5KBDA

Structural studies of transcription factor p73 dna binding domain bound to pa26 20-mer response element
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
201
structure length
201
Chain Sequence
HEFIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPVYKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGRDRKADEDHYREQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of Transcription Factor p73 DNA Binding Domain Bound to PA26 20-mer Response Element
rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Tumor protein p73
total genus 32
structure length 201
sequence length 201
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 5kbdA00
3WTXA 3WTUA 4XR8C 5AOJA 4L0ZA 5AB9A 1TSRA 2XWCA 1KZYA 5AOMA 4MZIA 3D08A 3EXLA 3ZMEA 3D0AA 3QYMA 5ECGA 2X0WA 3D09A 3VD0A 2RMNA 4A63A 3KZ8A 3WTTA 2PCXA 4GUQA 4L0YA 5AOIA 4IBUA 2OCJA 5ABAA 4AGQA 5G4MA 4G83A 2IOMA 1HJBC 4AGNA 4IBZA 2BIOA 3US1A 2BIPA 5KBDA 1HU8A 4AGOA 3EXJA 1E50A 3WTSA 1HJCA 1IO4C 4L18A 2VUKA 1YCSA 5AOKA 3VD1A 2ATAA 2X0VA 1H9DA 2J1XA 2P52A 2X0UA 4IJTA 1TUPA 4IBVA 2YBGA 3IGKA 3QYNA 2J1YA 4IBWA 2FEJA 1EAOA 4AGLA 2ADYA 2AC0A 3D07A 2H1LM 4HJEA 2BIMA 2WGXA 4IBYA 3US0A 4LOEA 3D05A 4QO1B 4GUOA 4IBQA 1EAQA 2IOOA 4IBTA 5G4NA 1LJMA 2BIQA 3WTYA 2XWRA 5A7BA 3Q01A 2AHIA 2J20A 2J1ZA 3WU1A 3Q06A 1CO1A 5AOLA 2IOIA 2J21A 4KVPA 3D06A 2BINA 3Q05A 4IBSA 1UOLA 1GZHC 5G4OA 3WTVA 1GZHA 5BUAA 3VD2A 3TS8A 2J6WA 4LO9A 3KMDA 3IGLA 2MEJB 4AGPA 3WTWA 1T4WA 2GEQA 4G82A 1CMOA 5LGYA 1EANA 4AGMA 4LOFA 2J1WA 5LAPA 4MZRA
chains in the Genus database with same CATH superfamily
5CJBA 3J7HA 2QPEB 2K45A 5F7NC 3ZT5A 1RZKL 2J6EH 2ZSVB 4IDJL 5LXVA 2VLKB 5FHBH 4FTVE 1ID2A 1T66C 3UTTA 4OM0L 3L3OC 1RJZB 4YUEH 2R2BA 4U6TA 3ARTA 5JQ6L 1XH2A 2PO6D 3OHMB 1NPUA 1RIVL 2PR4L 2Z7YA 5F0MB 3TN0B 4UNUA 4AXWB 1IBFA 4XXWC 1NCBL 4TSBL 5E8EB 3DOSA 1EHLL 2YKLH 3MDJA 2JXMA 3NIFE 3D0VB 3R4DA 5I74B 5E1HB 3ULSB 1UXWB 1YDPA 4HCRL 4UANA 4YHKL 3T71A 43CAB 5HP5A 1NAMA 1DZBA 1OHQA 3HZYA 2C26A 2EABA 2H9GB 2XBTA 4B9FA 5C97A 4I3RL 4NRYA 3US1A 2BIPA 4MD0B 5CEXB 1IM9A 4EDXA 3BW9B 2W9DH 1UXMA 2EYSA 5KBMA 4ODSL 4GPVA 5ISZA 2K78A 1AO7A 2I9TB 5E4IA 3ATAA 3WHXB 5ENWA 5CEZE 4WFGE 2VDQB 3LPGA 4KVCL 5E2TL 3U4AA 4GKNB 4KVNH 4NN6B 1XAKA 4X6DB 2FEJA 4MNQA 2X10A 1WT5A 3HS0C 3P0VL 1MRDH 3VGAB 3UBXA 3VD4A 2AV7B 1F11A 1HHGB 4MJID 4TQ8A 4UQEA 1WO2A 1KEGL 2D9CA 1S3KH 2OMVB 3SDXE 4KRPB 5BZWA 1FJ1A 5I17A 4F8QA 2QELA 4Z7VE 1OXYA 4QHNB 1J1XH 1N2RA 3H42H 3GHPA 5L2JA 5F9AC 3UC2A 3WNLA 3FXIC 4F7CB 3R19A 1PKQB 3P4NA 5KTEL 3BJ91 3CC5B 3TYFB 3EGSB 4HS6A 1J0IA 4LOVA 1AGEA 4MJ2A 4GMTH 1PW3A 5F0LB 3L3DB 1MJJB 4JKNA 3G5XB 5GSVA 3SPVA 2DWYA 3U2SB 4FQ2H 2JKTM 2GK2A 3VFNB 5TE4H 4YGAB 2XVGA 2AFNA 3WS6C 3MRGB 5IQOA 3F01A 4N2KA 1OGAD 1DQKA 4PJXE 1DVFC 1PMYA 2BCMA 3C6SA 4JQIL 2YD3A 4TS6A 1RUMH 4NQDD 3V9EA 3WIAA 5JPMA 2J88L 4QHKJ 4WSJA 2R1XA 2YPVL 4FNQA 2RAMA 1XIWB 4AKOA 1J18A 1J87A 1KJ2L 5L7XL 1LK3H 1BZOA 1MCWW 2Y2WA 4OI9A 1OAUL 3MV9B 5F89B 4B9ZA 1QFOA 3X2QB 1GYCA 5CU9A 1VF5C 3U7AA 3AG3B 1OTTD 3CDGA 4JRYD 1OPGL 3IFNH 3H7BA 5DJ6A 3VXMA 4CU7A 4JFDD 3ZT7A 5IB4B 1FL6B 1WFMA 1JV2B 2J1KA 4M7JL 1AJ7L 4XNQB 1FNGB 4R4FH 2FWOB 4J8QA 3QXDB 4O2EA 4DVBA 1XGUA 2JCCF 2FNBA 3BVDB 4JZOA 4U7SA 4G42A 1G6VK 4E68A 2JIXB 1EO7A 4U6YA 2OMZB 5IIEA 3BUPA 4L0YA 4QRFA 3G6JB 5FS5A 4HUNB 4OLYH 2GUOB 1F86A 2ED8A 4JL2A 1GGBH 1D5MA 3HC0A 3K6SA 4JAMA 4N9GA 3SPIA 1ITCA 1YN7A 1YQ2A 3UDWA 2M26A 3LV3A 3K5RA 4PWGA 2R2HB 5E0FA 3S36X 3MYJB 1G7IB 1E42A 5EFIA 1Z9PA 3RDTD 4L5FL 3Q8AA 4ODTL 2R15A 4W9GC 4AVKA 1NEPA 1UVQB 1XBDA 4DO4A 1PDKB 4NPJA 2Q76A 5L4IA 1LWRA 2VRKA 1IFHH 2VITB 2WLNA 3MUHL 4J3OC 3S7GA 4DESA 5AUMB 3MRHB 5JTWA 2ADYA 2I60H 4O9HH 3LKSB 2C7FA 2WCGA 1X4YA 2KLRA 5HTSA 4TVSa 3FB6A 1IQDA 1R3LB 4R7NA 1I85A 1UWEL 3KL3A 4OAWA 2MQCA 5AW4B 3B8YA 2ICWA 3RIAK 2HT3D 4POYA 5JQHC 5EMYA 2IFFH 1TJIL 5HHNA 2VXSL 3WN5C 1GW0A 3C75A 5C0FA 2DQGL 3UG3A 1P1VA 5IHUL 1TKWA 2HFGH 1DANU 3KPRB 4NQDA 3IJ7A 3K1DA 3ATDA 3P77B 3A4EA 4GIAA 3BP5A 5EU4B 5EU7E 3QRGH 4XP5L 1CG9B 3BAXA 2AXFB 5FHAH 1IBZA 3OV6A 1TITA 3CN0A 3QORB 1OP5H 3V6OE 2F58H 1HVXA 2QBWA 1KTDB 4K7FB 3N1QC 1JZ4A 4NJAH 5DA4A 4BFEA 1Z66A 5F96L 1CZ8L 1M7DB 4QGTA 1MPAH 2DQFA 3FT1A 4HT1L 5BUGA 2FGWH 1MFBL 5I24A 2PXYC 1EJOL 1SN0A 5D7JB 3CH8A 3PV7A 4JM2A 3HJ0A 1UJ3C 5E5UB 1QW8A 4LXFA 3NFSH 3ARBC 2AV1B 3FUNA 3GMMA 3L4ZA 4U1MA 1MCOL 3RTQB 5EBGA 4L0ZA 5ETUA 2OXHB 4HH9A 1WZKA 3EXLA 3I9GL 2DD8H 3P9LA 5LO7A 4ETQA 4G2AA 2YD0A 3BRGC 3BMVA 3OMAB 1ES0A 4FQLH 4A6YA 3IDMB 3NJFA 4GAJL 3KEDA 3CN3A 4U1JA 1P4UA 1QTPA 3DVNA 1P9MA 1R3KA 3SCMD 4F5CE 1TQTA 5DJ2B 1S5IH 1EEZB 1A65A 4G8EA 5SWQA 1YNTA 3INOA 3FTGA 4H20H 1LEGB 2FJSA 5L2KB 4LBEA 3E1F1 1HJCA 2IAMD 4MYPA 4Q9BA 3D39E 2WYTA 3OSVA 4GJTB 3VXNA 2AV1A 1CLVA 4Z5RA 5TDPB 1G0YR 5INCB 4NBXB 1QFWM 3WHE0 1F1AA 2LU3A 4JFEA 4MDIB 5E8PB 2Y7SA 1U33A 4JM2B 4J3TA 5AEAA 4GAJH 2OX5B 3KDPB 3GSWB 3HN8A 1A6PA 3N0PB 4KK8D 1F4HA 3BVWA 1K5WA 5EU3A 3DTXA 2HH0H 4FLSA 4XX1E 4KY1L 4ZD3L 3SPHA 1AZUA 1KTDA 3QE5A 1KB5B 4K7FA 3TOPA 1MFDH 2Z31C 2HRLA 1KCSH 4GRLC 2K1MA 5D7SL 3IMBA 4ZX6A 5GXBB 1R3IL 5CN3A 1S78D 1T20A 2GFBB 2Q8BH 3ARDB 3O6FB 3O9WD 3OKNB 5CILH 1RUPL 5JW4M 5K1NA 4IBTA 1JWSA 3P77A 3L16A 5EU4A 4NO0D 4AQ8A 4DP8X 1ORQB 1TETL 1U8LB 1W72A 2XWDA 3WEBA 1ZHBB 2VW7A 5C0BE 4XMZA 5JZ7D 3RA7L 1T1WA 3QNZB 1L3WA 1M3IA 1IAIM 2BSED 3TYGL 2D9QB 3PUUA 4ZOBA 1SN5A 1Z32X 3LNHA 1KB5H 1UZ6E 2EXWC 5FA3A 3QJRB 4JHBA 4CC0A 3NSYA 4PBWD 4HX1B 4ANXA 2X41A 5D93C 1CE6A 3VD2A 4KXBA 2DYPD 1JGVH 1E90A 3DX7B 4NZ8A 5IFJB 3W81A 3RWEB 2PO6A 4ZBJA 2CRMA 1J8RA 2NQCA 3TNNB 3BSZL 2YD9A 4JUTA 1OTTC 3MV8B 4L8SB 4JRWA 4C4UA 3QDMB 1NCDH 3BXNB 5CS7A 2GIYA 2HPTA 3RTQD 1M6UA 4PWIA 2F8VA 1WFIA 4HHAA 4ZFZA 6PAZA 3P3SA 4NNXA 2C3XA 4GXVH 4ZS7L 3VFRA 2Z1KA 1RULH 2GSIB 2XCMC 3NBNA 4MRBA 4EQ2A 5EFIB 4HIXH 2DQTL 4I9WE 2CCWA 5A7EA 4JFXA 5HDLA 3U1PA 3LRMA 3LKPB 3DMMD 2OZ4A 1YN7B 4NAMA 5DEJA 4O58H 1DLFL 4BINA 2DTML 2Y36L 3D87B 3D69A 3TESA 2KZWA 4D9LH 1ICTA 3ZTCC 4GRWF 2DH3A 4JG0H 5JHDA 4N0CD 5T3XH 1PIGA 4PCSA 2CA4A 5AFAA 3UMNA 3WNOA 3ZDYB 1Q72H 2EYTA 4KI5E 1A6VH 1WFOA 4K5MA 4XO9A 3DI3B 4DVRL 1T4KB 5A2AA 3HCVB 4PRAA 4LSUL 1N0LB 2FWOA 1OP5K 3R06A 1KPRA 3S0PA 4XNUH 1XF3B 2CG9X 1TJGH 3GMOA 5DJ6B 3VXMB 3CDGB 5KJ7E 3ML9A 1H6EA 3P11H 5CZRA 5D96C 3EF7A 2DS4A 4L4VE 3RB7A 2VDOB 5F89A 1PFOA 1WIOA 3CH1A 4P2QD 3L4UA 1NUNB 3FQ1A 2YMTA 3K7UA 3NJXA 4G7RB 4OTXL 5DFTA 5HJ3B 5AB0A 1KGUA 1U8HB 2W8CA 3KR3L 4AGLA 4YHZL 3IDIA 1SEQL 1A6AA 4HGWA 1A7RL 3DPDA 4Q4EA 5E8OA 4NPKA 2ZJSH 3RVVC 2ICWJ 4RFEB 3QDMD 4YSPA 1SDAB 3VFNA 3MI6A 3VXRB 4KBPA 3P40A 5KANI 3UFIA 1LP9B 2DICA 2R9HD 5GSVB 4ENED 1NDGA 3BAKA 4FMKA 2GTZB 3PQYE 5DVMA 5I8KH 4KX8A 2VLJB 2ZCLL 2QQLL 2OZNA 4XCYB 4XPGL 3BD5A 5I2IA 4UCFA 1I7ZB 2EP6A 1AANA 1OZUA 1L9RA 2H1PH 4JZNA 1SNRA 4HPOH 5HI5D 1TZGL 1SYSB 4E5XG 5IJVA 2XTJB 2X87A 3Q5OA 3CMGA 2WJ5A 3FT0A 2QDWA 8PAZA 5DHEA 3M07A 5FDWA 1IAII 3HR5B 1DBAH 2MMXA 4XVTH 5BOZG 1P7KA 3BDBA 4AY0A 5DRZA 3HG1D 1I3GL 3OR7A 2PP9A 4JBSA 5MERB 3HZKA 4ADJA 1CVRA 1GAFL 3CU7A 1QFWH 4J6IA 5AYUL 3JTBA 4C54A 5IVXF 3C5ZC 1EEYA 2WO3B 1S7XA 5I1HL 2J8UE 2HTKC 1S3KL 2OK0L 5B7FA 5CMAB 4CW1B 5ILTH 1R6VA 1T04A 5LKNA 4HC1L 3MAWA 3FUFA 4NKQB 5D4JA 3P54A 4IMLB 3VAEA 5J3HD 4K5PA 5DZNA 1E28B 4PCTA 1UZ6F 2VDLH 3LOWA 2VR7A 4EE2A 1X5MA 2C1OA 1KCRH 1YUHA 3ULVD 1IEHA 2EYSB 1HHJA 1CDIA 1DJZA 4AJVA 1VAHA 3DX9B 2PYEA 1MJ8H 3HAEG 4YDVB 2X4RB 1OCWH 4V1DA 5KSBE 1T5KA 1HOEA 4XN4A 3GB7B 2FD6L 2YXMA 3UAFA 2ZYHA 2YGOA 2CPCA 2YGVA 3IM1A 4GEIA 1F97A 3PJSB 3V4VL 4DOHE 1DLFH 1KCUH 3VE0B 3QCUL 4K94H 1NMAH 5GGQH 1NANH 5H4YA 1OB1B 3I9AA 4F33B 4S0HA 3WUWA 2I32A 2RCSH 1EEUA 4PS8A 1HN1A 4OFQA 4AVIA 2DLEA 2IAMC 1FORL 3S34H 4AXWA 4LU5H 1A4BA 3A21A 2QFRA 4MMZA 5LGHL 4LSVL 5IY5B 1NCNA 2AAAA 3T77B 3ZDYE 4ZO9A 2GK0A 2QVFB 1C12A 5GJSL 3BFOA 1OE1A 3T3PE 3X3GH 5EEZA 1XD0A 3MJ9A 4XB7A 1A9VA 2KLTA 1AQDB 2VZUA 6FABH 4ZOAA 3ESUF 2CO4A 1HT6A 3ZL1A 3ZR5A 4F7PB 5FKAB 1EFXB 1GZPA 1MHPL 3FSOA 1WWBX 3JTSB 3MX0A 3VG0L 1AXTL 5MP6H 2GCYB 4DGIH 3CXDL 4H5SA 2Q0ZX 1MIML 3BE1H 4GSXA 2F7IA 1L9NA 3VFUA 3WN6A 2R27A 4GFXA 4AUJA 3HHRB 2WZ0A 5K59F 4JQIA 3CFKB 2L7EA 3CFMA 3GD1C 1BZQK 1EDHA 1P6FA 2W0KA 4HFWB 2YAHA 5D71H 3FFCA 2ZXQA 2NY3B 4O2CA 3SO3C 5CSZA 4DN4L 4QRRB 3EKCA 1GPOL 4LHUB 1QX1A 3TV3H 4APXA 2NMSA 1KZQA 4OZHE 2IALA 1DLHA 2ORBH 1VERA 1ZRUA 5HDBB 3V4VH 3VG0H 1UJ3A 3BPNB 1NEZG 3K0YA 3DETD 4XTRC 1FVCA 3U9WA 5E08L 2GT9A 1CC3A 1RJYA 3ARVA 3GBDA 1JF1B 2R23B 1MXDA 1JOIA 2ZSWB 3DXAA 2K6WA 4L29A 4M61A 4J3VA 4U1HB 5I16B 3VFPB 5EEXA 5BUAA 4HIIA 1Z0NA 2J6WA 5B38G 4Y4HB 2G9KA 1JPGB 3KMDA 5TE7L 3GK8H 4FHJA 2QPDB 1HOCB 2Z8SA 5CM1A 4MLSA 1V7NL 5ES4B 1JDCA 2JKSA 3PAYA 2DLTA 1HH6B 2GC4C 3EH1A 4UUJB 4BDVB 1HE7A 3APDA 4QHUB 1CXIA 2HT4C 2R4RL 2WB7A 3H4FA 4K8RL 2OAAA 3T0XA 3PWPB 3WAJA 4EEEA 2O6FA 2BCKA 2GABA 5T5NF 1GOFA 2J2ZB 4LPVA 5LBSA 5F7DA 2OCFD 3JV4B 1MLCB 4TQHA 4UDUB 2BOLA 1ZSHA 3JV6A 3CN2A 4KJPC 1R0AH 2MQ3A 1XSOA 3ZHNA 5K9KB 4CN6A 4K07A 1MFAL 3RZWA 4LCCA 5IVZA 1D7BA 1L7TH 2X42A 3PNRB 5CHNB 3LJ3A 4KU1A 5LAXB 3UYOD 4XN9A 4AM0B 2UZIL 2CK0L 3HAEA 4MCZB 4XX5A 4DFHA 4FFZH 1INDL 4XBGA 1P7BA 3D4YA 1OSEA 4KXCA 4P59L 3WNKA 2IPTH 5HPMB 4F5CA 1FIGL 5FB8B 3QXAB 1C16B 1XWVA 4F8OA 1BD2B 1AE6L 2H45A 3IU4L 3LVEA 3TO2B 2OMWA 3R0NA 2YS4A 4OLUH 4EF3A 1D9KA 2Y22A 5JDSB 1XBRA 1E8YA 1XCQA 4ODHL 1IILE 1OOWA 3S35X 4WW1B 1ZEAH 2YPLD 2Q86B 1QHQA 2HFFA 2YEQA 4UINL 3RVTD 3DOIA 2R0ZH 4OGXL 3Q1SH 5FUCC 1ZLDA 4Q74A 4KQ3H 3ECQA 1B90A 3CX5J 3FQ4A 2FSEA 5GRJH 1K4DB 3H9SA 4L37A 2EXYC 2WWNA 3PXJA 4FOMA 1SEQH 2XPGA 3KBFA 4P05A 1NGXB 2V9QA 2ZUXA 5IG7B 1URLA 2UXFA 3QWNA 4YSAA 5J6GB 4O58L 2V37A 3L45A 5EBWA 3C5ZD 1WWCA 4OGYL 3SKOB 4U3CA 2MQGA 1JGDB 3BGMA 1GZHC 4XBPA 5IESL 4D9RD 1B0GB 5HI3C 1FG9C 1VKXA 2FO1A 3S2CA 4LP5A 3UPAA 3OX8A 4WNQA 1R3HB 3IEAA 3NCYP 4AYBA 2HJLA 1IBGL 1PJWA 1S9WB 4LGSB 5EOCL 1CIUA 4YX2L 2VO5A 4MQSB 1KN2L 3OKLA 3T65B 1UD5A 4RRPA 3BWAB 1FC1A 1QEXA 1KWGA 1RKRA 1IGTA 5FGCB 1IE4A 1T2XA 4X42A 4IGBA 1X6LA 1I1YA 3IDJB 4YR6B 5I1IL 3K6IA 3TURA 1KXVA 3NPSB 4X83A 1X9RA 3C8DA 2AXGB 3KJ4C 4MA8L 1OAXL 5BJTA 1S9VA 1U4FA 3NH7L 3NSXA 2DTMH 4CSPA 2WWKO 3HC2A 4W9DC 3EYSL 3DIVA 4RAUB 2RMNA 1BBDL 1TCMA 3EGDA 1V7MH 4PJ8A 5E6IB 3SY0B 4KKLD 5T1KA 1BM3L 2FATH 1KTRL 4XP9H 3KBHE 3WJJC 4ZFQA 3VI3A 2BNUB 4XAWL 2Y5TA 1GSKA 3VFSB 3VQ2C 5CN1A 3FU8A 2MCAA 2PYFB 5IR1B 4PJDA 2VR9A 3AG4B 2JJTC 3HS8A 5CWSB 4PG9A 3O4LB 3WFBL 3QO0B 4N6QA 3GUTB 1U8KA 2QHLA 1TJMA 1YY8B 4PJIF 4LVNC 1OF2B 3RB5A 4IHOA 4U2ZA 5IJCC 3GFUA 1RI8A 3MRDB 4ODUA 3AXIA 3CX5K 3FONA 4ZUWA 1I53A 2Y7QA 5ESQA 3FU9A 4XX1G 4QYAA 2O72A 5C07D 3OKOB 5GGSA 3V6BR 1XAUA 5ICZA 2KZ1B 5ID0A 5TFSL 5AVZB 1AJ7H 1C1EH 1UB5B 2H6UA 4ZTEA 3MRIB 3VGDA 2DH2A 4FQ2L 5FOBB 1JZ7A 1XSKA 3UROR 5BZZA 2K9FB 3ZYZA 4X80L 1O6SB 2VDNH 3KYNA 1ET5A 3HNTL 4N26A 4MKTA 3IPFA 2XNAA 3TF4A 2Z7UA 4RX4D 4JANA 3TV8A 1LD9A 2WNWA 2DDQH 1W2KT 3C5ZA 3FU5A 1MHHA 1U92A 3T0EE 5INDB 2QZ5A 3WNPA 1U8MA 1F58L 3KWWB 2HVJA 3LAFA 4JPKL 3VFOB 3QJXA 2BOCB 2BW4A 3D4ZA 7FABH 2X4NA 2YR3A 5DHXB 1JPSH 1KLFA 2X70B 5I18L 3ARDC 3O6FC 3PPEA 2OZ4L 4XVUC 1XGRA 1P2CA 2QVIA 1U8IB 3FO1B 3AS0A 4TOYL 4GW5B 2EVHA 3KYAA 4Y5XA 2Y3NA 4KHTL 3ASNB 2EXTA 4WY7L 5HDQH 3ROLB 4V1DD 2JFCA 3MHZA 1PQZB 1IJNA 2XYCA 3FAXA 3BWUC 4UDTB 1I9JL 3A47A 3OD3A 1HILB 4OCWL 2FJHB 5EC1A 4YN3A 3TIEA 4YZFE 5C0GA 1W0YT 2XV0A 4I3GA 1U2CA 3LQAL 4XMKH 4JPQA 4G9FE 1TZHB 4XMPL 3U0TA 5CCHE 5L6YL 4OI8A 2G0KA 5C7ZA 3T04D 4MMXB 3JWOH 1LE5B 3GHBH 3LPOA 1BGXL 3DGDA 3QCVL 4U4IA 3X14A 2ITDA 2VC2H 2ZWYA 1E8XA 1MRDL 1FGVL 4G1MA 4WQOA 5DTFA 1Z6JT 3UO1L 3SOTA 1XZWA 1AHMA 1FPTH 3RNQB 4XGZA 1ASPA 5IT2H 4YDIH 1A4KA 3NP4A 4OJEH 1T0MB 4YUEL 2DLIA 4BZ1H 4ZW5A 5JQ6H 4FG6D 3TA3A 1I9JH 1TNNA 4AQ1A 5JOPE 4OD2B 3DTUB 5CBEA 3BVNB 1QP1A 2R56L 4HS8L 2NUPA 5TE6L 3UC0H 3V5DB 5FYLH 3H3PL 3T2OA 3TWCL 4PRBB 3LQZA 1BD2D 1X6NA 4A7UA 5DHYA 3P0YH 4HCRH 4BCXA 5KS9F 3FPXA 2H32H 2X6AA 3V9FA 2HG0A 3KGRA 2EACA 4GRLB 2Z34A 2E9WA 4L4VD 5DRNA 4L8DB 4NFCA 1A4JB 1WSST 2A6KA 1WHOA 4ZRGA 3S2AA 1FFPB 3FFDB 5D1QE 5C09A 2BVOA 1B0WA 1KF9B 5C2UB 5EO1A 1RIUL 2AJZB 3VRIA 3RVTC 3LB6C 3R8BB 1CVSC 1U3YA 4X6CA 5IB1A 2XZZA 3C08H 4H44C 3W5MA 3O8XB 4IU2A 3KPSD 4D8OA 4KQ0A 4QT5A 2FJGB 1CLYH 1NMCB 1PPIA 3QI9B 3OB8A 4JKWA 2A77H 3GK8L 4Y5VC 5GZOD 1C8QA 1LQBC 2RH0A 3LH9A 4M7ZC 1IL1A 5KVDE 5FYJE 4A7GF 1A3LL 4CVXA 2Z6FA 2ZT9C 3LKOA 3BH8A 5E9DA 1ZXQA 3CLFL 4Z7AA 4EDWL 2P45B 3DSNA 3AITA 4MHHI 1Z5YD 4UU9B 2DLFH 3S5ZA 1KDIA 4L9LB 1VZGA 3LRGA 5HYIA 2K70A 5DCCA 4WKZB 4F1SA 5E94B 1G7QA 3NCWA 1PIFA 3FFCE 4R97B 4JFTA 5BRZD 4KVPA 4P57A 1S7WB 3ELQA 4Z95L 1OGAB 3PHOA 5HHOB 1T3FA 2YMXH 4LF3B 2GJRA 4JPIB 5J11C 4QMEA 4UIMA 5EEWA 2IFFL 4HK0A 3WFDL 3WUWG 2DM7A 2DV6A 1LK2A 2MJWA 4R96A 4BZ2A 4PWFA 1T7YA 2VKXA 4KO6A 3QDGA 3VGHA 1JWUB 4GXUM 4WUKH 3NCBB 1N5YH 1I31A 5D2LB 3DXAE 2EEAA 2WOYA 2IXQA 2ILLA 5J89A 1RJLA 2DM3A 3UZVB 1IAIH 4HJIA 1JUFA 4MD4A 4L48A 1HH9B 2L7JA 4DGVL 1N10A 3HFML 4FXLA 2VNCA 1ZLVH 1L6PA 3NQIA 3CVIL 3IPEA 4TUJB 4RGNC 4H1LA 1HESA 1F6LL 4HIJB 4IGBC 1REIA 1N59B 2J55A 2WWOA 3II3A 3ZKXC 1QLEB 2R8SL 4NZRH 4ZW6A 2QHRL 5C0CE 3ZDZB 1GCFA 3FBQA 2VABA 3HRZA 4IS6B 2L7QA 4OZGB 5LNEA 3BP7B 5IMMA 3QEQE 2UZYA 4LVNB 3PWUB 4HCIA 3GSOB 3RFZA 1S2EA 1ZHKA 1ERNA 2YPVH 1A9BB 4MNQE 1Y1UA 3CFIC 3SEPA 4EQ3A 4WK2B 2BDNH 1G0DA 2EE9A 5HJGA 1E7UA 4EZKA 1QTYT 1U93A 5DHVH 1XCXA 3BPCB 3HLAB 4P07A 2PCPB 1X7TA 5AOKA 3MNWA 4H26A 3S88H 3RU8L 2ATAA 4A67A 1MOEA 1T7ZA 4KKBD 3RVVD 5F3FA 5EBLA 1ZHNA 2YWYA 3C8KB 4Y19B 3WY2A 3WKML 2VDMB 1AGBB 2GG1A 2IBGA 4JHAH 3SE4A 4XN7A 3BGFC 1G9HA 4PJBF 2P8MA 4G8GE 2R9HC 2JCCE 2FT8A 3C8KA 4OCSH 4X6EA 2BIMA 1MI5E 4QHMA 1UACH 3X3FL 4JFQA 1NIEA 4N2LA 1DBBH 1ZEAL 2NDFA 2BDNL 4MBOA 3FQ2A 3T6WA 1E67A 4UV4H 3BPCA 3ARDD 3O6FD 4H2AA 4PJGF 5D1XA 4DEUA 1IM9D 4NO3B 4DVRH 1AIZA 2Y1AA 4HUVB 5EORH 3ZY7A 3P0VH 1HYSD 3O3UN 2FJUB 4PYGA 2UUDK 1TZIB 1NC2A 2HN7B 2YOCA 5K9QI 3PWUA 3I6KB 1QSEA 4F7TB 4HS3A 1I3UA 4KKZA 3MGTB 4OF5A 3PQYD 3GGWB 4W9CC 2OBGA 3CMOL 3QDHA 4IRJC 4UTBA 2VDLB 3FQXA 3AMKA 1IC4H 4AE0A 3L1EA 2HA1A 4G72B 4JFZL 2FHBA 5GISL 3O8XD 1VA9A 3C5XA 3F65A 4FG0A 3FTXA 4G80B 5DO2C 4HXAL 1PS3A 5ESVB 4LCYA 2IH9A 3EGXB 4OLVH 5DJZA 5FM8A 3ZTNL 3MBWA 3WTWA 3L9EA 5E2WL 5ICYA 4WEBL 1JUFB 3UDWC 4BEIA 4YE4H 4U6HB 3CSPA 2DAVA 3PWJB 2EDTA 1F90H 3SKNB 4TMPA 4UIKH 1T5XB 4GQ9L 4LFHD 5FHBL 5J06A 2AEQH 1BYOA 4DF9A 2CDEA 1LNUA 3ZMRA 4AIOA 4NCC1 2XWCA 2H2SD 4FQQA 3APCA 1JHKH 4ZMYA 2AMGA 3AFLA 3QZMA 2MOGA 3EH4B 3MXWL 3R1GH 1AS8A 2ZONA 4HK0B 4DCQB 3CFCL 3L8QA 1G6RB 3PWPD 5HHOA 5EO0B 1CFNA 5IEHA 5DGQA 2MCPH 4GINA 5F9OL 4LQFL 2X4QB 1XIWD 1WBZA 1NOLA 5HY9B 1G7QB 1H3PL 1QLRA 3CZUB 3HN3A 4PREA 4WKZA 3VXUA 5IP4A 4LOUD 2APTA 3L5JA 1G1CA 4HJGB 4CILA 4QRAA 3RIAF 5HYSB 5ISZD 3PABB 3U4BH 2NXZB 3ZTJG 1ZS8A 1A21A 5E9DB 2OV0A 5DHVB 1GXEA 1PZBA 1RP9A 4JRYA 3VXMD 4F9PA 4YPJA 1J48A 4IIQB 1HTYA 2OP4H 3PNWA 1E8WA 2YSTA 4NEHB 4MNQD 1B88A 3VNZA 1N8OE 4Z0BL 3KLKA 1MLBA 4FI7A 2BMKA 2EYRB 2P26A 3KPRE 4PMFA 4LL1A 5JOFA 2D7MA 2NXYC 2ARWA 3BVTA 4JDVB 4RIRB 1NUDA 1BWWA 3T8XB 3OJDB 2G4EA 5SWZD 4YLBA 5GGRB 3VRIB 3GBMH 2XKNA 4MDRA 1EGJA 1CF8L 4NS0A 3S5YA 3SKUD 1FFPA 3V6FB 2Z91B 3B2XA 5L9DH 4JNXA 4XXDB 3KNBA 5DRNB 1L6XA 1SRDA 4J3WA 2K3TA 4M6ML 4U1KA 1KXTA 4YHPA 1JHKL 5AL0A 1T2JA 4BUQA 4P0DA 3OAZK 1WD9A 2AQSA 3O2WL 4H13C 4HEME 5F7AA 4ZO7A 2MHAA 1QA9A 1UC6A 2A83B 2HCZX 1MKFA 3DHUA 5DWUH 3BVNA 3KPOA 1HXMA 3FCBA 3T0EA 1UH2A 4UM8B 4OZ4A 3EJZD 1NFDB 3ZDWA 1NUGA 3D4CA 4YQXH 5F9OH 4HISA 3F7KA 4IU3A 1WD8A 3HNSL 3E1ZA 2MPAL 4TQPA 5F7LB 1JWMB 4PJEE 3W82A 1A02N 5DEZA 3KPMB 3RNQA 1JMXA 1H19A 4AUUA 4W9JC 4GRMA 3CFEA 4L8BB 3T2NL 1BMZA 2HT2C 2Y5EA 3TEUA 5TE6H 3SDAB 4DP7X 2ALWA 4Z7NB 4F8LA 5HDWA 3SGDI 2APSA 5KJ4A 1NKOA 2QZQA 4YDKH 4PWKA 1KBVA 3MLPA 4Y4KA 1OL0A 4UT9A 4KNQA 1ZS2A 4QNPF 1M1SA 2X6MA 4W4OA 5F9WB 1T7WA 3CFQA 1TZGH 1C5CH 5DC9B 4A7SA 2F54D 2GVYA 1M7IB 3K8LA 2ZXEB 3SPCA 5C0DB 3ULUF 5AB9A 3QO1B 3HNSH 2PPFA 3K2MC 3VFTB 2NQ3A 4BJLA 1QNIA 1FHNA 5D1XE 1RAMA 3WDHA 3IMRA 4M8QB 1VACB 2W9LA 2V3EA 1AKJA 1S7SB 2AKRA 2BNRD 3DX8B 4OLEA 2WWMC 4PJGE 1AS6A 1KBKA 2NY3D 5L88H 5L8LB 3OMNB 3SZ6A 3MROA 4A68A 1I7TA 3MLVH 4Z7IA 1ZMYA 1LP9E 2X70A 1PCSA 3D85D 4OBSA 1FFOA 4Q6YA 4QRTB 5JA9A 4WAFA 2RFXB 2PWGA 4LKCB 3Q3GA 3KWWA 3QUYA 4LAJH 4U1GB 1S7VB 5TFSH 1XF1A 3UYRL 3ZE0B 1MHHB 1U92B 5T8IA 4WWKA 3VFWB 1II4E 1CK0H 1XGZA 5JUEH 2YMOA 4Y16B 3ZIYA 4MBRA 2FBJH 4J27A 4EAEA 4EI6A 3KXFB 5J12B 3LYRA 4KRLB 4XWGH 5LGJA 1SHXA 1O6SA 1SY6H 2CUIA 2JJSA 3FB8A 1A0QH 5SX5H 32C2B 2YBGA 3CSFA 1JPFB 5DMJB 1S7QA 3BO8B 3BEVA 1YEKL 3M17B 1Z9MA 4AKQA 5GGSB 4R2GD 4OZIF 2ITCB 4GQZA 3CD4A 4LCIL 3FONB 4ZUWB 5IV2A 1HQRB 1A6VL 1FRGL 1VZIA 4ODUB 5MEPA 4TVUA 2QPSA 5J57B 4PM1A 3U6RB 2V3DA 1U8KB 3QO0A 3GUTA 2HKHL 4X6BA 2QVKA 4OUOA 4AUYA 4DGWC 4PD4K 3MO1B 5C0JA 4W6XB 3W11C 5FO7A 2Y5TB 2G3ZA 4KZEH 5DMYA 2PNDA 3KLDA 3RUGB 3SBRA 2AK1L 2M1KA 3ISRA 5TDOA 3RWCB 3CVDA 2X4UB 4AL8L 1KCBA 3MV01 5B4MC 5C6PB 4BE6A 4C59B 1Z3RA 4RAVB 3V52H 4X0NA 3F7VB 3SKMA 3EBAA 1J5CA 1X5HA 4P5TC 4A04A 2CLZB 3RQ3A 5F44A 2CHNA 4LLAA 4ZUSB 4ZX3A 2Y06L 3A23A 2O26U 2AXGA 3ILDA 1MAMH 1JD7A 1CTNA 1BZ7A 5K5YA 1W6WA 2H3NB 4KNTA 5IJBC 2VMDA 4AWJC 5CXPA 3QDGE 4KKLC 3U46B 4I1NB 2OI9C 1DO5A 5AOMA 3CXHK 1IV8A 3UTQA 3EHBC 1T6VN 5IF0B 3DVGA 1DL7L 4UMSA 1GGCL 1WFUA 4WKXA 4HG4J 4WNQB 1NCDL 1XR9B 3E3QC 2DQ6A 2X6BA 4LPXA 2FHCA 4UOJA 1P7QA 2B59B 2VZVA 1QD0A 3OTTA 4O51A 1E5CA 4NO2B 4Z7QE 3RFRA 5J6GA 3BGFB 4KMTH 1QBAA 5HGHA 2G2NA 1J88A 3JVFC 1NZRA 3U6RA 3UMTA 4AG4L 2CR6A 4HU8A 2P5WB 4YHYC 2IAMA 4U05A 1BM7A 1KCKA 4OGXH 4HC1H 5FYKD 2ZOKB 3QIBD 3ARED 1FSKB 1MEXH 3T3PF 2V2TB 4HOMA 3F3HA 5JMOC 1T89C 4GAYA 2BVQA 2VLRD 3U6XA 1JBJA 2YRBA 2A6JB 2VLRE 1HKLH 1A5FH 2R7EA 1S7QB 2XWBA 3HTLX 2ZIDA 3WKMH 5KN5B 32C2A 1U21A 4R6UA 3IRPX 1FCCA 3EO0A 3MREA 4UQ2B 4RGNE 5BV7B 1HEJC 1G7LB 2Z4QB 1R3IH 5EU6A 3RWDA 4ZMVA 1NGZB 5DGRA 1U8OA 2OMWB 3UAAA 1JXDA 4M7ZB 3TO2A 3N1FC 2F15A 1EZVX 2C9RA 4Y5YB 1Y6MR 1BIIA 3Q3GB 2BPBA 3QI9C 3SBWA 5CZXC 3AADB 4PP1D 3II2A 1AS7A 5DZOA 3S6CA 4DN3L 4EZMA 5KJRL 5TQ0L 5CD5D 3L2NA 3MROB 4G6JH 3AXLA 5B38A 4DK6A 2WVUA 5DDHA 5J6HB 1JPEA 4P49A 4AM0A 4ZFGH 1LEIA 4AJ0A 1YMHB 3L1GA 4OLUL 3EJCA 1KSRA 1E4XH 2AQNA 5IMKA 5KZCB 1LO2H 4BQ9A 1ZGLM 5A6LA 2EUXA 1QYGH 4P3WA 5IJKC 3JV6B 3UTOA 5I8EB 2J8HA 3VGEA 1J5OL 3WBDA 3OF6A 4R83A 4MS8C 5KSBA 3W9EA 1EO5A 2XOTA 5BCAA 3TIDA 2D3JA 4LCVA 3VDBA 2AITA 2X28A 5IWLA 2GEQA 3BH9B 3PWPA 3NEEA 1DVTA 4JM4H 4LLUB 5TE7H 4R5TA 1FNAA 3RP1A 2YKKA 1BV8A 2XKSA 3VXUD 4KTGA 5KVFH 4JFFB 3Q8FA 1AQ8A 3NUKA 5GGSY 3JTTA 3T6ZA 2Z31B 1E5ZA 1I8LA 2OW6A 3F7RA 4L4JA 3O3BB 4BQ8A 2VDRL 3REWA 3HUJF 2FBRA 4K9EL 4RZCA 5JHDD 1CIDA 4OFYD 4P3CH 1QSFE 3GMNB 2KZKA 2EJ1A 4KFZC 2B9AA 1N4XH 1EXGA 3FB5B 4WFEE 2GI7A 3ZX1A 5BXFA 3OJ2C 3HI1A 4JR9H 2HUEA 4RCAA 2VLRA 3KEHA 5D1QC 4Q9RL 1DLHB 3QH3A 1HHIB 5DZAA 3SGKC 4AQAB 4QLRA 5DJ8A 1Q0EA 5I82A 1XVSA 2E56A 4CMMB 3ZUNC 4HWNA 2DLHA 5HYEA 5IHZB 4KPHL 5EF2A 4K8RD 2CRZA 3HMXA 5GGRA 1JP5A 5JHLA 4G8FB 3M7FB 2XPZA 4GKSA 4W9HC 2WY3B 2ZX7A 4K3DL 4JO5A 1MQKH 1JK9A 1YEIH 4H4NA 4JFDE 5HHPB 2VL4A 2F74A 2OYLA 1HWHB 3PJNA 4UAHA 4Z7UE 2JNZA 2IH3B 4HG4K 3JTSA 2WLHA 4C47A 3RA7H 3IJHA 1M05A 3PABA 4M3KB 3O41B 4HJGA 1F4AA 1CGSL 4POUB 4Y4FA 3BZFA 3EYOB 3L4TA 3VXUB 1KC5H 1AXTH 1KFAL 1J9SA 4HKXB 5TH2A 5GRVL 5MEQA 4LDLB 5SWSE 5MEND 5EOTB 5DHMC 1QVOA 2NW3A 5EN3A 3TGXA 5HYJD 3A5VA 5EO0A 1H5BC 1BIHA 3O2DA 4L5FH 4WEBH 4MAYA 3PV6B 4FNLL 2HH0L 3WUWB 3ULUD 4RISH 3L1OH 1YNLL 3D50A 3AAZA 4YSDA 4PEEA 4O2FB 4LSDA 1FGNL 1S9YB 4YHIB 4Q9RH 3Q0HA 4LCWE 5HD8C 2W60B 2E6QA 2XVBA 5AKVA 3RJDA 1G6RH 2ZNXA 2RCSL 5IESH 2AZAA 3D51A 1BQKA 4RETB 2PYEB 3WNNA 4OZIB 3HZ3A 5BV7C 3IT8D 1CB4A 1HHJB 3E9UA 3SDCC 1P4IL 1TOXA 2X2YA 2A74C 4RMQA 3GRWH 4P9ML 4TPRH 5DJZB 2JTDA 1DVYA 3TO4A 1RLWA 2XXGA 1B6UA 1QFUL 1T04B 2V5TA 4BZ2L 3F83A 4EI5D 3S96B 3KLHD 2MTPA 2A1WL 3EJJX 1XR8A 2V33A 4NXKA 2DWDB 1TYJA 2V2WA 4X5WB 3MLZL 3FUHA 4WWKD 4Z76A 4PJ7B 3HZKB 4BFJA 3OR7B 1M1XA 3T1FB 1P7KB 4JDZA 2GSGA 2CGRL 4EIBA 1SXAA 2N59A 1AQHA 1NC2B 4QWWC 1WFNA 1VSCA 2VN3A 5E1AB 4GH7B 3AREC 4XE0A 5I1JH 4U4BA 3FF7A 2ZUSA 1E2ZA 4JZNB 4XP6L 4ABVA 4MA7L 4H8PA 3F5WA 2EE0A 3LVTA 4AMWA 2XUWA 5A43C 2JB5L 2VLJA 4OKVA 1Q9WB 2GTZA 3P4OA 4P2QE 4P4KA 1EEQA 1NDGB 4PJFB 3CFUA 1LP9A 1WYJA 4KKNA 1D5ZA 3IKCB 4HDIB 2BXYA 2B0SH 1S7UA 4ZOEA 4BUHA 3WKNA 1J5DA 1EFQA 2WTOA 4OZFB 3X17A 1QPPA 4HZLA 1SMAA 3LEXB 4GG6F 2ZOLA 4TLSA 3PWPE 5E8OB 4PH8A 4XP1L 1INDH 2QR0A 4KX7A 4ZQTA 2TAAA 1EAOA 1ZA3B 1OTUC 4JFOA 1NFIB 2C5DC 4H26B 5E56A 3ELAT 3KPSB 2EZ0C 5F9JA 5M94B 4YHLH 2E4TA 1MFCL 2D0FA 4ZMOA 5JYMA 3AG1B 4U33A 3FRPG 2NY0B 4XNUL 1T83A 2YRPA 4OCLC 4C4KT 2VDNL 3UEZA 1UA7A 5JQIB 4PRHE 2D3VA 1W0VB 4OZGA 1XF3A 2VABB 1GGUA 4FQIL 3KJ4B 2VN4A 2HVKA 2CNYA 4NIKB 3UTPE 4DZBB 3EW3B 3DMMA 1ETA1 2EYTB 2XKUA 1NC4D 3AS3A 3CSBA 4CRPA 3QUML 4P9HL 1O5DT 4DPBX 3H9ZA 4RGMC 3F7YB 3V8OA 2P44B 4XHQA 1RJLB 1NBZB 2AXWA 4GBXA 4LSPH 3QJFA 5FYJD 3BWUF 1G6RL 4TNEA 3LSOA 2WO4A 4NDMA 5K9QG 2E7CA 5T1MA 5KOMC 4MA3A 3WJLA 2GSIA 3WMPA 5LVEA 4I48A 2YMXL 3MJWA 3CAFA 2W9EL 4QRSB 1KGXA 3L95B 2ID5A 2VXQA 4KAQL 4ZFFB 4PWEA 3H9HA 3O3EA 4J6RH 3PHOB 4AQZA 4HUCA 1CGTA 4Y9GA 4N90E 3KHQA 5K9OA 1S7WA 3VU1A 4K9JA 4WUKL 4RNRB 4KJWD 1JXKA 2WXPA 1RURL 1MCJA 3BVUA 1N6QL 4LESA 1ZIAA 3CXFA 2HVBA 5I1IH 1MUJB 1R5IA 4L9LA 3O3AB 2VIRA 4UU9A 1RVFL 3RY4A 3DSNB 2RB8A 4YBQD 1I9RH 4LMQI 3G04B 5IQMA 2N01B 4E9WA 3AGWA 1L4IA 3JUZA 1Q1PA 2CUMA 4QRQA 2KYIA 4MD5A 1OAJA 1GHFH 1LO0L 2VDOH 4MB5A 5AVXB 1WWWX 1ZHBA 2J71A 4ZXBD 3D3VD 4PI2A 1ORQA 2F8OA 1BG9A 2LVEA 4PJHF 3SODB 1HSAB 2IQ9L 1BF2A 4FLOA 1IO4C 4YEFA 3QZNA 5I74C 2D8KA 1SLUA 4LPWA 1BOGA 4MASA 4WFFD 4IU2B 5KW9L 4RMVA 2EKSA 1PSKL 1EAPA 2VLLB 5TTRA 3SZKC 2VXTH 2IDCA 5C8JB 3UADA 2BVUA 4K5OA 4QJ5B 4A2EA 5I0YA 3JQOB 4BZ1A 3P02A 3RGVB 3DX4A 2A6KB 3L3OB 3GKZA 5E2JA 1A4JA 1J5OH 5JORA 4LU5L 2Z0BA 3MBED 4LIQL 3TVMB 3GSWA 3T6QC 1QRNB 2OX5A 1FO0A 1E6JL 1DUYA 3WEXA 5D9SB 3HIZA 2V2XA 3GPSA 3LQZB 1YC8A 4I8DA 1UUSA 3VXNB 1RUQL 2H32A 3DBSA 3PS6A 4CBPA 4AOFA 4P9HC 3H0TB 2G3MA 3T09A 3O0RH 4WGWB 4HD5A 1ZK9A 4R7LA 5KS9E 3NACH 4U2YA 2P9RA 4NBYB 1F4WH 4P2OB 3S8GB 4HWEL 3HOGA 3DYOA 3DVNB 4PGBB 2YGQA 2F7RA 3FSWA 1U0QA 2HT2D 2DJSA 5JIHA 4JCLA 1UQSB 4HOWA 1UACL 3X3FH 3HE6A 2UZXA 3JWOC 2UUDH 4K8RH 1NCJA 1N64L 2YJLA 3ECUA 4AW4A 2ZG3A 3WL9A 2XRAH 4X6FA 4YDLC 1MN4A 2CQVA 1H15B 4HWBA 4NKOA 5ETUB 4CDHA 4AYSA 1BAFL 4EI5C 3AB0B 4H25B 4OJAA 2WTRB 1A6WH 1I3RB 4J1UA 3BPNC 2EE3A 3BCFA 1IIIA 3RKDC 5KVGL 5FW6A 2PMZA 3I02A 2EE2A 1I3VA 5D7JA 2UY7B 3GXNA 3PDGA 4HU2A 1V3JA 4HK3N 3RPBA 5FO9B 1J8HA 2QQLH 2ZCLH 5GGTA 3ZMEA 3DDGA 5D2NE 4N25A 5EBMB 1OAKL 3BYYA 4PR5A 4PRPE 1V3LA 1NANI 3LNIA 2C9PA 4F3FB 3GLEA 3VMNA 1E5BA 3QORA 15C8L 5D55A 1CYXA 2DTSA 4DHLA 3ME0B 1DHKA 4N8VA 1U36A 2VXQL 4OFDA 3O6KL 4PP2B 2HVJB 3TZVC 4AE1A 1HKLL 3ALXA 1S7RB 1E5UI 5F96H 4HAGA 2FL5B 4BWWA 1P4BH 3RWGA 8FABB 3RTLA 2F9BT 2NRDA 4HT1H 1TKWB 2EH7H 4UILH 4DGYL 2HLFC 2XNAB 4R5VA 3LH2H 4AIEA 1CFTA 1HQ4B 3GRGA 2CJTA 3ZKQD 1AIFA 2K8MA 2NXZD 2ICWB 4OGZA 3BPLB 2A6DA 2GB2A 1QR4A 2NY0C 3LKRB 5CJ8A 4UQ3A 3PP3K 3MBEA 1F1DA 4ZPVB 2FCBA 1R3LA 5JW4R 3O3DA 3CK0H 1AI1L 1DBJL 3FB6B 4Z8FL 1TCRB 2DL9A 4FTVD 5ACZA 2FHFA 2CLRB 4XPBH 5FLUA 3TONA 3MRHA 3MRDA 2CO3A 5F71A 3ZW3A 2A38A 4G6FB 5LBVA 4NZUL 1NPNA 1TEFA 4FQJH 3KWXA 2BNRB 2Q76B 4M02A 4XP9L 1PDKA 4XRCA 4DKEL 3LTVA 4H8VA 4WEUD 2CJUL 3NZSA 4N8CH 3LQMA 4WCYL 3E38A 2NTFA 3CVHA 1KLUA 1JF5A 3BN9C 4R2GB 3VFSA 3NZ8A 1S8DA 3FT4B 4OCRH 4XPHH 3WENA 4AT6B 2YHGA 4KZCA 5DHDA 2WTPA 2JE8A 4GOSA 4E41D 4KUZH 2WW8A 2DMBA 4U1SB 2CK2A 3PRZA 3K6SB 1ACYL 3AU1B 5EZLB 3ECBB 4Q9CA 2GUOA 4ZUVB 4RAUA 1BVNP 4GAGL 4AT6A 3K4ZA 2G4GA 2WLKA 5A1AA 5DUPH 3KPLA 4KK5D 3D25A 1QWUA 2GY7B 3IDJA 1OGAE 3N06B 4YR6A 4M5YH 3RE0A 2KLSA 3KW7A 4HIHA 4NXSA 5IB4A 3V6OA 2KQMA 1FFTB 1BQHB 5ITBH 1SVBA 2AJYL 5FUZH 4RWYL 3FQYA 1NFAA 2VJ8A 4KUZL 1WC7A 2W94A 5LAPA 2KQNA 1KENL 1HFUA 4UM9D 1GC1C 4NBZB 1KG0A 1ML0A 4L4TD 1F18A 3UYRH 3GLAA 4XBPB 4E9QA 2EDLA 4R97C 4ZTPL 3BGMB 3QZWG 3FBKA 1ZKAA 3LKRA 3SKOA 4YL4A 2A6DB 1B9ZA 1E4WL 1RFDH 3D09A 4UTAA 5GGVL 1BJMA 5F2FA 3GBNL 1OHZA 3E0GA 1ZHLB 2Q3ZA 1OAKH 3LN9A 5E99L 2HFEA 4TM9A 2XPGB 2R0WH 2GTWA 3HHMA 1H6UA 1D7FA 1MJJA 3FU7B 2XTLA 3QUGA 1JXJA 1RU9H 5D1ZC 4XNYH 5JW4N 4PP2A 5DMKB 5B1BB 1LO5A 4KI5C 5L2JB 4OZHB 4A2GA 4PJFE 1K72A 3CBRA 4XMPH 3OLEA 2EECA 1CURA 1URZA 5FO9A 3DO7A 2X0VA 9CGTA 1JCKA 1J1XL 3H7LA 3FQRB 1F11B 3N3EA 4FRWA 2AV7A 3WEOA 4X6DF 4QI3A 3BAEL 3I3BA 3QXAA 3QG7H 4PP1C 5SV4A 1EJ8A 3NJNA 4NQCE 6PCYA 1MI5B 2B08A 2WBXA 4E9XA 5BMFL 2G9HB 2YXFA 4QO1B 5LCVL 3IWVA 5GQBA 4NM8H 2QMJA 3B5GA 4FEMA 2P5PA 3WHXA 1RK0B 1I1AB 4MYWB 1E3XA 1AO7B 4OF7A 1CK0L 5FEBA 5DQ9B 2I9TA 3R7QA 3DDFA 4URKA 2F1BA 5MENB 4MD0A 2P47B 4WTZG 3FN0L 4UT7L 3VQLA 3Q01A 1XX9C 1SHSA 3L17A 4HUMB 3SJVA 4DGVH 3ULSA 5GGUA 1A4AA 1X9QA 1E6JH 1LO4H 4YHNA 2IPTL 4FF9A 3KYKL 1JNLH 1P4IH 1MLCA 2JXMB 5T3ZD 4HXBL 2DEYX 4JY6A 3V4LA 5JYLA 5F7DB 1BYNA 4JRXD 2M83A 4HCGA 1MNUL 3BSZA 3V0EA 4NWUH 1NEUA 1DVSA 3OVUB 4M1DH 3V0WL 4X4KA 1UG9A 4H40A 2WIIA 3P4LA 4XVSH 2JH2A 1YEHL 4I3RH 5AD0A 2V2XB 1L0XA 3NACL 5D93B 5IKCA 3P3YA 5ANHA 5D9SA 4UUJA 4B6ZA 3IBEA 4ADIA 4KK6C 1FO0B 1OSPL 4LHQB 1JZ5A 4MJHA 3S3PA 4WDIB 5IQNA 4NN7C 1YEJL 3UZEC 4RMTA 4X5LA 3V0AC 2WBJB 4C55A 3IRZA 4NLHA 5C9KA 1FYTE 4B27A 2PLTA 3RVUC 4GP4B 4I0PA 3CQQA 4OD1L 4WW2A 5B1AB 5EIIA 2GBTA 4A66A 5EC2A 2BO0A 3Q44A 2F54A 4IEFA 3RTQC 3WELA 3DXAB 5ECGA 2RACA 3NDYE 4Z7VF 1U6AL 5E6ZA 4AEHH 2WQ8A 3PU7A 3ARBA 2J8UB 3GTVA 3TBWA 5KVGE 1U3NA 5DZLA 3FHAA 5IMOA 3FOLA 2IALB 2ZYSA 3SBPA 4AJYV 1BAWA 2LFEA 5I5RA 3LPPA 4QRQB 4D0CA 1W0WA 3T3MF 1J7VR 4NZFA 5E23A 5D1ZI 3UXFA 1PZ3A 1IFHL 4I5BA 3MRQB 3ESMA 2NY0D 2DRUA 2C1PA 4GUPA 1VLXA 4NKMB 4HFWA 1R5IB 1ZY9A 2CMRH 2ZUQC 3MLRH 4GP8B 2ZPKL 4CN4A 4ZNCD 4EKJA 3B2UC 4ZDHA 3HNVH 3RBSA 1I8IA 2R39A 2NY6D 4HJJH 5GJSH 5D1ZB 1RH8A 3PQYB 4LQFH 2Y4SA 2WXFA 3FUKA 3MRKB 3O3EB 4H5SB 4PJIA 2NY2D 2HLAB 3UTSB 2NNFA 3PP3H 4M4RA 3PXLA 3MX0B 5F7BA 4CVZA 3U79A 1EFXA 1GZPB 4BH8B 4MB1A 5I76B 2DQIH 4G70B 4M8RA 2P80A 4UZUA 1KCLA 1TTBA 2QT6A 1KGYE 1KCUL 1GGBL 4DGIL 5MP6L 4HS8H 5DUBB 4WK0B 5K1JA 3VJ6A 2W59A 1ADQA 1BVKB 5DJDB 3TM6A 4NM4L 5C3LD 1E7VA 3T77A 1F5WA 4DO5A 5GSRB 1MVFA 1IU1A 4LRNH 1WLHA 2O5ZL 4Y4HD 4JFFE 1OT4A 4YDZA 5B3SB 1FZOA 2R1YB 3LPWA 4F27A 1M6OA 3O4LD 4LLQA 3E80A 2P28B 3MN8A 2YQ3A 3SD2A 2AVFA 5KVFL 4X50A 3JV0A 4B97A 5EEVA 2PTUA 1IT9L 1ITBB 2D31A 3MOAH 1QQDB 4J3XA 2X4RA 1QRND 3OR6A 2R51A 4J4PC 4Q58C 4MNGA 3PHSA 4UINH 4GW1A 4JFHE 4OCRL 4XPHL 3OXRB 1I9IH 1G7PA 4HFUL 1PY9A 4KUCF 4MFHA 4YGVB 4ZMXA 2XFXA 1E28A 1H3XA 3KYOB 2YA0A 3NCJH 1XF4B 5LLIC 4JFDA 4UILL 1NINA 4RZKA 2XN0A 3RVWD 3EOBB 1JGLL 1HZLA 4GQ9H 4Y5YC 1CGYA 3HBZA 3G6AB 5J0BA 1ZA3A 4WWKC 2QR0B 5BQ7B 3KJ6L 1X5KA 1TMQA 3R8QA 5CCKL 4ONOA 4UNIA 3LEXA 2P5WD 2E4FA 2FECI 3HR5A 1CJYA 3SHSA 1NTDA 1S7UB 3QDME 2EUWA 1UT1A 4HDIA 2PWFA 2BWQA 1PEZA 1OW0C 2NTSP 3L54A 2X89A 4PJ8C 4PPTA 5T1LA 4BFFA 3LN5A 1DYZA 3G9AB 5D1ZD 1SN2A 1HXYB 5PAZA 4MDJA 1Q9WA 3BT2H 3D33A 2VR8A 3RRQA 3RU8H 3T8MA 1I9EA 1WFTA 4HK3J 1X5XA 2EH7L 4MDJB 4DGYH 2L8AA 1EJOH 1ZT1A 4Y2DA 2A9DA 1IGMH 4PFEA 5E6IC 3UG5A 5FPIA 4FG6C 4XP4H 3A4AA 4AIXA 3BWZA 1HU8A 2IQAB 1Q0YH 2UZIH 3P11L 1SXCA 2G60H 5I19L 1OCOB 2R4RH 3NSJA 4Z76B 1OTUD 1A6AB 2OTWB 5DZPA 4I77L 3TL5A 5E5RB 2CUHA 5BRZB 4J28A 4BK8A 4JFVA 1XR8B 4EBQH 2VOTA 3CUPB 1I9IL 1OK8A 1EMTL 1WISA 3MUUA 2OULB 2OI9B 2ZAIA 3OAZH 3BMWA 3OKDB 1OLZA 4NPYB 4RISL 4YGVA 1X5YA 4LDEB 5FX3A 1G9MC 4P5TA 5BQDA 1OARH 3ROOB 1J5IA 4LRIA 3OXRA 3WN5A 4GW1B 4B60A 1YYLH 1MF2H 2NT1A 4MNGB 4N3UA 4NT6B 1DQQA 5KAQF 3R06B 4D2NA 1N0LA 1NL0H 1MCCA 3DA0A 2D31B 1RZIA 2W65B 3K46A 4JDTH 2A5UA 1T2QH 5FKPA 4ISVA 1LJMA 4O2FA 1A6ZA 2WVVB 3AAZB 4P06A 1MRFH 4TPRL 5C1MB 1MRCH 2IGFL 2J20A 5JHDB 4KKQA 4HBQA 4N9OB 2DWEB 1FNLA 1TDQA 4PGCA 5AQ0A 1ZVYA 2YKLL 2EAEA 2F7PA 2KPNA 4RFNB 3LKPA 5FCUH 1PZ5A 2D4DA 1IT9H 1BVKA 1UGKA 1ZE3H 3MOAL 3PCYA 4MSWB 3OXSB 2DN7A 3VJ6B 2OLDA 4N5ED 4FI8A 2HZHA 1WUNT 5E00B 3BISA 3IDUA 5IJKA 4FS0A 2XV3A 4BH8A 3SYPA 4JDEB 1ROCA 3BXNA 3DX6B 4IIZA 7PCYA 4CVZB 4AV0A 4M4RB 5E9DE 1XGYL 4AL8H 3KDMB 4APQD 3RWEA 3R18A 4U3HA 4X99B 2I5YH 2YUWA 5D1ZA 4S1DC 3TYGH 1MVUA 3L5XL 1M2VA 1I8IB 1KYOJ 1H3PH 1SUHA 1WJ3A 3EOYG 5I1EH 2XN9A 5FA3B 3X1BA 1YY9C 2Y06H 2X4TA 1TQBC 2EEFA 4GUPB 3GZQA 3T0AA 4JCMA 3K81A 2F6AA 4ZAKB 3RGBA 3MRQA 1KCSL 1RZPA 3FRPA 4O5LH 3GUFA 5FYLE 1WA2X 4W93A 1GH7A 2OMXA 5AW7B 4Z78B 5KAQG 1HHIA 4AQAA 3D85A 1UOKA 4IKKA 4PJDF 4C4BA 1I4FB 1K6QH 1WBXB 4B9GA 4JPVH 2NY6C 4ECNA 1AI1H 1DBJH 3TBWB 3TFBA 3O6MH 2V5YA 1QSFA 3STZA 1JWSB 2AEOA 3UO1H 4ZMWA 4A6YL 3ARDA 3O6FA 3FB5A 3ZKND 5KBDA 3N43F 5EC2B 4YSEA 3EXJA 2GJZB 1XXDC 1MH5A 2DMGA 3GHBL 4JGUA 1DVXA 4I0PB 3VRJB 2OXGA 1KTBA 4L3EB 1IGCH 4F7EB 3HHSA 2XG4A 3A67L 3NZHL 3BGAA 2H0JA 4B53A 1CYWA 3GF8A 3FU6A 5EU3B 4HLEA 1RY7B 3DRTA 3UC0L 2WQRA 3E6HB 3WLBA 1CD9B 1MNUH 2ZUVA 4P3CL 1OY3B 4V2CB 3V4PA 1I8MA 4MDIA 4E9RA 3P69A 2CLVB 3N91A 1JGUL 3TEXA 5F9WC 5FK9B 1HIMH 1FP5A 2ZD0A 1NCWH 4KKBC 1I7RA 2EADA 3N44F 1LEGA 1FHGA 1HX0A 4KROC 4G8EB 4YHKH 4X9GA 2XQBH 2H8PA 4TNVF 4F8TA 2OR8A 5GS3A 1TQBB 3D18B 2JMRA 2WLJA 2MCG1 1KT2A 2QV2A 4H20L 3V0VB 1DEDA 3B3BA 5IMKB 4RMUA 3PFQA 3VB8A 4BBWA 1KTLA 1FZMA 2B4CC 2N56A 1A1MB 3VWJA 4E5XA 4NWUL 1JZHA 3QIUA 2WCPA 2IANE 5J6HA 3P9LB 4JREC 4RGMB 3AXLB 2YARA 3BAEH 2OXHA 4BV1A 1KYOK 1PG7W 4TOYH 2F5AL 3MRCA 3BZ4B 4AZ8A 2HTLC 4APQA 4YWGL 1OAZH 3FQTA 4DP2X 1X5ZA 5G2NA 3U6XS 1E6OL 4G6ML 4DW2H 4ZFGL 3ARBD 4EOWL 1I7UA 1KEMH 1PG7H 3O81A 4Z7WE 2YA2A 2XN9D 5GZND 5D5ME 3FQRA 5HI3D 2ZUTA 3GS4A 3KH4A 1UM4L 5JR1H 3IJYA 3CFBB 4XMVA 4J4PA 3ULAB 3CZKA 3L4CA 2A6IA 3UCRA 3MREB 1M7DA 2ZKXA 4ACPA 2CIIB 5FFLA 4DP1X 3WS3B 3GT6A 5CEZD 2VRAA 4OZHA 3GO1L 3IJSA 4RDQG 3TT1L 3GIVA 4JB9H 5JLZA 3VXRE 2Q3AA 1CG9A 2A6JA 3ZDZE 2Q8AL 2ZJSL 4L0PB 3KPRA 4L3EE 1D6VH 3VNYA 4JHWH 1TTRA 2N3JA 1UWEH 2IAMB 3K2KA 3OF6D 3TCLA 4PW3A 1R9FA 1VESA 5HHNB 3QGVA 4N1HB 5GGTL 1TZAA 5I5JA 2ENPA 2AJSH 3FQWA 3FDWA 1NEZB 3QIBA 2EDQA 2MH4A 4L4VB 1P7QB 2B59A 3F64A 5C0BA 2FAUA 1IQDB 1XR9A 3CZSA 5JPMC 4YXHL 3ISWA 4PJ5D 1JZJA 5HDBE 3SQBA 4R3SA 1FVEB 3L3IB 4ZYKB 1J1OH 1T80A 3LKSA 2AJVH 2R29A 3QJZA 3BSHA 1RK7A 5IF0A 2YFNA 2Y7MA 3UTQB 1DE4A 3M86A 5KSVA 4NQCB 1SMOA 3U46A 2JLLA 2VITA 4Z7UF 1BQHA 3IXTA 4HV8B 3F6LA 5A3ID 2PPEA 4GLRH 3AQZA 4PY7A 1RVFH 4B7IA 4ZT1A 2EO1A 4U7KA 3QDJE 3WY3A 1BZ7B 3Q2CA 5IQ7L 2ATPA 3QHTC 2GKIA 3QUYD 5I1KL 4PN6A 4RQQA 4U1IB 2X4SA 4R0LC 2NT0A 4JE0A 1KBGL 4MJIA 2Y72A 4KUCD 3LV3B 2VW6A 1H8OA 5E8DH 3QPQC 5F97E 3V4PL 1I1FA 4H7VA 3VXTA 4JAMB 4EXPX 3AU1A 4ZX5A 3GXPA 2BVYA 2VERA 3GMLB 4GSDH 3BIAX 1JV5B 4LRIC 2EXWD 3LNFA 3OC5A 1LE9A 1MHCB 1N19A 4JGJA 3RUGA 2XN2A 1HE8A 3FT4A 3WFCH 4N5EC 5IREA 1O9VA 1XGUB 4J3OH 3IFPA 3QR2A 1P6WA 4YSOA 4JLRB 2NX5A 5CILL 5AL8A 2LTQB 1SVZA 4XNQA 3I6GA 1OVZA 3NIFB 2FH8A 3HUJB 3RL2B 2IH8A 5F3BB 1XCTB 4QUOA 2AW2A 4P2AA 1JPST 4TVPH 1JZDC 4NKIH 3LN4A 4NGHH 4MQ7A 1YY9D 4PRDB 3ZMNA 4OCMC 3RZCD 2XIIA 1M9SA 1SDYA 3BO8A 3HI6L 1NBVL 1G87A 1JPFA 2FTAA 3MRRA 5IHWA 2JI1A 3S37X 4L3FA 4Q2ZA 2ENYA 3TBSA 1CFQB 2UY6B 3RYMA 4HJ0C 3KXFA 2ZAHA 4OLVL 4ZW7A 4EI6B 1T6WA 4JQIH 5I9QB 5A2IH 2PTTA 2OL3B 2J5LB 5HYQA 4Y16A 1MFDL 4RMBA 3UH8A 4N0RA 3G08A 3SPVB 1CICA 2P24B 2XN1A 3RWGB 2YN3A 5DJ0A 8FABA 3VTMA 4Z8FH 5T3XD 1QI4A 3SQRA 1S7RA 1S7VA 3EGSA 1NIBA 2BFVL 2ZOTA 4WWPA 4ZX4A 4YS4A 3T3ME 4QRTA 1FUNA 1UURA 3INUH 1NMBH 1VPOL 2DQDL 4NC1E 4LHJB 2BC4A 4IRZA 4PR5B 2F8XC 3VI4E 5I71C 3B9VA 3DV4A 3MLZH 5CINL 1FJ1B 4CU8A 1JGLH 2EVGA 3DX8A 3C6LB 4LNRB 5KSUB 4GQRA 1K85A 1B4JH 4LKXA 2IG2H 4R4ND 1GJWA 3RDJA 5I1JL 4GG6A 2DIEA 1E2VA 4NO0B 2BW5A 4TUOB 4MNQB 3QBTB 4J1UB 3VH8A 2PWDA 1NSNL 5D5MA 2B1AL 4PB0H 3QEQB 3DHJA 5IVXE 4ELDA 3QJHB 1JSYA 5AB2A 5GRUL 3QA3B 4AYFA 5K93A 1OP4A 4ENEC 5EHFA 3SGDH 2BLFA 1AYRA 3SYQA 3AXHA 3SDAA 1IM9B 3U82B 4YO0B 4EDXB 2IF7A 4ODXA 3CFEB 2XX1A 4L8BA 1U8QB 1XGQA 3RX8A 1JYXA 1TLMA 2Q7AA 1UXWA 1YDPB 5EPMA 5F6HI 2DYPA 2NX5D 4X9BA 2HRPH 1TQCC 5LBSH 3WIHH 3DUUB 4F92B 2CCVA 1B2YA 4R4BA 4P2OA 5BZDB 5MEOB 4IU3B 1DCLA 5CZVH 4OH2A 5KVEE 1ZE3C 1F2QA 4XBMA 4R8WL 3RWJB 2IV9A 5DJCB 1HXMB 1OEZW 3NSFA 4YDJA 4G5AA 3ILPB 2VMJA 1PSKH 2H7WA 3BP4B 1RJZA 2A4EA 1ILSA 3LZOA 5KUKA 1IGFH 2WQXA 1CF8H 2XBZA 4HALA 2ADGB 4OW6A 4L9LC 5IBTL 5H37G 4B0MM 3IS0X 3KVQA 4GW4A 3K6OA 1BDYA 3L3OA 1UFUA 4JQXC 1MIMH 4OM0H 4BSWB 4D0DB 5IBUG 4AGPA 4KFMA 1IAKA 4N2FA 2XZAL 3VVWA 3F85A 3KXFD 1OWWA 2IWEA 3T8XA 3O4OC 4FL4B 3UTPD 1NBCA 3O2WH 4JGNA 4JN2A 4UV7H 5SX4H 2CU9A 3OZLA 1CGUA 2R83A 4JM2C 1FVDA 1YPZA 1KLGB 1DN0B 2ZNWA 1RHHB 1HC1A 2C4FU 3FQUB 3MNVB 4GG8B 5AAMC 4YXLH 3NFPB 3UYPB 5E7BA 4P5KA 3TPKA 3EO1A 4PVMA 2XVLA 4BUGA 4CN1A 5F1NA 4MD5B 1M71A 1CD8A 4JRYB 4LCCC 2V7HB 2F61A 1OP3K 4E0RB 2ESVB 1JN6A 1RD6A 1QSZA 1FO0L 3MV8E 3RWIB 1A7PL 4Q9QL 2YLKA 3CLWA 3N6YA 5LWYH 3IFOA 1WAEA 1BVZA 2VXUL 2PKDA 3F6JA 4KAQH 1KYFA 4AG4H 1QLRB 4PREB 5LBSL 1X5FA 5BPPA 1H8SA 1WGVA 1HHKA 4RNRA 1CUOA 2GW5A 3VI3F 3GNMH 4PJHA 1CFNB 2C9AA 4XAKE 5IEHB 4XPTL 1RZQA 3H9HB 1HZKA 1N6QH 3L95A 4BK5C 1YEDA 4OVUA 4JFEE 4JFPB 3HE7D 2GITA 4ORZC 4QHKI 5H37H 1GR7A 4BWTA 4DKFL 2YPLA 1XQ4A 3OG4B 1PNCA 3IGUA 3RILA 2WZ5A 4KRNA 1MWAA 2VL5A 4MA3B 2XHNA 5T1MB 3QUMH 4J3UA 3ZSTA 2EDKA 4P9HH 2ADJB 5TGBA 4ALAL 3KGSA 4LB8A 5D6CA 4PG2C 4AYMC 3KYMB 4PJXA 4K3JL 2HT3C 5ADPL 1IBBA 3F7YA 4YDIL 1QBLH 2FECL 3IAGC 3Q48A 1E8ZA 1UWYA 4QY8A 4NZUH 2UVEA 1ZXKA 3EGXA 4XZUB 5FV2A 5CIPH 3V9CA 2K8QA 4XPAL 3ZE0F 3ZZ1A 1NAKL 5T3ZL 4CKQA 5I6NA 3UTSD 3DWTA 2HSIA 1G1YA 1OSPH 3KS0H 5A6MA 1BYPA 2VH5H 2G5BB 1RUML 3L1FA 3MLYH 2HX9A 2FWUA 3ISYA 4KC3B 5IB2B 3WU1A 4F7TA 3Q06A 4Y0GA 5ADOH 3FRUB 3KLQA 4IQHA 3MBXL 3QIWA 3PREA 4TL4A 4YIQB 4MXWH 5F3HA 3GDCA 3W0WA 4UQDA 3MV8D 3FAWA 1R5WA 3K4AA 4XP1H 2I9LA 1NGWB 1TLKA 2KUTA 3RVWC 5F9JB 4GUCA 5FCSH 3AACA 3DBXA 4XVTL 5GIRB 3O6LL 2HT4D 1QFWL 5AVVB 5AYUH 2VR4A 2NNCA 4ZPTA 1ZTXE 2J25A 5C7XH 3RFZC 3GMRB 1D5RA 3O45B 4BELD 4OZFA 3NEXA 2HJKA 2APVA 3IXAA 4JL1A 2ZCKH 3IKCA 4HSQA 4PJ8D 1VGKB 3FQNA 2QTVA 4Y19A 1C5DA 4U6XB 4KJPD 5DQJB 4D9QD 2LLNA 3H3BC 3P4OB 2EC8A 2Y2TA 4FD0A 3SDXB 2VR3A 1UENA 2W07B 4PJEF 2QPFA 2XG5B 4AYID 1E4KC 1PLGH 2WAQA 2YAOA 3HI6H 1AAJA 2B0SL 2ZYIA 2GUYA 4QF1A 2XWJA 1A9BA 1LHZA 4LAQL 3C2AL 3HE7A 3ZDZF 4A7QA 4JDZB 3T1FA 2ZP0T 3KGTA 1FBIH 4HFUH 2DYRB 1ZA6A 4CSSA 3ATBA 3MGAA 4PJ7A 5I26A 4G1EA 2X9ZA 3B7SA 1NWOA 5C07A 2IC2A 2YN5A 1WBYA 3VG9C 4HIJA 3RL1B 5DC2A 1DJHA 4TUJA 2QPUA 2VZ3A 3OKKB 4A2HA 5F1IB 2A73A 4GIOA 3BPLC 5H35A 4P46C 4TVPD 2CGRH 1GY2A 1R75A 1XF5A 5TQ2L 2JKLA 1KNOB 5D2LF 3WLWD 4ZO6A 3ZK0A 1KPVA 4F24A 2YK1L 2CKBA 1YYMH 3J07A 3NPSC 5HDOA 3CTTA 1ZJBA 3VGBA 2EXYD 3QSKB 1MFEH 4AVJA 1NCAH 4X4XB 3MRNB 4K3JH 5IROD 2GAZB 1BM3H 2FATL 2VE6A 3QULA 4WUUD 4R96B 4HBCH 4W4NA 4JM0A 3LY6A 3QIWD 2X6CA 4YPGB 3U4KA 4X5XB 4XCEA 3V7MA 2F2HA 4PUBL 4JREB 1NICA 3T6VA 4JPIA 3OMIB 4A7GA 2Q2EB 4UMGA 3HG5A 1P5UA 1QVOB 4HHWA 2VR6A 3NIGB 5J8OA 2CDFB 1SJHB 2BP5M 3SDAC 3NIGF 4HKXA 2FYVA 4KGLA 4TNFA 2NCEA 5KZCD 1T0OA 5MEQB 1CO1A 5KYWA 3TBYA 2OM5A 5HDRA 2JCCB 4Y89A 3DX1A 3FOMA 2JTYA 3ZE2F 2MRYA 3V0DA 3MRMA 4O4YH 4Y16C 1G7HB 4HCRA 1G9NH 2GBUA 4L2LA 2AVGA 2BP8B 3BUYA 2GYSA 3NTCH 3FSZA 2FUTA 1FN4A 2EUVA 2VN5A 4Q6KA 1NDMA 3G3LA 4XOCA 4IOFC 5CIPB 4PB9L 3CFTA 1AP2A 2Z35B 2XZQL 1LEKB 4J8RB 3F8UB 4JO1H 3TJPA 4QRRD 1OCRB 1KPUA 4CMMA 3R1GL 4H0LC 2BWDA 1QW9A 5C08D 4XT1C 3L81A 1IGYA 4CADB 1YEGH 2YQBA 1Z9SB 3VQMA 5IOKA 4HXBH 5D6DA 3QH3B 2D03L 4PGDB 2PYED 3VFGL 1GYWA 5LQBL 2XIDA 4MJ6B 43C9A 3GJFH 4L2YA 1V27A 3HI1B 5DHYB 1FLTX 5LCVA 2HKFL 1O7DE 2OFQA 1HCZA 3HBQA 1XH3B 1YEHH 1JS4A 1WA0X 5CBEB 2VUOA 4JO4H 4X8JB 2WWKT 3GMNA 4UYQA 1K9TA 4QAWA 2CALA 1MZZA 3P0YL 4AQ1B 3ZTDC 2ZX5A 2EDOA 2NY3C 3SO3B 4BSVA 1A6WL 3P4MB 4ZAKC 2Z31A 3BUBA 1UB6B 3UPCA 3CDZB 4FG2A 5C09E 3U36B 2EILB 4ZW8A 3W2DH 3F62A 4P59H 3GSUA 1CLZL 5DTFB 1S7TB 1FIGH 5EB9A 4GAFB 4P2OD 1BEYH 4X8CA 2YPKB 4I18B 3VACA 1FNHA 1SJEA 5C3TA 3TIDB 2XA8H 4NZJA 1IGJB 2X6UA 1WEJH 5HHXL 2YPKA 4OIIH 1T1XA 1TFHA 5BS0B 1MFCH 2YD7A 4D7BA 4CU6A 4OLXH 1Q1JH 1MFAH 1DJYA 5C0AD 1HHHB 4LSSH 2I26N 2ISDA 5K9JL 4NUJA 1ROWA 1JL8A 1MCOH 4NQVA 3RX9A 1UB6A 2QVTA 1SF3A 4XVUD 4MLIA 4ZJ9A 2OMUB 2DQGH 1H5BA 4I0PC 4CNIA 4MRCA 2XRAL 1Z5LA 5AB1A 1CL7H 4ZTOH 2HTLD 3OAUH 3M1OA 4ZNEE 1I82A 4ZK8A 2A9BA 1KGIA 3VFOA 1BFVH 2HTKD 4Q14A 2VM9A 5IW6A 1X5LA 2WOBA 3SGKA 4JO4L 1RZKC 43C9B 4IRJB 3D0LB 1BJ1J 3I9IA 3NRQA 3NCXA 1XMWA 1YG9A 3P30H 4X9IA 5EU6B 4Q4IA 2F54E 3GMQA 3KL5A 3IYLW 4GI8A 4V2BA 2OZ4H 4D9RE 4HSAC 3VD5A 4ZOCA 1TU2A 3TTSA 5E08H 3V0IA 1HAWA 1WAPA 2IGTA 2R4SL 4J8RA 4PRHA 4CBZA 4UM9A 1BVLA 4M1GH 1XZ0A 3WKPA 5ID0B 3MNMA 2ICWI 3EBIA 3F58L 3GS0A 2V2TA 5EOQL 4JK0D 2XZQH 1CR9L 1RFDL 3CVIH 3TT3H 4XH2A 1HI6B 2P5WA 3A67H 3MTXA 3NZHH 3ZZQA 1G7HA 2X6VA 3N43B 2ZXDA 2RBLA 3GRWL 4C56A 4ELMF 4PG9B 3HPJB 3UPRA 2GHZA 2OL3L 3IMVA 4O51B 1SM3H 1NJ9B 2A7BA 1J8SA 2OP4L 3ARGB 3D3VE 2PYFA 5F0PB 1U8CA 1XTLA 2HWZH 4YBLB 2FX9L 5F21B 1MNNA 3VXSE 1SJHA 5B22A 1MCQA 5DVLA 5BS0D 3KPTA 4PJ8B 5E6IA 2C3WA 4X5XA 2QV4A 2FDBP 4YPGA 3NMEA 5KSAD 2H3NA 4MAZA 5CD3B 3THMH 2DIBA 4GS7C 3AMLA 3O0LA 4TNVK 4I1PA 2ADFH 3QUYC 4X8XA 2UX6A 1J0ZA 2X4OB 3CFCH 4DSYA 5EZPA 5GZOC 2G2PA 4ZMLA 4NUQA 1FV1B 4IGBB 4LLMA 2JQAA 4PRIA 2CLZA 2AGJH 5HGDB 5C3IA 2NW2B 4RAHA 1ZT4B 4WJG3 3SKMB 3BLBA 4RAVA 4M7KH 1JHLL 1ZT7A 4K94L 4UIKL 1DO6A 1NGQH 1BQRA 2HJLB 1YYLL 2IWFA 4AMKH 1R3HA 4HOZA 3GHEL 1B0GA 5ICUA 4FULA 1IEAB 2X3CA 3GSQA 4FTVA 4B41A 2RHEA 4NAQA 4LSQH 5EBWB 2AK1H 4LBAA 1GCYA 5CZXD 1NCIA 5G55A 1FYTD 1EZVY 3HMWL 2YRLA 5IB3B 1MRCL 1OW0A 1W80A 1SM3L 4NOBA 5JNYB 1EBPA 4ODVH 4RA0C 3E7JA 1JE6A 2G2RB 4ZMAT 1HQRA 3QORD 2Z65C 3B3IB 1DTUA 2AQQA 3OHXA 4PJ5B 5L0QC 4WCYH 2HKAA 2Z7ZA 3IGLA 1AQKH 3L3GA 4E41A 3MLTB 2Y07L 1W16A 3TA3D 4PJAB 4UTBL 2DQCL 3S3JA 3W0WE 3TEZA 4NQTA 1PU0A 2UYLB 1T1YB 5T1DL 3MSPA 2WXKA 1XD1A 3QEHB 3QQDB 5L88L 2YXVA 3DGCR 3I3DA 2CO2A 3QDAA 4WWKB 3VFWA 4PJ9C 3IMTA 4G43A 3ZKXB 1CT8B 2IAND 4PJBE 4Q6IB 5IOPA 4Y5VB 4JKKA 5HGAA 3MUGB 3EJQA 5KBLA 2ZKHH 3CPLB 1LO3H 4BRJA 2Y1YA 1BXXA 3DBXB 2VC2L 5ABZA 3TEWA 3SQOH 4I89A 1YAZA 3CFDB 1I7TB 3U30C 5D96B 3TPUA 4WJ5A 4OT1H 4EIGB 4Z7OE 4N0UB 2O61A 1QLFB 1AC6A 2AKRB 3FRUA 5C2BL 4WEEA 1YNTF 5LHDA 3LS4L 1A25A 3S37H 5HHVH 4UQCA 4F9PC 5JHLL 3BQVA 4OCWH 2P4AB 4FYTA 4JEGB 3GRWA 1UTDA 2B14A 3SB3A 1P1ZB 4P9MH 2WUCH 3QO1A 4NKIL 5C0DA 3JV4A 5KVDL 4F58H 4B0MB 2MPAH 5SWZA 2DYSB 1F8TL 3K2UL 1EHLH 2BCKB 2AP2A 1VFBB 3JT0A 4YDNA 1IGCL 1EFXD 1YJDL 1YNKH 1GGIH 4KTYA 4RDBA 2I7OA 1WE5A 3IGKA 3VSQA 4DZ8A 1I1CA 2EH8L 3S4SG 4HLZH 2IDSA 3N5AA 3QZWA 2APXA 5EZIH 3QVAA 4PRPD 4YDKL 5K33A 3T5WA 1MWAB 1F42A 3KPMA 1SOXA 2AXHA 1JWMA 1HIML 4AEIH 5HSFA 4GMSH 1Q9OB 4JFPA 1BQLH 4M6MH 1YEDB 1SBBA 5CFHA 5DYOB 3KPOB 1NFDF 4OF6A 1NMCC 4M61B 2TRYA 3HVDA 1E65A 3BZ5A 1NCCH 5C0CB 2FLBT 2DJUA 2Z0UA 3UGXA 1DQTA 1HHKB 1RURH 3QWOA 3O8XC 1RUKL 3UTTD 5E7FA 3KNBB 1OF0A 3B7YA 2X88A 5DRXB 3VD3A 3K8KA 2B1HL 4PS4H 4QRRA 4ZUUA 5IBUB 5DQDH 1AGFA 3ALPA 1JN6B 2ESVA 3RWIA 4OD1H 3GI8H 1BW8A 3NTCL 3OJDA 4NKDA 8CGTA 1Q4NX 3K1KC 4PWHA 2VDOL 4RIRA 4B50A 2Q6WA 2HMID 1KJVA 1DFXA 2A9ML 2C3HA 4YK4B 3WDIA 2DWXA 1NIAA 4RMRA 3IDGA 5AG9A 3A4FA 2BMKB 1UHVA 4G8IB 2PP7A 1KN4H 3NFPA 4K7PX 4LCWA 4TN9A 2P8PA 4KJYA 3FQUA 3MNVA 4GG8A 3SOBH 4W1TA 3JWNC 1DN0A 3VFUB 1ASOA 1A3LH 2P1YA 2J6EA 2BSRB 5D7JC 4EDWH 4GO8A 1AY1L 5GJTL 2LW3A 4N6RA 3T4YA 3CX2A 1ET7A 4DEWA 4ZUUB 3SDDC 2X9WA 3EDJA 3GI9L 2VMCA 3F7LA 1WRFA 4G8AC 3GI8L 5I5IA 4WTXA 3VVVA 4UT6H 2GK0B 5EU5A 3TZVA 4MMXC 4AEIL 4GUQA 2IDUA 4BFBD 1IFRA 1A9EA 3ILPA 5EOCJ 1A1OB 4DNLA 4QJ4B 35C8L 4KXZH 1OPGH 3IFNL 5DJCA 5IBTH 3ASWA 3E6FB 4TXVB 4OCNC 5ALCL 1CDGA 2APFA 5CKAA 5ERWA 1F3JB 2FEDD 2ZF9A 1KJ3L 5BZDA 5JR1L 5LG1A 5JW3L 1RUKH 4S11A 5C0AA 3DUUA 3IETB 1O75A 4DTGH 1PVHA 2DYPB 5D1QA 1TZ8A 3QZWB 2WUCL 1IFGA 2NXYD 4HJTA 3S35H 5JOEA 2ZWZA 4F2EA 4H8WC 1I1AC 1T21A 3L2LA 5IBLC 3H2QA 2XLLA 1YJDC 4RH4A 2OKMA 4R8WH 3ABLB 5DLMH 2VQTA 1AR1B 4HLZG 3MBWB 3V7AE 3BYTA 3L9BA 1QKZL 4FZEL 1NC2D 5ALBL 3QA3A 5SWZB 2XU9A 3QEQA 2LVCA 4HJEA 4MKMA 3WSQH 3VH8B 5GRYA 3UX9B 3AQYA 5F7EL 4TLKA 3U9PL 4O02A 4DPRA 3EBGA 3FZUC 1DBBL 2VQ1B 4PB0L 3MGTA 2IDFA 1A14L 2B7DT 1FE8L 5J1AB 4UV4L 5KSUA 2YXWA 3LDBB 3EHBB 3FT2B 4WJ5B 5IJVB 1D6EB 3SBQA 4D0BB 2BC4B 5GRVK 3QUKB 1UOWA 3OAWA 5DR5H 3MV9D 1SQMA 4ZMTA 2PCFA 3MACL 3Q05A 4IBSA 5CJ5A 3O11B 2CRYA 5HGAB 4X98B 1EIBA 4JHAL 3ARGD 1AMXA 2QQKH 3ZLQC 2DQEL 4QHMB 2QDVA 1NH6A 2OR9H 2Y6SC 3WXWH 5HYQB 4JMNA 4G9FB 4M62H 2P8MB 3FT9A 4XPGH 2W38A 2EDEA 2UYLA 5IZ7A 3TBSB 4QRUB 2AAVA 4GXUN 4HP5A 3OZ9H 3HMWH 1ZHNB 4Q2ZB 5FUCE 4FQHB 5DMGD 4XN8A 3MRRB 2VUYA 2E7BA 3HC3L 2HX7A 4ODVL 1U3HB 2PCPA 2O5YH 3S36L 4PRDA 1U3HD 2XXMB 4MQ7B 2CWRA 1G4RA 4IK6A 5DUPL 2CO6A 3SDCA 4I3SH 2WWMD 2J73A 3IJ8A 2G2RA 4GEJA 4MS6A 1DVFB 2YBRB 3NJMA 2BSCA 3N1PC 2DQUL 4Y4KD 1THCA 3HUJA 1ED3A 2UZYB 4LDCA 4Q0XL 3I6GB 3VM5A 1KPRB 3SD5A 1K8IB 3P9MA 4CGTA 5J13B 3B9DA 4JLRA 4ALAH 2YZ8A 2EIMB 5BRQA 3VH8G 2L7UA 4RWYH 4X2UA 4J3OG 3W2DL 4AW7A 4C56E 4H1LB 5ADPH 4UYPA 1MHCA 3CZFA 4X7CC 1N3NB 1QI3A 1O7SA 4LSUH 4XNXH 2WANA 3FTUA 3A6CL 5CR8A 3BKCH 4B5ZA 1HH9A 4MD4B