5KDRB

The crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b.
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
255
structure length
250
Chain Sequence
IMTKCPKCKKIMYTKELAENLNVCFNCDHHIALTAYKRIEAISDEGSFTEFDKGMTSANPLDFPSYLEKIEKDQQKTGLKEAVVTGTAQLDGMKFGVAVMDSRFRMGSMGSVIGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQMGKTSVSLKRHSDAGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTINDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIHQEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Carboxyltransferase from Staphylococcus aureus Bound to the Antibacterial Agent Moiramide B.
pubmed doi rcsb
source organism Staphylococcus aureus (strain usa300)
molecule tags Transferase
molecule keywords Acetyl-coenzyme A carboxylase carboxyl transferase subunit a
total genus 86
structure length 250
sequence length 255
ec nomenclature ec 2.1.3.15: Acetyl-CoA carboxytransferase.
pdb deposition date 2016-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01039 Carboxyl_trans Carboxyl transferase domain
B PF17848 zf-ACC Acetyl-coA carboxylase zinc finger domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5kdrB00
4ZDCA 5INIA 2A7KA 2F6QA 3TT7A 1EY3A 4FNDA 4QIIA 5DU4A 2BZRA 4RCNA 1HZDA 3R9QA 5CTBA 1W2XA 1PJHA 4HC8A 1WDKA 5DUFA 2J5II 1Y7OA 2Q35A 3GMAA 4ZU2A 3OMEA 1DCIA 4U0HA 3HP0A 4L6WA 2EJ5A 4OLQA 4HNKA 3R6HA 3BF0A 5DTWA 3P5MA 4RYFH 4IZBA 4LK5A 2ZL2A 4Z0MA 4ASIA 2PPYA 1WZ8A 3WG5A 2DUBA 3GF3A 1ON3A 2HW5A 3GKBA 1SG4A 3P2LA 4NEKA 3RSIA 1VRGA 3HRXA 3H0JA 4JCRA 5DU6A 3GLMA 3QREA 3ZWAA 4U18A 4EMMA 2QQ3A 1Q52A 5FIFA 5C90A 5DL1A 3IBBA 5E0SH 3ZWCA 4FZWC 5INFA 3FDUA 4MI2A 3M6NA 4ZDDA 3H02A 4KPKA 3R9TA 3R0OA 3K50A 2J5IB 3R9SA 3TLFA 5DKPA 1DUBA 3KTIA 3LKEA 2F9IA 4NNQA 1O8UA 3LAOA 4MXIA 2J5GD 1UYTA 4FB8A 5DZKH 4JYJA 1ON9A 1MJ3A 3I47A 3KQFA 4FJWD 3KTKA 4JYLA 4WCZA 2F6IA 4FNBA 3KTHA 4FN7A 3STAA 3QXIA 2J5GA 5KJPA 3QXZA 2VX2A 1N6FA 1HNUA 4ZDFA 3IB9A 2Q2XA 1YG8A 3K8XA 4IZCA 1XX4A 4I42A 4U0GA 3OC7A 3T88A 4WYOB 2F9YA 2ZL0A 2W3PA 3HE2A 3BPPA 3KTGA 1X0UA 4I52A 2VSUA 3DJAA 2ZL3A 2VSUF 1XNWA 4JCQA 3PE8A 3IAVA 4IZDA 3RRVA 2CBYA 3H0SA 5DU8A 3T8BA 1WDMA 3Q1TA 3KTJA 4DI1A 4K2NA 5DTPA 2UZFA 3MT6A 1HNOA 2C8TA 5IKLB 1N6DA 2PG8A 2D3TA 1UYRA 5G1RA 4G2RA 3HLN1 1JXZA 4WZ8B 1NZYA 2X24A 3Q0GA 3ISAA 4L8KA 3TRRA 4B3IA 1EF8A 4JCSA 4JJTA 3HINA 5FUSA 3QWDA 5KDRB 2VSSE 3PEAA 4GM2A 2FBMA 3TV5A 1EF9A 3ZW9A 3TT6A 3SLLA 2NP9A 4ELWA 3NJDA 4MOUA 2FZSA 3Q0JA 4FZWA 2DEOA 3PGQA 3PZKA 1K39A 2PBPA 1TG6A 4U19A 3BEZA 4QFEA 3T89A 1N6EA 5JBWA 2J5IA 2VREA 1FC9A 3VIVA 1XO6A 4EMPA 1WDLA 4K29A 4YLHA 4JOTA 2ZL4A 5JBXA 4B3JA 2VSUE 2VSUC 4JVTA 2FW2A 2X58A 1K32A 4Q0GA 1RJMA 1PIXA 1OD2A 4JCTA 4QIJA 1FC6A 4F47A 5CTCA 2F9YB 4OMRA 3TDCA 3L3SA 4GHNA 3DORA 4I4ZA 1FC7A 5E0NX 3TZ3A 1XNVA 4K3WA 5DZKA 5G1SA 2J5SA 5MGBA 3V5IA 2ZQQA 3MOYA 5INGA 2Q34A 3G64A 2VSSF 3TVUA 3MFMA 3T3WA 3QK8A 2GTRA 3P85A 1YG6A 3M6MA 4FN8A 3H0UA 3SWXA 3JU1A 2WTBA 3RSTA 4JWVA 1TYFA 2F9IB 4JSBA 1XNYA 3NJBA 3V5EA 4OG1A 4U0GH 4KD6A 3H0QA 5KDRA 4JFCA 3QMJA 4KWBA 3ZW8A 3H81A 3QYRA 4EMLA 3ZWBA 2A7SA 4ZDEA 3N6RB 5C9GA 3U9RB 4ELSA 3FF6A 1UYVA 4ELXA 1OD4A 3T8AA 1UYSA 2A81A 1J7XA 3QKAA 1RJNA 2ZQRA 2VSSA 3OT6A 3TVWA 4B3HA 5E0SA 5DUCA 4Q1IA 3MYBA 2IEXA 3ST9A 3U9TB 3GF7A 4KNPA 1Q51A 3Q7HA 3U9SB 4ZDBA 1FCFA 1NZYB 5G1QA 4RYFA 1SZOA 1UIYA 4U1AA 2CE3A
chains in the Genus database with same CATH superfamily
4ZDCA 5INIA 2A7KA 2F6QA 3TT7A 1EY3A 4FNDA 4QIIA 5DU4A 2BZRA 4RCNA 1HZDA 3R9QA 5CTBA 1W2XA 1PJHA 4HC8A 1WDKA 5DUFA 2J5II 1Y7OA 2Q35A 3GMAA 4ZU2A 3OMEA 4J2UA 1DCIA 4U0HA 3HP0A 4L6WA 2EJ5A 4OLQA 4HNKA 3R6HA 3BF0A 5DTWA 3P5MA 4RYFH 4IZBA 4LK5A 2ZL2A 4Z0MA 4ASIA 2PPYA 1WZ8A 3WG5A 2DUBA 3GF3A 1ON3A 2HW5A 3GKBA 1SG4A 3P2LA 4NEKA 3RSIA 1VRGA 3HRXA 3H0JA 4JCRA 5DU6A 3GLMA 3QREA 3ZWAA 4U18A 4EMMA 2QQ3A 1Q52A 5FIFA 5C90A 5DL1A 3IBBA 5E0SH 3ZWCA 4FZWC 5INFA 3FDUA 4MI2A 3M6NA 4ZDDA 3H02A 4KPKA 3R9TA 3R0OA 3K50A 2J5IB 3R9SA 3TLFA 5DKPA 1DUBA 3KTIA 3LKEA 2F9IA 4NNQA 1O8UA 3LAOA 4MXIA 2J5GD 1UYTA 4FB8A 5DZKH 4JYJA 1ON9A 1MJ3A 3I47A 3KQFA 5HUQA 4FJWD 3KTKA 4JYLA 4WCZA 2F6IA 4FNBA 3KTHA 4FN7A 3STAA 3QXIA 2J5GA 5KJPA 3QXZA 2VX2A 1N6FA 1HNUA 4ZDFA 3IB9A 2Q2XA 1YG8A 3K8XA 4IZCA 1XX4A 4I42A 4U0GA 3OC7A 3T88A 4WYOB 2F9YA 2ZL0A 2W3PA 3HE2A 3BPPA 3KTGA 1X0UA 4I52A 2VSUA 3DJAA 2ZL3A 2VSUF 1XNWA 4JCQA 3PE8A 3IAVA 4IZDA 3RRVA 2CBYA 3H0SA 5DU8A 3T8BA 1WDMA 3Q1TA 3KTJA 4DI1A 4K2NA 5DTPA 2UZFA 3MT6A 1HNOA 2C8TA 5IKLB 1N6DA 2PG8A 2D3TA 1UYRA 5G1RA 4G2RA 3HLN1 1JXZA 4WZ8B 1NZYA 2X24A 3Q0GA 3ISAA 4L8KA 3TRRA 4B3IA 1EF8A 4JCSA 4JJTA 3HINA 5FUSA 3QWDA 5KDRB 2VSSE 3PEAA 4GM2A 2FBMA 3TV5A 1EF9A 3ZW9A 3TT6A 3SLLA 2NP9A 4ELWA 3NJDA 4MOUA 2FZSA 3Q0JA 4FZWA 2DEOA 3PGQA 3PZKA 4NARA 1K39A 2PBPA 1TG6A 4U19A 3BEZA 4QFEA 3T89A 1N6EA 5JBWA 2J5IA 2VREA 1FC9A 3VIVA 1XO6A 4EMPA 1WDLA 4K29A 4YLHA 4JOTA 2ZL4A 5JBXA 4B3JA 2VSUE 2VSUC 4JVTA 2FW2A 2X58A 1K32A 4Q0GA 1RJMA 1PIXA 1OD2A 4JCTA 4QIJA 1FC6A 4F47A 5CTCA 2F9YB 4OMRA 3TDCA 3L3SA 4GHNA 3DORA 4I4ZA 1FC7A 5E0NX 3TZ3A 1XNVA 4K3WA 5DZKA 5G1SA 2J5SA 5MGBA 3V5IA 2ZQQA 3MOYA 5INGA 2Q34A 3G64A 2VSSF 3TVUA 3MFMA 3T3WA 3QK8A 2GTRA 3P85A 1YG6A 3M6MA 4FN8A 3H0UA 3SWXA 3JU1A 2WTBA 3RSTA 4JWVA 1TYFA 2F9IB 4JSBA 4HDTA 1XNYA 3NJBA 3V5EA 4OG1A 4U0GH 4KD6A 3H0QA 5KDRA 4JFCA 3QMJA 4KWBA 2YJGA 3ZW8A 3H81A 3QYRA 4EMLA 3ZWBA 2A7SA 4ZDEA 3N6RB 5C9GA 3U9RB 3BPTA 4ELSA 3FF6A 1UYVA 4ELXA 1OD4A 3T8AA 1UYSA 2A81A 1J7XA 3QKAA 1RJNA 2ZQRA 2VSSA 3OT6A 3TVWA 4B3HA 5E0SA 5DUCA 4Q1IA 3MYBA 2IEXA 3ST9A 3U9TB 3GF7A 4KNPA 1Q51A 3Q7HA 3U9SB 4ZDBA 1FCFA 1NZYB 5G1QA 4RYFA 1SZOA 1UIYA 4U1AA 2CE3A
chains in the Genus database with same CATH topology
4ZDCA 5INIA 2A7KA 2F6QA 3TT7A 1EY3A 4FNDA 4QIIA 5DU4A 2BZRA 4RCNA 1HZDA 3R9QA 5CTBA 1W2XA 1PJHA 4HC8A 1WDKA 5DUFA 2J5II 1Y7OA 2Q35A 3GMAA 4ZU2A 3OMEA 4J2UA 1DCIA 4U0HA 3HP0A 4L6WA 2EJ5A 4OLQA 4HNKA 3R6HA 3BF0A 5DTWA 3P5MA 4RYFH 4IZBA 4LK5A 2ZL2A 4Z0MA 4ASIA 2PPYA 1WZ8A 3WG5A 2DUBA 3GF3A 1ON3A 2HW5A 3GKBA 1SG4A 3P2LA 4NEKA 3RSIA 1VRGA 3HRXA 3H0JA 4JCRA 5DU6A 3GLMA 3QREA 3ZWAA 4U18A 4EMMA 2QQ3A 1Q52A 5FIFA 5C90A 5DL1A 3IBBA 5E0SH 3ZWCA 4FZWC 5INFA 3FDUA 4MI2A 3M6NA 4ZDDA 3H02A 4KPKA 3R9TA 3R0OA 3K50A 2J5IB 3R9SA 3TLFA 5DKPA 1DUBA 3KTIA 3LKEA 2F9IA 4NNQA 1O8UA 3LAOA 4MXIA 2J5GD 1UYTA 4FB8A 5DZKH 4JYJA 1ON9A 1MJ3A 3I47A 3KQFA 5HUQA 4FJWD 3KTKA 4JYLA 4WCZA 2F6IA 4FNBA 3KTHA 4FN7A 3STAA 3QXIA 2J5GA 5KJPA 3QXZA 2VX2A 1N6FA 1HNUA 4ZDFA 3IB9A 2Q2XA 1YG8A 3K8XA 4IZCA 1XX4A 4I42A 4U0GA 3OC7A 3T88A 4WYOB 2F9YA 2ZL0A 2W3PA 3HE2A 3BPPA 3KTGA 1X0UA 4I52A 2VSUA 3DJAA 2ZL3A 2VSUF 1XNWA 4JCQA 3PE8A 3IAVA 4IZDA 3RRVA 2CBYA 3H0SA 5DU8A 3T8BA 1WDMA 3Q1TA 3KTJA 4DI1A 4K2NA 5DTPA 2UZFA 3MT6A 1HNOA 2C8TA 5IKLB 1N6DA 2PG8A 2D3TA 1UYRA 5G1RA 4G2RA 3HLN1 1JXZA 4WZ8B 1NZYA 2X24A 3Q0GA 3ISAA 4L8KA 3TRRA 4B3IA 1EF8A 4JCSA 4JJTA 3HINA 5FUSA 3QWDA 5KDRB 2VSSE 3PEAA 4GM2A 2FBMA 3TV5A 1EF9A 3ZW9A 3TT6A 3SLLA 2NP9A 4ELWA 3NJDA 4MOUA 2FZSA 3Q0JA 4FZWA 2DEOA 3PGQA 3PZKA 4NARA 1K39A 2PBPA 1TG6A 4U19A 3BEZA 4QFEA 3T89A 1N6EA 5JBWA 2J5IA 2VREA 1FC9A 3VIVA 1XO6A 4EMPA 1WDLA 4K29A 4YLHA 4JOTA 2ZL4A 5JBXA 4B3JA 2VSUE 2VSUC 4JVTA 2FW2A 2X58A 1K32A 4Q0GA 1RJMA 1PIXA 1OD2A 4JCTA 4QIJA 1FC6A 4F47A 5CTCA 2F9YB 4OMRA 3TDCA 3L3SA 4GHNA 3DORA 4I4ZA 1FC7A 5E0NX 3TZ3A 1XNVA 4K3WA 5DZKA 5G1SA 2J5SA 5MGBA 3V5IA 2ZQQA 3MOYA 5INGA 2Q34A 3G64A 2VSSF 3TVUA 3MFMA 3T3WA 3QK8A 2GTRA 3P85A 1YG6A 3M6MA 4FN8A 3H0UA 3SWXA 3JU1A 2WTBA 3RSTA 4JWVA 1TYFA 2F9IB 4JSBA 4HDTA 1XNYA 3NJBA 3V5EA 4OG1A 4U0GH 4KD6A 3H0QA 5KDRA 4JFCA 3QMJA 4KWBA 2YJGA 3ZW8A 3H81A 3QYRA 4EMLA 3ZWBA 2A7SA 4ZDEA 3N6RB 5C9GA 3U9RB 3BPTA 4ELSA 3FF6A 1UYVA 4ELXA 1OD4A 3T8AA 1UYSA 2A81A 1J7XA 3QKAA 1RJNA 2ZQRA 2VSSA 3OT6A 3TVWA 4B3HA 5E0SA 5DUCA 4Q1IA 3MYBA 2IEXA 3ST9A 3U9TB 3GF7A 4KNPA 1Q51A 3Q7HA 3U9SB 4ZDBA 1FCFA 1NZYB 5G1QA 4RYFA 1SZOA 1UIYA 4U1AA 2CE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZDC A;  5INI A;  2A7K A;  2F6Q A;  3TT7 A;  1EY3 A;  4FND A;  4QII A;  5DU4 A;  2BZR A;  4RCN A;  1HZD A;  3R9Q A;  5CTB A;  1W2X A;  1PJH A;  4HC8 A;  1WDK A;  5DUF A;  2J5I I;  1Y7O A;  2Q35 A;  3GMA A;  4ZU2 A;  3OME A;  1DCI A;  4U0H A;  3HP0 A;  4L6W A;  2EJ5 A;  4OLQ A;  4HNK A;  3R6H A;  3BF0 A;  5DTW A;  3P5M A;  4RYF H;  4IZB A;  4LK5 A;  2ZL2 A;  4Z0M A;  4ASI A;  2PPY A;  1WZ8 A;  3WG5 A;  2DUB A;  3GF3 A;  1ON3 A;  2HW5 A;  3GKB A;  1SG4 A;  3P2L A;  4NEK A;  3RSI A;  1VRG A;  3HRX A;  3H0J A;  4JCR A;  5DU6 A;  3GLM A;  3QRE A;  3ZWA A;  4U18 A;  4EMM A;  2QQ3 A;  1Q52 A;  5FIF A;  5C90 A;  5DL1 A;  3IBB A;  5E0S H;  3ZWC A;  4FZW C;  5INF A;  3FDU A;  4MI2 A;  3M6N A;  4ZDD A;  3H02 A;  4KPK A;  3R9T A;  3R0O A;  3K50 A;  2J5I B;  3R9S A;  3TLF A;  5DKP A;  1DUB A;  3KTI A;  3LKE A;  2F9I A;  4NNQ A;  1O8U A;  3LAO A;  4MXI A;  2J5G D;  1UYT A;  4FB8 A;  5DZK H;  4JYJ A;  1ON9 A;  1MJ3 A;  3I47 A;  3KQF A;  4FJW D;  3KTK A;  4JYL A;  4WCZ A;  2F6I A;  4FNB A;  3KTH A;  4FN7 A;  3STA A;  3QXI A;  2J5G A;  5KJP A;  3QXZ A;  2VX2 A;  1N6F A;  1HNU A;  4ZDF A;  3IB9 A;  2Q2X A;  1YG8 A;  3K8X A;  4IZC A;  1XX4 A;  4I42 A;  4U0G A;  3OC7 A;  3T88 A;  4WYO B;  2F9Y A;  2ZL0 A;  2W3P A;  3HE2 A;  3BPP A;  3KTG A;  1X0U A;  4I52 A;  2VSU A;  3DJA A;  2ZL3 A;  2VSU F;  1XNW A;  4JCQ A;  3PE8 A;  3IAV A;  4IZD A;  3RRV A;  2CBY A;  3H0S A;  5DU8 A;  3T8B A;  1WDM A;  3Q1T A;  3KTJ A;  4DI1 A;  4K2N A;  5DTP A;  2UZF A;  3MT6 A;  1HNO A;  2C8T A;  5IKL B;  1N6D A;  2PG8 A;  2D3T A;  1UYR A;  5G1R A;  4G2R A;  3HLN 1;  1JXZ A;  4WZ8 B;  1NZY A;  2X24 A;  3Q0G A;  3ISA A;  4L8K A;  3TRR A;  4B3I A;  1EF8 A;  4JCS A;  4JJT A;  3HIN A;  5FUS A;  3QWD A;  5KDR B;  2VSS E;  3PEA A;  4GM2 A;  2FBM A;  3TV5 A;  1EF9 A;  3ZW9 A;  3TT6 A;  3SLL A;  2NP9 A;  4ELW A;  3NJD A;  4MOU A;  2FZS A;  3Q0J A;  4FZW A;  2DEO A;  3PGQ A;  3PZK A;  1K39 A;  2PBP A;  1TG6 A;  4U19 A;  3BEZ A;  4QFE A;  3T89 A;  1N6E A;  5JBW A;  2J5I A;  2VRE A;  1FC9 A;  3VIV A;  1XO6 A;  4EMP A;  1WDL A;  4K29 A;  4YLH A;  4JOT A;  2ZL4 A;  5JBX A;  4B3J A;  2VSU E;  2VSU C;  4JVT A;  2FW2 A;  2X58 A;  1K32 A;  4Q0G A;  1RJM A;  1PIX A;  1OD2 A;  4JCT A;  4QIJ A;  1FC6 A;  4F47 A;  5CTC A;  2F9Y B;  4OMR A;  3TDC A;  3L3S A;  4GHN A;  3DOR A;  4I4Z A;  1FC7 A;  5E0N X;  3TZ3 A;  1XNV A;  4K3W A;  5DZK A;  5G1S A;  2J5S A;  5MGB A;  3V5I A;  2ZQQ A;  3MOY A;  5ING A;  2Q34 A;  3G64 A;  2VSS F;  3TVU A;  3MFM A;  3T3W A;  3QK8 A;  2GTR A;  3P85 A;  1YG6 A;  3M6M A;  4FN8 A;  3H0U A;  3SWX A;  3JU1 A;  2WTB A;  3RST A;  4JWV A;  1TYF A;  2F9I B;  4JSB A;  1XNY A;  3NJB A;  3V5E A;  4OG1 A;  4U0G H;  4KD6 A;  3H0Q A;  5KDR A;  4JFC A;  3QMJ A;  4KWB A;  3ZW8 A;  3H81 A;  3QYR A;  4EML A;  3ZWB A;  2A7S A;  4ZDE A;  3N6R B;  5C9G A;  3U9R B;  4ELS A;  3FF6 A;  1UYV A;  4ELX A;  1OD4 A;  3T8A A;  1UYS A;  2A81 A;  1J7X A;  3QKA A;  1RJN A;  2ZQR A;  2VSS A;  3OT6 A;  3TVW A;  4B3H A;  5E0S A;  5DUC A;  4Q1I A;  3MYB A;  2IEX A;  3ST9 A;  3U9T B;  3GF7 A;  4KNP A;  1Q51 A;  3Q7H A;  3U9S B;  4ZDB A;  1FCF A;  1NZY B;  5G1Q A;  4RYF A;  1SZO A;  1UIY A;  4U1A A;  2CE3 A; 
#chains in the Genus database with same CATH topology
 4ZDC A;  5INI A;  2A7K A;  2F6Q A;  3TT7 A;  1EY3 A;  4FND A;  4QII A;  5DU4 A;  2BZR A;  4RCN A;  1HZD A;  3R9Q A;  5CTB A;  1W2X A;  1PJH A;  4HC8 A;  1WDK A;  5DUF A;  2J5I I;  1Y7O A;  2Q35 A;  3GMA A;  4ZU2 A;  3OME A;  4J2U A;  1DCI A;  4U0H A;  3HP0 A;  4L6W A;  2EJ5 A;  4OLQ A;  4HNK A;  3R6H A;  3BF0 A;  5DTW A;  3P5M A;  4RYF H;  4IZB A;  4LK5 A;  2ZL2 A;  4Z0M A;  4ASI A;  2PPY A;  1WZ8 A;  3WG5 A;  2DUB A;  3GF3 A;  1ON3 A;  2HW5 A;  3GKB A;  1SG4 A;  3P2L A;  4NEK A;  3RSI A;  1VRG A;  3HRX A;  3H0J A;  4JCR A;  5DU6 A;  3GLM A;  3QRE A;  3ZWA A;  4U18 A;  4EMM A;  2QQ3 A;  1Q52 A;  5FIF A;  5C90 A;  5DL1 A;  3IBB A;  5E0S H;  3ZWC A;  4FZW C;  5INF A;  3FDU A;  4MI2 A;  3M6N A;  4ZDD A;  3H02 A;  4KPK A;  3R9T A;  3R0O A;  3K50 A;  2J5I B;  3R9S A;  3TLF A;  5DKP A;  1DUB A;  3KTI A;  3LKE A;  2F9I A;  4NNQ A;  1O8U A;  3LAO A;  4MXI A;  2J5G D;  1UYT A;  4FB8 A;  5DZK H;  4JYJ A;  1ON9 A;  1MJ3 A;  3I47 A;  3KQF A;  5HUQ A;  4FJW D;  3KTK A;  4JYL A;  4WCZ A;  2F6I A;  4FNB A;  3KTH A;  4FN7 A;  3STA A;  3QXI A;  2J5G A;  5KJP A;  3QXZ A;  2VX2 A;  1N6F A;  1HNU A;  4ZDF A;  3IB9 A;  2Q2X A;  1YG8 A;  3K8X A;  4IZC A;  1XX4 A;  4I42 A;  4U0G A;  3OC7 A;  3T88 A;  4WYO B;  2F9Y A;  2ZL0 A;  2W3P A;  3HE2 A;  3BPP A;  3KTG A;  1X0U A;  4I52 A;  2VSU A;  3DJA A;  2ZL3 A;  2VSU F;  1XNW A;  4JCQ A;  3PE8 A;  3IAV A;  4IZD A;  3RRV A;  2CBY A;  3H0S A;  5DU8 A;  3T8B A;  1WDM A;  3Q1T A;  3KTJ A;  4DI1 A;  4K2N A;  5DTP A;  2UZF A;  3MT6 A;  1HNO A;  2C8T A;  5IKL B;  1N6D A;  2PG8 A;  2D3T A;  1UYR A;  5G1R A;  4G2R A;  3HLN 1;  1JXZ A;  4WZ8 B;  1NZY A;  2X24 A;  3Q0G A;  3ISA A;  4L8K A;  3TRR A;  4B3I A;  1EF8 A;  4JCS A;  4JJT A;  3HIN A;  5FUS A;  3QWD A;  5KDR B;  2VSS E;  3PEA A;  4GM2 A;  2FBM A;  3TV5 A;  1EF9 A;  3ZW9 A;  3TT6 A;  3SLL A;  2NP9 A;  4ELW A;  3NJD A;  4MOU A;  2FZS A;  3Q0J A;  4FZW A;  2DEO A;  3PGQ A;  3PZK A;  4NAR A;  1K39 A;  2PBP A;  1TG6 A;  4U19 A;  3BEZ A;  4QFE A;  3T89 A;  1N6E A;  5JBW A;  2J5I A;  2VRE A;  1FC9 A;  3VIV A;  1XO6 A;  4EMP A;  1WDL A;  4K29 A;  4YLH A;  4JOT A;  2ZL4 A;  5JBX A;  4B3J A;  2VSU E;  2VSU C;  4JVT A;  2FW2 A;  2X58 A;  1K32 A;  4Q0G A;  1RJM A;  1PIX A;  1OD2 A;  4JCT A;  4QIJ A;  1FC6 A;  4F47 A;  5CTC A;  2F9Y B;  4OMR A;  3TDC A;  3L3S A;  4GHN A;  3DOR A;  4I4Z A;  1FC7 A;  5E0N X;  3TZ3 A;  1XNV A;  4K3W A;  5DZK A;  5G1S A;  2J5S A;  5MGB A;  3V5I A;  2ZQQ A;  3MOY A;  5ING A;  2Q34 A;  3G64 A;  2VSS F;  3TVU A;  3MFM A;  3T3W A;  3QK8 A;  2GTR A;  3P85 A;  1YG6 A;  3M6M A;  4FN8 A;  3H0U A;  3SWX A;  3JU1 A;  2WTB A;  3RST A;  4JWV A;  1TYF A;  2F9I B;  4JSB A;  4HDT A;  1XNY A;  3NJB A;  3V5E A;  4OG1 A;  4U0G H;  4KD6 A;  3H0Q A;  5KDR A;  4JFC A;  3QMJ A;  4KWB A;  2YJG A;  3ZW8 A;  3H81 A;  3QYR A;  4EML A;  3ZWB A;  2A7S A;  4ZDE A;  3N6R B;  5C9G A;  3U9R B;  3BPT A;  4ELS A;  3FF6 A;  1UYV A;  4ELX A;  1OD4 A;  3T8A A;  1UYS A;  2A81 A;  1J7X A;  3QKA A;  1RJN A;  2ZQR A;  2VSS A;  3OT6 A;  3TVW A;  4B3H A;  5E0S A;  5DUC A;  4Q1I A;  3MYB A;  2IEX A;  3ST9 A;  3U9T B;  3GF7 A;  4KNP A;  1Q51 A;  3Q7H A;  3U9S B;  4ZDB A;  1FCF A;  1NZY B;  5G1Q A;  4RYF A;  1SZO A;  1UIY A;  4U1A A;  2CE3 A; 
#chains in the Genus database with same CATH homology
 4ZDC A;  5INI A;  2A7K A;  2F6Q A;  3TT7 A;  1EY3 A;  4FND A;  4QII A;  5DU4 A;  2BZR A;  4RCN A;  1HZD A;  3R9Q A;  5CTB A;  1W2X A;  1PJH A;  4HC8 A;  1WDK A;  5DUF A;  2J5I I;  1Y7O A;  2Q35 A;  3GMA A;  4ZU2 A;  3OME A;  4J2U A;  1DCI A;  4U0H A;  3HP0 A;  4L6W A;  2EJ5 A;  4OLQ A;  4HNK A;  3R6H A;  3BF0 A;  5DTW A;  3P5M A;  4RYF H;  4IZB A;  4LK5 A;  2ZL2 A;  4Z0M A;  4ASI A;  2PPY A;  1WZ8 A;  3WG5 A;  2DUB A;  3GF3 A;  1ON3 A;  2HW5 A;  3GKB A;  1SG4 A;  3P2L A;  4NEK A;  3RSI A;  1VRG A;  3HRX A;  3H0J A;  4JCR A;  5DU6 A;  3GLM A;  3QRE A;  3ZWA A;  4U18 A;  4EMM A;  2QQ3 A;  1Q52 A;  5FIF A;  5C90 A;  5DL1 A;  3IBB A;  5E0S H;  3ZWC A;  4FZW C;  5INF A;  3FDU A;  4MI2 A;  3M6N A;  4ZDD A;  3H02 A;  4KPK A;  3R9T A;  3R0O A;  3K50 A;  2J5I B;  3R9S A;  3TLF A;  5DKP A;  1DUB A;  3KTI A;  3LKE A;  2F9I A;  4NNQ A;  1O8U A;  3LAO A;  4MXI A;  2J5G D;  1UYT A;  4FB8 A;  5DZK H;  4JYJ A;  1ON9 A;  1MJ3 A;  3I47 A;  3KQF A;  5HUQ A;  4FJW D;  3KTK A;  4JYL A;  4WCZ A;  2F6I A;  4FNB A;  3KTH A;  4FN7 A;  3STA A;  3QXI A;  2J5G A;  5KJP A;  3QXZ A;  2VX2 A;  1N6F A;  1HNU A;  4ZDF A;  3IB9 A;  2Q2X A;  1YG8 A;  3K8X A;  4IZC A;  1XX4 A;  4I42 A;  4U0G A;  3OC7 A;  3T88 A;  4WYO B;  2F9Y A;  2ZL0 A;  2W3P A;  3HE2 A;  3BPP A;  3KTG A;  1X0U A;  4I52 A;  2VSU A;  3DJA A;  2ZL3 A;  2VSU F;  1XNW A;  4JCQ A;  3PE8 A;  3IAV A;  4IZD A;  3RRV A;  2CBY A;  3H0S A;  5DU8 A;  3T8B A;  1WDM A;  3Q1T A;  3KTJ A;  4DI1 A;  4K2N A;  5DTP A;  2UZF A;  3MT6 A;  1HNO A;  2C8T A;  5IKL B;  1N6D A;  2PG8 A;  2D3T A;  1UYR A;  5G1R A;  4G2R A;  3HLN 1;  1JXZ A;  4WZ8 B;  1NZY A;  2X24 A;  3Q0G A;  3ISA A;  4L8K A;  3TRR A;  4B3I A;  1EF8 A;  4JCS A;  4JJT A;  3HIN A;  5FUS A;  3QWD A;  5KDR B;  2VSS E;  3PEA A;  4GM2 A;  2FBM A;  3TV5 A;  1EF9 A;  3ZW9 A;  3TT6 A;  3SLL A;  2NP9 A;  4ELW A;  3NJD A;  4MOU A;  2FZS A;  3Q0J A;  4FZW A;  2DEO A;  3PGQ A;  3PZK A;  4NAR A;  1K39 A;  2PBP A;  1TG6 A;  4U19 A;  3BEZ A;  4QFE A;  3T89 A;  1N6E A;  5JBW A;  2J5I A;  2VRE A;  1FC9 A;  3VIV A;  1XO6 A;  4EMP A;  1WDL A;  4K29 A;  4YLH A;  4JOT A;  2ZL4 A;  5JBX A;  4B3J A;  2VSU E;  2VSU C;  4JVT A;  2FW2 A;  2X58 A;  1K32 A;  4Q0G A;  1RJM A;  1PIX A;  1OD2 A;  4JCT A;  4QIJ A;  1FC6 A;  4F47 A;  5CTC A;  2F9Y B;  4OMR A;  3TDC A;  3L3S A;  4GHN A;  3DOR A;  4I4Z A;  1FC7 A;  5E0N X;  3TZ3 A;  1XNV A;  4K3W A;  5DZK A;  5G1S A;  2J5S A;  5MGB A;  3V5I A;  2ZQQ A;  3MOY A;  5ING A;  2Q34 A;  3G64 A;  2VSS F;  3TVU A;  3MFM A;  3T3W A;  3QK8 A;  2GTR A;  3P85 A;  1YG6 A;  3M6M A;  4FN8 A;  3H0U A;  3SWX A;  3JU1 A;  2WTB A;  3RST A;  4JWV A;  1TYF A;  2F9I B;  4JSB A;  4HDT A;  1XNY A;  3NJB A;  3V5E A;  4OG1 A;  4U0G H;  4KD6 A;  3H0Q A;  5KDR A;  4JFC A;  3QMJ A;  4KWB A;  2YJG A;  3ZW8 A;  3H81 A;  3QYR A;  4EML A;  3ZWB A;  2A7S A;  4ZDE A;  3N6R B;  5C9G A;  3U9R B;  3BPT A;  4ELS A;  3FF6 A;  1UYV A;  4ELX A;  1OD4 A;  3T8A A;  1UYS A;  2A81 A;  1J7X A;  3QKA A;  1RJN A;  2ZQR A;  2VSS A;  3OT6 A;  3TVW A;  4B3H A;  5E0S A;  5DUC A;  4Q1I A;  3MYB A;  2IEX A;  3ST9 A;  3U9T B;  3GF7 A;  4KNP A;  1Q51 A;  3Q7H A;  3U9S B;  4ZDB A;  1FCF A;  1NZY B;  5G1Q A;  4RYF A;  1SZO A;  1UIY A;  4U1A A;  2CE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...