH 1I1AA 1XH2A 2E9BA 4GQQA 4P3DA 4PJIF 4AYBA 5E5UB 3WFHA 3NOIA 1IIKA 1LP9B 1DJSA 2A77H 3GBLA 3K71A 1GW0A 1IBGH 5SX5K 2NY5C 1UTDA 2IALA 1T5XA 5DURB 2RCSL 3LB6D 1YQ2A 3LAFA 2G60L 3VRJB 1AD9B 1Q0EA 1JV2B 2FH6A 1S78D 1EIBA 1KTLA 4GAJL 5CZXC 4ZSOB 5IM7B 3MACL 3ZIYA 4BXVA 1A6WL 3VYOA 3U30B 1FVDA 4M6ML 3U2SB 2G5BB 4KRNA 3U30C 3Q6FA 4KITB 2CJ3A 5HDRA 3MRQB 1E5CA 2X0UA 1ZGLA 1U6AL 2BVTA 2I9LA 1KIUA 2A77L 1LEIB 1IBGL 3KWUA 2XPYA 3PWUB 1BQHG 2W9DH 2EDMA 1NCBL 4PJGF 4E9RA 4X7FC 4U1GB 3MYZA 1DYZA 2P7TB 4X6CB 4U1GC 3H42H 4TUOB 3HLAA 3GMPB 1GZPA 1J05B 3V6FB 4GUCA 1PJWA 3UJIH 1DBKH 4ENED 2V7HA 1LEKA 5T33L 3DDFA 1G1OA 4PU2A 3FTWA 2DOCA 4PRID 4U1NB 3VNZA 3Q5YA 3MA9H 2K6ZA 3OX8A 1X5GA 1PZAA 4O02L 1N67A 1S7QB 4BINA 3B9KD 3DOIA 1EZLA 2HMIC 5D5MA 1QBAA 2X4RA 1TTCA 3H42L 4G9FA 3V0WH 3QEGH 2VZTA 3GJFB 5T1JA 3VFMA 1W6WA 2E6PA 5LGJA 1DBKL 1RL1A 3EYSH 4M5SA 4OFVA 4PWJA 3T2NH 1A7OL 1Z7JA 2N7BA 1TMQA 1H8OA 1IAOB 1E9PB 2FLMA 4R7VA 3RRQA 5B3JF 3MA9L 5T8IA 2MPAL 3Q9QA 5J4MA 4NCDA 4E42A 4YXKH 3T6VA 2F53D 2Z31A 4IBQA 3QEGL 5H2BB 5LBSH 3V0WL 2AK4D 4QF1B 4NENB 2L8AA 4YSOA 5C0BE 1OPOA 3EYSL 1QHPA 2PYEA 1Q9KA 1DCLA 3AADB 3T2NL 3MRCB 1J7VR 3VFNB 5DJ2B 1WZLA 1KIRB 3ZKSD 1OE2A 3PWLB 1ZPUA 4JMXA 4Y4FD 3DYMA 5CSGA 1BZ7B 1NGQH 4JPVL 3TZVA 1VKXB 3TBYB 4FOMA 4NBYB 5LBSL 4ELMA 3SGDI 1SYVB 3CC5B 3LEYH 2A4ZA 1UB6A 1XFPA 3QZOA 4A7GA 1U8IB 3BGAA 4NO0A 4XWGL 1UZGA 4GKSB 4X6DE 2CO1A 4DP5X 5K9JH 3KGUA 5DYOA 2DQHH 4FFVC 1XEUA 4XRCA 4DK5A 1MCHA 4XN1A 2WXOA 4J6RH 4TVPE 1LWHA 2ARJA 3SPVA 1Z0MA 5D2LF 2DMCA 4A7UA 2EEBA 1AR1D 1DFBH 5B4MD 4AX3A 3BAKA 3DBXA 1BXXA 5HGBB 3EJSA 5DMIL 5K9JL 4OY9A 5A3IC 4OCNC 4LAJH 4U6HA 4HBQA 5A2BA 2N56A 2DW5A 1KB9K 1HDMB 3QBTB 2P4AB 4J6RL 2APVA 2XV0A 4BZ2A 4NSKB 3L54A 4LRIC 5EZLA 1DFBL 1VZIA 1D7CA 3NPSB 4TMPA 3PDDA 4NPKA 4PJDE 3NPSC 1HWWA 4FD0A 2X87A 2YSSB 2QEJA 2A9CA 4JRWA 3DURB 4PPTA 2Z64C 4BELD 5TGBA 1KFAH 4NQDE 3GTTA 1MQ8A 3F85A 1TR7A 4M62H 3TWCH 3W5NA 3BP5A 2O72A 1FIGL 2E8ZA 4J4PD 1M71A 4LEXL 2X70B 4OZGA 4R4NC 3VQ2C 3IRZA 1SXBA 1H3VA 1KTCA 3TEXA 4FL4B 3UTTD 4UQ3A 4ZO9A 1X5XA 1GCFA 2XETA 3FOLA 3TWCL 1WZKA 4M62L 1ND0A 2LQRA 4TQPA 3MR9A 3FQWA 3ARBA 4RCAA 3BWSA 4YGAB 2FWOB 5SWZE 1DE4A 4PD4K 2CMRL 5SV3A 5CKAA 5BJTA 4FERA 3K6SA 4XCYB 5KANG 3E9TA 3TBSB 2F74A 5JNYA 3CZSA 3EH4B 3KMDA 2YLHA 3SJVD 2WIMA 2G9KA 3QQ9C 4BUGA 5HVFB 2AKRA 2R4RL 3WLBB 2EAEA 1NGYA 5B7FA 3HI6H 3R4RA 3UEQA 4M00A 3QPQC 1XD1A 4GPVA 3BAEH 5KAQF 3G6JB 2HT4C 1R3HB 3PQYE 2IFGA 4AQ8C 1GL4B 2YA2A 3RX5A 4Q9RH 2WVVB 2OMVB 3DXAA 2DWSA 2EABA 3PAUA 4WU7A 2HJLA 1CF8H 1EGJA 1YEJL 2D8KA 3CVCA 3HI6L 4PY7B 2J5WA 4JKPH 5AW5B 5I8OH 1MCCA 1I1FB 1TUPA 4MA7L 3IMBA 4KV5E 3BAEL 3ZN6A 2OXHB 2RMNA 1PF3A 1KV7A 5EU6B 4XNUH 3EOAA 1EZSA 1Q38A 3FH5A 5I1DB 4Q9RL 4AVHA 2R29H 4U3SA 3GDBA 4JFUA 1Q1JH 5JPMA 2ZXDA 3OHXC 5DD3L 1JHKH 1A4JA 1CGWA 4KZEL 5I8OL 4AYMC 2ZNXA 1R4XA 1KLUA 2X6VA 2EIBA 1RSFA 2TSAA 4X6FB 1PAZA 2JKWA 2X0WA 2I32A 5SWSA 5E6ZA 2TRHA 3CVHB 1OCWH 3U0WH 2R29L 3LV3B 1JHKL 3A4FA 2H26A 4LSVH 1HHIA 3TH3T 3PY9A 3ROOA 1P4LB 5AYUL 35C8H 3HR5B 1T5WB 4HWNA 2CO2A 3WHE1 3RAJH 4YLCA 5CCHE 1NA8A 3UTSB 1URIA 4X5WB 4Z7QF 3R0NA 4AC4A 5T3ZL 1HIMH 4AKQA 4PJCF 3HG1E 4R84A 2W0KA 4LSVL 3AAZA 1J1OH 1KCSL 1H19A 3W38A 2X41A 2RD0A 3VGFA 5FOJA 1SN5A 3T65A 4RNRB 3WSQH 4HFWB 2JI3A 4OD2B 3F6IA 1UD2A 4U49A 3WCYA 1RIHH 2PCPA 4H8PA 4KRPB 4QDGA 4U3HA 2NUTA 4KRPC 4JFED 3WE1A 4ZX4A 3AWFA 3WD5H 4MA3B 3NFNB 2PTVA 1SEBB 4XWOD 3P4OA 3RZWA 2FHBA 3ZZQA 5AD0A 1J8KA 4OLXH 2FGZA 4RDQG 3P11H 2JCCE 5FW8A 3TEUA 2JKJA 4LMQE 4N5EC 2J8UF 3ZR5A 1RIHL 3NCYP 3V7AG 1UHVA 2VXSH 5HGAB 1YN7A 2NOYA 4XC3L 5AAMC 1HVXA 3WD5L 5DGQA 2K1MA 1YO4A 2WYHA 3VAEA 1MCOL 4OLXL 1FNSH 2VXTH 1N0XH 1QSZA 1F3DJ 3KM1A 4P5TD 4UB0H 2CWRA 4HJGB 4ZUWA 2B4CL 1HHHA 1E28B 3V4VB 4PTTB 4I2XB 5E8NB 4Z78A 2W5PA 2VXSL 2F19H 3QJRB 5BOZG 3J07A 3OKLB 3DHJA 4XPTL 4XBGB 5E1AA 4OZIB 5DQ9A 4TUUA 2CIIB 1FNSL 1IKFL 1HWGB 2GI7A 3O3EA 1N0XL 3HFMH 4UB0L 1FNEA 2BNQB 2MSPA 1YVLA 5EPMA 1YEEH 2P47B 3VRLE 4ZXBA 2F19L 4NI3A 2EXWC 4YHLL 3EF7A 2H2PC 1JF1A 3F7RA 4P3CH 1OCRB 4FZ8H 4K8RH 3W9DB 2GC7C 2PW2B 2QQNL 2YEVB 5IROD 2EKSA 1LO2H 2WTOA 4N0FB 1FWXA 2QVIA 1LWJA 2PWEA 1U93A 1P5VB 1YUHB 4AYID 3T08A 4AM0A 1MELA 5JQIB 2XOTA 2VRAA 4CU6A 3TYGH 2M83A 2H3NB 2IAMA 4LLDA 4FZ8L 5LQBH 3ZDXB 3ZZSA 5AFAA 4PWEA 4K8RL 2VZVA 2AJYH 3F62A 5JIQA 1PY0A 4KDTC 2EIZB 3SZ6A 3RKDD 1I7RB 2JJTC 5F1IB 2AS5M 4JM2A 2R51A 3TYGL 5F88A 1CDIA 2R29A 5HVWA 1E9QB 1DVFB 4E9WA 5LQBL 4QY8A 1J9TA 1DVFC 4W68A 1NEZB 5EBMB 5LN4A 5JR1H 2P24A 2AJYL 2APXA 1J8HB 1AJ7H 2W88A 4GSDL 4L1DA 4TSBH 3PHQA 2ALAA 4UTAH 1V3JA 1SDDB 4TVPL 4PQXA 4AUJA 3L3OC 5ADPH 1CTOA 1CVSC 1QBBA 3FONA 3JQOB 3EYQD 1PVHA 3P9WB 4ZS7H 1BIIA 2X2YA 2J8HA 5ESQA 3SKNB 4N0RA 1ZVSB 3SHSA 1S9WB 1G43A 4UTAL 5DS8B 1HHKB 5EFIA 2O5XH 2W59A 3FW6A 4LHQB 5ADPL 4PIBA 3GMRB 2AERT 1VFMA 4EZJA 3UZEA 2E9JA 1TEGA 4PJBF 3AQZA 5F7UA 5DTFA 2TRYA 4ZS7L 3HRPA 3OV6A 3BIKA 5EU3B 2J4WL 3GSRA 4P8QA 2CJTA 4UAOC 1F13A 2HLFD 5D7LE 2DTML 2E4FA 4M7KH 3WO4C 1NC4B 1GZHC 2X4QB 3VRIB 5C70A 2VWEC 4WQOA 2YD3A 1MG3C 4C47A 2AQ3A 4PP2A 3CFQA 4ABUA 4NQCB 2GPZA 5LHDA 4O4YL 1XF5A 3DA0A 2H1PL 3NRPA 4R4BA 4P4RB 4OVVA 1IC0A 2UWEF 4U3CA 4M7KL 4LIQH 5ABAA 3WENA 5BV7C 2ZXAA 2EYSB 4AQAB 4TQEH 4Q9BA 2C9XA 4A2DA 2AI0H 2FTAA 3RZCB 4NXSA 4W4OA 3RZCC 4QGYA 4A6YL 2FIKB 3HE6D 5FFGA 4P2QA 1G4MA 1FJ1B 3A5VA 5DJDB 4AIXA 3X14A 5D9SA 1LO3H 1SXSA 4LIQL 4JG1H 2DI8A 5LB1A 3NQKA 4QRQA 3VW3H 1AACA 1KZQA 2J6EH 2HN7A 1PFCA 3P30L 4NPYB 4Y19A 3SPHA 1Z9PA 1IJNA 3IJEB 4F7KA 5ILTH 4Y9GA 3BI9X 4UZSA 5ECJE 5FF6A 3NA4A 3VI4E 2WAQA 3O6LL 5FB8A 4HPOL 2BK8A 5J1AA 4JG1L 1ZJAA 3NN8A 3VW3L 3IU3B 3TN0D 4IRSB 2J6EL 5CLXA 1C7TA 3DOSB 3OB8A 4IRSC 4IU2A 3OWRA 1Z66A 4ZPVA 4CDHA 5HHME 2AXFB 2UZXB 3ARDD 4MTMA 4N85A 5ILTL 4ODWA 1GPOL 3FHAA 3TBBA 4N0UA 3DO7B 4QTIL 4JZOA 3V2AR 1GY1A 1SVBA 4IBSA 4ZYKB 2AC0A 4LCUB 3HZMA 2H3XC 2GTZB 4HHGA 2BIOA 2X6BA 3NIGF 4DF9A 4F93B 1DBMH 3OJDB 3TIDB 3RNQB 2VUYA 1IUZA 1EXUA 1BM3L 1YDPA 4RIRA 2WXIA 5HDBE 2VDRH 2GY5A 3LB6C 5L2JA 4JFDD 1K72A 1S78C 4B7LA 3RHWF 2JE8A 3AT0A 1SY6H 1CDHA 4KXDA 4QXTB 5HJBA 3TONA 3IJ9A 3NK4A 5DK3A 1H6TA 4Z1PA 3GXMA 2H9GA 1DBML 5B21A 2DPKA 3CZGA 3DPBB 3IYLW 3P4MB 4ETYA 1JERA 3TA3A 1NBYB 3QUYB 3Q13A 4ADIA 3TO4D 2VDRL 3FYIB 1ZSDB 4GRMB 4W81A 1F4HA 3QDGA 3VSVA 3ABLB 5KG9B 2EE9A 5D2LB 5B3NA