5KEJA

Crystallographic structure of the tau class glutathione s-transferase migstu in complex with s-hexyl-glutathione
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
222
structure length
222
Chain Sequence
AKSDVKLLGAWPSPYVMRARITLNVKSVDYELLEETLGSKSDLLLKSNPVHKKIPVLIHNDKPICESLIIVHYIDEFWSSGPSILPSDPYDRAIARFWAAYLDEKWYPSLKGIASAQGEEAKKAAVDQVGESLALIEDTYVKLSKGKPFFGGEKIGYLDIAFGCFLGWLRVTEKTSGVKFLNEAKTPHLAKWAVRFCADPAVKDVMPETEKLAEFAKLLAKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tau class glutathione S-transferase
publication title Insights into ligand binding to a glutathione S-transferase from mango: Structure, thermodynamics and kinetics.
pubmed doi rcsb
source organism Mangifera indica
molecule tags Transferase
total genus 75
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2016-06-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 5kejA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kejA01
4TN8A 4XS6A 3TJJA 1GLQA 4F2IA 4ECBA 2OE3A 3APOA 1HNBA 5FT3A 2YN1A 4O92A 1TK8B 5DBQA 1K3LA 3FEUA 1AIUA 6GSYA 3W6GA 2GZZA 4EUYA 1HNCA 4K9ZA 3TKQA 3F3RA 1O73A 2DLXA 12GSA 1VF4A 2GLRA 3FZ4A 5B7CA 4L5OA 4IJIA 5E59A 4IJ3A 4H86A 1YF0A 5ECOB 2RLIA 3CYNA 4ZBBA 2L6DA 4POKA 2G0FA 3LYPA 1GSEA 3GH6A 4HS1A 1TRVA 1DE1A 5ID2A 1A24A 2GVPA 2REMA 2H01A 5ECHB 3JCML 4FYBA 4WKWA 5IPGA 3EURA 2XPEA 5F06A 3ZIVA 3ZZXA 4MDCA 2HRNA 2OADA 3HHVA 3ISOA 3KJYA 1R5AA 5DQYA 1T8EB 5A4VA 1BJXA 3P7XA 4IELA 5ENUA 4IW9A 1TW9A 5GAPD 1X5DA 3KD0A 3IBHA 3WD6A 4HZ4A 5AN1A 1BX9A 1Z3EA 2B3SA 3NOFA 5F07A 5ABRA 4L0UA 5EY6A 4J2FA 1TI1A 4POLA 2H1BA 2HSNB 3GH9A 4EDZA 2HRAA 3VLNA 4DEJA 5DCHA 2ZCTA 4K0GA 3TJBA 2YNXA 2E7PA 2CX3A 3LSZA 4USSA 3Q6OA 3O6TA 4NMUA 1FOVA 2JADA 2I3YA 2K8SA 1JZRA 1AXDA 5J4UA 18GSA 2I9HA 2X64A 6GSVA 1U3AA 1XBSA 2VUPA 1PA3A 2MMAA 2N5BA 3VURA 4WR5A 2YJ7A 1ZOFA 5F8BA 3UBKA 3KCMA 1SYXA 3FZ9A 2H1GA 3C8EA 3TRQA 5HR1A 5GSSA 4TKYA 3GFKA 2O7KA 4GSTA 5J41A 1J08A 4KB3A 5DDLA 1AW9A 2GSTA 1A2MA 1W89A 2PGTA 1IYHA 3ZMLA 5HR3A 4G0LA 4GRFA 5ECRB 1W4VA 3QFAC 3UL3A 1M0UA 5JWQB 1Z6NA 5ECNB 1HYUA 4E8HA 4OFTA 1EP7A 1SJZA 4ID0A 4KSMA 2PVQA 1YQ1A 1MD3A 2YPMA 1H75A 3J7Yb 1GSFA 1JZWA 3RPPA 1EV4A 3GKKA 1WIKA 2VLVA 4PUAA 3I9V2 1OC9B 3HJOA 8GSSA 4MJEA 1ACVA 2HSMB 5A4UA 2Z9SA 1A2LA 1TJDA 1B48A 4BA7A 3CSHA 4X0XA 2H0HA 2LV3A 3BCKA 2L59A 2CX4A 4XS4A 4V2MA 4F0BA 1KTEA 5B6MA 3H79A 5COHA 2V32A 1F2EA 5ECQB 2LQQA 1ZYEA 4L5LA 2GQLA 4AGSA 5CYYA 4MJAA 1Z7PA 2HQTA 3KTBA 4WXTA 5CP1A 3TKSE 5HQPA 2I81A 1J0FA 3G7IA 1LU4A 5G1KA 4CHSA 1F6MC 1GLPA 2OE0A 4AJ6A 1NSWA 3GL5A 3UIWA 4I5QA 3ZFBA 2VCVA 5AIVA 2FWHA 1WOUA 4I8BA 5DALA 3CBUA 5D73A 3QOUA 1ON4A 1AQXA 1U6TA 3I43A 1YEXA 1ABAA 2OBIA 3IA1A 2LTKA 2IMFA 1XWKA 2YV7A 2F9SA 5B6NA 5H5SA 1ZMAA 1FG4A 5ELAA 2KLXA 3UBLA 2LUSA 2IN3A 1OC8A 3IRAA 5BMUA 3CSIA 3FYGA 5CRHA 5IO0A 4MH2A 4TR1A 1TP9A 2R2JA 1PRXA 3L9SA 2YANA 3TGZA 4LMWA 4F82A 2BTOT 4XTSA 3HY2A 2XBQA 5DQSA 2X99A 2IFQB 4EC0A 1T1VA 5DAKB 3BJ5A 3ZREA 3IXRA 1JFUA 4NAXA 3QDNA 1MEKA 3CXGA 2RUEA 2HRFA 4MMMA 3UVTA 4HUAA 2JU5A 1ST9A 3FY7A 2NTOA 3GUSA 2LQOA 5JWOB 2OKAA 2AUVA 1ZYQB 4FIWA 4AF2A 3QCPA 4MZBA 1GTBA 2WS2A 1ML6A 2VL2A 1BYEA 1XWBA 2FGXA 2B7JA 4KGIA 2HLSA 1EP8A 6GSXA 3ZLPA 2FHEA 3MDKA 4EDYA 4XHMA 2E2MA 10GSA 1M2BA 4ZILA 2H73A 2RM5A 4WF4A 2C3QA 4LA1A 4OO4A 1TK5B 1XWCA 5DVBA 3CSJA 3UEMA 3ZL5A 1O7UA 3BBYA 1T7PB 4F03A 3GKXA 1A8YA 3HD5A 3US3A 2C4JA 3HZ8A 5G31A 2EIQA 1XFLA 1X9WB 2E2GA 3H1NA 4MABA 4Q5FA 2IJYA 4LLRA 1TXXA 1QK8A 2AV4A 3FZAA 4TXOB 5A5KA 3IK7A 1GRXA 2FCHA 2O89A 3EU3A 5KN1A 4HZ2A 1S3CA 3F0IA 2FWEA 1OVNA 1I9DA 3D0ZA 2HZFA 2PVOC 1PN9A 3WGDA 13GSA 4RI7A 1PL2A 2NBSA 2PBJA 5ECLB 2XC2A 3GURA 4FQUA 1RQMA 3DVXA 1SD8A 1A8LA 2HSHA 3DYRA 4DSSB 3QR6A 4PQIA 3MWHA 2VD1A 4KDXA 4QQ7A 2GT6A 3WT2A 4WBJA 3KH9A 3M9KA 5D96A 2CT6A 3RHCA 2MBSA 2C3NA 4RQXA 1FVJA 4K0NA 5KN3A 4KCAA 1F37A 4XS4B 1XOBA 5AISA 3R2QA 2P5RA 1ZGNA 3C71A 2JZSA 2WFCA 2FWGA 2FA4A 1WMJA 2AJQB 3TKRA 2NDOA 4JU5A 2IMIA 3D4TA 5KN2A 2VLUA 3U6VA 4QL9A 1GTIA 5GZZB 3FR6A 1JZDA 3G9BA 3FHKA 4KW6A 3GMFA 3RAZA 1HQOA 2MYGA 3QAVA 2EIRA 4EF0A 1OKDA 4YAPA 2WZ9A 2CZ2A 1YZXA 5E4WA 3DGQA 2L4QA 3CRUA 1PKWA 2HT9A 4HU9A 1EEMA 1M99A 1LBKA 2UZ8A 3TOUA 2CVDA 2DJKA 4PUFC 4HOJA 4NV2A 4YAVA 2H6XA 2HSMA 2VM1A 4MP4A 1K3YA 5A4WA 4K8MA 1QFNA 4POBA 3IV4A 4X1UA 1FAAA 2PWJA 3GKNA 4GF0A 2MMZA 4I97A 4KAEA 5F0GA 1TK0B 4NPBA 4FH8A 4GQCA 3DXBA 5CRDA 4MPGA 4TW5A 2I1UA 2PU9C 1X0RA 1QMVA 4YQVA 2YWMA 5G30A 4ZL8A 2H70A 1IYIA 4OO5A 2WB9A 1A0RP 4OD7A 3M3MA 3A3TA 5D9VA 1XW5A 2M46A 1SU9A 2V41A 3LG6A 3A2WA 1MTCA 3A5WA 1SD9A 2WDUA 3LEFA 1GUKA 4GQFA 1Z7RA 1TRSA 3EVIA 6GSWA 3IAS2 1WP0A 3QAGA 1GNWA 5G5FA 1ZZYA 4WBRD 2OA7A 2HZEB 2NPBA 3F4SA 4HJMA 1ERVA 2WRTA 3CRTA 4PURA 3F3QA 4JBBA 3F6DA 1OE8A 3MNGA 1B8XA 5D93A 4HEA2 3QFBC 1TI3A 1GSUA 1G7EA 4MF7A 2WGRA 2YZUA 3KXOA 2VM2A 3PH9A 3S9FA 2FY6A 1AUCA 4HDEA 4P3YB 4LL4B 4JE1A 2PERA 3H4KA 2IFQA 1TRWA 5DAKA 1X9MB 4O5RA 4G19A 1X5EA 1XW6A 3BOAA 3P90A 3LWAA 1FO5A 4F9ZA 4DSRA 2OACA 1THXA 2GZPA 1MDKA 1RW1A 4I2UA 1QQ2A 3FK8A 2CA8A 4TR3A 4MJBA 5ECMB 4IP6A 2H71A 1VRSD 3TKSA 4AJ7A 3C73A 3D22A 5HR2A 1R26A 2J23A 1G6WA 4CW9A 3W8JA 2B7KA 2R37A 1RK4A 1EGRA 5FHIA 4E8EA 1AAZA 2ES7A 4MLYA 3ZITA 3TKSC 3RHBA 1FB6A 5CRGA 4FO5A 3GL3A 1KEBA 4KSOA 2H6YA 3KP9A 5C04A 4KNDA 2LJRA 1GWCA 3RPNA 1PX7A 4TRXA 2DJ3A 3SBCA 3GRXA 3N5OA 2YP6A 3KM6A 1ERUA 3D4MA 4TXOA 4L8EA 4NHZA 3HKRA 4ECIA 1QXHA 1FVKA 3M9JA 3IAM2 3PPUA 4YQUA 4TVEA 2OJLA 2PUKC 1FB0A 1SK2A 3V1WA 2CVBA 2E0QA 2NVLA 5EL8A 1MDIA 4DSSA 4ECJA 2VCTA 4IVFA 1X5CA 1GTUA 4G9HA 3GX0A 3K8NA 4PNFA 19GSA 3E0UA 5KN0A 3FR9A 5HFGA 2G2QA 3F4RA 3KGKA 4WEYA 1SK0A 3VWUA 1OYJA 2O8VB 1XCCA 2IMKA 4ILFA 1N2AA 3VFIA 2LRNA 1GH2A 3GX8A 1YEPA 1BAYA 2GTUA 6GSTA 4XCSA 1X9SB 3ZIJA 3PINA 1EWXA 2ON7A 1GNEA 2H19A 3P8WA 1PQNA 2O87A 2VL3A 2DC5A 3L0HA 1O81A 4TOPA 2O85A 4JRRA 2QC7A 2AHEA 1Z9HA 5ECPB 2YCDA 2B5EA 3CTGA 3IR4A 1XVQA 4PQ1A 5KEJA 2OE1A 1PGTA 2B5YA 4ML6A 2DIZA 5D9WA 5LNKe 3TRPA 3TRXA 2HSYA 3HVXA 1K0NA 1GUMA 3DEXA 4IHUA 3E9JB 3LXZA 2V6KA 3HJMA 1ILOA 3GSTA 2IIYA 1DUGA 1B9YC 3UVHA 2L5LA 2H76A 4RQRA 5AGYA 2F3MA 1PMTA 5J9BA 4PXOA 1WWJA 4ISDA 1PSQA 2H1DA 3IK9A 1OC3A 4HQZA 5AIXA 1F3BA 1BEDA 4BWQA 4NWYA 4MF6A 1TDIA 4GCIA 3HA9A 1K0CA 3ZYWA 1SL0B 2DJ1A 3F8UA 4MZCA 2OBKA 2FA8A 3QPMA 1A0FA 2FWFA 2F8FA 3HCZA 4MH3A 4POMA 3KMOA 1PD21 5H5QA 2LRTA 1M9AA 2FUG2 1R4WA 2QKEA 4BVYB 4IN0A 4TR4A 3OR5A 2HFDA 5D8IA 2RM6A 5IMCA 4K6XA 2KP2A 3GA4A 4OCEA 1QUWA 2K9FA 1SYRA 2HZEA 4RI6A 3FZ5A 22GSA 3GN3A 1E2YA 2B5XA 3M0FA 1Y25A 3P2AA 4K1FA 1PX6A 1Q4JA 1LJRA 3UOMA 3NIVA 5IOWA 1TOFA 4ZB6A 2VL2C 3L9VA 3F63A 2BJXA 3DKSA 5ECSA 1NHYA 4MA9A 3LJRA 3LQ7A 2GSRA 1EOGA 2K8VA 5DJLA 3HJPA 2YWOA 4EXJA 2VCWA 2KUCA 2GQKA 4PQHA 1K0BA 2M80A 2GZYA 5G2ZA 1B9XC 1KBNA 1QGVA 4NHWA 2CAQA 2H66A 3DMLA 1VF1A 3WYWA 5J5NA 2AAWA 1VF2A 4G2EA 1YKAA 5IPHA 3KIJA 4IQ1A 3TCOA 4Q5QA 1SKRB 4ML1A 1V9WA 4GTUA 4L0WA 1CQHA 2LJAA 3TUEA 3GTUA 4XRAA 2QGVA 2LNSA 4TR0A 5IOXA 5IM9A 1XWGA 4FYCA 3EC3A 2H0IA 4K7IA 4K2DA 4KDYA 5HFKA 4G0IA 1S3DA 2PN8A 3APSA 4ZBDA 2DJ2A 3DRNA 2L4CA 3KP8A 4XRDA 1XPVA 1V98A 2IPAA 2WJUA 1V57A 2I4AA 4EO3A 3RBTA 2H72A 4EL1A 1SL2B 2L6CA 3FR3A 2GDRA 11GSA 1NM3A 5INYA 3L9UA 3LYKA 5B8BA 4GWRA 4WF5A 1SKSB 4IQAA 2YWNA 4K7NA 1O8WA 4HI7A 2GSSA 3ERWA 3EINA 2GQMA 2L57A 3KZQA 1BG5A 3ME7A 3E3EA 3ZTLA 1UC7A 1WRYA 4MZWA 1M2AA 3H93A 16GSA 2JZTA 4KCEA 3FKFA 6GSUA 1EZKA 4WR4A 2QSIA 3C1SA 2YJHA 4HU7A 4QL7A 7GSSA 4GLTA 3C7MA 1VF3A 3TJGA 5FWGA 5ELGA 3GSSA 4BPYA 4YQMA 4F0CA 2R6KA 3J7Yk 3IDVA 4ACSA 2H75A 2DJJA 2MMOA 2C0DA 2X8CA 3D6IA 2TRXA 5IQYA 1JHBA 1YKCA 4FYUA 4HQSA 4CDOA 4N10A 3TKPA 1ERTA 5ECIB 1J9BA 1PL1A 3W8SA 3UAPA 1K0OA 2V1MA 3HYPA 4KF9A 1R5PA 2MMNA 5CNWA 3ZVJA 3M8NA 2H8LA 1OE7A 6GSSA 2JZRA 2HRKB 4GSNA 2C0GA 1GSQA 1TRUA 5ECKB 4LMVA 2CQ9A 1U88A 5F05A 1SL1B 4LL1B 3M1GA 1SK1A 1XOAA 2C0EA 2RUFA 3EYTA 5JWRB 1B4PA 2H30A 3GYKA 5JCGA 4EVMA 2YWIA 1TKDB 4NV5A 3A2VA 4OMVA 3VWWA 3UMAA 2X8HA 4JEDA 1JLWA 5IMZA 1F3AA 4IBPA 1O8XA 4RUVA 2WCIA 4KH7A 3TDGA 1HD2A 4ZB8A 2ALBA 20GSA 3VWXA 3H8QA 2IMEA 1CQGA 2XBIA 3IOSA 1U87A 2VD0A 5HFIA 4G0KA 4BVYA 4JR6A 1C72A 2M72A 4ECCA 1Q98A 2R4VA 2LKUA 4BVXA 2FLSA 4V2LA 3N9JA 2P0GA 3IC4A 2VL9A 4OFNA 4ZB9A 2EC4A 3HZ4A 4IS0A 2H74A 3EWLA 3DVWA 1THOA 3WGEA 4XS1A 2RIIA 1K0MA 4BWSA 3QD9A 3GTUB 4ZIJA 1ERWA 3TJKA 4ZL9A 4Q5NA 2C1YA 1GSYA 3ZFLA 5EPFA 1XWAA 4MPFA 2K18A 5D9TA 5DCGA 4KA0A 2DIYA 2ZUPA 2CV4A 2YV9A 9GSSA 2B1LA 1ZL9A 3ZMKA 2GT5A 3LXTA 4OWYA 3KTLA 1T00A 2P31A 2A4VA 1N8JA 1T4ZA 2LJKA 4V2NA 2VIMA 3PGTA 3TB2A 5IIZA 1GULA 3CMIA 4BL7B 5J3RA 3VI5A 3DIEA 4V1Ag 3KMNA 2HNLA 2XHFA 3GNJA 1OAZA 1G6YA 1XIYA 4V1Ap 2A2SA 3BD2A 3L4NA 3ERGA 4JR4A 2DBCA 2A2RA 2IWTA 4D73A 3LORA 5L71A 3IHQA 1MDJA 2YOIA 3HDCA 4NXIA 3VK9A 1BQ7A 1KNGA 3C1RA 3FW2A 3ZVJD 1FHEA 3O76A 2R3XA 2TIRA 1GL8A 2DJ0A 4IP1A 4MJCA 3R3EA 4PX1A 2GSQA 3GIXA 2CAIA 1T4YA 2P5QA 2C0FA 1M9BA 3MSZA 4DSQA 2F8AA 1B4QA 1FW1A 1UN2A 1DSBA 4KE3A 3VI7A 2AYTA 14GSA 4KUNA 1EOHA 2KHPA 2V6OA 3QAWA 17GSA 4IGJA 2KOKA 1YDKA 2K6VA 3GV1A 3LFLA 5LD0A 3EE2A 1PKZA 1Y6EA 4AJ8A 1O6JA 1XW9A 4GXZA 4YH2A 1A2JA 4J57E 1TU7A 3U5RE 1SENA 1URMA 5CRWA 3D5JA 2IL3A 1V58A 2GS3A 3HXSA 4ZBAA 1G0TA 2N5FA 2VLTA 3Q19A 4WETA 4TXVA 3MAKA 2CVKA 2JL4A 1MD4A 1AQWA 2ON5A 3I69A 2LS5A 2VCXA 5ID2B 2H0GA 1JLVA 4MK3A 4ZL7A 1S3AA 5JCUA 1NW2A 4GSSA 4G10A 3SWLA 1R7HA 3GKMA 2JACA 2HXKA 5CO3A 4HJ2A 3L78A 4OCFA 5EVOA 4N0ZA 3GHAA 4EKZA 4BVXB 4O32A 2HRKA 5IMVA 4ZXGA 5J9CA 3AY8A 5HR0A 1YY7A 3VWVA 5G5EA 1YF1A 3WGXA 2WULA 2B1KA 5JCWA 3KH7A 1O85A 3QMXA 2H1AA 2N5AA 2HE3A 3F9UA 1XZOA 5IMFA 3G7JA 1I5GA 2LRCA 3EMXA 1Z6MA 2AB6A 3HVVA 3KEBA 4I2TA 1TU8A 1WPIA 1GUHA 2D2ZA 1GSSA 2IMDA 3UJ1A 3ME8A 2VCQA 2H6ZA 1G7OA 2JSZA 1VGLA 1SJ6A 3APQA 3Q74A 2HYXA 4N0VA 2F51A 2J9HA 2HI7A 2L5OA 3IE3A 3NZNA 1GP1A 4O7HA 1V40A 3CTFA 3VPTA 5IO2A 2VAFA 3O3TA 2LNTA 3FRCA 3DWVA 3PR8A 4KDUA 2DMLA 1UVZA 2KP1A 4K7OA 2VCZA 3F6FA 4J56E 4PGTA 2ZNMA 5CAXA 5GSTA 3ZRDA 2C80A 5CREA 4D73B 3RDWA 4KX4A 2FD3A 4MF5A 1F9MA 5D9XA 2B6MA 2JSYA 5H5RA 3TJFA 1DBYA 4N11A 2FNOA 2DMMA 1EGOA 4XIHA 3A2XA 1V2AA 1E6BA 3ED3A 1AQVA 2VO4A 1GSDA 3Q18A 1DE2A 3IC8A 2EIOA 4PTSA 2PMTA 2YZHA 3D21A 2X8GA 4Z7XA 1M2DA 1M7TA 4DVCA 5C00A 4EE0A 4MCUA 3HVSA 4BL7A 4N30A 3EMPA 1UA5A 2MBTA 1K0DA 5B8AA 4JZQA 2LSTA 1WE0A 2PPTA 1GTAA 2DSAA 5G1LA 2R5GA 2V2GA 3F4TA 2CZ3A 3G7YA 1H4OA 2VOCA 2LEGA 2C8UA 5LCZA 1SJIA 1T3BA 3UARA 1U3IA 1K0AA 3I6AA 5DALB 2BMXA 1JZOA 3BCIA 3DD3A 3EU4A 1EV9A 1ZCPA 3IPZA 4PNGA 1A23A 3ERFA 2XPDA 5IMDA 1XVWA 5DJMA 1USBA 1XXUA 3TOTA 1OC9A 3VPQA 4OFMA 1HNAA 5IMAA 3WT1A 4X43A 1NHOA 5GAND 1K3OA 4ULXA 1WJKA 1AC1A 4TR1B 1OKTA 4IKHA 3LGCA 1TTZA 2TRCP 1EEJA 1YJ6A 4I6XA 2GGTA 1Z5YE 2C3TA 4Q5RA 1SKWB 2MZCA
chains in the Genus database with same CATH superfamily
4TN8A 4XS6A 3TJJA 1GLQA 4F2IA 2WW1A 4ECBA 2OE3A 3APOA 1HNBA 5FT3A 2YN1A 4O92A 1TK8B 5DBQA 1K3LA 3FEUA 1AIUA 6GSYA 3W6GA 2GZZA 4EUYA 1HNCA 4K9ZA 3TKQA 3F3RA 1Y1UA 1O73A 2DLXA 12GSA 1VF4A 2GLRA 3FZ4A 5B7CA 4L5OA 4IJIA 5E59A 4IJ3A 4H86A 1YF0A 4W66A 5ECOB 2RLIA 3CYNA 4ZBBA 2L6DA 4POKA 2G0FA 3LYPA 1GSEA 3GH6A 4HS1A 1TRVA 1DE1A 5ID2A 1A24A 2GVPA 2REMA 2H01A 5ECHB 3JCML 2QA2A 4FYBA 4WKWA 5IPGA 3EURA 2XPEA 5F06A 3ZIVA 3ZZXA 4MDCA 2HRNA 2OADA 3HHVA 1M3JA 3ISOA 3KJYA 2WZSA 1R5AA 5DQYA 1T8EB 5A4VA 1BJXA 3P7XA 4IELA 5ENUA 4IW9A 1TW9A 5GAPD 1X5DA 3KD0A 3IBHA 3WD6A 4HZ4A 5AN1A 1BX9A 4QMKA 1Z3EA 2B3SA 3NOFA 5F07A 5ABRA 4L0UA 5EY6A 4J2FA 1TI1A 4POLA 2H1BA 2HSNB 3GH9A 4EDZA 2HRAA 3VLNA 4DEJA 5DCHA 2ZCTA 4K0GA 3TJBA 3HMJG 2YNXA 2E7PA 2CX3A 3LSZA 4USSA 3Q6OA 3O6TA 4NMUA 1FOVA 2JADA 2I3YA 2K8SA 1JZRA 1AXDA 5J4UA 18GSA 2I9HA 2X64A 6GSVA 1U3AA 1BG1A 1XBSA 2VUPA 1PA3A 2MMAA 2N5BA 3VURA 4WR5A 2YJ7A 1ZOFA 5F8BA 3UBKA 1PFOA 3KCMA 1SYXA 3FZ9A 2H1GA 3C8EA 3TRQA 5HR1A 5GSSA 4TKYA 3GFKA 2O7KA 4GSTA 5J41A 1J08A 4KB3A 5DDLA 1AW9A 2GSTA 1A2MA 1W89A 2PGTA 1IYHA 3ZMLA 5HR3A 4G0LA 4GRFA 5ECRB 1W4VA 3QFAC 3UL3A 1M0UA 5JWQB 1Z6NA 5ECNB 1HYUA 4E8HA 4OFTA 1EP7A 1SJZA 4ID0A 4KSMA 2PVQA 1YQ1A 1MD3A 2YPMA 1H75A 3J7Yb 1GSFA 1JZWA 3RPPA 1EV4A 3GKKA 1WIKA 2VLVA 4PUAA 3I9V2 1OC9B 3HJOA 8GSSA 4MJEA 1ACVA 2HSMB 5A4UA 2Z9SA 1A2LA 1TJDA 1B48A 4BA7A 3CSHA 4X0XA 2H0HA 2LV3A 3MYDA 3BCKA 2L59A 2CX4A 4XS4A 1YVLA 4V2MA 4F0BA 1KTEA 5B6MA 3H79A 5COHA 2V32A 1F2EA 5ECQB 2LQQA 1ZYEA 4L5LA 2GQLA 5J40A 4AGSA 5CYYA 4MJAA 1Z7PA 2HQTA 3KTBA 4WXTA 5CP1A 3TKSE 5HQPA 1N25A 2I81A 1J0FA 3G7IA 1LU4A 5G1KA 4CHSA 1F6MC 1GLPA 2OE0A 4AJ6A 1NSWA 3GL5A 3UIWA 4I5QA 3ZFBA 2VCVA 5AIVA 2FWHA 1WOUA 4I8BA 5DALA 3CBUA 5D73A 4K5SA 3QOUA 1ON4A 1AQXA 1U6TA 2O36A 3I43A 1YEXA 1ABAA 2OBIA 3IA1A 2LTKA 2IMFA 1XWKA 2YV7A 2F9SA 5B6NA 5H5SA 1ZMAA 1FG4A 5ELAA 2KLXA 3UBLA 2LUSA 2IN3A 1OC8A 3IRAA 5BMUA 3CSIA 3FYGA 5CRHA 5IO0A 4MH2A 4TR1A 1TP9A 2R2JA 1PRXA 3L9SA 2YANA 3TGZA 4LMWA 4F82A 2BTOT 4XTSA 3HY2A 2XBQA 5DQSA 2X99A 2IFQB 4EC0A 1T1VA 5DAKB 3BJ5A 3ZREA 3IXRA 1SVMA 1JFUA 4NAXA 3QDNA 1MEKA 3CXGA 2RUEA 2HRFA 4MMMA 3UVTA 4HUAA 2JU5A 4Z2RA 1ST9A 3FY7A 2R0PA 2NTOA 3GUSA 2LQOA 5JWOB 2OKAA 2AUVA 1ZYQB 4FIWA 4AF2A 3QCPA 4MZBA 5KOWA 1GTBA 2WS2A 1ML6A 2VL2A 1BYEA 1XWBA 2FGXA 2B7JA 4KGIA 2HLSA 1EP8A 6GSXA 3ZLPA 2FHEA 3MDKA 4EDYA 4XHMA 2E2MA 10GSA 1M2BA 4ZILA 2H73A 3CWGA 2RM5A 4WF4A 2C3QA 4LA1A 4OO4A 1TK5B 1XWCA 2X4AA 5DVBA 3CSJA 3UEMA 3ZL5A 1O7UA 3BBYA 1T7PB 4F03A 3GKXA 1A8YA 3HD5A 3US3A 2C4JA 3LW9A 3HZ8A 4X4JA 5G31A 2EIQA 1XFLA 1X9WB 2E2GA 3H1NA 4MABA 4Q5FA 2IJYA 4LLRA 1TXXA 1QK8A 2AV4A 3FZAA 4TXOB 5A5KA 3A5IA 3IK7A 1GRXA 2FCHA 2O89A 3EU3A 5KN1A 4BIKA 4HZ2A 1S3CA 3F0IA 2FWEA 1OVNA 1I9DA 2EFCA 3D0ZA 2HZFA 2PVOC 2HSNA 1PN9A 3WGDA 13GSA 4RI7A 1PL2A 2NBSA 2PBJA 5ECLB 2XC2A 3GURA 4FQUA 1RQMA 3DVXA 1SD8A 1A8LA 2HSHA 3DYRA 4DSSB 3QR6A 4PQIA 3MWHA 2VD1A 4KDXA 4QQ7A 2GT6A 3WT2A 4WBJA 3KH9A 3M9KA 5D96A 2CT6A 3RHCA 2MBSA 2C3NA 4RQXA 1FVJA 4K0NA 5KN3A 4KCAA 1F37A 4XS4B 1XOBA 5AISA 4O5UA 3R2QA 2P5RA 1ZGNA 3C71A 2JZSA 2WFCA 2FWGA 2FA4A 1WMJA 2AJQB 3TKRA 2NDOA 4JU5A 2IMIA 4PI2C 3D4TA 5KN2A 2VLUA 3U6VA 4QL9A 1GTIA 5GZZB 3FR6A 1JZDA 3G9BA 3FHKA 4KW6A 2UV8G 3GMFA 3RAZA 1HQOA 2MYGA 3QAVA 2EIRA 4EF0A 1OKDA 4YAPA 2WZ9A 2CZ2A 1YZXA 5E4WA 3DGQA 2L4QA 3CRUA 4K5RA 1PKWA 2HT9A 4HU9A 1EEMA 1M99A 1LBKA 2UZ8A 3TOUA 2CVDA 2DJKA 4PUFC 4HOJA 4NV2A 4YAVA 2H6XA 5A1NB 2HSMA 2VM1A 4MP4A 1K3YA 5J4YA 5A4WA 4K8MA 1QFNA 4POBA 3IV4A 4X1UA 2WW3A 2DKIA 1FAAA 2PWJA 2R0CA 3GKNA 4GF0A 2MMZA 4I97A 4KAEA 5F0GA 1TK0B 4NPBA 4FH8A 4GQCA 3DXBA 5CRDA 4MPGA 4TW5A 2I1UA 2EFHA 2PU9C 1X0RA 1QMVA 4YQVA 2YWMA 5G30A 5A5HB 4ZL8A 2H70A 1IYIA 4OO5A 2WB9A 1A0RP 4OD7A 3M3MA 3A3TA 5D9VA 1XW5A 2M46A 1SU9A 2V41A 3LG6A 3A2WA 1MTCA 3A5WA 1SD9A 2WDUA 3LEFA 1GUKA 4GQFA 1Z7RA 1TRSA 3EVIA 6GSWA 3IAS2 1WP0A 3QAGA 1GNWA 5G5FA 1ZZYA 4WBRD 2OA7A 2HZEB 2NPBA 3F4SA 4HJMA 1ERVA 2WRTA 3CRTA 4PURA 3F3QA 4JBBA 3F6DA 1OE8A 3MNGA 1B8XA 5D93A 4FXYP 4HEA2 3QFBC 1TI3A 1GSUA 1G7EA 4MF7A 2WGRA 2YZUA 3KXOA 2VM2A 3PH9A 3CQFA 3S9FA 2FY6A 1AUCA 4HDEA 4P3YB 4LL4B 4JE1A 2PERA 3H4KA 2IFQA 1TRWA 5DAKA 1X9MB 4O5RA 4G19A 1X5EA 1XW6A 3BOAA 3P90A 3LWAA 1FO5A 4F9ZA 4DSRA 2OACA 1THXA 2GZPA 1MDKA 1RW1A 4I2UA 1QQ2A 3FK8A 2CA8A 4TR3A 4MJBA 5ECMB 2DKHA 4IP6A 2H71A 1VRSD 3TKSA 4AJ7A 3C73A 3D22A 5HR2A 1R26A 2J23A 5BRTA 4EIPA 1G6WA 4CW9A 3W8JA 2B7KA 4AKXB 2R37A 1RK4A 1EGRA 5FHIA 2O3EA 4E8EA 1AAZA 2ES7A 4MLYA 3ZITA 3TKSC 3RHBA 2OT3A 1FB6A 5CRGA 4FO5A 4E68A 3GL3A 1KEBA 1BF5A 4KSOA 2H6YA 3KP9A 5C04A 4KNDA 2LJRA 1GWCA 3RPNA 4CY6A 1PX7A 4TRXA 2DJ3A 3SBCA 3GRXA 3N5OA 2YP6A 3KM6A 1ERUA 3D4MA 4TXOA 4L8EA 4NHZA 3HKRA 4ECIA 1QXHA 1FVKA 3M9JA 3IAM2 3PPUA 4YQUA 4TVEA 2OJLA 2PUKC 1FB0A 1SK2A 3V1WA 2CVBA 2E0QA 2NVLA 5EL8A 1MDIA 3TU3B 4DSSA 4ECJA 2VCTA 4IVFA 1X5CA 5J4VA 1GTUA 4G9HA 3GX0A 3K8NA 4PNFA 19GSA 3E0UA 2O5VA 5KN0A 3FR9A 5HFGA 2G2QA 3F4RA 3KGKA 4WEYA 3EPTA 3HVNA 1SK0A 3VWUA 1OYJA 2O8VB 3FMWA 1XCCA 2IMKA 4ILFA 1N2AA 3VFIA 2LRNA 1GH2A 3GX8A 1YEPA 1BAYA 2GTUA 6GSTA 4XCSA 1X9SB 3ZIJA 3PINA 1EWXA 2ON7A 1GNEA 2H19A 3P8WA 1PQNA 2O87A 2VL3A 2DC5A 3L0HA 1O81A 4TOPA 2O85A 4JRRA 2QC7A 2AHEA 1Z9HA 5A34B 5ECPB 2YCDA 2B5EA 3CTGA 3IR4A 1XVQA 4PQ1A 5KEJA 2OE1A 1PGTA 3CHXC 2B5YA 4ML6A 2DIZA 5D9WA 5LNKe 3TRPA 5A1NA 3TRXA 2HSYA 3HVXA 1K0NA 1GUMA 3DEXA 4IHUA 3E9JB 3LXZA 2V6KA 3HJMA 1ILOA 3GSTA 2IIYA 1DUGA 1B9YC 3UVHA 2L5LA 2H76A 4RQRA 5AGYA 2F3MA 1PMTA 5J9BA 4PXOA 1WWJA 4ISDA 1PSQA 2H1DA 3IK9A 1OC3A 4HQZA 5AIXA 1F3BA 1BEDA 4BWQA 4NWYA 4MF6A 2WW2A 1TDIA 4GCIA 5A5HA 3HA9A 1K0CA 3ZYWA 1SL0B 2DJ1A 3F8UA 4MZCA 4PI0C 2OBKA 1YEWC 2FA8A 3QPMA 1A0FA 2FWFA 2F8FA 3HCZA 4MH3A 4POMA 3KMOA 1PD21 5H5QA 2LRTA 1M9AA 2FUG2 1R4WA 2QKEA 4BVYB 4IN0A 4TR4A 3OR5A 2HFDA 4EIQA 5D8IA 2RM6A 5IMCA 4K6XA 2KP2A 3GA4A 4N3ZA 4OCEA 1QUWA 4MNNA 2K9FA 1SYRA 2HZEA 4RI6A 3FZ5A 22GSA 3GN3A 1E2YA 2B5XA 3M0FA 1Y25A 3P2AA 4K1FA 1PX6A 1Q4JA 1LJRA 3UOMA 3NIVA 5IOWA 1TOFA 4ZB6A 2EFDA 2VL2C 3L9VA 3F63A 2BJXA 3DKSA 5ECSA 1NHYA 4MA9A 3LJRA 3LQ7A 2GSRA 1EOGA 4YKGA 2K8VA 5DJLA 3HJPA 2YWOA 4EXJA 2VCWA 2KUCA 2GQKA 4PQHA 1K0BA 2M80A 1XG8A 2GZYA 5G2ZA 1B9XC 1KBNA 1QGVA 4NHWA 2CAQA 2H66A 3DMLA 1VF1A 3WYWA 5J5NA 2AAWA 1VF2A 4G2EA 1YKAA 1ZYNA 5IPHA 3KIJA 4IQ1A 3TCOA 4Q5QA 4ICYA 4ML1A 1SKRB 1V9WA 4GTUA 4L0WA 1CQHA 2LJAA 3TUEA 3GTUA 4XRAA 2QGVA 2LNSA 4TR0A 5IOXA 5IM9A 1XWGA 4GDFA 4FYCA 3EC3A 2H0IA 4K7IA 4K2DA 4KDYA 4PHZC 5HFKA 4G0IA 1S3DA 2PN8A 3APSA 4ZBDA 2DJ2A 3DRNA 2L4CA 3KP8A 4XRDA 1XPVA 1V98A 2IPAA 2WJUA 1V57A 2I4AA 4EO3A 3RBTA 2H72A 4EL1A 1SL2B 2L6CA 3FR3A 2GDRA 11GSA 1NM3A 5INYA 3L9UA 3LYKA 5B8BA 4GWRA 4WF5A 1SKSB 4IQAA 2YWNA 4K7NA 1O8WA 4HI7A 2GSSA 3ERWA 3EINA 2GQMA 2L57A 3KZQA 1BG5A 3ME7A 3E3EA 3ZTLA 1UC7A 1WRYA 4MZWA 2X49A 1M2AA 3H93A 16GSA 2JZTA 4KCEA 3FKFA 6GSUA 1EZKA 4WR4A 2QSIA 3C1SA 2YJHA 4HU7A 4QL7A 7GSSA 4GLTA 3C7MA 1VF3A 3TJGA 5FWGA 5ELGA 3GSSA 4BPYA 4YQMA 4F0CA 2R6KA 3J7Yk 3IDVA 4ACSA 2H75A 2DJJA 2MMOA 2C0DA 2X8CA 2WVXB 3D6IA 2TRXA 5IQYA 1JHBA 1YKCA 4FYUA 4HQSA 4CDOA 4N10A 3TKPA 5A34A 1ERTA 2VKZG 5ECIB 1J9BA 1PL1A 3W8SA 3UAPA 1K0OA 2V1MA 3HYPA 4Z2TA 4KF9A 1R5PA 2MMNA 5CNWA 3ZVJA 3M8NA 2H8LA 1OE7A 6GSSA 2JZRA 2HRKB 4GSNA 2C0GA 1GSQA 1TRUA 5ECKB 4LMVA 2CQ9A 1U88A 5F05A 1SL1B 4LL1B 3M1GA 1SK1A 1XOAA 2C0EA 2RUFA 3EYTA 5JWRB 1TXUA 1B4PA 2H30A 3GYKA 5JCGA 4EVMA 2YWIA 1TKDB 5KOXA 4NV5A 3A2VA 4OMVA 3VWWA 3UMAA 2X8HA 4HSCX 4JEDA 1JLWA 5IMZA 1F3AA 4IBPA 1O8XA 4RUVA 2WCIA 4KH7A 3TDGA 1HD2A 4ZB8A 2ALBA 5J47A 20GSA 3VWXA 3H8QA 2IMEA 3IHGA 4CY8A 1CQGA 2XBIA 3IOSA 1U87A 2VD0A 5HFIA 4G0KA 4BVYA 1C72A 4JR6A 2M72A 4ECCA 1Q98A 2R4VA 2LKUA 4BVXA 2FLSA 4V2LA 3N9JA 2P0GA 3IC4A 2VL9A 4OFNA 4ZB9A 2EC4A 1I1IP 3HZ4A 1ZYPA 4IS0A 2H74A 3EWLA 3DVWA 1THOA 3WGEA 4XS1A 2RIIA 1K0MA 4BWSA 3QD9A 3GTUB 4ZIJA 1ERWA 3TJKA 4ZL9A 4Q5NA 2C1YA 1GSYA 2H1LA 3ZFLA 5EPFA 1XWAA 4MPFA 2K18A 5D9TA 5DCGA 4KA0A 2DIYA 2ZUPA 2CV4A 2YV9A 9GSSA 2B1LA 1ZL9A 3ZMKA 2GT5A 3LXTA 4AKGA 4OWYA 3KTLA 1T00A 2P31A 2A4VA 1N8JA 1T4ZA 4AKHA 2LJKA 4V2NA 2VIMA 3PGTA 3TB2A 5IIZA 1GULA 3CMIA 4BL7B 5J3RA 3VI5A 3MIXA 3DIEA 4V1Ag 3KMNA 2HNLA 2XHFA 3GNJA 1OAZA 1G6YA 1XIYA 4AKIA 4V1Ap 2A2SA 3BD2A 3L4NA 3ERGA 4JR4A 2DBCA 2A2RA 2IWTA 4D73A 3LORA 5L71A 3IHQA 1MDJA 2YOIA 3HDCA 4NXIA 3VK9A 1BQ7A 1KNGA 3C1RA 3FW2A 3ZVJD 1FHEA 3O76A 2R3XA 2TIRA 1GL8A 2DJ0A 4IP1A 4MJCA 3R3EA 1S4BP 4PX1A 2GSQA 3GIXA 2CAIA 1T4YA 2P5QA 2C0FA 1M9BA 4ZB7A 3MSZA 4DSQA 2F8AA 1B4QA 1FW1A 1PN0A 1UN2A 2A2PA 1DSBA 4YKFA 4KE3A 3VI7A 2AYTA 1S3RA 14GSA 4KUNA 1EOHA 2KHPA 2V6OA 3QAWA 3RGBC 17GSA 4IGJA 2KOKA 2WVYA 1YDKA 2K6VA 3GV1A 2R0GA 3LFLA 5LD0A 3EE2A 1PKZA 1Y6EA 4AJ8A 1O6JA 1XW9A 4GXZA 4YH2A 4A5PA 1A2JA 4J57E 1TU7A 3U5RE 1SENA 1URMA 5CRWA 3D5JA 2IL3A 1V58A 2GS3A 3HXSA 4ZBAA 1G0TA 2N5FA 2VLTA 3Q19A 4WETA 4TXVA 3MAKA 2CVKA 2JL4A 1MD4A 1AQWA 2ON5A 3I69A 2LS5A 2VCXA 5ID2B 2H0GA 1JLVA 4MK3A 4ZL7A 1S3AA 2EFEA 2WVXA 5JCUA 1NW2A 4GSSA 4G10A 3SWLA 1R7HA 3GKMA 2JACA 2HXKA 5CO3A 4HJ2A 3L78A 4OCFA 5EVOA 4N0ZA 3GHAA 4EKZA 4BVXB 4O32A 2HRKA 5IMVA 4ZXGA 5J9CA 3AY8A 5HR0A 1YY7A 3VWVA 5G5EA 1YF1A 3WGXA 4Z2UA 2WULA 2B1KA 5JCWA 3KH7A 1O85A 3QMXA 2H1AA 2N5AA 2HE3A 3F9UA 1XZOA 5IMFA 3G7JA 1I5GA 2LRCA 3EMXA 1Z6MA 2AB6A 3HVVA 3KEBA 4I2TA 1TU8A 1WPIA 1GUHA 2D2ZA 1GSSA 2IMDA 3UJ1A 3ME8A 2VCQA 2H6ZA 1G7OA 2JSZA 1VGLA 1SJ6A 3APQA 3Q74A 2HYXA 4N0VA 2F51A 2J9HA 2HI7A 2L5OA 3IE3A 3NZNA 1GP1A 4O7HA 1V40A 3CTFA 3VPTA 5IO2A 4G01A 2VAFA 3O3TA 2LNTA 3FRCA 3DWVA 3PR8A 4KDUA 2DMLA 1UVZA 2KP1A 4K7OA 2VCZA 3F6FA 4J56E 4PGTA 2ZNMA 1SVLA 5CAXA 5GSTA 3ZRDA 2C80A 5CREA 4D73B 3RDWA 4KX4A 2FD3A 2QA1A 4MF5A 1F9MA 5D9XA 2B6MA 2JSYA 5H5RA 3TJFA 1DBYA 4N11A 2FNOA 2DMMA 1EGOA 4XIHA 3A2XA 1V2AA 1E6BA 3ED3A 1AQVA 2VO4A 1GSDA 3Q18A 1DE2A 2WW0A 3IC8A 2EIOA 4PTSA 2PMTA 2YZHA 3D21A 2X8GA 4Z7XA 1M2DA 1M7TA 4DVCA 5C00A 4EE0A 4MCUA 3HVSA 4BL7A 4N30A 3EMPA 1UA5A 2MBTA 1K0DA 5B8AA 4JZQA 2LSTA 1WE0A 2PPTA 1GTAA 2WVZA 2DSAA 5G1LA 2R5GA 2V2GA 3F4TA 2CZ3A 3G7YA 1H4OA 2VOCA 1SVOA 2LEGA 2C8UA 5LCZA 1SJIA 1T3BA 3UARA 1U3IA 1K0AA 3I6AA 5DALB 2BMXA 1JZOA 1FOHA 3BCIA 3DD3A 4AI6A 3RFRC 3EU4A 1EV9A 1ZCPA 3IPZA 4PNGA 1A23A 3ERFA 2XPDA 5IMDA 1XVWA 5DJMA 1USBA 1XXUA 3TOTA 1OC9A 3VPQA 1M3IA 4OFMA 1HNAA 5IMAA 3WT1A 4X43A 1NHOA 5GAND 1K3OA 4ULXA 1WJKA 5BMUB 4O5QA 1AC1A 2A4HA 4TR1B 1OKTA 4K2XA 4IKHA 3LGCA 1TTZA 2TRCP 1EEJA 1YJ6A 4I6XA 2GGTA 1Z5YE 2C3TA 4Q5RA 1SKWB 2MZCA
chains in the Genus database with same CATH topology
4TN8A 4XS6A 3TJJA 1GLQA 4F2IA 4ECBA 2OE3A 3APOA 1HNBA 5FT3A 2YN1A 4O92A 1TK8B 5DBQA 1K3LA 3FEUA 1AIUA 6GSYA 3W6GA 2GZZA 4EUYA 1HNCA 4K9ZA 3TKQA 3F3RA 1Y1UA 1O73A 2DLXA 12GSA 1VF4A 2GLRA 3FZ4A 5B7CA 4L5OA 4IJIA 5E59A 4IJ3A 4H86A 1YF0A 4W66A 5ECOB 2RLIA 3CYNA 4ZBBA 2L6DA 4POKA 2G0FA 3LYPA 1GSEA 3GH6A 4HS1A 1TRVA 1DE1A 5ID2A 1A24A 2GVPA 2REMA 2H01A 5ECHB 3JCML 2QA2A 4FYBA 4WKWA 5IPGA 3EURA 2XPEA 5F06A 3ZIVA 3ZZXA 4MDCA 2HRNA 2OADA 3HHVA 3ISOA 3KJYA 1R5AA 5DQYA 1T8EB 5A4VA 1BJXA 3P7XA 4IELA 5ENUA 4IW9A 1TW9A 5GAPD 1X5DA 3KD0A 3IBHA 3WD6A 4HZ4A 5AN1A 1BX9A 4QMKA 1Z3EA 2B3SA 3NOFA 5F07A 5ABRA 4L0UA 5EY6A 4J2FA 1TI1A 4POLA 2H1BA 2HSNB 3GH9A 4EDZA 2HRAA 3VLNA 4DEJA 5DCHA 2ZCTA 4K0GA 3TJBA 3HMJG 2YNXA 2E7PA 2CX3A 3LSZA 4USSA 3Q6OA 3O6TA 4NMUA 1FOVA 2JADA 2I3YA 2K8SA 1JZRA 1AXDA 5J4UA 18GSA 2I9HA 2X64A 6GSVA 1U3AA 1BG1A 1XBSA 2VUPA 1PA3A 2MMAA 2N5BA 3VURA 4WR5A 2YJ7A 1ZOFA 5F8BA 3UBKA 3KCMA 1SYXA 3FZ9A 2H1GA 3C8EA 3TRQA 5HR1A 5GSSA 4TKYA 3GFKA 2O7KA 4GSTA 5J41A 1J08A 4KB3A 5DDLA 1AW9A 2GSTA 1A2MA 1W89A 2PGTA 1IYHA 3ZMLA 5HR3A 4G0LA 4GRFA 5ECRB 1W4VA 3QFAC 3UL3A 1M0UA 5JWQB 1Z6NA 5ECNB 1HYUA 4E8HA 4OFTA 1EP7A 1SJZA 4ID0A 4KSMA 2PVQA 1YQ1A 1MD3A 2YPMA 1H75A 3J7Yb 1GSFA 1JZWA 3RPPA 1EV4A 3GKKA 1WIKA 2VLVA 4PUAA 3I9V2 1OC9B 3HJOA 8GSSA 4MJEA 1ACVA 2HSMB 5A4UA 2Z9SA 1A2LA 1TJDA 1B48A 4BA7A 3CSHA 4X0XA 2H0HA 2LV3A 3MYDA 3BCKA 2L59A 2CX4A 4XS4A 1YVLA 4V2MA 4F0BA 1KTEA 5B6MA 3H79A 5COHA 2V32A 1F2EA 5ECQB 2LQQA 1ZYEA 4L5LA 2GQLA 5J40A 4AGSA 5CYYA 4MJAA 1Z7PA 2HQTA 3KTBA 4WXTA 5CP1A 3TKSE 5HQPA 1N25A 2I81A 1J0FA 3G7IA 1LU4A 5G1KA 4CHSA 1F6MC 1GLPA 2OE0A 4AJ6A 1NSWA 3GL5A 3UIWA 4I5QA 3ZFBA 2VCVA 5AIVA 2FWHA 1WOUA 4I8BA 5DALA 3CBUA 5D73A 4K5SA 3QOUA 1ON4A 1AQXA 1U6TA 3I43A 1YEXA 1ABAA 2OBIA 3IA1A 2LTKA 2IMFA 1XWKA 2YV7A 2F9SA 5B6NA 5H5SA 1ZMAA 1FG4A 5ELAA 2KLXA 3UBLA 2LUSA 2IN3A 1OC8A 3IRAA 5BMUA 3CSIA 3FYGA 5CRHA 5IO0A 4MH2A 4TR1A 1TP9A 2R2JA 1PRXA 3L9SA 2YANA 3TGZA 4LMWA 4F82A 2BTOT 4XTSA 3HY2A 2XBQA 5DQSA 2X99A 2IFQB 4EC0A 1T1VA 5DAKB 3BJ5A 3ZREA 3IXRA 1SVMA 1JFUA 4NAXA 3QDNA 1MEKA 3CXGA 2RUEA 2HRFA 4MMMA 3UVTA 4HUAA 2JU5A 4Z2RA 1ST9A 3FY7A 2R0PA 2NTOA 3GUSA 2LQOA 5JWOB 2OKAA 2AUVA 1ZYQB 4FIWA 4AF2A 3QCPA 4MZBA 5KOWA 1GTBA 2WS2A 1ML6A 2VL2A 1BYEA 1XWBA 2FGXA 2B7JA 4KGIA 2HLSA 1EP8A 6GSXA 3ZLPA 2FHEA 3MDKA 4EDYA 4XHMA 2E2MA 10GSA 1M2BA 4ZILA 2H73A 3CWGA 2RM5A 4WF4A 2C3QA 4LA1A 4OO4A 1TK5B 1XWCA 2X4AA 5DVBA 3CSJA 3UEMA 3ZL5A 1O7UA 3BBYA 1T7PB 4F03A 3GKXA 1A8YA 3HD5A 3US3A 2C4JA 3LW9A 3HZ8A 4X4JA 5G31A 2EIQA 1XFLA 1X9WB 2E2GA 3H1NA 4MABA 4Q5FA 2IJYA 4LLRA 1TXXA 1QK8A 2AV4A 3FZAA 4TXOB 5A5KA 3A5IA 3IK7A 1GRXA 2FCHA 2O89A 3EU3A 5KN1A 4HZ2A 1S3CA 3F0IA 2FWEA 1OVNA 1I9DA 2EFCA 3D0ZA 2HZFA 2PVOC 2HSNA 1PN9A 3WGDA 13GSA 4RI7A 1PL2A 2NBSA 2PBJA 5ECLB 2XC2A 3GURA 4FQUA 1RQMA 3DVXA 1SD8A 1A8LA 2HSHA 3DYRA 4DSSB 3QR6A 4PQIA 3MWHA 2VD1A 4KDXA 4QQ7A 2GT6A 3WT2A 4WBJA 3KH9A 3M9KA 5D96A 2CT6A 3RHCA 2MBSA 2C3NA 4RQXA 1FVJA 4K0NA 5KN3A 4KCAA 1F37A 4XS4B 1XOBA 5AISA 4O5UA 3R2QA 2P5RA 1ZGNA 3C71A 2JZSA 2WFCA 2FWGA 2FA4A 1WMJA 2AJQB 3TKRA 2NDOA 4JU5A 2IMIA 3D4TA 5KN2A 2VLUA 3U6VA 4QL9A 1GTIA 5GZZB 3FR6A 1JZDA 3G9BA 3FHKA 4KW6A 2UV8G 3GMFA 3RAZA 1HQOA 2MYGA 3QAVA 2EIRA 4EF0A 1OKDA 4YAPA 2WZ9A 2CZ2A 1YZXA 5E4WA 3DGQA 2L4QA 3CRUA 4K5RA 1PKWA 2HT9A 4HU9A 1EEMA 1M99A 1LBKA 2UZ8A 3TOUA 2CVDA 2DJKA 4PUFC 4HOJA 4NV2A 4YAVA 2H6XA 5A1NB 2HSMA 2VM1A 4MP4A 1K3YA 5J4YA 5A4WA 4K8MA 1QFNA 4POBA 3IV4A 4X1UA 2DKIA 1FAAA 2PWJA 2R0CA 3GKNA 4GF0A 2MMZA 4I97A 4KAEA 5F0GA 1TK0B 4NPBA 4FH8A 4GQCA 3DXBA 5CRDA 4MPGA 4TW5A 2I1UA 2EFHA 2PU9C 1X0RA 1QMVA 4YQVA 2YWMA 5G30A 5A5HB 4ZL8A 2H70A 1IYIA 4OO5A 2WB9A 1A0RP 4OD7A 3M3MA 3A3TA 5D9VA 1XW5A 2M46A 1SU9A 2V41A 3LG6A 3A2WA 1MTCA 3A5WA 1SD9A 2WDUA 3LEFA 1GUKA 4GQFA 1Z7RA 1TRSA 3EVIA 6GSWA 3IAS2 1WP0A 3QAGA 1GNWA 5G5FA 1ZZYA 4WBRD 2OA7A 2HZEB 2NPBA 3F4SA 4HJMA 1ERVA 2WRTA 3CRTA 4PURA 3F3QA 4JBBA 3F6DA 1OE8A 3MNGA 1B8XA 5D93A 4HEA2 3QFBC 1TI3A 1GSUA 1G7EA 4MF7A 2WGRA 2YZUA 3KXOA 2VM2A 3PH9A 3S9FA 2FY6A 1AUCA 4HDEA 4P3YB 4LL4B 4JE1A 2PERA 3H4KA 2IFQA 1TRWA 5DAKA 1X9MB 4O5RA 4G19A 1X5EA 1XW6A 3BOAA 3P90A 3LWAA 1FO5A 4F9ZA 4DSRA 2OACA 1THXA 2GZPA 1MDKA 1RW1A 4I2UA 1QQ2A 3FK8A 2CA8A 4TR3A 4MJBA 5ECMB 2DKHA 4IP6A 2H71A 1VRSD 3TKSA 4AJ7A 3C73A 3D22A 5HR2A 1R26A 2J23A 5BRTA 4EIPA 1G6WA 4CW9A 3W8JA 2B7KA 4AKXB 2R37A 1RK4A 1EGRA 5FHIA 4E8EA 1AAZA 2ES7A 4MLYA 3ZITA 3TKSC 3RHBA 2OT3A 1FB6A 5CRGA 4FO5A 4E68A 3GL3A 1KEBA 1BF5A 4KSOA 2H6YA 3KP9A 5C04A 4KNDA 2LJRA 1GWCA 3RPNA 4CY6A 1PX7A 4TRXA 2DJ3A 3SBCA 3GRXA 3N5OA 2YP6A 3KM6A 1ERUA 3D4MA 4TXOA 4L8EA 4NHZA 3HKRA 4ECIA 1QXHA 1FVKA 3M9JA 3IAM2 3PPUA 4YQUA 4TVEA 2OJLA 2PUKC 1FB0A 1SK2A 3V1WA 2CVBA 2E0QA 2NVLA 5EL8A 1MDIA 3TU3B 4DSSA 4ECJA 2VCTA 4IVFA 1X5CA 5J4VA 1GTUA 4G9HA 3GX0A 3K8NA 4PNFA 19GSA 3E0UA 2O5VA 5KN0A 3FR9A 5HFGA 2G2QA 3F4RA 3KGKA 4WEYA 3EPTA 1SK0A 3VWUA 1OYJA 2O8VB 3FMWA 1XCCA 2IMKA 4ILFA 1N2AA 3VFIA 2LRNA 1GH2A 3GX8A 1YEPA 1BAYA 2GTUA 6GSTA 4XCSA 1X9SB 3ZIJA 3PINA 1EWXA 2ON7A 1GNEA 2H19A 3P8WA 1PQNA 2O87A 2VL3A 2DC5A 3L0HA 1O81A 4TOPA 2O85A 4JRRA 2QC7A 2AHEA 1Z9HA 5A34B 5ECPB 2YCDA 2B5EA 3CTGA 3IR4A 1XVQA 4PQ1A 5KEJA 2OE1A 1PGTA 2B5YA 4ML6A 2DIZA 5D9WA 5LNKe 3TRPA 5A1NA 3TRXA 2HSYA 3HVXA 1K0NA 1GUMA 3DEXA 4IHUA 3E9JB 3LXZA 2V6KA 3HJMA 1ILOA 3GSTA 2IIYA 1DUGA 1B9YC 3UVHA 2L5LA 2H76A 4RQRA 5AGYA 2F3MA 1PMTA 5J9BA 4PXOA 1WWJA 4ISDA 1PSQA 2H1DA 3IK9A 1OC3A 4HQZA 5AIXA 1F3BA 1BEDA 4BWQA 4NWYA 4MF6A 1TDIA 4GCIA 5A5HA 3HA9A 1K0CA 3ZYWA 1SL0B 2DJ1A 3F8UA 4MZCA 2OBKA 2FA8A 3QPMA 1A0FA 2FWFA 2F8FA 3HCZA 4MH3A 4POMA 3KMOA 1PD21 5H5QA 2LRTA 1M9AA 2FUG2 1R4WA 2QKEA 4BVYB 4IN0A 4TR4A 3OR5A 2HFDA 4EIQA 5D8IA 2RM6A 5IMCA 4K6XA 2KP2A 3GA4A 4N3ZA 4OCEA 1QUWA 4MNNA 2K9FA 1SYRA 2HZEA 4RI6A 3FZ5A 22GSA 3GN3A 1E2YA 2B5XA 3M0FA 1Y25A 3P2AA 4K1FA 1PX6A 1Q4JA 1LJRA 3UOMA 3NIVA 5IOWA 1TOFA 4ZB6A 2EFDA 2VL2C 3L9VA 3F63A 2BJXA 3DKSA 5ECSA 1NHYA 4MA9A 3LJRA 3LQ7A 2GSRA 1EOGA 4YKGA 2K8VA 5DJLA 3HJPA 2YWOA 4EXJA 2VCWA 2KUCA 2GQKA 4PQHA 1K0BA 2M80A 2GZYA 5G2ZA 1B9XC 1KBNA 1QGVA 4NHWA 2CAQA 2H66A 3DMLA 1VF1A 3WYWA 5J5NA 2AAWA 1VF2A 4G2EA 1YKAA 1ZYNA 5IPHA 3KIJA 4IQ1A 3TCOA 4Q5QA 4ICYA 4ML1A 1SKRB 1V9WA 4GTUA 4L0WA 1CQHA 2LJAA 3TUEA 3GTUA 4XRAA 2QGVA 2LNSA 4TR0A 5IOXA 5IM9A 1XWGA 4GDFA 4FYCA 3EC3A 2H0IA 4K7IA 4K2DA 4KDYA 5HFKA 4G0IA 1S3DA 2PN8A 3APSA 4ZBDA 2DJ2A 3DRNA 2L4CA 3KP8A 4XRDA 1XPVA 1V98A 2IPAA 2WJUA 1V57A 2I4AA 4EO3A 3RBTA 2H72A 4EL1A 1SL2B 2L6CA 3FR3A 2GDRA 11GSA 1NM3A 5INYA 3L9UA 3LYKA 5B8BA 4GWRA 4WF5A 1SKSB 4IQAA 2YWNA 4K7NA 1O8WA 4HI7A 2GSSA 3ERWA 3EINA 2GQMA 2L57A 3KZQA 1BG5A 3ME7A 3E3EA 3ZTLA 1UC7A 1WRYA 4MZWA 2X49A 1M2AA 3H93A 16GSA 2JZTA 4KCEA 3FKFA 6GSUA 1EZKA 4WR4A 2QSIA 3C1SA 2YJHA 4HU7A 4QL7A 7GSSA 4GLTA 3C7MA 1VF3A 3TJGA 5FWGA 5ELGA 3GSSA 4BPYA 4YQMA 4F0CA 2R6KA 3J7Yk 3IDVA 4ACSA 2H75A 2DJJA 2MMOA 2C0DA 2X8CA 3D6IA 2TRXA 5IQYA 1JHBA 1YKCA 4FYUA 4HQSA 4CDOA 4N10A 3TKPA 5A34A 1ERTA 2VKZG 5ECIB 1J9BA 1PL1A 3W8SA 3UAPA 1K0OA 2V1MA 3HYPA 4Z2TA 4KF9A 1R5PA 2MMNA 5CNWA 3ZVJA 3M8NA 2H8LA 1OE7A 6GSSA 2JZRA 2HRKB 4GSNA 2C0GA 1GSQA 1TRUA 5ECKB 4LMVA 2CQ9A 1U88A 5F05A 1SL1B 4LL1B 3M1GA 1SK1A 1XOAA 2C0EA 2RUFA 3EYTA 5JWRB 1TXUA 1B4PA 2H30A 3GYKA 5JCGA 4EVMA 2YWIA 1TKDB 5KOXA 4NV5A 3A2VA 4OMVA 3VWWA 3UMAA 2X8HA 4JEDA 1JLWA 5IMZA 1F3AA 4IBPA 1O8XA 4RUVA 2WCIA 4KH7A 3TDGA 1HD2A 4ZB8A 2ALBA 5J47A 20GSA 3VWXA 3H8QA 2IMEA 3IHGA 4CY8A 1CQGA 2XBIA 3IOSA 1U87A 2VD0A 5HFIA 4G0KA 4BVYA 1C72A 4JR6A 2M72A 4ECCA 1Q98A 2R4VA 2LKUA 4BVXA 2FLSA 4V2LA 3N9JA 2P0GA 3IC4A 2VL9A 4OFNA 4ZB9A 2EC4A 3HZ4A 1ZYPA 4IS0A 2H74A 3EWLA 3DVWA 1THOA 3WGEA 4XS1A 2RIIA 1K0MA 4BWSA 3QD9A 3GTUB 4ZIJA 1ERWA 3TJKA 4ZL9A 4Q5NA 2C1YA 1GSYA 2H1LA 3ZFLA 5EPFA 1XWAA 4MPFA 2K18A 5D9TA 5DCGA 4KA0A 2DIYA 2ZUPA 2CV4A 2YV9A 9GSSA 2B1LA 1ZL9A 3ZMKA 2GT5A 3LXTA 4AKGA 4OWYA 3KTLA 1T00A 2P31A 2A4VA 1N8JA 1T4ZA 4AKHA 2LJKA 4V2NA 2VIMA 3PGTA 3TB2A 5IIZA 1GULA 3CMIA 4BL7B 5J3RA 3VI5A 3MIXA 3DIEA 4V1Ag 3KMNA 2HNLA 2XHFA 3GNJA 1OAZA 1G6YA 1XIYA 4AKIA 4V1Ap 2A2SA 3BD2A 3L4NA 3ERGA 4JR4A 2DBCA 2A2RA 2IWTA 4D73A 3LORA 5L71A 3IHQA 1MDJA 2YOIA 3HDCA 4NXIA 3VK9A 1BQ7A 1KNGA 3C1RA 3FW2A 3ZVJD 1FHEA 3O76A 2R3XA 2TIRA 1GL8A 2DJ0A 4IP1A 4MJCA 3R3EA 4PX1A 2GSQA 3GIXA 2CAIA 1T4YA 2P5QA 2C0FA 1M9BA 4ZB7A 3MSZA 4DSQA 2F8AA 1B4QA 1FW1A 1PN0A 1UN2A 2A2PA 1DSBA 4YKFA 4KE3A 3VI7A 2AYTA 14GSA 4KUNA 1EOHA 2KHPA 2V6OA 3QAWA 17GSA 4IGJA 2KOKA 1YDKA 2K6VA 3GV1A 2R0GA 3LFLA 5LD0A 3EE2A 1PKZA 1Y6EA 4AJ8A 1O6JA 1XW9A 4GXZA 4YH2A 4A5PA 1A2JA 4J57E 1TU7A 3U5RE 1SENA 1URMA 5CRWA 3D5JA 2IL3A 1V58A 2GS3A 3HXSA 4ZBAA 1G0TA 2N5FA 2VLTA 3Q19A 4WETA 4TXVA 3MAKA 2CVKA 2JL4A 1MD4A 1AQWA 2ON5A 3I69A 2LS5A 2VCXA 5ID2B 2H0GA 1JLVA 4MK3A 4ZL7A 1S3AA 2EFEA 5JCUA 1NW2A 4GSSA 4G10A 3SWLA 1R7HA 3GKMA 2JACA 2HXKA 5CO3A 4HJ2A 3L78A 4OCFA 5EVOA 4N0ZA 3GHAA 4EKZA 4BVXB 4O32A 2HRKA 5IMVA 4ZXGA 5J9CA 3AY8A 5HR0A 1YY7A 3VWVA 5G5EA 1YF1A 3WGXA 4Z2UA 2WULA 2B1KA 5JCWA 3KH7A 1O85A 3QMXA 2H1AA 2N5AA 2HE3A 3F9UA 1XZOA 5IMFA 3G7JA 1I5GA 2LRCA 3EMXA 1Z6MA 2AB6A 3HVVA 3KEBA 4I2TA 1TU8A 1WPIA 1GUHA 2D2ZA 1GSSA 2IMDA 3UJ1A 3ME8A 2VCQA 2H6ZA 1G7OA 2JSZA 1VGLA 1SJ6A 3APQA 3Q74A 2HYXA 4N0VA 2F51A 2J9HA 2HI7A 2L5OA 3IE3A 3NZNA 1GP1A 4O7HA 1V40A 3CTFA 3VPTA 5IO2A 4G01A 2VAFA 3O3TA 2LNTA 3FRCA 3DWVA 3PR8A 4KDUA 2DMLA 1UVZA 2KP1A 4K7OA 2VCZA 3F6FA 4J56E 4PGTA 2ZNMA 1SVLA 5CAXA 5GSTA 3ZRDA 2C80A 5CREA 4D73B 3RDWA 4KX4A 2FD3A 2QA1A 4MF5A 1F9MA 5D9XA 2B6MA 2JSYA 5H5RA 3TJFA 1DBYA 4N11A 2FNOA 2DMMA 1EGOA 4XIHA 3A2XA 1V2AA 1E6BA 3ED3A 1AQVA 2VO4A 1GSDA 3Q18A 1DE2A 3IC8A 2EIOA 4PTSA 2PMTA 2YZHA 3D21A 2X8GA 4Z7XA 1M2DA 1M7TA 4DVCA 5C00A 4EE0A 4MCUA 3HVSA 4BL7A 4N30A 3EMPA 1UA5A 2MBTA 1K0DA 5B8AA 4JZQA 2LSTA 1WE0A 2PPTA 1GTAA 2DSAA 5G1LA 2R5GA 2V2GA 3F4TA 2CZ3A 3G7YA 1H4OA 2VOCA 1SVOA 2LEGA 2C8UA 5LCZA 1SJIA 1T3BA 3UARA 1U3IA 1K0AA 3I6AA 5DALB 2BMXA 1JZOA 1FOHA 3BCIA 3DD3A 4AI6A 3EU4A 1EV9A 1ZCPA 3IPZA 4PNGA 1A23A 3ERFA 2XPDA 5IMDA 1XVWA 5DJMA 1USBA 1XXUA 3TOTA 1OC9A 3VPQA 4OFMA 1HNAA 5IMAA 3WT1A 4X43A 1NHOA 5GAND 1K3OA 4ULXA 1WJKA 5BMUB 4O5QA 1AC1A 2A4HA 4TR1B 1OKTA 4K2XA 4IKHA 3LGCA 1TTZA 2TRCP 1EEJA 1YJ6A 4I6XA 2GGTA 1Z5YE 2C3TA 4Q5RA 1SKWB 2MZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TN8 A;  4XS6 A;  3TJJ A;  1GLQ A;  4F2I A;  4ECB A;  2OE3 A;  3APO A;  1HNB A;  5FT3 A;  2YN1 A;  4O92 A;  1TK8 B;  5DBQ A;  1K3L A;  3FEU A;  1AIU A;  6GSY A;  3W6G A;  2GZZ A;  4EUY A;  1HNC A;  4K9Z A;  3TKQ A;  3F3R A;  1O73 A;  2DLX A;  12GS A;  1VF4 A;  2GLR A;  3FZ4 A;  5B7C A;  4L5O A;  4IJI A;  5E59 A;  4IJ3 A;  4H86 A;  1YF0 A;  5ECO B;  2RLI A;  3CYN A;  4ZBB A;  2L6D A;  4POK A;  2G0F A;  3LYP A;  1GSE A;  3GH6 A;  4HS1 A;  1TRV A;  1DE1 A;  5ID2 A;  1A24 A;  2GVP A;  2REM A;  2H01 A;  5ECH B;  3JCM L;  4FYB A;  4WKW A;  5IPG A;  3EUR A;  2XPE A;  5F06 A;  3ZIV A;  3ZZX A;  4MDC A;  2HRN A;  2OAD A;  3HHV A;  3ISO A;  3KJY A;  1R5A A;  5DQY A;  1T8E B;  5A4V A;  1BJX A;  3P7X A;  4IEL A;  5ENU A;  4IW9 A;  1TW9 A;  5GAP D;  1X5D A;  3KD0 A;  3IBH A;  3WD6 A;  4HZ4 A;  5AN1 A;  1BX9 A;  1Z3E A;  2B3S A;  3NOF A;  5F07 A;  5ABR A;  4L0U A;  5EY6 A;  4J2F A;  1TI1 A;  4POL A;  2H1B A;  2HSN B;  3GH9 A;  4EDZ A;  2HRA A;  3VLN A;  4DEJ A;  5DCH A;  2ZCT A;  4K0G A;  3TJB A;  2YNX A;  2E7P A;  2CX3 A;  3LSZ A;  4USS A;  3Q6O A;  3O6T A;  4NMU A;  1FOV A;  2JAD A;  2I3Y A;  2K8S A;  1JZR A;  1AXD A;  5J4U A;  18GS A;  2I9H A;  2X64 A;  6GSV A;  1U3A A;  1XBS A;  2VUP A;  1PA3 A;  2MMA A;  2N5B A;  3VUR A;  4WR5 A;  2YJ7 A;  1ZOF A;  5F8B A;  3UBK A;  3KCM A;  1SYX A;  3FZ9 A;  2H1G A;  3C8E A;  3TRQ A;  5HR1 A;  5GSS A;  4TKY A;  3GFK A;  2O7K A;  4GST A;  5J41 A;  1J08 A;  4KB3 A;  5DDL A;  1AW9 A;  2GST A;  1A2M A;  1W89 A;  2PGT A;  1IYH A;  3ZML A;  5HR3 A;  4G0L A;  4GRF A;  5ECR B;  1W4V A;  3QFA C;  3UL3 A;  1M0U A;  5JWQ B;  1Z6N A;  5ECN B;  1HYU A;  4E8H A;  4OFT A;  1EP7 A;  1SJZ A;  4ID0 A;  4KSM A;  2PVQ A;  1YQ1 A;  1MD3 A;  2YPM A;  1H75 A;  3J7Y b;  1GSF A;  1JZW A;  3RPP A;  1EV4 A;  3GKK A;  1WIK A;  2VLV A;  4PUA A;  3I9V 2;  1OC9 B;  3HJO A;  8GSS A;  4MJE A;  1ACV A;  2HSM B;  5A4U A;  2Z9S A;  1A2L A;  1TJD A;  1B48 A;  4BA7 A;  3CSH A;  4X0X A;  2H0H A;  2LV3 A;  3BCK A;  2L59 A;  2CX4 A;  4XS4 A;  4V2M A;  4F0B A;  1KTE A;  5B6M A;  3H79 A;  5COH A;  2V32 A;  1F2E A;  5ECQ B;  2LQQ A;  1ZYE A;  4L5L A;  2GQL A;  4AGS A;  5CYY A;  4MJA A;  1Z7P A;  2HQT A;  3KTB A;  4WXT A;  5CP1 A;  3TKS E;  5HQP A;  2I81 A;  1J0F A;  3G7I A;  1LU4 A;  5G1K A;  4CHS A;  1F6M C;  1GLP A;  2OE0 A;  4AJ6 A;  1NSW A;  3GL5 A;  3UIW A;  4I5Q A;  3ZFB A;  2VCV A;  5AIV A;  2FWH A;  1WOU A;  4I8B A;  5DAL A;  3CBU A;  5D73 A;  3QOU A;  1ON4 A;  1AQX A;  1U6T A;  3I43 A;  1YEX A;  1ABA A;  2OBI A;  3IA1 A;  2LTK A;  2IMF A;  1XWK A;  2YV7 A;  2F9S A;  5B6N A;  5H5S A;  1ZMA A;  1FG4 A;  5ELA A;  2KLX A;  3UBL A;  2LUS A;  2IN3 A;  1OC8 A;  3IRA A;  5BMU A;  3CSI A;  3FYG A;  5CRH A;  5IO0 A;  4MH2 A;  4TR1 A;  1TP9 A;  2R2J A;  1PRX A;  3L9S A;  2YAN A;  3TGZ A;  4LMW A;  4F82 A;  2BTO T;  4XTS A;  3HY2 A;  2XBQ A;  5DQS A;  2X99 A;  2IFQ B;  4EC0 A;  1T1V A;  5DAK B;  3BJ5 A;  3ZRE A;  3IXR A;  1JFU A;  4NAX A;  3QDN A;  1MEK A;  3CXG A;  2RUE A;  2HRF A;  4MMM A;  3UVT A;  4HUA A;  2JU5 A;  1ST9 A;  3FY7 A;  2NTO A;  3GUS A;  2LQO A;  5JWO B;  2OKA A;  2AUV A;  1ZYQ B;  4FIW A;  4AF2 A;  3QCP A;  4MZB A;  1GTB A;  2WS2 A;  1ML6 A;  2VL2 A;  1BYE A;  1XWB A;  2FGX A;  2B7J A;  4KGI A;  2HLS A;  1EP8 A;  6GSX A;  3ZLP A;  2FHE A;  3MDK A;  4EDY A;  4XHM A;  2E2M A;  10GS A;  1M2B A;  4ZIL A;  2H73 A;  2RM5 A;  4WF4 A;  2C3Q A;  4LA1 A;  4OO4 A;  1TK5 B;  1XWC A;  5DVB A;  3CSJ A;  3UEM A;  3ZL5 A;  1O7U A;  3BBY A;  1T7P B;  4F03 A;  3GKX A;  1A8Y A;  3HD5 A;  3US3 A;  2C4J A;  3HZ8 A;  5G31 A;  2EIQ A;  1XFL A;  1X9W B;  2E2G A;  3H1N A;  4MAB A;  4Q5F A;  2IJY A;  4LLR A;  1TXX A;  1QK8 A;  2AV4 A;  3FZA A;  4TXO B;  5A5K A;  3IK7 A;  1GRX A;  2FCH A;  2O89 A;  3EU3 A;  5KN1 A;  4HZ2 A;  1S3C A;  3F0I A;  2FWE A;  1OVN A;  1I9D A;  3D0Z A;  2HZF A;  2PVO C;  1PN9 A;  3WGD A;  13GS A;  4RI7 A;  1PL2 A;  2NBS A;  2PBJ A;  5ECL B;  2XC2 A;  3GUR A;  4FQU A;  1RQM A;  3DVX A;  1SD8 A;  1A8L A;  2HSH A;  3DYR A;  4DSS B;  3QR6 A;  4PQI A;  3MWH A;  2VD1 A;  4KDX A;  4QQ7 A;  2GT6 A;  3WT2 A;  4WBJ A;  3KH9 A;  3M9K A;  5D96 A;  2CT6 A;  3RHC A;  2MBS A;  2C3N A;  4RQX A;  1FVJ A;  4K0N A;  5KN3 A;  4KCA A;  1F37 A;  4XS4 B;  1XOB A;  5AIS A;  3R2Q A;  2P5R A;  1ZGN A;  3C71 A;  2JZS A;  2WFC A;  2FWG A;  2FA4 A;  1WMJ A;  2AJQ B;  3TKR A;  2NDO A;  4JU5 A;  2IMI A;  3D4T A;  5KN2 A;  2VLU A;  3U6V A;  4QL9 A;  1GTI A;  5GZZ B;  3FR6 A;  1JZD A;  3G9B A;  3FHK A;  4KW6 A;  3GMF A;  3RAZ A;  1HQO A;  2MYG A;  3QAV A;  2EIR A;  4EF0 A;  1OKD A;  4YAP A;  2WZ9 A;  2CZ2 A;  1YZX A;  5E4W A;  3DGQ A;  2L4Q A;  3CRU A;  1PKW A;  2HT9 A;  4HU9 A;  1EEM A;  1M99 A;  1LBK A;  2UZ8 A;  3TOU A;  2CVD A;  2DJK A;  4PUF C;  4HOJ A;  4NV2 A;  4YAV A;  2H6X A;  2HSM A;  2VM1 A;  4MP4 A;  1K3Y A;  5A4W A;  4K8M A;  1QFN A;  4POB A;  3IV4 A;  4X1U A;  1FAA A;  2PWJ A;  3GKN A;  4GF0 A;  2MMZ A;  4I97 A;  4KAE A;  5F0G A;  1TK0 B;  4NPB A;  4FH8 A;  4GQC A;  3DXB A;  5CRD A;  4MPG A;  4TW5 A;  2I1U A;  2PU9 C;  1X0R A;  1QMV A;  4YQV A;  2YWM A;  5G30 A;  4ZL8 A;  2H70 A;  1IYI A;  4OO5 A;  2WB9 A;  1A0R P;  4OD7 A;  3M3M A;  3A3T A;  5D9V A;  1XW5 A;  2M46 A;  1SU9 A;  2V41 A;  3LG6 A;  3A2W A;  1MTC A;  3A5W A;  1SD9 A;  2WDU A;  3LEF A;  1GUK A;  4GQF A;  1Z7R A;  1TRS A;  3EVI A;  6GSW A;  3IAS 2;  1WP0 A;  3QAG A;  1GNW A;  5G5F A;  1ZZY A;  4WBR D;  2OA7 A;  2HZE B;  2NPB A;  3F4S A;  4HJM A;  1ERV A;  2WRT A;  3CRT A;  4PUR A;  3F3Q A;  4JBB A;  3F6D A;  1OE8 A;  3MNG A;  1B8X A;  5D93 A;  4HEA 2;  3QFB C;  1TI3 A;  1GSU A;  1G7E A;  4MF7 A;  2WGR A;  2YZU A;  3KXO A;  2VM2 A;  3PH9 A;  3S9F A;  2FY6 A;  1AUC A;  4HDE A;  4P3Y B;  4LL4 B;  4JE1 A;  2PER A;  3H4K A;  2IFQ A;  1TRW A;  5DAK A;  1X9M B;  4O5R A;  4G19 A;  1X5E A;  1XW6 A;  3BOA A;  3P90 A;  3LWA A;  1FO5 A;  4F9Z A;  4DSR A;  2OAC A;  1THX A;  2GZP A;  1MDK A;  1RW1 A;  4I2U A;  1QQ2 A;  3FK8 A;  2CA8 A;  4TR3 A;  4MJB A;  5ECM B;  4IP6 A;  2H71 A;  1VRS D;  3TKS A;  4AJ7 A;  3C73 A;  3D22 A;  5HR2 A;  1R26 A;  2J23 A;  1G6W A;  4CW9 A;  3W8J A;  2B7K A;  2R37 A;  1RK4 A;  1EGR A;  5FHI A;  4E8E A;  1AAZ A;  2ES7 A;  4MLY A;  3ZIT A;  3TKS C;  3RHB A;  1FB6 A;  5CRG A;  4FO5 A;  3GL3 A;  1KEB A;  4KSO A;  2H6Y A;  3KP9 A;  5C04 A;  4KND A;  2LJR A;  1GWC A;  3RPN A;  1PX7 A;  4TRX A;  2DJ3 A;  3SBC A;  3GRX A;  3N5O A;  2YP6 A;  3KM6 A;  1ERU A;  3D4M A;  4TXO A;  4L8E A;  4NHZ A;  3HKR A;  4ECI A;  1QXH A;  1FVK A;  3M9J A;  3IAM 2;  3PPU A;  4YQU A;  4TVE A;  2OJL A;  2PUK C;  1FB0 A;  1SK2 A;  3V1W A;  2CVB A;  2E0Q A;  2NVL A;  5EL8 A;  1MDI A;  4DSS A;  4ECJ A;  2VCT A;  4IVF A;  1X5C A;  1GTU A;  4G9H A;  3GX0 A;  3K8N A;  4PNF A;  19GS A;  3E0U A;  5KN0 A;  3FR9 A;  5HFG A;  2G2Q A;  3F4R A;  3KGK A;  4WEY A;  1SK0 A;  3VWU A;  1OYJ A;  2O8V B;  1XCC A;  2IMK A;  4ILF A;  1N2A A;  3VFI A;  2LRN A;  1GH2 A;  3GX8 A;  1YEP A;  1BAY A;  2GTU A;  6GST A;  4XCS A;  1X9S B;  3ZIJ A;  3PIN A;  1EWX A;  2ON7 A;  1GNE A;  2H19 A;  3P8W A;  1PQN A;  2O87 A;  2VL3 A;  2DC5 A;  3L0H A;  1O81 A;  4TOP A;  2O85 A;  4JRR A;  2QC7 A;  2AHE A;  1Z9H A;  5ECP B;  2YCD A;  2B5E A;  3CTG A;  3IR4 A;  1XVQ A;  4PQ1 A;  5KEJ A;  2OE1 A;  1PGT A;  2B5Y A;  4ML6 A;  2DIZ A;  5D9W A;  5LNK e;  3TRP A;  3TRX A;  2HSY A;  3HVX A;  1K0N A;  1GUM A;  3DEX A;  4IHU A;  3E9J B;  3LXZ A;  2V6K A;  3HJM A;  1ILO A;  3GST A;  2IIY A;  1DUG A;  1B9Y C;  3UVH A;  2L5L A;  2H76 A;  4RQR A;  5AGY A;  2F3M A;  1PMT A;  5J9B A;  4PXO A;  1WWJ A;  4ISD A;  1PSQ A;  2H1D A;  3IK9 A;  1OC3 A;  4HQZ A;  5AIX A;  1F3B A;  1BED A;  4BWQ A;  4NWY A;  4MF6 A;  1TDI A;  4GCI A;  3HA9 A;  1K0C A;  3ZYW A;  1SL0 B;  2DJ1 A;  3F8U A;  4MZC A;  2OBK A;  2FA8 A;  3QPM A;  1A0F A;  2FWF A;  2F8F A;  3HCZ A;  4MH3 A;  4POM A;  3KMO A;  1PD2 1;  5H5Q A;  2LRT A;  1M9A A;  2FUG 2;  1R4W A;  2QKE A;  4BVY B;  4IN0 A;  4TR4 A;  3OR5 A;  2HFD A;  5D8I A;  2RM6 A;  5IMC A;  4K6X A;  2KP2 A;  3GA4 A;  4OCE A;  1QUW A;  2K9F A;  1SYR A;  2HZE A;  4RI6 A;  3FZ5 A;  22GS A;  3GN3 A;  1E2Y A;  2B5X A;  3M0F A;  1Y25 A;  3P2A A;  4K1F A;  1PX6 A;  1Q4J A;  1LJR A;  3UOM A;  3NIV A;  5IOW A;  1TOF A;  4ZB6 A;  2VL2 C;  3L9V A;  3F63 A;  2BJX A;  3DKS A;  5ECS A;  1NHY A;  4MA9 A;  3LJR A;  3LQ7 A;  2GSR A;  1EOG A;  2K8V A;  5DJL A;  3HJP A;  2YWO A;  4EXJ A;  2VCW A;  2KUC A;  2GQK A;  4PQH A;  1K0B A;  2M80 A;  2GZY A;  5G2Z A;  1B9X C;  1KBN A;  1QGV A;  4NHW A;  2CAQ A;  2H66 A;  3DML A;  1VF1 A;  3WYW A;  5J5N A;  2AAW A;  1VF2 A;  4G2E A;  1YKA A;  5IPH A;  3KIJ A;  4IQ1 A;  3TCO A;  4Q5Q A;  1SKR B;  4ML1 A;  1V9W A;  4GTU A;  4L0W A;  1CQH A;  2LJA A;  3TUE A;  3GTU A;  4XRA A;  2QGV A;  2LNS A;  4TR0 A;  5IOX A;  5IM9 A;  1XWG A;  4FYC A;  3EC3 A;  2H0I A;  4K7I A;  4K2D A;  4KDY A;  5HFK A;  4G0I A;  1S3D A;  2PN8 A;  3APS A;  4ZBD A;  2DJ2 A;  3DRN A;  2L4C A;  3KP8 A;  4XRD A;  1XPV A;  1V98 A;  2IPA A;  2WJU A;  1V57 A;  2I4A A;  4EO3 A;  3RBT A;  2H72 A;  4EL1 A;  1SL2 B;  2L6C A;  3FR3 A;  2GDR A;  11GS A;  1NM3 A;  5INY A;  3L9U A;  3LYK A;  5B8B A;  4GWR A;  4WF5 A;  1SKS B;  4IQA A;  2YWN A;  4K7N A;  1O8W A;  4HI7 A;  2GSS A;  3ERW A;  3EIN A;  2GQM A;  2L57 A;  3KZQ A;  1BG5 A;  3ME7 A;  3E3E A;  3ZTL A;  1UC7 A;  1WRY A;  4MZW A;  1M2A A;  3H93 A;  16GS A;  2JZT A;  4KCE A;  3FKF A;  6GSU A;  1EZK A;  4WR4 A;  2QSI A;  3C1S A;  2YJH A;  4HU7 A;  4QL7 A;  7GSS A;  4GLT A;  3C7M A;  1VF3 A;  3TJG A;  5FWG A;  5ELG A;  3GSS A;  4BPY A;  4YQM A;  4F0C A;  2R6K A;  3J7Y k;  3IDV A;  4ACS A;  2H75 A;  2DJJ A;  2MMO A;  2C0D A;  2X8C A;  3D6I A;  2TRX A;  5IQY A;  1JHB A;  1YKC A;  4FYU A;  4HQS A;  4CDO A;  4N10 A;  3TKP A;  1ERT A;  5ECI B;  1J9B A;  1PL1 A;  3W8S A;  3UAP A;  1K0O A;  2V1M A;  3HYP A;  4KF9 A;  1R5P A;  2MMN A;  5CNW A;  3ZVJ A;  3M8N A;  2H8L A;  1OE7 A;  6GSS A;  2JZR A;  2HRK B;  4GSN A;  2C0G A;  1GSQ A;  1TRU A;  5ECK B;  4LMV A;  2CQ9 A;  1U88 A;  5F05 A;  1SL1 B;  4LL1 B;  3M1G A;  1SK1 A;  1XOA A;  2C0E A;  2RUF A;  3EYT A;  5JWR B;  1B4P A;  2H30 A;  3GYK A;  5JCG A;  4EVM A;  2YWI A;  1TKD B;  4NV5 A;  3A2V A;  4OMV A;  3VWW A;  3UMA A;  2X8H A;  4JED A;  1JLW A;  5IMZ A;  1F3A A;  4IBP A;  1O8X A;  4RUV A;  2WCI A;  4KH7 A;  3TDG A;  1HD2 A;  4ZB8 A;  2ALB A;  20GS A;  3VWX A;  3H8Q A;  2IME A;  1CQG A;  2XBI A;  3IOS A;  1U87 A;  2VD0 A;  5HFI A;  4G0K A;  4BVY A;  4JR6 A;  1C72 A;  2M72 A;  4ECC A;  1Q98 A;  2R4V A;  2LKU A;  4BVX A;  2FLS A;  4V2L A;  3N9J A;  2P0G A;  3IC4 A;  2VL9 A;  4OFN A;  4ZB9 A;  2EC4 A;  3HZ4 A;  4IS0 A;  2H74 A;  3EWL A;  3DVW A;  1THO A;  3WGE A;  4XS1 A;  2RII A;  1K0M A;  4BWS A;  3QD9 A;  3GTU B;  4ZIJ A;  1ERW A;  3TJK A;  4ZL9 A;  4Q5N A;  2C1Y A;  1GSY A;  3ZFL A;  5EPF A;  1XWA A;  4MPF A;  2K18 A;  5D9T A;  5DCG A;  4KA0 A;  2DIY A;  2ZUP A;  2CV4 A;  2YV9 A;  9GSS A;  2B1L A;  1ZL9 A;  3ZMK A;  2GT5 A;  3LXT A;  4OWY A;  3KTL A;  1T00 A;  2P31 A;  2A4V A;  1N8J A;  1T4Z A;  2LJK A;  4V2N A;  2VIM A;  3PGT A;  3TB2 A;  5IIZ A;  1GUL A;  3CMI A;  4BL7 B;  5J3R A;  3VI5 A;  3DIE A;  4V1A g;  3KMN A;  2HNL A;  2XHF A;  3GNJ A;  1OAZ A;  1G6Y A;  1XIY A;  4V1A p;  2A2S A;  3BD2 A;  3L4N A;  3ERG A;  4JR4 A;  2DBC A;  2A2R A;  2IWT A;  4D73 A;  3LOR A;  5L71 A;  3IHQ A;  1MDJ A;  2YOI A;  3HDC A;  4NXI A;  3VK9 A;  1BQ7 A;  1KNG A;  3C1R A;  3FW2 A;  3ZVJ D;  1FHE A;  3O76 A;  2R3X A;  2TIR A;  1GL8 A;  2DJ0 A;  4IP1 A;  4MJC A;  3R3E A;  4PX1 A;  2GSQ A;  3GIX A;  2CAI A;  1T4Y A;  2P5Q A;  2C0F A;  1M9B A;  3MSZ A;  4DSQ A;  2F8A A;  1B4Q A;  1FW1 A;  1UN2 A;  1DSB A;  4KE3 A;  3VI7 A;  2AYT A;  14GS A;  4KUN A;  1EOH A;  2KHP A;  2V6O A;  3QAW A;  17GS A;  4IGJ A;  2KOK A;  1YDK A;  2K6V A;  3GV1 A;  3LFL A;  5LD0 A;  3EE2 A;  1PKZ A;  1Y6E A;  4AJ8 A;  1O6J A;  1XW9 A;  4GXZ A;  4YH2 A;  1A2J A;  4J57 E;  1TU7 A;  3U5R E;  1SEN A;  1URM A;  5CRW A;  3D5J A;  2IL3 A;  1V58 A;  2GS3 A;  3HXS A;  4ZBA A;  1G0T A;  2N5F A;  2VLT A;  3Q19 A;  4WET A;  4TXV A;  3MAK A;  2CVK A;  2JL4 A;  1MD4 A;  1AQW A;  2ON5 A;  3I69 A;  2LS5 A;  2VCX A;  5ID2 B;  2H0G A;  1JLV A;  4MK3 A;  4ZL7 A;  1S3A A;  5JCU A;  1NW2 A;  4GSS A;  4G10 A;  3SWL A;  1R7H A;  3GKM A;  2JAC A;  2HXK A;  5CO3 A;  4HJ2 A;  3L78 A;  4OCF A;  5EVO A;  4N0Z A;  3GHA A;  4EKZ A;  4BVX B;  4O32 A;  2HRK A;  5IMV A;  4ZXG A;  5J9C A;  3AY8 A;  5HR0 A;  1YY7 A;  3VWV A;  5G5E A;  1YF1 A;  3WGX A;  2WUL A;  2B1K A;  5JCW A;  3KH7 A;  1O85 A;  3QMX A;  2H1A A;  2N5A A;  2HE3 A;  3F9U A;  1XZO A;  5IMF A;  3G7J A;  1I5G A;  2LRC A;  3EMX A;  1Z6M A;  2AB6 A;  3HVV A;  3KEB A;  4I2T A;  1TU8 A;  1WPI A;  1GUH A;  2D2Z A;  1GSS A;  2IMD A;  3UJ1 A;  3ME8 A;  2VCQ A;  2H6Z A;  1G7O A;  2JSZ A;  1VGL A;  1SJ6 A;  3APQ A;  3Q74 A;  2HYX A;  4N0V A;  2F51 A;  2J9H A;  2HI7 A;  2L5O A;  3IE3 A;  3NZN A;  1GP1 A;  4O7H A;  1V40 A;  3CTF A;  3VPT A;  5IO2 A;  2VAF A;  3O3T A;  2LNT A;  3FRC A;  3DWV A;  3PR8 A;  4KDU A;  2DML A;  1UVZ A;  2KP1 A;  4K7O A;  2VCZ A;  3F6F A;  4J56 E;  4PGT A;  2ZNM A;  5CAX A;  5GST A;  3ZRD A;  2C80 A;  5CRE A;  4D73 B;  3RDW A;  4KX4 A;  2FD3 A;  4MF5 A;  1F9M A;  5D9X A;  2B6M A;  2JSY A;  5H5R A;  3TJF A;  1DBY A;  4N11 A;  2FNO A;  2DMM A;  1EGO A;  4XIH A;  3A2X A;  1V2A A;  1E6B A;  3ED3 A;  1AQV A;  2VO4 A;  1GSD A;  3Q18 A;  1DE2 A;  3IC8 A;  2EIO A;  4PTS A;  2PMT A;  2YZH A;  3D21 A;  2X8G A;  4Z7X A;  1M2D A;  1M7T A;  4DVC A;  5C00 A;  4EE0 A;  4MCU A;  3HVS A;  4BL7 A;  4N30 A;  3EMP A;  1UA5 A;  2MBT A;  1K0D A;  5B8A A;  4JZQ A;  2LST A;  1WE0 A;  2PPT A;  1GTA A;  2DSA A;  5G1L A;  2R5G A;  2V2G A;  3F4T A;  2CZ3 A;  3G7Y A;  1H4O A;  2VOC A;  2LEG A;  2C8U A;  5LCZ A;  1SJI A;  1T3B A;  3UAR A;  1U3I A;  1K0A A;  3I6A A;  5DAL B;  2BMX A;  1JZO A;  3BCI A;  3DD3 A;  3EU4 A;  1EV9 A;  1ZCP A;  3IPZ A;  4PNG A;  1A23 A;  3ERF A;  2XPD A;  5IMD A;  1XVW A;  5DJM A;  1USB A;  1XXU A;  3TOT A;  1OC9 A;  3VPQ A;  4OFM A;  1HNA A;  5IMA A;  3WT1 A;  4X43 A;  1NHO A;  5GAN D;  1K3O A;  4ULX A;  1WJK A;  1AC1 A;  4TR1 B;  1OKT A;  4IKH A;  3LGC A;  1TTZ A;  2TRC P;  1EEJ A;  1YJ6 A;  4I6X A;  2GGT A;  1Z5Y E;  2C3T A;  4Q5R A;  1SKW B;  2MZC A; 
#chains in the Genus database with same CATH topology
 4TN8 A;  4XS6 A;  3TJJ A;  1GLQ A;  4F2I A;  2WW1 A;  4ECB A;  2OE3 A;  3APO A;  1HNB A;  5FT3 A;  2YN1 A;  4O92 A;  1TK8 B;  5DBQ A;  1K3L A;  3FEU A;  1AIU A;  6GSY A;  3W6G A;  2GZZ A;  4EUY A;  1HNC A;  4K9Z A;  3TKQ A;  3F3R A;  1Y1U A;  1O73 A;  2DLX A;  12GS A;  1VF4 A;  2GLR A;  3FZ4 A;  5B7C A;  4L5O A;  4IJI A;  5E59 A;  4IJ3 A;  4H86 A;  1YF0 A;  4W66 A;  5ECO B;  2RLI A;  3CYN A;  4ZBB A;  2L6D A;  4POK A;  2G0F A;  3LYP A;  1GSE A;  3GH6 A;  4HS1 A;  1TRV A;  1DE1 A;  5ID2 A;  1A24 A;  2GVP A;  2REM A;  2H01 A;  5ECH B;  3JCM L;  2QA2 A;  4FYB A;  4WKW A;  5IPG A;  3EUR A;  2XPE A;  5F06 A;  3ZIV A;  3ZZX A;  4MDC A;  2HRN A;  2OAD A;  3HHV A;  1M3J A;  3ISO A;  3KJY A;  2WZS A;  1R5A A;  5DQY A;  1T8E B;  5A4V A;  1BJX A;  3P7X A;  4IEL A;  5ENU A;  4IW9 A;  1TW9 A;  5GAP D;  1X5D A;  3KD0 A;  3IBH A;  3WD6 A;  4HZ4 A;  5AN1 A;  1BX9 A;  4QMK A;  1Z3E A;  2B3S A;  3NOF A;  5F07 A;  5ABR A;  4L0U A;  5EY6 A;  4J2F A;  1TI1 A;  4POL A;  2H1B A;  2HSN B;  3GH9 A;  4EDZ A;  2HRA A;  3VLN A;  4DEJ A;  5DCH A;  2ZCT A;  4K0G A;  3TJB A;  3HMJ G;  2YNX A;  2E7P A;  2CX3 A;  3LSZ A;  4USS A;  3Q6O A;  3O6T A;  4NMU A;  1FOV A;  2JAD A;  2I3Y A;  2K8S A;  1JZR A;  1AXD A;  5J4U A;  18GS A;  2I9H A;  2X64 A;  6GSV A;  1U3A A;  1BG1 A;  1XBS A;  2VUP A;  1PA3 A;  2MMA A;  2N5B A;  3VUR A;  4WR5 A;  2YJ7 A;  1ZOF A;  5F8B A;  3UBK A;  1PFO A;  3KCM A;  1SYX A;  3FZ9 A;  2H1G A;  3C8E A;  3TRQ A;  5HR1 A;  5GSS A;  4TKY A;  3GFK A;  2O7K A;  4GST A;  5J41 A;  1J08 A;  4KB3 A;  5DDL A;  1AW9 A;  2GST A;  1A2M A;  1W89 A;  2PGT A;  1IYH A;  3ZML A;  5HR3 A;  4G0L A;  4GRF A;  5ECR B;  1W4V A;  3QFA C;  3UL3 A;  1M0U A;  5JWQ B;  1Z6N A;  5ECN B;  1HYU A;  4E8H A;  4OFT A;  1EP7 A;  1SJZ A;  4ID0 A;  4KSM A;  2PVQ A;  1YQ1 A;  1MD3 A;  2YPM A;  1H75 A;  3J7Y b;  1GSF A;  1JZW A;  3RPP A;  1EV4 A;  3GKK A;  1WIK A;  2VLV A;  4PUA A;  3I9V 2;  1OC9 B;  3HJO A;  8GSS A;  4MJE A;  1ACV A;  2HSM B;  5A4U A;  2Z9S A;  1A2L A;  1TJD A;  1B48 A;  4BA7 A;  3CSH A;  4X0X A;  2H0H A;  2LV3 A;  3MYD A;  3BCK A;  2L59 A;  2CX4 A;  4XS4 A;  1YVL A;  4V2M A;  4F0B A;  1KTE A;  5B6M A;  3H79 A;  5COH A;  2V32 A;  1F2E A;  5ECQ B;  2LQQ A;  1ZYE A;  4L5L A;  2GQL A;  5J40 A;  4AGS A;  5CYY A;  4MJA A;  1Z7P A;  2HQT A;  3KTB A;  4WXT A;  5CP1 A;  3TKS E;  5HQP A;  1N25 A;  2I81 A;  1J0F A;  3G7I A;  1LU4 A;  5G1K A;  4CHS A;  1F6M C;  1GLP A;  2OE0 A;  4AJ6 A;  1NSW A;  3GL5 A;  3UIW A;  4I5Q A;  3ZFB A;  2VCV A;  5AIV A;  2FWH A;  1WOU A;  4I8B A;  5DAL A;  3CBU A;  5D73 A;  4K5S A;  3QOU A;  1ON4 A;  1AQX A;  1U6T A;  2O36 A;  3I43 A;  1YEX A;  1ABA A;  2OBI A;  3IA1 A;  2LTK A;  2IMF A;  1XWK A;  2YV7 A;  2F9S A;  5B6N A;  5H5S A;  1ZMA A;  1FG4 A;  5ELA A;  2KLX A;  3UBL A;  2LUS A;  2IN3 A;  1OC8 A;  3IRA A;  5BMU A;  3CSI A;  3FYG A;  5CRH A;  5IO0 A;  4MH2 A;  4TR1 A;  1TP9 A;  2R2J A;  1PRX A;  3L9S A;  2YAN A;  3TGZ A;  4LMW A;  4F82 A;  2BTO T;  4XTS A;  3HY2 A;  2XBQ A;  5DQS A;  2X99 A;  2IFQ B;  4EC0 A;  1T1V A;  5DAK B;  3BJ5 A;  3ZRE A;  3IXR A;  1SVM A;  1JFU A;  4NAX A;  3QDN A;  1MEK A;  3CXG A;  2RUE A;  2HRF A;  4MMM A;  3UVT A;  4HUA A;  2JU5 A;  4Z2R A;  1ST9 A;  3FY7 A;  2R0P A;  2NTO A;  3GUS A;  2LQO A;  5JWO B;  2OKA A;  2AUV A;  1ZYQ B;  4FIW A;  4AF2 A;  3QCP A;  4MZB A;  5KOW A;  1GTB A;  2WS2 A;  1ML6 A;  2VL2 A;  1BYE A;  1XWB A;  2FGX A;  2B7J A;  4KGI A;  2HLS A;  1EP8 A;  6GSX A;  3ZLP A;  2FHE A;  3MDK A;  4EDY A;  4XHM A;  2E2M A;  10GS A;  1M2B A;  4ZIL A;  2H73 A;  3CWG A;  2RM5 A;  4WF4 A;  2C3Q A;  4LA1 A;  4OO4 A;  1TK5 B;  1XWC A;  2X4A A;  5DVB A;  3CSJ A;  3UEM A;  3ZL5 A;  1O7U A;  3BBY A;  1T7P B;  4F03 A;  3GKX A;  1A8Y A;  3HD5 A;  3US3 A;  2C4J A;  3LW9 A;  3HZ8 A;  4X4J A;  5G31 A;  2EIQ A;  1XFL A;  1X9W B;  2E2G A;  3H1N A;  4MAB A;  4Q5F A;  2IJY A;  4LLR A;  1TXX A;  1QK8 A;  2AV4 A;  3FZA A;  4TXO B;  5A5K A;  3A5I A;  3IK7 A;  1GRX A;  2FCH A;  2O89 A;  3EU3 A;  5KN1 A;  4BIK A;  4HZ2 A;  1S3C A;  3F0I A;  2FWE A;  1OVN A;  1I9D A;  2EFC A;  3D0Z A;  2HZF A;  2PVO C;  2HSN A;  1PN9 A;  3WGD A;  13GS A;  4RI7 A;  1PL2 A;  2NBS A;  2PBJ A;  5ECL B;  2XC2 A;  3GUR A;  4FQU A;  1RQM A;  3DVX A;  1SD8 A;  1A8L A;  2HSH A;  3DYR A;  4DSS B;  3QR6 A;  4PQI A;  3MWH A;  2VD1 A;  4KDX A;  4QQ7 A;  2GT6 A;  3WT2 A;  4WBJ A;  3KH9 A;  3M9K A;  5D96 A;  2CT6 A;  3RHC A;  2MBS A;  2C3N A;  4RQX A;  1FVJ A;  4K0N A;  5KN3 A;  4KCA A;  1F37 A;  4XS4 B;  1XOB A;  5AIS A;  4O5U A;  3R2Q A;  2P5R A;  1ZGN A;  3C71 A;  2JZS A;  2WFC A;  2FWG A;  2FA4 A;  1WMJ A;  2AJQ B;  3TKR A;  2NDO A;  4JU5 A;  2IMI A;  4PI2 C;  3D4T A;  5KN2 A;  2VLU A;  3U6V A;  4QL9 A;  1GTI A;  5GZZ B;  3FR6 A;  1JZD A;  3G9B A;  3FHK A;  4KW6 A;  2UV8 G;  3GMF A;  3RAZ A;  1HQO A;  2MYG A;  3QAV A;  2EIR A;  4EF0 A;  1OKD A;  4YAP A;  2WZ9 A;  2CZ2 A;  1YZX A;  5E4W A;  3DGQ A;  2L4Q A;  3CRU A;  4K5R A;  1PKW A;  2HT9 A;  4HU9 A;  1EEM A;  1M99 A;  1LBK A;  2UZ8 A;  3TOU A;  2CVD A;  2DJK A;  4PUF C;  4HOJ A;  4NV2 A;  4YAV A;  2H6X A;  5A1N B;  2HSM A;  2VM1 A;  4MP4 A;  1K3Y A;  5J4Y A;  5A4W A;  4K8M A;  1QFN A;  4POB A;  3IV4 A;  4X1U A;  2WW3 A;  2DKI A;  1FAA A;  2PWJ A;  2R0C A;  3GKN A;  4GF0 A;  2MMZ A;  4I97 A;  4KAE A;  5F0G A;  1TK0 B;  4NPB A;  4FH8 A;  4GQC A;  3DXB A;  5CRD A;  4MPG A;  4TW5 A;  2I1U A;  2EFH A;  2PU9 C;  1X0R A;  1QMV A;  4YQV A;  2YWM A;  5G30 A;  5A5H B;  4ZL8 A;  2H70 A;  1IYI A;  4OO5 A;  2WB9 A;  1A0R P;  4OD7 A;  3M3M A;  3A3T A;  5D9V A;  1XW5 A;  2M46 A;  1SU9 A;  2V41 A;  3LG6 A;  3A2W A;  1MTC A;  3A5W A;  1SD9 A;  2WDU A;  3LEF A;  1GUK A;  4GQF A;  1Z7R A;  1TRS A;  3EVI A;  6GSW A;  3IAS 2;  1WP0 A;  3QAG A;  1GNW A;  5G5F A;  1ZZY A;  4WBR D;  2OA7 A;  2HZE B;  2NPB A;  3F4S A;  4HJM A;  1ERV A;  2WRT A;  3CRT A;  4PUR A;  3F3Q A;  4JBB A;  3F6D A;  1OE8 A;  3MNG A;  1B8X A;  5D93 A;  4FXY P;  4HEA 2;  3QFB C;  1TI3 A;  1GSU A;  1G7E A;  4MF7 A;  2WGR A;  2YZU A;  3KXO A;  2VM2 A;  3PH9 A;  3CQF A;  3S9F A;  2FY6 A;  1AUC A;  4HDE A;  4P3Y B;  4LL4 B;  4JE1 A;  2PER A;  3H4K A;  2IFQ A;  1TRW A;  5DAK A;  1X9M B;  4O5R A;  4G19 A;  1X5E A;  1XW6 A;  3BOA A;  3P90 A;  3LWA A;  1FO5 A;  4F9Z A;  4DSR A;  2OAC A;  1THX A;  2GZP A;  1MDK A;  1RW1 A;  4I2U A;  1QQ2 A;  3FK8 A;  2CA8 A;  4TR3 A;  4MJB A;  5ECM B;  2DKH A;  4IP6 A;  2H71 A;  1VRS D;  3TKS A;  4AJ7 A;  3C73 A;  3D22 A;  5HR2 A;  1R26 A;  2J23 A;  5BRT A;  4EIP A;  1G6W A;  4CW9 A;  3W8J A;  2B7K A;  4AKX B;  2R37 A;  1RK4 A;  1EGR A;  5FHI A;  2O3E A;  4E8E A;  1AAZ A;  2ES7 A;  4MLY A;  3ZIT A;  3TKS C;  3RHB A;  2OT3 A;  1FB6 A;  5CRG A;  4FO5 A;  4E68 A;  3GL3 A;  1KEB A;  1BF5 A;  4KSO A;  2H6Y A;  3KP9 A;  5C04 A;  4KND A;  2LJR A;  1GWC A;  3RPN A;  4CY6 A;  1PX7 A;  4TRX A;  2DJ3 A;  3SBC A;  3GRX A;  3N5O A;  2YP6 A;  3KM6 A;  1ERU A;  3D4M A;  4TXO A;  4L8E A;  4NHZ A;  3HKR A;  4ECI A;  1QXH A;  1FVK A;  3M9J A;  3IAM 2;  3PPU A;  4YQU A;  4TVE A;  2OJL A;  2PUK C;  1FB0 A;  1SK2 A;  3V1W A;  2CVB A;  2E0Q A;  2NVL A;  5EL8 A;  1MDI A;  3TU3 B;  4DSS A;  4ECJ A;  2VCT A;  4IVF A;  1X5C A;  5J4V A;  1GTU A;  4G9H A;  3GX0 A;  3K8N A;  4PNF A;  19GS A;  3E0U A;  2O5V A;  5KN0 A;  3FR9 A;  5HFG A;  2G2Q A;  3F4R A;  3KGK A;  4WEY A;  3EPT A;  3HVN A;  1SK0 A;  3VWU A;  1OYJ A;  2O8V B;  3FMW A;  1XCC A;  2IMK A;  4ILF A;  1N2A A;  3VFI A;  2LRN A;  1GH2 A;  3GX8 A;  1YEP A;  1BAY A;  2GTU A;  6GST A;  4XCS A;  1X9S B;  3ZIJ A;  3PIN A;  1EWX A;  2ON7 A;  1GNE A;  2H19 A;  3P8W A;  1PQN A;  2O87 A;  2VL3 A;  2DC5 A;  3L0H A;  1O81 A;  4TOP A;  2O85 A;  4JRR A;  2QC7 A;  2AHE A;  1Z9H A;  5A34 B;  5ECP B;  2YCD A;  2B5E A;  3CTG A;  3IR4 A;  1XVQ A;  4PQ1 A;  5KEJ A;  2OE1 A;  1PGT A;  3CHX C;  2B5Y A;  4ML6 A;  2DIZ A;  5D9W A;  5LNK e;  3TRP A;  5A1N A;  3TRX A;  2HSY A;  3HVX A;  1K0N A;  1GUM A;  3DEX A;  4IHU A;  3E9J B;  3LXZ A;  2V6K A;  3HJM A;  1ILO A;  3GST A;  2IIY A;  1DUG A;  1B9Y C;  3UVH A;  2L5L A;  2H76 A;  4RQR A;  5AGY A;  2F3M A;  1PMT A;  5J9B A;  4PXO A;  1WWJ A;  4ISD A;  1PSQ A;  2H1D A;  3IK9 A;  1OC3 A;  4HQZ A;  5AIX A;  1F3B A;  1BED A;  4BWQ A;  4NWY A;  4MF6 A;  2WW2 A;  1TDI A;  4GCI A;  5A5H A;  3HA9 A;  1K0C A;  3ZYW A;  1SL0 B;  2DJ1 A;  3F8U A;  4MZC A;  4PI0 C;  2OBK A;  1YEW C;  2FA8 A;  3QPM A;  1A0F A;  2FWF A;  2F8F A;  3HCZ A;  4MH3 A;  4POM A;  3KMO A;  1PD2 1;  5H5Q A;  2LRT A;  1M9A A;  2FUG 2;  1R4W A;  2QKE A;  4BVY B;  4IN0 A;  4TR4 A;  3OR5 A;  2HFD A;  4EIQ A;  5D8I A;  2RM6 A;  5IMC A;  4K6X A;  2KP2 A;  3GA4 A;  4N3Z A;  4OCE A;  1QUW A;  4MNN A;  2K9F A;  1SYR A;  2HZE A;  4RI6 A;  3FZ5 A;  22GS A;  3GN3 A;  1E2Y A;  2B5X A;  3M0F A;  1Y25 A;  3P2A A;  4K1F A;  1PX6 A;  1Q4J A;  1LJR A;  3UOM A;  3NIV A;  5IOW A;  1TOF A;  4ZB6 A;  2EFD A;  2VL2 C;  3L9V A;  3F63 A;  2BJX A;  3DKS A;  5ECS A;  1NHY A;  4MA9 A;  3LJR A;  3LQ7 A;  2GSR A;  1EOG A;  4YKG A;  2K8V A;  5DJL A;  3HJP A;  2YWO A;  4EXJ A;  2VCW A;  2KUC A;  2GQK A;  4PQH A;  1K0B A;  2M80 A;  1XG8 A;  2GZY A;  5G2Z A;  1B9X C;  1KBN A;  1QGV A;  4NHW A;  2CAQ A;  2H66 A;  3DML A;  1VF1 A;  3WYW A;  5J5N A;  2AAW A;  1VF2 A;  4G2E A;  1YKA A;  1ZYN A;  5IPH A;  3KIJ A;  4IQ1 A;  3TCO A;  4Q5Q A;  4ICY A;  4ML1 A;  1SKR B;  1V9W A;  4GTU A;  4L0W A;  1CQH A;  2LJA A;  3TUE A;  3GTU A;  4XRA A;  2QGV A;  2LNS A;  4TR0 A;  5IOX A;  5IM9 A;  1XWG A;  4GDF A;  4FYC A;  3EC3 A;  2H0I A;  4K7I A;  4K2D A;  4KDY A;  4PHZ C;  5HFK A;  4G0I A;  1S3D A;  2PN8 A;  3APS A;  4ZBD A;  2DJ2 A;  3DRN A;  2L4C A;  3KP8 A;  4XRD A;  1XPV A;  1V98 A;  2IPA A;  2WJU A;  1V57 A;  2I4A A;  4EO3 A;  3RBT A;  2H72 A;  4EL1 A;  1SL2 B;  2L6C A;  3FR3 A;  2GDR A;  11GS A;  1NM3 A;  5INY A;  3L9U A;  3LYK A;  5B8B A;  4GWR A;  4WF5 A;  1SKS B;  4IQA A;  2YWN A;  4K7N A;  1O8W A;  4HI7 A;  2GSS A;  3ERW A;  3EIN A;  2GQM A;  2L57 A;  3KZQ A;  1BG5 A;  3ME7 A;  3E3E A;  3ZTL A;  1UC7 A;  1WRY A;  4MZW A;  2X49 A;  1M2A A;  3H93 A;  16GS A;  2JZT A;  4KCE A;  3FKF A;  6GSU A;  1EZK A;  4WR4 A;  2QSI A;  3C1S A;  2YJH A;  4HU7 A;  4QL7 A;  7GSS A;  4GLT A;  3C7M A;  1VF3 A;  3TJG A;  5FWG A;  5ELG A;  3GSS A;  4BPY A;  4YQM A;  4F0C A;  2R6K A;  3J7Y k;  3IDV A;  4ACS A;  2H75 A;  2DJJ A;  2MMO A;  2C0D A;  2X8C A;  2WVX B;  3D6I A;  2TRX A;  5IQY A;  1JHB A;  1YKC A;  4FYU A;  4HQS A;  4CDO A;  4N10 A;  3TKP A;  5A34 A;  1ERT A;  2VKZ G;  5ECI B;  1J9B A;  1PL1 A;  3W8S A;  3UAP A;  1K0O A;  2V1M A;  3HYP A;  4Z2T A;  4KF9 A;  1R5P A;  2MMN A;  5CNW A;  3ZVJ A;  3M8N A;  2H8L A;  1OE7 A;  6GSS A;  2JZR A;  2HRK B;  4GSN A;  2C0G A;  1GSQ A;  1TRU A;  5ECK B;  4LMV A;  2CQ9 A;  1U88 A;  5F05 A;  1SL1 B;  4LL1 B;  3M1G A;  1SK1 A;  1XOA A;  2C0E A;  2RUF A;  3EYT A;  5JWR B;  1TXU A;  1B4P A;  2H30 A;  3GYK A;  5JCG A;  4EVM A;  2YWI A;  1TKD B;  5KOX A;  4NV5 A;  3A2V A;  4OMV A;  3VWW A;  3UMA A;  2X8H A;  4HSC X;  4JED A;  1JLW A;  5IMZ A;  1F3A A;  4IBP A;  1O8X A;  4RUV A;  2WCI A;  4KH7 A;  3TDG A;  1HD2 A;  4ZB8 A;  2ALB A;  5J47 A;  20GS A;  3VWX A;  3H8Q A;  2IME A;  3IHG A;  4CY8 A;  1CQG A;  2XBI A;  3IOS A;  1U87 A;  2VD0 A;  5HFI A;  4G0K A;  4BVY A;  1C72 A;  4JR6 A;  2M72 A;  4ECC A;  1Q98 A;  2R4V A;  2LKU A;  4BVX A;  2FLS A;  4V2L A;  3N9J A;  2P0G A;  3IC4 A;  2VL9 A;  4OFN A;  4ZB9 A;  2EC4 A;  1I1I P;  3HZ4 A;  1ZYP A;  4IS0 A;  2H74 A;  3EWL A;  3DVW A;  1THO A;  3WGE A;  4XS1 A;  2RII A;  1K0M A;  4BWS A;  3QD9 A;  3GTU B;  4ZIJ A;  1ERW A;  3TJK A;  4ZL9 A;  4Q5N A;  2C1Y A;  1GSY A;  2H1L A;  3ZFL A;  5EPF A;  1XWA A;  4MPF A;  2K18 A;  5D9T A;  5DCG A;  4KA0 A;  2DIY A;  2ZUP A;  2CV4 A;  2YV9 A;  9GSS A;  2B1L A;  1ZL9 A;  3ZMK A;  2GT5 A;  3LXT A;  4AKG A;  4OWY A;  3KTL A;  1T00 A;  2P31 A;  2A4V A;  1N8J A;  1T4Z A;  4AKH A;  2LJK A;  4V2N A;  2VIM A;  3PGT A;  3TB2 A;  5IIZ A;  1GUL A;  3CMI A;  4BL7 B;  5J3R A;  3VI5 A;  3MIX A;  3DIE A;  4V1A g;  3KMN A;  2HNL A;  2XHF A;  3GNJ A;  1OAZ A;  1G6Y A;  1XIY A;  4AKI A;  4V1A p;  2A2S A;  3BD2 A;  3L4N A;  3ERG A;  4JR4 A;  2DBC A;  2A2R A;  2IWT A;  4D73 A;  3LOR A;  5L71 A;  3IHQ A;  1MDJ A;  2YOI A;  3HDC A;  4NXI A;  3VK9 A;  1BQ7 A;  1KNG A;  3C1R A;  3FW2 A;  3ZVJ D;  1FHE A;  3O76 A;  2R3X A;  2TIR A;  1GL8 A;  2DJ0 A;  4IP1 A;  4MJC A;  3R3E A;  1S4B P;  4PX1 A;  2GSQ A;  3GIX A;  2CAI A;  1T4Y A;  2P5Q A;  2C0F A;  1M9B A;  4ZB7 A;  3MSZ A;  4DSQ A;  2F8A A;  1B4Q A;  1FW1 A;  1PN0 A;  1UN2 A;  2A2P A;  1DSB A;  4YKF A;  4KE3 A;  3VI7 A;  2AYT A;  1S3R A;  14GS A;  4KUN A;  1EOH A;  2KHP A;  2V6O A;  3QAW A;  3RGB C;  17GS A;  4IGJ A;  2KOK A;  2WVY A;  1YDK A;  2K6V A;  3GV1 A;  2R0G A;  3LFL A;  5LD0 A;  3EE2 A;  1PKZ A;  1Y6E A;  4AJ8 A;  1O6J A;  1XW9 A;  4GXZ A;  4YH2 A;  4A5P A;  1A2J A;  4J57 E;  1TU7 A;  3U5R E;  1SEN A;  1URM A;  5CRW A;  3D5J A;  2IL3 A;  1V58 A;  2GS3 A;  3HXS A;  4ZBA A;  1G0T A;  2N5F A;  2VLT A;  3Q19 A;  4WET A;  4TXV A;  3MAK A;  2CVK A;  2JL4 A;  1MD4 A;  1AQW A;  2ON5 A;  3I69 A;  2LS5 A;  2VCX A;  5ID2 B;  2H0G A;  1JLV A;  4MK3 A;  4ZL7 A;  1S3A A;  2EFE A;  2WVX A;  5JCU A;  1NW2 A;  4GSS A;  4G10 A;  3SWL A;  1R7H A;  3GKM A;  2JAC A;  2HXK A;  5CO3 A;  4HJ2 A;  3L78 A;  4OCF A;  5EVO A;  4N0Z A;  3GHA A;  4EKZ A;  4BVX B;  4O32 A;  2HRK A;  5IMV A;  4ZXG A;  5J9C A;  3AY8 A;  5HR0 A;  1YY7 A;  3VWV A;  5G5E A;  1YF1 A;  3WGX A;  4Z2U A;  2WUL A;  2B1K A;  5JCW A;  3KH7 A;  1O85 A;  3QMX A;  2H1A A;  2N5A A;  2HE3 A;  3F9U A;  1XZO A;  5IMF A;  3G7J A;  1I5G A;  2LRC A;  3EMX A;  1Z6M A;  2AB6 A;  3HVV A;  3KEB A;  4I2T A;  1TU8 A;  1WPI A;  1GUH A;  2D2Z A;  1GSS A;  2IMD A;  3UJ1 A;  3ME8 A;  2VCQ A;  2H6Z A;  1G7O A;  2JSZ A;  1VGL A;  1SJ6 A;  3APQ A;  3Q74 A;  2HYX A;  4N0V A;  2F51 A;  2J9H A;  2HI7 A;  2L5O A;  3IE3 A;  3NZN A;  1GP1 A;  4O7H A;  1V40 A;  3CTF A;  3VPT A;  5IO2 A;  4G01 A;  2VAF A;  3O3T A;  2LNT A;  3FRC A;  3DWV A;  3PR8 A;  4KDU A;  2DML A;  1UVZ A;  2KP1 A;  4K7O A;  2VCZ A;  3F6F A;  4J56 E;  4PGT A;  2ZNM A;  1SVL A;  5CAX A;  5GST A;  3ZRD A;  2C80 A;  5CRE A;  4D73 B;  3RDW A;  4KX4 A;  2FD3 A;  2QA1 A;  4MF5 A;  1F9M A;  5D9X A;  2B6M A;  2JSY A;  5H5R A;  3TJF A;  1DBY A;  4N11 A;  2FNO A;  2DMM A;  1EGO A;  4XIH A;  3A2X A;  1V2A A;  1E6B A;  3ED3 A;  1AQV A;  2VO4 A;  1GSD A;  3Q18 A;  1DE2 A;  2WW0 A;  3IC8 A;  2EIO A;  4PTS A;  2PMT A;  2YZH A;  3D21 A;  2X8G A;  4Z7X A;  1M2D A;  1M7T A;  4DVC A;  5C00 A;  4EE0 A;  4MCU A;  3HVS A;  4BL7 A;  4N30 A;  3EMP A;  1UA5 A;  2MBT A;  1K0D A;  5B8A A;  4JZQ A;  2LST A;  1WE0 A;  2PPT A;  1GTA A;  2WVZ A;  2DSA A;  5G1L A;  2R5G A;  2V2G A;  3F4T A;  2CZ3 A;  3G7Y A;  1H4O A;  2VOC A;  1SVO A;  2LEG A;  2C8U A;  5LCZ A;  1SJI A;  1T3B A;  3UAR A;  1U3I A;  1K0A A;  3I6A A;  5DAL B;  2BMX A;  1JZO A;  1FOH A;  3BCI A;  3DD3 A;  4AI6 A;  3RFR C;  3EU4 A;  1EV9 A;  1ZCP A;  3IPZ A;  4PNG A;  1A23 A;  3ERF A;  2XPD A;  5IMD A;  1XVW A;  5DJM A;  1USB A;  1XXU A;  3TOT A;  1OC9 A;  3VPQ A;  1M3I A;  4OFM A;  1HNA A;  5IMA A;  3WT1 A;  4X43 A;  1NHO A;  5GAN D;  1K3O A;  4ULX A;  1WJK A;  5BMU B;  4O5Q A;  1AC1 A;  2A4H A;  4TR1 B;  1OKT A;  4K2X A;  4IKH A;  3LGC A;  1TTZ A;  2TRC P;  1EEJ A;  1YJ6 A;  4I6X A;  2GGT A;  1Z5Y E;  2C3T A;  4Q5R A;  1SKW B;  2MZC A; 
#chains in the Genus database with same CATH homology
 4TN8 A;  4XS6 A;  3TJJ A;  1GLQ A;  4F2I A;  4ECB A;  2OE3 A;  3APO A;  1HNB A;  5FT3 A;  2YN1 A;  4O92 A;  1TK8 B;  5DBQ A;  1K3L A;  3FEU A;  1AIU A;  6GSY A;  3W6G A;  2GZZ A;  4EUY A;  1HNC A;  4K9Z A;  3TKQ A;  3F3R A;  1Y1U A;  1O73 A;  2DLX A;  12GS A;  1VF4 A;  2GLR A;  3FZ4 A;  5B7C A;  4L5O A;  4IJI A;  5E59 A;  4IJ3 A;  4H86 A;  1YF0 A;  4W66 A;  5ECO B;  2RLI A;  3CYN A;  4ZBB A;  2L6D A;  4POK A;  2G0F A;  3LYP A;  1GSE A;  3GH6 A;  4HS1 A;  1TRV A;  1DE1 A;  5ID2 A;  1A24 A;  2GVP A;  2REM A;  2H01 A;  5ECH B;  3JCM L;  2QA2 A;  4FYB A;  4WKW A;  5IPG A;  3EUR A;  2XPE A;  5F06 A;  3ZIV A;  3ZZX A;  4MDC A;  2HRN A;  2OAD A;  3HHV A;  3ISO A;  3KJY A;  1R5A A;  5DQY A;  1T8E B;  5A4V A;  1BJX A;  3P7X A;  4IEL A;  5ENU A;  4IW9 A;  1TW9 A;  5GAP D;  1X5D A;  3KD0 A;  3IBH A;  3WD6 A;  4HZ4 A;  5AN1 A;  1BX9 A;  4QMK A;  1Z3E A;  2B3S A;  3NOF A;  5F07 A;  5ABR A;  4L0U A;  5EY6 A;  4J2F A;  1TI1 A;  4POL A;  2H1B A;  2HSN B;  3GH9 A;  4EDZ A;  2HRA A;  3VLN A;  4DEJ A;  5DCH A;  2ZCT A;  4K0G A;  3TJB A;  3HMJ G;  2YNX A;  2E7P A;  2CX3 A;  3LSZ A;  4USS A;  3Q6O A;  3O6T A;  4NMU A;  1FOV A;  2JAD A;  2I3Y A;  2K8S A;  1JZR A;  1AXD A;  5J4U A;  18GS A;  2I9H A;  2X64 A;  6GSV A;  1U3A A;  1BG1 A;  1XBS A;  2VUP A;  1PA3 A;  2MMA A;  2N5B A;  3VUR A;  4WR5 A;  2YJ7 A;  1ZOF A;  5F8B A;  3UBK A;  3KCM A;  1SYX A;  3FZ9 A;  2H1G A;  3C8E A;  3TRQ A;  5HR1 A;  5GSS A;  4TKY A;  3GFK A;  2O7K A;  4GST A;  5J41 A;  1J08 A;  4KB3 A;  5DDL A;  1AW9 A;  2GST A;  1A2M A;  1W89 A;  2PGT A;  1IYH A;  3ZML A;  5HR3 A;  4G0L A;  4GRF A;  5ECR B;  1W4V A;  3QFA C;  3UL3 A;  1M0U A;  5JWQ B;  1Z6N A;  5ECN B;  1HYU A;  4E8H A;  4OFT A;  1EP7 A;  1SJZ A;  4ID0 A;  4KSM A;  2PVQ A;  1YQ1 A;  1MD3 A;  2YPM A;  1H75 A;  3J7Y b;  1GSF A;  1JZW A;  3RPP A;  1EV4 A;  3GKK A;  1WIK A;  2VLV A;  4PUA A;  3I9V 2;  1OC9 B;  3HJO A;  8GSS A;  4MJE A;  1ACV A;  2HSM B;  5A4U A;  2Z9S A;  1A2L A;  1TJD A;  1B48 A;  4BA7 A;  3CSH A;  4X0X A;  2H0H A;  2LV3 A;  3MYD A;  3BCK A;  2L59 A;  2CX4 A;  4XS4 A;  1YVL A;  4V2M A;  4F0B A;  1KTE A;  5B6M A;  3H79 A;  5COH A;  2V32 A;  1F2E A;  5ECQ B;  2LQQ A;  1ZYE A;  4L5L A;  2GQL A;  5J40 A;  4AGS A;  5CYY A;  4MJA A;  1Z7P A;  2HQT A;  3KTB A;  4WXT A;  5CP1 A;  3TKS E;  5HQP A;  1N25 A;  2I81 A;  1J0F A;  3G7I A;  1LU4 A;  5G1K A;  4CHS A;  1F6M C;  1GLP A;  2OE0 A;  4AJ6 A;  1NSW A;  3GL5 A;  3UIW A;  4I5Q A;  3ZFB A;  2VCV A;  5AIV A;  2FWH A;  1WOU A;  4I8B A;  5DAL A;  3CBU A;  5D73 A;  4K5S A;  3QOU A;  1ON4 A;  1AQX A;  1U6T A;  3I43 A;  1YEX A;  1ABA A;  2OBI A;  3IA1 A;  2LTK A;  2IMF A;  1XWK A;  2YV7 A;  2F9S A;  5B6N A;  5H5S A;  1ZMA A;  1FG4 A;  5ELA A;  2KLX A;  3UBL A;  2LUS A;  2IN3 A;  1OC8 A;  3IRA A;  5BMU A;  3CSI A;  3FYG A;  5CRH A;  5IO0 A;  4MH2 A;  4TR1 A;  1TP9 A;  2R2J A;  1PRX A;  3L9S A;  2YAN A;  3TGZ A;  4LMW A;  4F82 A;  2BTO T;  4XTS A;  3HY2 A;  2XBQ A;  5DQS A;  2X99 A;  2IFQ B;  4EC0 A;  1T1V A;  5DAK B;  3BJ5 A;  3ZRE A;  3IXR A;  1SVM A;  1JFU A;  4NAX A;  3QDN A;  1MEK A;  3CXG A;  2RUE A;  2HRF A;  4MMM A;  3UVT A;  4HUA A;  2JU5 A;  4Z2R A;  1ST9 A;  3FY7 A;  2R0P A;  2NTO A;  3GUS A;  2LQO A;  5JWO B;  2OKA A;  2AUV A;  1ZYQ B;  4FIW A;  4AF2 A;  3QCP A;  4MZB A;  5KOW A;  1GTB A;  2WS2 A;  1ML6 A;  2VL2 A;  1BYE A;  1XWB A;  2FGX A;  2B7J A;  4KGI A;  2HLS A;  1EP8 A;  6GSX A;  3ZLP A;  2FHE A;  3MDK A;  4EDY A;  4XHM A;  2E2M A;  10GS A;  1M2B A;  4ZIL A;  2H73 A;  3CWG A;  2RM5 A;  4WF4 A;  2C3Q A;  4LA1 A;  4OO4 A;  1TK5 B;  1XWC A;  2X4A A;  5DVB A;  3CSJ A;  3UEM A;  3ZL5 A;  1O7U A;  3BBY A;  1T7P B;  4F03 A;  3GKX A;  1A8Y A;  3HD5 A;  3US3 A;  2C4J A;  3LW9 A;  3HZ8 A;  4X4J A;  5G31 A;  2EIQ A;  1XFL A;  1X9W B;  2E2G A;  3H1N A;  4MAB A;  4Q5F A;  2IJY A;  4LLR A;  1TXX A;  1QK8 A;  2AV4 A;  3FZA A;  4TXO B;  5A5K A;  3A5I A;  3IK7 A;  1GRX A;  2FCH A;  2O89 A;  3EU3 A;  5KN1 A;  4HZ2 A;  1S3C A;  3F0I A;  2FWE A;  1OVN A;  1I9D A;  2EFC A;  3D0Z A;  2HZF A;  2PVO C;  2HSN A;  1PN9 A;  3WGD A;  13GS A;  4RI7 A;  1PL2 A;  2NBS A;  2PBJ A;  5ECL B;  2XC2 A;  3GUR A;  4FQU A;  1RQM A;  3DVX A;  1SD8 A;  1A8L A;  2HSH A;  3DYR A;  4DSS B;  3QR6 A;  4PQI A;  3MWH A;  2VD1 A;  4KDX A;  4QQ7 A;  2GT6 A;  3WT2 A;  4WBJ A;  3KH9 A;  3M9K A;  5D96 A;  2CT6 A;  3RHC A;  2MBS A;  2C3N A;  4RQX A;  1FVJ A;  4K0N A;  5KN3 A;  4KCA A;  1F37 A;  4XS4 B;  1XOB A;  5AIS A;  4O5U A;  3R2Q A;  2P5R A;  1ZGN A;  3C71 A;  2JZS A;  2WFC A;  2FWG A;  2FA4 A;  1WMJ A;  2AJQ B;  3TKR A;  2NDO A;  4JU5 A;  2IMI A;  3D4T A;  5KN2 A;  2VLU A;  3U6V A;  4QL9 A;  1GTI A;  5GZZ B;  3FR6 A;  1JZD A;  3G9B A;  3FHK A;  4KW6 A;  2UV8 G;  3GMF A;  3RAZ A;  1HQO A;  2MYG A;  3QAV A;  2EIR A;  4EF0 A;  1OKD A;  4YAP A;  2WZ9 A;  2CZ2 A;  1YZX A;  5E4W A;  3DGQ A;  2L4Q A;  3CRU A;  4K5R A;  1PKW A;  2HT9 A;  4HU9 A;  1EEM A;  1M99 A;  1LBK A;  2UZ8 A;  3TOU A;  2CVD A;  2DJK A;  4PUF C;  4HOJ A;  4NV2 A;  4YAV A;  2H6X A;  5A1N B;  2HSM A;  2VM1 A;  4MP4 A;  1K3Y A;  5J4Y A;  5A4W A;  4K8M A;  1QFN A;  4POB A;  3IV4 A;  4X1U A;  2DKI A;  1FAA A;  2PWJ A;  2R0C A;  3GKN A;  4GF0 A;  2MMZ A;  4I97 A;  4KAE A;  5F0G A;  1TK0 B;  4NPB A;  4FH8 A;  4GQC A;  3DXB A;  5CRD A;  4MPG A;  4TW5 A;  2I1U A;  2EFH A;  2PU9 C;  1X0R A;  1QMV A;  4YQV A;  2YWM A;  5G30 A;  5A5H B;  4ZL8 A;  2H70 A;  1IYI A;  4OO5 A;  2WB9 A;  1A0R P;  4OD7 A;  3M3M A;  3A3T A;  5D9V A;  1XW5 A;  2M46 A;  1SU9 A;  2V41 A;  3LG6 A;  3A2W A;  1MTC A;  3A5W A;  1SD9 A;  2WDU A;  3LEF A;  1GUK A;  4GQF A;  1Z7R A;  1TRS A;  3EVI A;  6GSW A;  3IAS 2;  1WP0 A;  3QAG A;  1GNW A;  5G5F A;  1ZZY A;  4WBR D;  2OA7 A;  2HZE B;  2NPB A;  3F4S A;  4HJM A;  1ERV A;  2WRT A;  3CRT A;  4PUR A;  3F3Q A;  4JBB A;  3F6D A;  1OE8 A;  3MNG A;  1B8X A;  5D93 A;  4HEA 2;  3QFB C;  1TI3 A;  1GSU A;  1G7E A;  4MF7 A;  2WGR A;  2YZU A;  3KXO A;  2VM2 A;  3PH9 A;  3S9F A;  2FY6 A;  1AUC A;  4HDE A;  4P3Y B;  4LL4 B;  4JE1 A;  2PER A;  3H4K A;  2IFQ A;  1TRW A;  5DAK A;  1X9M B;  4O5R A;  4G19 A;  1X5E A;  1XW6 A;  3BOA A;  3P90 A;  3LWA A;  1FO5 A;  4F9Z A;  4DSR A;  2OAC A;  1THX A;  2GZP A;  1MDK A;  1RW1 A;  4I2U A;  1QQ2 A;  3FK8 A;  2CA8 A;  4TR3 A;  4MJB A;  5ECM B;  2DKH A;  4IP6 A;  2H71 A;  1VRS D;  3TKS A;  4AJ7 A;  3C73 A;  3D22 A;  5HR2 A;  1R26 A;  2J23 A;  5BRT A;  4EIP A;  1G6W A;  4CW9 A;  3W8J A;  2B7K A;  4AKX B;  2R37 A;  1RK4 A;  1EGR A;  5FHI A;  4E8E A;  1AAZ A;  2ES7 A;  4MLY A;  3ZIT A;  3TKS C;  3RHB A;  2OT3 A;  1FB6 A;  5CRG A;  4FO5 A;  4E68 A;  3GL3 A;  1KEB A;  1BF5 A;  4KSO A;  2H6Y A;  3KP9 A;  5C04 A;  4KND A;  2LJR A;  1GWC A;  3RPN A;  4CY6 A;  1PX7 A;  4TRX A;  2DJ3 A;  3SBC A;  3GRX A;  3N5O A;  2YP6 A;  3KM6 A;  1ERU A;  3D4M A;  4TXO A;  4L8E A;  4NHZ A;  3HKR A;  4ECI A;  1QXH A;  1FVK A;  3M9J A;  3IAM 2;  3PPU A;  4YQU A;  4TVE A;  2OJL A;  2PUK C;  1FB0 A;  1SK2 A;  3V1W A;  2CVB A;  2E0Q A;  2NVL A;  5EL8 A;  1MDI A;  3TU3 B;  4DSS A;  4ECJ A;  2VCT A;  4IVF A;  1X5C A;  5J4V A;  1GTU A;  4G9H A;  3GX0 A;  3K8N A;  4PNF A;  19GS A;  3E0U A;  2O5V A;  5KN0 A;  3FR9 A;  5HFG A;  2G2Q A;  3F4R A;  3KGK A;  4WEY A;  3EPT A;  1SK0 A;  3VWU A;  1OYJ A;  2O8V B;  3FMW A;  1XCC A;  2IMK A;  4ILF A;  1N2A A;  3VFI A;  2LRN A;  1GH2 A;  3GX8 A;  1YEP A;  1BAY A;  2GTU A;  6GST A;  4XCS A;  1X9S B;  3ZIJ A;  3PIN A;  1EWX A;  2ON7 A;  1GNE A;  2H19 A;  3P8W A;  1PQN A;  2O87 A;  2VL3 A;  2DC5 A;  3L0H A;  1O81 A;  4TOP A;  2O85 A;  4JRR A;  2QC7 A;  2AHE A;  1Z9H A;  5A34 B;  5ECP B;  2YCD A;  2B5E A;  3CTG A;  3IR4 A;  1XVQ A;  4PQ1 A;  5KEJ A;  2OE1 A;  1PGT A;  2B5Y A;  4ML6 A;  2DIZ A;  5D9W A;  5LNK e;  3TRP A;  5A1N A;  3TRX A;  2HSY A;  3HVX A;  1K0N A;  1GUM A;  3DEX A;  4IHU A;  3E9J B;  3LXZ A;  2V6K A;  3HJM A;  1ILO A;  3GST A;  2IIY A;  1DUG A;  1B9Y C;  3UVH A;  2L5L A;  2H76 A;  4RQR A;  5AGY A;  2F3M A;  1PMT A;  5J9B A;  4PXO A;  1WWJ A;  4ISD A;  1PSQ A;  2H1D A;  3IK9 A;  1OC3 A;  4HQZ A;  5AIX A;  1F3B A;  1BED A;  4BWQ A;  4NWY A;  4MF6 A;  1TDI A;  4GCI A;  5A5H A;  3HA9 A;  1K0C A;  3ZYW A;  1SL0 B;  2DJ1 A;  3F8U A;  4MZC A;  2OBK A;  2FA8 A;  3QPM A;  1A0F A;  2FWF A;  2F8F A;  3HCZ A;  4MH3 A;  4POM A;  3KMO A;  1PD2 1;  5H5Q A;  2LRT A;  1M9A A;  2FUG 2;  1R4W A;  2QKE A;  4BVY B;  4IN0 A;  4TR4 A;  3OR5 A;  2HFD A;  4EIQ A;  5D8I A;  2RM6 A;  5IMC A;  4K6X A;  2KP2 A;  3GA4 A;  4N3Z A;  4OCE A;  1QUW A;  4MNN A;  2K9F A;  1SYR A;  2HZE A;  4RI6 A;  3FZ5 A;  22GS A;  3GN3 A;  1E2Y A;  2B5X A;  3M0F A;  1Y25 A;  3P2A A;  4K1F A;  1PX6 A;  1Q4J A;  1LJR A;  3UOM A;  3NIV A;  5IOW A;  1TOF A;  4ZB6 A;  2EFD A;  2VL2 C;  3L9V A;  3F63 A;  2BJX A;  3DKS A;  5ECS A;  1NHY A;  4MA9 A;  3LJR A;  3LQ7 A;  2GSR A;  1EOG A;  4YKG A;  2K8V A;  5DJL A;  3HJP A;  2YWO A;  4EXJ A;  2VCW A;  2KUC A;  2GQK A;  4PQH A;  1K0B A;  2M80 A;  2GZY A;  5G2Z A;  1B9X C;  1KBN A;  1QGV A;  4NHW A;  2CAQ A;  2H66 A;  3DML A;  1VF1 A;  3WYW A;  5J5N A;  2AAW A;  1VF2 A;  4G2E A;  1YKA A;  1ZYN A;  5IPH A;  3KIJ A;  4IQ1 A;  3TCO A;  4Q5Q A;  4ICY A;  4ML1 A;  1SKR B;  1V9W A;  4GTU A;  4L0W A;  1CQH A;  2LJA A;  3TUE A;  3GTU A;  4XRA A;  2QGV A;  2LNS A;  4TR0 A;  5IOX A;  5IM9 A;  1XWG A;  4GDF A;  4FYC A;  3EC3 A;  2H0I A;  4K7I A;  4K2D A;  4KDY A;  5HFK A;  4G0I A;  1S3D A;  2PN8 A;  3APS A;  4ZBD A;  2DJ2 A;  3DRN A;  2L4C A;  3KP8 A;  4XRD A;  1XPV A;  1V98 A;  2IPA A;  2WJU A;  1V57 A;  2I4A A;  4EO3 A;  3RBT A;  2H72 A;  4EL1 A;  1SL2 B;  2L6C A;  3FR3 A;  2GDR A;  11GS A;  1NM3 A;  5INY A;  3L9U A;  3LYK A;  5B8B A;  4GWR A;  4WF5 A;  1SKS B;  4IQA A;  2YWN A;  4K7N A;  1O8W A;  4HI7 A;  2GSS A;  3ERW A;  3EIN A;  2GQM A;  2L57 A;  3KZQ A;  1BG5 A;  3ME7 A;  3E3E A;  3ZTL A;  1UC7 A;  1WRY A;  4MZW A;  2X49 A;  1M2A A;  3H93 A;  16GS A;  2JZT A;  4KCE A;  3FKF A;  6GSU A;  1EZK A;  4WR4 A;  2QSI A;  3C1S A;  2YJH A;  4HU7 A;  4QL7 A;  7GSS A;  4GLT A;  3C7M A;  1VF3 A;  3TJG A;  5FWG A;  5ELG A;  3GSS A;  4BPY A;  4YQM A;  4F0C A;  2R6K A;  3J7Y k;  3IDV A;  4ACS A;  2H75 A;  2DJJ A;  2MMO A;  2C0D A;  2X8C A;  3D6I A;  2TRX A;  5IQY A;  1JHB A;  1YKC A;  4FYU A;  4HQS A;  4CDO A;  4N10 A;  3TKP A;  5A34 A;  1ERT A;  2VKZ G;  5ECI B;  1J9B A;  1PL1 A;  3W8S A;  3UAP A;  1K0O A;  2V1M A;  3HYP A;  4Z2T A;  4KF9 A;  1R5P A;  2MMN A;  5CNW A;  3ZVJ A;  3M8N A;  2H8L A;  1OE7 A;  6GSS A;  2JZR A;  2HRK B;  4GSN A;  2C0G A;  1GSQ A;  1TRU A;  5ECK B;  4LMV A;  2CQ9 A;  1U88 A;  5F05 A;  1SL1 B;  4LL1 B;  3M1G A;  1SK1 A;  1XOA A;  2C0E A;  2RUF A;  3EYT A;  5JWR B;  1TXU A;  1B4P A;  2H30 A;  3GYK A;  5JCG A;  4EVM A;  2YWI A;  1TKD B;  5KOX A;  4NV5 A;  3A2V A;  4OMV A;  3VWW A;  3UMA A;  2X8H A;  4JED A;  1JLW A;  5IMZ A;  1F3A A;  4IBP A;  1O8X A;  4RUV A;  2WCI A;  4KH7 A;  3TDG A;  1HD2 A;  4ZB8 A;  2ALB A;  5J47 A;  20GS A;  3VWX A;  3H8Q A;  2IME A;  3IHG A;  4CY8 A;  1CQG A;  2XBI A;  3IOS A;  1U87 A;  2VD0 A;  5HFI A;  4G0K A;  4BVY A;  1C72 A;  4JR6 A;  2M72 A;  4ECC A;  1Q98 A;  2R4V A;  2LKU A;  4BVX A;  2FLS A;  4V2L A;  3N9J A;  2P0G A;  3IC4 A;  2VL9 A;  4OFN A;  4ZB9 A;  2EC4 A;  3HZ4 A;  1ZYP A;  4IS0 A;  2H74 A;  3EWL A;  3DVW A;  1THO A;  3WGE A;  4XS1 A;  2RII A;  1K0M A;  4BWS A;  3QD9 A;  3GTU B;  4ZIJ A;  1ERW A;  3TJK A;  4ZL9 A;  4Q5N A;  2C1Y A;  1GSY A;  2H1L A;  3ZFL A;  5EPF A;  1XWA A;  4MPF A;  2K18 A;  5D9T A;  5DCG A;  4KA0 A;  2DIY A;  2ZUP A;  2CV4 A;  2YV9 A;  9GSS A;  2B1L A;  1ZL9 A;  3ZMK A;  2GT5 A;  3LXT A;  4AKG A;  4OWY A;  3KTL A;  1T00 A;  2P31 A;  2A4V A;  1N8J A;  1T4Z A;  4AKH A;  2LJK A;  4V2N A;  2VIM A;  3PGT A;  3TB2 A;  5IIZ A;  1GUL A;  3CMI A;  4BL7 B;  5J3R A;  3VI5 A;  3MIX A;  3DIE A;  4V1A g;  3KMN A;  2HNL A;  2XHF A;  3GNJ A;  1OAZ A;  1G6Y A;  1XIY A;  4AKI A;  4V1A p;  2A2S A;  3BD2 A;  3L4N A;  3ERG A;  4JR4 A;  2DBC A;  2A2R A;  2IWT A;  4D73 A;  3LOR A;  5L71 A;  3IHQ A;  1MDJ A;  2YOI A;  3HDC A;  4NXI A;  3VK9 A;  1BQ7 A;  1KNG A;  3C1R A;  3FW2 A;  3ZVJ D;  1FHE A;  3O76 A;  2R3X A;  2TIR A;  1GL8 A;  2DJ0 A;  4IP1 A;  4MJC A;  3R3E A;  4PX1 A;  2GSQ A;  3GIX A;  2CAI A;  1T4Y A;  2P5Q A;  2C0F A;  1M9B A;  4ZB7 A;  3MSZ A;  4DSQ A;  2F8A A;  1B4Q A;  1FW1 A;  1PN0 A;  1UN2 A;  2A2P A;  1DSB A;  4YKF A;  4KE3 A;  3VI7 A;  2AYT A;  14GS A;  4KUN A;  1EOH A;  2KHP A;  2V6O A;  3QAW A;  17GS A;  4IGJ A;  2KOK A;  1YDK A;  2K6V A;  3GV1 A;  2R0G A;  3LFL A;  5LD0 A;  3EE2 A;  1PKZ A;  1Y6E A;  4AJ8 A;  1O6J A;  1XW9 A;  4GXZ A;  4YH2 A;  4A5P A;  1A2J A;  4J57 E;  1TU7 A;  3U5R E;  1SEN A;  1URM A;  5CRW A;  3D5J A;  2IL3 A;  1V58 A;  2GS3 A;  3HXS A;  4ZBA A;  1G0T A;  2N5F A;  2VLT A;  3Q19 A;  4WET A;  4TXV A;  3MAK A;  2CVK A;  2JL4 A;  1MD4 A;  1AQW A;  2ON5 A;  3I69 A;  2LS5 A;  2VCX A;  5ID2 B;  2H0G A;  1JLV A;  4MK3 A;  4ZL7 A;  1S3A A;  2EFE A;  5JCU A;  1NW2 A;  4GSS A;  4G10 A;  3SWL A;  1R7H A;  3GKM A;  2JAC A;  2HXK A;  5CO3 A;  4HJ2 A;  3L78 A;  4OCF A;  5EVO A;  4N0Z A;  3GHA A;  4EKZ A;  4BVX B;  4O32 A;  2HRK A;  5IMV A;  4ZXG A;  5J9C A;  3AY8 A;  5HR0 A;  1YY7 A;  3VWV A;  5G5E A;  1YF1 A;  3WGX A;  4Z2U A;  2WUL A;  2B1K A;  5JCW A;  3KH7 A;  1O85 A;  3QMX A;  2H1A A;  2N5A A;  2HE3 A;  3F9U A;  1XZO A;  5IMF A;  3G7J A;  1I5G A;  2LRC A;  3EMX A;  1Z6M A;  2AB6 A;  3HVV A;  3KEB A;  4I2T A;  1TU8 A;  1WPI A;  1GUH A;  2D2Z A;  1GSS A;  2IMD A;  3UJ1 A;  3ME8 A;  2VCQ A;  2H6Z A;  1G7O A;  2JSZ A;  1VGL A;  1SJ6 A;  3APQ A;  3Q74 A;  2HYX A;  4N0V A;  2F51 A;  2J9H A;  2HI7 A;  2L5O A;  3IE3 A;  3NZN A;  1GP1 A;  4O7H A;  1V40 A;  3CTF A;  3VPT A;  5IO2 A;  4G01 A;  2VAF A;  3O3T A;  2LNT A;  3FRC A;  3DWV A;  3PR8 A;  4KDU A;  2DML A;  1UVZ A;  2KP1 A;  4K7O A;  2VCZ A;  3F6F A;  4J56 E;  4PGT A;  2ZNM A;  1SVL A;  5CAX A;  5GST A;  3ZRD A;  2C80 A;  5CRE A;  4D73 B;  3RDW A;  4KX4 A;  2FD3 A;  2QA1 A;  4MF5 A;  1F9M A;  5D9X A;  2B6M A;  2JSY A;  5H5R A;  3TJF A;  1DBY A;  4N11 A;  2FNO A;  2DMM A;  1EGO A;  4XIH A;  3A2X A;  1V2A A;  1E6B A;  3ED3 A;  1AQV A;  2VO4 A;  1GSD A;  3Q18 A;  1DE2 A;  3IC8 A;  2EIO A;  4PTS A;  2PMT A;  2YZH A;  3D21 A;  2X8G A;  4Z7X A;  1M2D A;  1M7T A;  4DVC A;  5C00 A;  4EE0 A;  4MCU A;  3HVS A;  4BL7 A;  4N30 A;  3EMP A;  1UA5 A;  2MBT A;  1K0D A;  5B8A A;  4JZQ A;  2LST A;  1WE0 A;  2PPT A;  1GTA A;  2DSA A;  5G1L A;  2R5G A;  2V2G A;  3F4T A;  2CZ3 A;  3G7Y A;  1H4O A;  2VOC A;  1SVO A;  2LEG A;  2C8U A;  5LCZ A;  1SJI A;  1T3B A;  3UAR A;  1U3I A;  1K0A A;  3I6A A;  5DAL B;  2BMX A;  1JZO A;  1FOH A;  3BCI A;  3DD3 A;  4AI6 A;  3EU4 A;  1EV9 A;  1ZCP A;  3IPZ A;  4PNG A;  1A23 A;  3ERF A;  2XPD A;  5IMD A;  1XVW A;  5DJM A;  1USB A;  1XXU A;  3TOT A;  1OC9 A;  3VPQ A;  4OFM A;  1HNA A;  5IMA A;  3WT1 A;  4X43 A;  1NHO A;  5GAN D;  1K3O A;  4ULX A;  1WJK A;  5BMU B;  4O5Q A;  1AC1 A;  2A4H A;  4TR1 B;  1OKT A;  4K2X A;  4IKH A;  3LGC A;  1TTZ A;  2TRC P;  1EEJ A;  1YJ6 A;  4I6X A;  2GGT A;  1Z5Y E;  2C3T A;  4Q5R A;  1SKW B;  2MZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...