5KDRB

The crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
255
structure length
250
Chain Sequence
b'IMTKCPKCKKIMYTKELAENLNVCFNCDHHIALTAYKRIEAISDEGSFTEFDKGMTSANPLDFPSYLEKIEKDQQKTGLKEAVVTGTAQLDGMKFGVAVMDSRFRMGSMGSVIGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQMGKTSVSLKRHSDAGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTINDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIHQEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acetyl-coenzyme A carboxylase carboxyl transferase subunit a
publication title Crystal Structure of Carboxyltransferase from Staphylococcus aureus Bound to the Antibacterial Agent Moiramide B.
pubmed doi rcsb
source organism Staphylococcus aureus (strain usa300)
molecule tags Transferase
total genus 86
structure length 250
sequence length 255
ec nomenclature ec 2.1.3.15: Acetyl-CoA carboxytransferase.
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
B PF17848 zf-ACC Acetyl-coA carboxylase zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5kdrB00
3ST9A 3PZKA 3R9QA 5C90A 5JBXA 3IB9A 4ELSA 4FN7A 4ZDDA 2ZL2A 3U9TB 4U0GA 3PEAA 5E0SH 3MOYA 2F6QA 3TV5A 5DUCA 3KTJA 4U1AA 4QIJA 3DJAA 4GHNA 1NZYA 5G1QA 2X24A 2HW5A 3SWXA 5G1SA 3TLFA 1VRGA 3OC7A 3OT6A 1DCIA 4I42A 3MFMA 5KDRB 4F47A 3QMJA 3P5MA 2PPYA 3R0OA 4G2RA 2VREA 3V5IA 3R9SA 1EY3A 2FW2A 2Q35A 3T3WA 4YLHA 5DU4A 4U0GH 5CTBA 2EJ5A 1WZ8A 5DU8A 3LKEA 4L8KA 5DL1A 2VSSA 3U9RB 3T8BA 4Z0MA 1XNYA 1FC6A 2UZFA 3QXIA 3TVWA 3Q7HA 4KWBA 4EMMA 4FZWC 3STAA 2J5II 3I47A 2BZRA 1FCFA 3PE8A 4MXIA 4RYFA 2CE3A 5INIA 4JCRA 4JCQA 4Q0GA 3HE2A 5KDRA 1XNWA 2J5GA 1N6EA 3Q0JA 3ZWAA 2VSUC 4JOTA 5KJPA 3KQFA 4IZCA 3H0QA 3R9TA 4ZDEA 3K8XA 2W3PA 2ZL3A 3GKBA 4RYFH 1TYFA 3QYRA 1J7XA 5FUSA 3U9SB 4I52A 4JSBA 4B3IA 3BEZA 2VX2A 3H0UA 4FJWD 4FNDA 4WZ8B 1UYVA 3QK8A 1PIXA 3HLN1 3GLMA 3MYBA 4FN8A 4B3HA 2QQ3A 4K29A 3T8AA 3P85A 4JFCA 2A7SA 3K50A 4QIIA 1YG6A 3P2LA 3LAOA 3KTIA 2WTBA 5G1RA 1K32A 3WG5A 1YG8A 3GMAA 3ZW9A 2ZQQA 4JYLA 2VSUE 1Q51A 2CBYA 5E0NX 2J5GD 4L6WA 3QREA 2J5IB 3SLLA 2VSUF 5DTPA 2ZL4A 1DUBA 3M6MA 5FIFA 3JU1A 4FNBA 2Q2XA 1XX4A 2DUBA 1SG4A 4HNKA 4I4ZA 4JVTA 2F9YB 5C9GA 1UYRA 1SZOA 2ZL0A 3HINA 1ON9A 3Q1TA 1OD4A 3TDCA 3NJDA 1Y7OA 1K39A 1RJNA 4U19A 4MOUA 2J5SA 4B3JA 5MGBA 4JWVA 3RRVA 3HRXA 3H0SA 3ZWCA 3HP0A 4Q1IA 3H81A 3OMEA 3VIVA 1NZYB 4OMRA 3GF3A 2VSSF 4ZDFA 3TVUA 3PGQA 3T89A 4IZBA 2F6IA 3KTHA 1EF9A 4EMPA 2PG8A 5E0SA 3NJBA 3BPPA 3ZWBA 1FC9A 1UIYA 2F9YA 4JYJA 4ASIA 1HZDA 2A81A 3M6NA 1WDKA 2VSUA 2X58A 4KNPA 5DZKA 2DEOA 4WCZA 4HC8A 4JCTA 3RSTA 4LK5A 1UYSA 1UYTA 3N6RB 3T88A 4K3WA 2NP9A 4U0HA 4KPKA 4MI2A 2F9IB 1X0UA 5DZKH 3QWDA 5JBWA 3L3SA 4FB8A 2ZQRA 1JXZA 3V5EA 4NNQA 3Q0GA 4DI1A 4OLQA 2PBPA 1HNUA 3GF7A 3ISAA 4ZDCA 4ZU2A 5CTCA 4IZDA 2FBMA 4EMLA 3R6HA 1OD2A 3KTKA 1XO6A 4QFEA 3RSIA 1ON3A 5DU6A 3TRRA 1WDLA 3KTGA 2A7KA 1HNOA 3TT7A 4ELXA 5DKPA 1Q52A 4OG1A 4NEKA 1RJMA 3TZ3A 5DUFA 4WYOB 2IEXA 5DTWA 4GM2A 1EF8A 3BF0A 3H0JA 1PJHA 2D3TA 5IKLB 1O8UA 2C8TA 2VSSE 4JJTA 3TT6A 3ZW8A 1N6DA 1XNVA 2Q34A 2J5IA 2F9IA 4U18A 1TG6A 1MJ3A 3FDUA 4K2NA 4KD6A 3IBBA 3IAVA 5INFA 4JCSA 5INGA 3MT6A 3H02A 3G64A 4FZWA 3DORA 1WDMA 3FF6A 1N6FA 4ZDBA 1FC7A 4RCNA 2FZSA 2GTRA 3QKAA 1W2XA 3QXZA 4ELWA
chains in the Genus database with same CATH superfamily
3ST9A 3PZKA 3R9QA 5C90A 5JBXA 3IB9A 4ELSA 4FN7A 4ZDDA 2ZL2A 3U9TB 4U0GA 3PEAA 5E0SH 3MOYA 2F6QA 3TV5A 4NARA 5DUCA 3KTJA 4U1AA 4QIJA 3DJAA 4GHNA 1NZYA 5G1QA 2X24A 2HW5A 3SWXA 5G1SA 3TLFA 1VRGA 3OC7A 3OT6A 1DCIA 4I42A 3MFMA 5KDRB 4F47A 3QMJA 3P5MA 2PPYA 3R0OA 4G2RA 2VREA 3V5IA 3R9SA 1EY3A 2FW2A 2Q35A 3T3WA 4YLHA 5DU4A 4U0GH 5CTBA 2EJ5A 1WZ8A 5DU8A 3LKEA 4L8KA 5DL1A 2VSSA 3U9RB 3T8BA 4Z0MA 1XNYA 1FC6A 2UZFA 3QXIA 3TVWA 3Q7HA 4KWBA 4EMMA 4FZWC 3STAA 2J5II 3I47A 2BZRA 1FCFA 3PE8A 4MXIA 4RYFA 2CE3A 5INIA 4JCRA 4JCQA 4Q0GA 3HE2A 5KDRA 1XNWA 2J5GA 1N6EA 3Q0JA 3ZWAA 2VSUC 4JOTA 5KJPA 3KQFA 4IZCA 3H0QA 3R9TA 4ZDEA 3K8XA 2W3PA 2ZL3A 3GKBA 4RYFH 1TYFA 3QYRA 1J7XA 5FUSA 3U9SB 4I52A 4JSBA 4B3IA 3BEZA 2VX2A 3H0UA 4FJWD 4FNDA 4WZ8B 1UYVA 3QK8A 1PIXA 3HLN1 3GLMA 3MYBA 4FN8A 4B3HA 2QQ3A 4K29A 3T8AA 3P85A 4JFCA 2A7SA 3K50A 4QIIA 1YG6A 3P2LA 3LAOA 3KTIA 2WTBA 5G1RA 1K32A 3WG5A 1YG8A 3GMAA 3ZW9A 2ZQQA 4JYLA 2VSUE 1Q51A 2CBYA 5E0NX 2J5GD 4L6WA 3QREA 2J5IB 3SLLA 2VSUF 5DTPA 2ZL4A 1DUBA 3M6MA 5FIFA 3JU1A 4FNBA 2Q2XA 1XX4A 2DUBA 3BPTA 1SG4A 4HNKA 4I4ZA 4JVTA 2F9YB 5C9GA 1UYRA 1SZOA 2ZL0A 3HINA 1ON9A 3Q1TA 1OD4A 3TDCA 3NJDA 1Y7OA 1K39A 1RJNA 4U19A 4MOUA 2J5SA 4B3JA 5MGBA 4JWVA 3RRVA 3HRXA 3H0SA 3ZWCA 3HP0A 4Q1IA 3H81A 3OMEA 3VIVA 1NZYB 4J2UA 4OMRA 3GF3A 2VSSF 4ZDFA 3TVUA 2YJGA 3PGQA 3T89A 4IZBA 2F6IA 3KTHA 1EF9A 4EMPA 2PG8A 5E0SA 3NJBA 3BPPA 3ZWBA 1FC9A 1UIYA 2F9YA 4JYJA 4ASIA 1HZDA 2A81A 3M6NA 1WDKA 2VSUA 2X58A 4KNPA 5DZKA 2DEOA 4WCZA 4HC8A 4JCTA 3RSTA 4LK5A 1UYSA 1UYTA 3N6RB 3T88A 4K3WA 2NP9A 4U0HA 4KPKA 4MI2A 2F9IB 1X0UA 5DZKH 3QWDA 5JBWA 3L3SA 4FB8A 2ZQRA 1JXZA 3V5EA 4NNQA 3Q0GA 4DI1A 4OLQA 2PBPA 1HNUA 3GF7A 3ISAA 4ZDCA 4ZU2A 4HDTA 5CTCA 4IZDA 2FBMA 4EMLA 3R6HA 1OD2A 3KTKA 1XO6A 4QFEA 3RSIA 1ON3A 5DU6A 3TRRA 1WDLA 3KTGA 2A7KA 1HNOA 3TT7A 4ELXA 5DKPA 1Q52A 4OG1A 4NEKA 1RJMA 3TZ3A 5DUFA 4WYOB 5HUQA 2IEXA 5DTWA 4GM2A 1EF8A 3BF0A 3H0JA 1PJHA 2D3TA 5IKLB 1O8UA 2C8TA 2VSSE 4JJTA 3TT6A 3ZW8A 1N6DA 1XNVA 2Q34A 2J5IA 2F9IA 4U18A 1TG6A 1MJ3A 3FDUA 4K2NA 4KD6A 3IBBA 3IAVA 5INFA 4JCSA 5INGA 3MT6A 3H02A 3G64A 4FZWA 3DORA 1WDMA 3FF6A 1N6FA 4ZDBA 1FC7A 4RCNA 2FZSA 2GTRA 3QKAA 1W2XA 3QXZA 4ELWA
chains in the Genus database with same CATH topology
3ST9A 3PZKA 3R9QA 5C90A 5JBXA 3IB9A 4ELSA 4FN7A 4ZDDA 2ZL2A 3U9TB 4U0GA 3PEAA 5E0SH 3MOYA 2F6QA 3TV5A 4NARA 5DUCA 3KTJA 4U1AA 4QIJA 3DJAA 4GHNA 1NZYA 5G1QA 2X24A 2HW5A 3SWXA 5G1SA 3TLFA 1VRGA 3OC7A 3OT6A 1DCIA 4I42A 3MFMA 5KDRB 4F47A 3QMJA 3P5MA 2PPYA 3R0OA 4G2RA 2VREA 3V5IA 3R9SA 1EY3A 2FW2A 2Q35A 3T3WA 4YLHA 5DU4A 4U0GH 5CTBA 2EJ5A 1WZ8A 5DU8A 3LKEA 4L8KA 5DL1A 2VSSA 3U9RB 3T8BA 4Z0MA 1XNYA 1FC6A 2UZFA 3QXIA 3TVWA 3Q7HA 4KWBA 4EMMA 4FZWC 3STAA 2J5II 3I47A 2BZRA 1FCFA 3PE8A 4MXIA 4RYFA 2CE3A 5INIA 4JCRA 4JCQA 4Q0GA 3HE2A 5KDRA 1XNWA 2J5GA 1N6EA 3Q0JA 3ZWAA 2VSUC 4JOTA 5KJPA 3KQFA 4IZCA 3H0QA 3R9TA 4ZDEA 3K8XA 2W3PA 2ZL3A 3GKBA 4RYFH 1TYFA 3QYRA 1J7XA 5FUSA 3U9SB 4I52A 4JSBA 4B3IA 3BEZA 2VX2A 3H0UA 4FJWD 4FNDA 4WZ8B 1UYVA 3QK8A 1PIXA 3HLN1 3GLMA 3MYBA 4FN8A 4B3HA 2QQ3A 4K29A 3T8AA 3P85A 4JFCA 2A7SA 3K50A 4QIIA 1YG6A 3P2LA 3LAOA 3KTIA 2WTBA 5G1RA 1K32A 3WG5A 1YG8A 3GMAA 3ZW9A 2ZQQA 4JYLA 2VSUE 1Q51A 2CBYA 5E0NX 2J5GD 4L6WA 3QREA 2J5IB 3SLLA 2VSUF 5DTPA 2ZL4A 1DUBA 3M6MA 5FIFA 3JU1A 4FNBA 2Q2XA 1XX4A 2DUBA 3BPTA 1SG4A 4HNKA 4I4ZA 4JVTA 2F9YB 5C9GA 1UYRA 1SZOA 2ZL0A 3HINA 1ON9A 3Q1TA 1OD4A 3TDCA 3NJDA 1Y7OA 1K39A 1RJNA 4U19A 4MOUA 2J5SA 4B3JA 5MGBA 4JWVA 3RRVA 3HRXA 3H0SA 3ZWCA 3HP0A 4Q1IA 3H81A 3OMEA 3VIVA 1NZYB 4J2UA 4OMRA 3GF3A 2VSSF 4ZDFA 3TVUA 2YJGA 3PGQA 3T89A 4IZBA 2F6IA 3KTHA 1EF9A 4EMPA 2PG8A 5E0SA 3NJBA 3BPPA 3ZWBA 1FC9A 1UIYA 2F9YA 4JYJA 4ASIA 1HZDA 2A81A 3M6NA 1WDKA 2VSUA 2X58A 4KNPA 5DZKA 2DEOA 4WCZA 4HC8A 4JCTA 3RSTA 4LK5A 1UYSA 1UYTA 3N6RB 3T88A 4K3WA 2NP9A 4U0HA 4KPKA 4MI2A 2F9IB 1X0UA 5DZKH 3QWDA 5JBWA 3L3SA 4FB8A 2ZQRA 1JXZA 3V5EA 4NNQA 3Q0GA 4DI1A 4OLQA 2PBPA 1HNUA 3GF7A 3ISAA 4ZDCA 4ZU2A 4HDTA 5CTCA 4IZDA 2FBMA 4EMLA 3R6HA 1OD2A 3KTKA 1XO6A 4QFEA 3RSIA 1ON3A 5DU6A 3TRRA 1WDLA 3KTGA 2A7KA 1HNOA 3TT7A 4ELXA 5DKPA 1Q52A 4OG1A 4NEKA 1RJMA 3TZ3A 5DUFA 4WYOB 5HUQA 2IEXA 5DTWA 4GM2A 1EF8A 3BF0A 3H0JA 1PJHA 2D3TA 5IKLB 1O8UA 2C8TA 2VSSE 4JJTA 3TT6A 3ZW8A 1N6DA 1XNVA 2Q34A 2J5IA 2F9IA 4U18A 1TG6A 1MJ3A 3FDUA 4K2NA 4KD6A 3IBBA 3IAVA 5INFA 4JCSA 5INGA 3MT6A 3H02A 3G64A 4FZWA 3DORA 1WDMA 3FF6A 1N6FA 4ZDBA 1FC7A 4RCNA 2FZSA 2GTRA 3QKAA 1W2XA 3QXZA 4ELWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ST9 A;  3PZK A;  3R9Q A;  5C90 A;  5JBX A;  3IB9 A;  4ELS A;  4FN7 A;  4ZDD A;  2ZL2 A;  3U9T B;  4U0G A;  3PEA A;  5E0S H;  3MOY A;  2F6Q A;  3TV5 A;  5DUC A;  3KTJ A;  4U1A A;  4QIJ A;  3DJA A;  4GHN A;  1NZY A;  5G1Q A;  2X24 A;  2HW5 A;  3SWX A;  5G1S A;  3TLF A;  1VRG A;  3OC7 A;  3OT6 A;  1DCI A;  4I42 A;  3MFM A;  5KDR B;  4F47 A;  3QMJ A;  3P5M A;  2PPY A;  3R0O A;  4G2R A;  2VRE A;  3V5I A;  3R9S A;  1EY3 A;  2FW2 A;  2Q35 A;  3T3W A;  4YLH A;  5DU4 A;  4U0G H;  5CTB A;  2EJ5 A;  1WZ8 A;  5DU8 A;  3LKE A;  4L8K A;  5DL1 A;  2VSS A;  3U9R B;  3T8B A;  4Z0M A;  1XNY A;  1FC6 A;  2UZF A;  3QXI A;  3TVW A;  3Q7H A;  4KWB A;  4EMM A;  4FZW C;  3STA A;  2J5I I;  3I47 A;  2BZR A;  1FCF A;  3PE8 A;  4MXI A;  4RYF A;  2CE3 A;  5INI A;  4JCR A;  4JCQ A;  4Q0G A;  3HE2 A;  5KDR A;  1XNW A;  2J5G A;  1N6E A;  3Q0J A;  3ZWA A;  2VSU C;  4JOT A;  5KJP A;  3KQF A;  4IZC A;  3H0Q A;  3R9T A;  4ZDE A;  3K8X A;  2W3P A;  2ZL3 A;  3GKB A;  4RYF H;  1TYF A;  3QYR A;  1J7X A;  5FUS A;  3U9S B;  4I52 A;  4JSB A;  4B3I A;  3BEZ A;  2VX2 A;  3H0U A;  4FJW D;  4FND A;  4WZ8 B;  1UYV A;  3QK8 A;  1PIX A;  3HLN 1;  3GLM A;  3MYB A;  4FN8 A;  4B3H A;  2QQ3 A;  4K29 A;  3T8A A;  3P85 A;  4JFC A;  2A7S A;  3K50 A;  4QII A;  1YG6 A;  3P2L A;  3LAO A;  3KTI A;  2WTB A;  5G1R A;  1K32 A;  3WG5 A;  1YG8 A;  3GMA A;  3ZW9 A;  2ZQQ A;  4JYL A;  2VSU E;  1Q51 A;  2CBY A;  5E0N X;  2J5G D;  4L6W A;  3QRE A;  2J5I B;  3SLL A;  2VSU F;  5DTP A;  2ZL4 A;  1DUB A;  3M6M A;  5FIF A;  3JU1 A;  4FNB A;  2Q2X A;  1XX4 A;  2DUB A;  1SG4 A;  4HNK A;  4I4Z A;  4JVT A;  2F9Y B;  5C9G A;  1UYR A;  1SZO A;  2ZL0 A;  3HIN A;  1ON9 A;  3Q1T A;  1OD4 A;  3TDC A;  3NJD A;  1Y7O A;  1K39 A;  1RJN A;  4U19 A;  4MOU A;  2J5S A;  4B3J A;  5MGB A;  4JWV A;  3RRV A;  3HRX A;  3H0S A;  3ZWC A;  3HP0 A;  4Q1I A;  3H81 A;  3OME A;  3VIV A;  1NZY B;  4OMR A;  3GF3 A;  2VSS F;  4ZDF A;  3TVU A;  3PGQ A;  3T89 A;  4IZB A;  2F6I A;  3KTH A;  1EF9 A;  4EMP A;  2PG8 A;  5E0S A;  3NJB A;  3BPP A;  3ZWB A;  1FC9 A;  1UIY A;  2F9Y A;  4JYJ A;  4ASI A;  1HZD A;  2A81 A;  3M6N A;  1WDK A;  2VSU A;  2X58 A;  4KNP A;  5DZK A;  2DEO A;  4WCZ A;  4HC8 A;  4JCT A;  3RST A;  4LK5 A;  1UYS A;  1UYT A;  3N6R B;  3T88 A;  4K3W A;  2NP9 A;  4U0H A;  4KPK A;  4MI2 A;  2F9I B;  1X0U A;  5DZK H;  3QWD A;  5JBW A;  3L3S A;  4FB8 A;  2ZQR A;  1JXZ A;  3V5E A;  4NNQ A;  3Q0G A;  4DI1 A;  4OLQ A;  2PBP A;  1HNU A;  3GF7 A;  3ISA A;  4ZDC A;  4ZU2 A;  5CTC A;  4IZD A;  2FBM A;  4EML A;  3R6H A;  1OD2 A;  3KTK A;  1XO6 A;  4QFE A;  3RSI A;  1ON3 A;  5DU6 A;  3TRR A;  1WDL A;  3KTG A;  2A7K A;  1HNO A;  3TT7 A;  4ELX A;  5DKP A;  1Q52 A;  4OG1 A;  4NEK A;  1RJM A;  3TZ3 A;  5DUF A;  4WYO B;  2IEX A;  5DTW A;  4GM2 A;  1EF8 A;  3BF0 A;  3H0J A;  1PJH A;  2D3T A;  5IKL B;  1O8U A;  2C8T A;  2VSS E;  4JJT A;  3TT6 A;  3ZW8 A;  1N6D A;  1XNV A;  2Q34 A;  2J5I A;  2F9I A;  4U18 A;  1TG6 A;  1MJ3 A;  3FDU A;  4K2N A;  4KD6 A;  3IBB A;  3IAV A;  5INF A;  4JCS A;  5ING A;  3MT6 A;  3H02 A;  3G64 A;  4FZW A;  3DOR A;  1WDM A;  3FF6 A;  1N6F A;  4ZDB A;  1FC7 A;  4RCN A;  2FZS A;  2GTR A;  3QKA A;  1W2X A;  3QXZ A;  4ELW A; 
#chains in the Genus database with same CATH topology
 3ST9 A;  3PZK A;  3R9Q A;  5C90 A;  5JBX A;  3IB9 A;  4ELS A;  4FN7 A;  4ZDD A;  2ZL2 A;  3U9T B;  4U0G A;  3PEA A;  5E0S H;  3MOY A;  2F6Q A;  3TV5 A;  4NAR A;  5DUC A;  3KTJ A;  4U1A A;  4QIJ A;  3DJA A;  4GHN A;  1NZY A;  5G1Q A;  2X24 A;  2HW5 A;  3SWX A;  5G1S A;  3TLF A;  1VRG A;  3OC7 A;  3OT6 A;  1DCI A;  4I42 A;  3MFM A;  5KDR B;  4F47 A;  3QMJ A;  3P5M A;  2PPY A;  3R0O A;  4G2R A;  2VRE A;  3V5I A;  3R9S A;  1EY3 A;  2FW2 A;  2Q35 A;  3T3W A;  4YLH A;  5DU4 A;  4U0G H;  5CTB A;  2EJ5 A;  1WZ8 A;  5DU8 A;  3LKE A;  4L8K A;  5DL1 A;  2VSS A;  3U9R B;  3T8B A;  4Z0M A;  1XNY A;  1FC6 A;  2UZF A;  3QXI A;  3TVW A;  3Q7H A;  4KWB A;  4EMM A;  4FZW C;  3STA A;  2J5I I;  3I47 A;  2BZR A;  1FCF A;  3PE8 A;  4MXI A;  4RYF A;  2CE3 A;  5INI A;  4JCR A;  4JCQ A;  4Q0G A;  3HE2 A;  5KDR A;  1XNW A;  2J5G A;  1N6E A;  3Q0J A;  3ZWA A;  2VSU C;  4JOT A;  5KJP A;  3KQF A;  4IZC A;  3H0Q A;  3R9T A;  4ZDE A;  3K8X A;  2W3P A;  2ZL3 A;  3GKB A;  4RYF H;  1TYF A;  3QYR A;  1J7X A;  5FUS A;  3U9S B;  4I52 A;  4JSB A;  4B3I A;  3BEZ A;  2VX2 A;  3H0U A;  4FJW D;  4FND A;  4WZ8 B;  1UYV A;  3QK8 A;  1PIX A;  3HLN 1;  3GLM A;  3MYB A;  4FN8 A;  4B3H A;  2QQ3 A;  4K29 A;  3T8A A;  3P85 A;  4JFC A;  2A7S A;  3K50 A;  4QII A;  1YG6 A;  3P2L A;  3LAO A;  3KTI A;  2WTB A;  5G1R A;  1K32 A;  3WG5 A;  1YG8 A;  3GMA A;  3ZW9 A;  2ZQQ A;  4JYL A;  2VSU E;  1Q51 A;  2CBY A;  5E0N X;  2J5G D;  4L6W A;  3QRE A;  2J5I B;  3SLL A;  2VSU F;  5DTP A;  2ZL4 A;  1DUB A;  3M6M A;  5FIF A;  3JU1 A;  4FNB A;  2Q2X A;  1XX4 A;  2DUB A;  3BPT A;  1SG4 A;  4HNK A;  4I4Z A;  4JVT A;  2F9Y B;  5C9G A;  1UYR A;  1SZO A;  2ZL0 A;  3HIN A;  1ON9 A;  3Q1T A;  1OD4 A;  3TDC A;  3NJD A;  1Y7O A;  1K39 A;  1RJN A;  4U19 A;  4MOU A;  2J5S A;  4B3J A;  5MGB A;  4JWV A;  3RRV A;  3HRX A;  3H0S A;  3ZWC A;  3HP0 A;  4Q1I A;  3H81 A;  3OME A;  3VIV A;  1NZY B;  4J2U A;  4OMR A;  3GF3 A;  2VSS F;  4ZDF A;  3TVU A;  2YJG A;  3PGQ A;  3T89 A;  4IZB A;  2F6I A;  3KTH A;  1EF9 A;  4EMP A;  2PG8 A;  5E0S A;  3NJB A;  3BPP A;  3ZWB A;  1FC9 A;  1UIY A;  2F9Y A;  4JYJ A;  4ASI A;  1HZD A;  2A81 A;  3M6N A;  1WDK A;  2VSU A;  2X58 A;  4KNP A;  5DZK A;  2DEO A;  4WCZ A;  4HC8 A;  4JCT A;  3RST A;  4LK5 A;  1UYS A;  1UYT A;  3N6R B;  3T88 A;  4K3W A;  2NP9 A;  4U0H A;  4KPK A;  4MI2 A;  2F9I B;  1X0U A;  5DZK H;  3QWD A;  5JBW A;  3L3S A;  4FB8 A;  2ZQR A;  1JXZ A;  3V5E A;  4NNQ A;  3Q0G A;  4DI1 A;  4OLQ A;  2PBP A;  1HNU A;  3GF7 A;  3ISA A;  4ZDC A;  4ZU2 A;  4HDT A;  5CTC A;  4IZD A;  2FBM A;  4EML A;  3R6H A;  1OD2 A;  3KTK A;  1XO6 A;  4QFE A;  3RSI A;  1ON3 A;  5DU6 A;  3TRR A;  1WDL A;  3KTG A;  2A7K A;  1HNO A;  3TT7 A;  4ELX A;  5DKP A;  1Q52 A;  4OG1 A;  4NEK A;  1RJM A;  3TZ3 A;  5DUF A;  4WYO B;  5HUQ A;  2IEX A;  5DTW A;  4GM2 A;  1EF8 A;  3BF0 A;  3H0J A;  1PJH A;  2D3T A;  5IKL B;  1O8U A;  2C8T A;  2VSS E;  4JJT A;  3TT6 A;  3ZW8 A;  1N6D A;  1XNV A;  2Q34 A;  2J5I A;  2F9I A;  4U18 A;  1TG6 A;  1MJ3 A;  3FDU A;  4K2N A;  4KD6 A;  3IBB A;  3IAV A;  5INF A;  4JCS A;  5ING A;  3MT6 A;  3H02 A;  3G64 A;  4FZW A;  3DOR A;  1WDM A;  3FF6 A;  1N6F A;  4ZDB A;  1FC7 A;  4RCN A;  2FZS A;  2GTR A;  3QKA A;  1W2X A;  3QXZ A;  4ELW A; 
#chains in the Genus database with same CATH homology
 3ST9 A;  3PZK A;  3R9Q A;  5C90 A;  5JBX A;  3IB9 A;  4ELS A;  4FN7 A;  4ZDD A;  2ZL2 A;  3U9T B;  4U0G A;  3PEA A;  5E0S H;  3MOY A;  2F6Q A;  3TV5 A;  4NAR A;  5DUC A;  3KTJ A;  4U1A A;  4QIJ A;  3DJA A;  4GHN A;  1NZY A;  5G1Q A;  2X24 A;  2HW5 A;  3SWX A;  5G1S A;  3TLF A;  1VRG A;  3OC7 A;  3OT6 A;  1DCI A;  4I42 A;  3MFM A;  5KDR B;  4F47 A;  3QMJ A;  3P5M A;  2PPY A;  3R0O A;  4G2R A;  2VRE A;  3V5I A;  3R9S A;  1EY3 A;  2FW2 A;  2Q35 A;  3T3W A;  4YLH A;  5DU4 A;  4U0G H;  5CTB A;  2EJ5 A;  1WZ8 A;  5DU8 A;  3LKE A;  4L8K A;  5DL1 A;  2VSS A;  3U9R B;  3T8B A;  4Z0M A;  1XNY A;  1FC6 A;  2UZF A;  3QXI A;  3TVW A;  3Q7H A;  4KWB A;  4EMM A;  4FZW C;  3STA A;  2J5I I;  3I47 A;  2BZR A;  1FCF A;  3PE8 A;  4MXI A;  4RYF A;  2CE3 A;  5INI A;  4JCR A;  4JCQ A;  4Q0G A;  3HE2 A;  5KDR A;  1XNW A;  2J5G A;  1N6E A;  3Q0J A;  3ZWA A;  2VSU C;  4JOT A;  5KJP A;  3KQF A;  4IZC A;  3H0Q A;  3R9T A;  4ZDE A;  3K8X A;  2W3P A;  2ZL3 A;  3GKB A;  4RYF H;  1TYF A;  3QYR A;  1J7X A;  5FUS A;  3U9S B;  4I52 A;  4JSB A;  4B3I A;  3BEZ A;  2VX2 A;  3H0U A;  4FJW D;  4FND A;  4WZ8 B;  1UYV A;  3QK8 A;  1PIX A;  3HLN 1;  3GLM A;  3MYB A;  4FN8 A;  4B3H A;  2QQ3 A;  4K29 A;  3T8A A;  3P85 A;  4JFC A;  2A7S A;  3K50 A;  4QII A;  1YG6 A;  3P2L A;  3LAO A;  3KTI A;  2WTB A;  5G1R A;  1K32 A;  3WG5 A;  1YG8 A;  3GMA A;  3ZW9 A;  2ZQQ A;  4JYL A;  2VSU E;  1Q51 A;  2CBY A;  5E0N X;  2J5G D;  4L6W A;  3QRE A;  2J5I B;  3SLL A;  2VSU F;  5DTP A;  2ZL4 A;  1DUB A;  3M6M A;  5FIF A;  3JU1 A;  4FNB A;  2Q2X A;  1XX4 A;  2DUB A;  3BPT A;  1SG4 A;  4HNK A;  4I4Z A;  4JVT A;  2F9Y B;  5C9G A;  1UYR A;  1SZO A;  2ZL0 A;  3HIN A;  1ON9 A;  3Q1T A;  1OD4 A;  3TDC A;  3NJD A;  1Y7O A;  1K39 A;  1RJN A;  4U19 A;  4MOU A;  2J5S A;  4B3J A;  5MGB A;  4JWV A;  3RRV A;  3HRX A;  3H0S A;  3ZWC A;  3HP0 A;  4Q1I A;  3H81 A;  3OME A;  3VIV A;  1NZY B;  4J2U A;  4OMR A;  3GF3 A;  2VSS F;  4ZDF A;  3TVU A;  2YJG A;  3PGQ A;  3T89 A;  4IZB A;  2F6I A;  3KTH A;  1EF9 A;  4EMP A;  2PG8 A;  5E0S A;  3NJB A;  3BPP A;  3ZWB A;  1FC9 A;  1UIY A;  2F9Y A;  4JYJ A;  4ASI A;  1HZD A;  2A81 A;  3M6N A;  1WDK A;  2VSU A;  2X58 A;  4KNP A;  5DZK A;  2DEO A;  4WCZ A;  4HC8 A;  4JCT A;  3RST A;  4LK5 A;  1UYS A;  1UYT A;  3N6R B;  3T88 A;  4K3W A;  2NP9 A;  4U0H A;  4KPK A;  4MI2 A;  2F9I B;  1X0U A;  5DZK H;  3QWD A;  5JBW A;  3L3S A;  4FB8 A;  2ZQR A;  1JXZ A;  3V5E A;  4NNQ A;  3Q0G A;  4DI1 A;  4OLQ A;  2PBP A;  1HNU A;  3GF7 A;  3ISA A;  4ZDC A;  4ZU2 A;  4HDT A;  5CTC A;  4IZD A;  2FBM A;  4EML A;  3R6H A;  1OD2 A;  3KTK A;  1XO6 A;  4QFE A;  3RSI A;  1ON3 A;  5DU6 A;  3TRR A;  1WDL A;  3KTG A;  2A7K A;  1HNO A;  3TT7 A;  4ELX A;  5DKP A;  1Q52 A;  4OG1 A;  4NEK A;  1RJM A;  3TZ3 A;  5DUF A;  4WYO B;  5HUQ A;  2IEX A;  5DTW A;  4GM2 A;  1EF8 A;  3BF0 A;  3H0J A;  1PJH A;  2D3T A;  5IKL B;  1O8U A;  2C8T A;  2VSS E;  4JJT A;  3TT6 A;  3ZW8 A;  1N6D A;  1XNV A;  2Q34 A;  2J5I A;  2F9I A;  4U18 A;  1TG6 A;  1MJ3 A;  3FDU A;  4K2N A;  4KD6 A;  3IBB A;  3IAV A;  5INF A;  4JCS A;  5ING A;  3MT6 A;  3H02 A;  3G64 A;  4FZW A;  3DOR A;  1WDM A;  3FF6 A;  1N6F A;  4ZDB A;  1FC7 A;  4RCN A;  2FZS A;  2GTR A;  3QKA A;  1W2X A;  3QXZ A;  4ELW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...