5KETA

Structure of the aldo-keto reductase from coptotermes gestroi
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
328
structure length
328
Chain Sequence
b'SVTFHNGRKMPVVGLGTWQSPPEEVTAAIDVALEVGYRHIDTAFMYQNEAAIGKTLKKWFDSGKLKREDVFIVTKLPPIGNRAESVEKFLTKSLEALQLDYVDLYLIHLPVGFQYKGDDNLWPRGEAGEFLIDTSTDLISLWKAMEAQVDAGRTRSVGLSNFNSRQIARIVKSARIRPANLQVELNVYFQQRELVAFCRALDITVCAYAPIGSPGLANVIKARGAEVPESAKFDPLTDPVVLKIAEHHKKTPAQVLLRHCMQRDIVVIPKSTNAGRIKENFQVFDFELSKAEVDELDSLDKRAAGRRFRMDQYKGLREHPEHPYDEPY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase 1
publication title The Coptotermes gestroi aldo-keto reductase: a multipurpose enzyme for biorefinery applications.
pubmed doi rcsb
source organism Coptotermes gestroi
molecule tags Oxidoreductase
total genus 96
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5ketA00
4L1WA 4LBRA 1RY8A 3LEPA 3O0KA 3UYIA 2PDPA 4IGSA 3C3UA 3GHUA 1LQAA 4JQ2A 2IKJA 1S2CA 2WZTA 1VP5A 3V0SA 4IJRA 3BURA 4JQ3A 2HV5A 1ZSXA 5AZ1A 3BV7A 4H7CA 3LZ3A 3EB3A 3UP8A 3UZXA 3S3GA 2IKHA 3V36A 1T40A 4XZNX 3CMFA 2IS7A 2PDXA 4XZHA 3P2VA 5LIXX 1EXBA 2FZDA 3V0TA 1EF3A 3R58A 3GUGA 3MB9A 2PDJA 2PDKA 3LQLA 1PZ1A 3V0UA 5C7HA 4LB3A 2FVLA 4DBSA 3O3RA 2PDYA 4XO7A 4QR6A 1AH0A 1X98A 4L1XA 3KRBA 2INEA 3ERPA 3M0IA 4FAMA 1IEIA 2QXWA 4JTQA 2VDGA 1ADSA 3LD5A 5HNUA 3GHTA 2HDJA 2FZ9A 3R94A 1RALA 3BUVA 5HA7A 2PFHA 4PUWA 4Q7BA 4YS1A 4PRRA 1C9WA 4WGHA 4JQ4A 3VXGA 1X97A 1HW6A 1Q5MA 2FZBA 4H8NA 3LZ5A 1AH4A 2PDIA 1S1RA 2CLPA 2IPJA 3EB4A 2R9RA 4HMNA 4JTAA 1Z3NA 4PMJA 1OG6A 4ZFCA 4FZIA 3N2TA 4YVVA 1PWMA 1LWIA 3MC5A 1HQTA 2I17A 1YNPA 3COTA 3N6QA 3LENA 4F40A 3WBYA 4JIHA 2F38A 2PDCA 3D3FA 3LUTA 4PRTA 4DBWA 3F7JA 5DANA 1JEZA 3NTYA 2R24A 5LIUX 4XK2A 5LIYX 3QKZA 1PWLA 1AZ1A 4R9OA 1S1PA 3T42A 1XGDA 3LBOA 3CV7A 2A79A 1K8CA 2BGQA 1PZ0A 1FRBA 1X96A 4GQ0A 2P5NA 4XVEA 4GABA 4EXBA 4GCAA 3UZWA 5AZ0A 4GACA 3R8HA 4HBKA 3M4HA 2IKIA 3EAUA 1QRQA 4GQGA 1R38A 4OTKA 1YE6A 2AGTA 4JIRA 3R43A 3ONCA 1MI3A 3G1RA 4JIIX 2PD5A 3Q65A 2HEJA 5JH1A 1YE4A 3CAVA 2IQDA 2DV0A 1Z8AA 4NKCA 3R7MA 2BP1A 1S2AA 3LQGA 4I5XA 1EL3A 4XZLX 4JQAA 1ZUAX 3H7UA 3RX2A 2ACUA 2NVDA 4JTRA 4IJCA 5HNTA 1AFSA 4XVDA 2HE5A 4RPQA 2HVOA 1AH3A 2C91A 2HE8A 1VBJA 2IKGA 3CAQA 3WBWA 4FALA 2ISFA 4GIEA 3WG6A 3WBXA 1ZQ5A 3R6IA 3GHRA 3CV6A 3R8GA 4JQ1A 3RX3A 3LNMA 4YVPA 3UWEA 2PEVA 2F2KA 1US0A 2INZA 4WRHA 1RY0A 5LIKX 4EXAA 4FA3A 2J8TA 1MZRA 3ONBA 2PDMA 3DOPA 4QBXA 4GA8A 3M64A 3H7RA 3U2CA 1Z9AA 2PDQA 1T41A 1A80A 4G5DA 4QX4A 2PDNA 4LBSA 4MHBA 2PDBA 2ACSA 4XO6A 1AZ2A 4PUUA 2I16A 5JH2A 4Q3MA 2PDUA 4LAUA 2PD9A 1J96A 4WDUA 4AUBA 4DBUA 3G5EA 1M9HA 3Q67A 1SM9A 2PF8A 1UR3M 4ICCX 2IPFA 4YU1A 4XAPA 3FJNA 2PDHA 4WDXA 2PDWA 1PYFA 3UFYA 2PDLA 1XF0A 3LN3A 4WEVX 1GVEA 1EKOA 4LB4A 3B3DA 2PDGA 1QWKA 4DZ5A 5KETA 5LIWX 2PDFA 4YVXA 2ACQA 3FX4A 2FGBA 3CASA 2BGSA 3UZYA 3UZZA 3WCZA 2DUZA 4PR4A 4XZIA 1XJBA 2ACRA 4XZMX 2FZ8A 2DUXA 4JTDA 4WDWA 4ASTA 3DN5A 2ALRA 4JTCA 2IQ0A 1MRQA 1YNQA 3RX4A 2PZNA 2WZMA 1IHIA 2NVCA 1Q13A 2IPWA 3UGRA 2HVNA 3GHSA 3V35A 1Z89A 4LAZA 2IPGA 3BCJA 3UG8A 4WDTA 1ZGDA 5M2FX 3H4GA 4QXIA
chains in the Genus database with same CATH superfamily
4ZOAA 2PPGA 2ZIDA 3FHAA 2O55A 5F2IA 3H7VA 4R9XA 1NFPA 2ESCA 4WCJA 3ITGA 4GYJA 2OO0A 4TIMA 1KM6A 1BTCA 1A5KC 1OSEA 1UBSA 4ZXLA 3S46A 1QPKA 4FS9A 3V18A 1X1ZA 4H7CA 1XBXA 4DWSD 1VFMA 4AF0A 3B9AA 3RGTA 3ARWA 3TN3A 4MKSA 3PSVA 5IDIA 1QATA 3T4WA 1GEQA 3K1DA 1XBZA 5K4XA 4UUIA 3V0TA 3E3HA 3EMCA 5JBDA 3KOXA 2FH6A 2G95A 4A8IA 2Q8ZA 3DU0A 4UMAA 3PPHA 3HO8A 5C2XA 2Y5JA 1ESWA 1J01A 1X98A 5G1TA 2W62A 1C8YA 3GNRA 3O2LA 3MDUA 2TRSA 3TFXA 3BOXA 2FLIA 3WLMA 4P8WA 3WMSA 4QJ1A 4L6OA 2C15A 4IX2A 4XBSA 3AO0A 3W2UA 1EJXC 3ORWA 4CEUC 2GWGA 1AW2A 5EMJA 3WLQA 1IIHA 2EPLX 4RE4A 1CI1A 3VKBA 4X61A 2P3ZA 1QW7A 1P0EA 4GIAA 1S1RA 1CXHA 2PP0A 2QKFA 1TX0A 1NJJA 3FXYA 1FDJA 4NZ5A 3L66A 1RD6A 3VMNA 3WLIA 1R2RA 1FKXA 4QEEA 3D3AA 4AWUA 5CZTA 1R3VA 5FACA 4X2RA 4M29A 4OE7A 4B5SA 2ZADA 2YA2A 1VD6A 4O4VA 3VNMA 1OIFA 5AC4A 2PDCA 3T07A 3VOJA 4XAYA 4M0XA 4O11A 5KINA 1M1BA 3UEQA 4ZR8A 4W8AA 3PJXA 4XAZA 1UP2A 3BLIA 1A0DA 3MHUA 4D8ZA 2QJGA 4IT1A 2R94A 3KM8A 2OQLA 1XM3A 1UQYA 3P61A 2A79A 2ZTJA 4ADUA 1P4CA 1GHSA 4LPCA 4DLMA 4GYKA 1XIGA 2OZ8A 2WSKA 1ONWA 1EJVC 4Z0JA 4AZCA 5FSDC 3EPMA 5T9BG 3IJQA 3OO2A 2CHOA 2IKIA 5CPLA 3S2CA 1M01A 3NQEA 4WGXA 6XIMA 3IVUA 1NOUA 3HU7A 3G1VA 4G2DA 1R38A 1XLIA 3WKZA 4O1DA 2H3DA 3QZ6A 3CK5A 3TCSA 3K46A 1EB3A 2AGTA 3PUGA 4KWSA 3GDLA 1RJRA 1E4MM 1W1IE 4P7LA 3L4WA 2PMQA 1A47A 1DJIA 3C6CA 5K9DA 1VBRA 4W8LA 3P3BA 5FF0A 3EWBX 2ACUA 2AAMA 2J78A 4E8GA 1OZMA 1PO9A 5FSEC 1LF1A 3F4VA 3ZT5A 3ISIX 1BQGA 2ZC8A 3BH4A 4L4MA 1V6VA 3BLLA 3GFYA 4F0LA 4B5TA 2H3BA 2YL6A 2BY2A 4CGTA 3N9RA 4NZ4A 4RJEA 4PMDA 4AXKA 4GINA 4LF1A 1JZ4A 5DT5A 1OD0A 2JQXA 2OO6A 3QLLA 4JQ1A 3VOCA 4ICMA 2RFGA 1E3XA 4JBRA 3I68A 2XIIA 3GD6A 2E5CA 1DJQA 5T8GA 3GG7A 1FCQA 1XRSA 1TMQA 1XBVA 3RDKA 4WK9A 3N12A 3IK4A 1F05A 4OV9A 2BZNA 3M64A 4GUGA 1W1ZA 3LM7A 5F2MA 2QCEA 1KXVA 1RLDA 4NHVA 4RX0A 4GJJA 1JGIA 1A80A 1W3KA 2X8RA 1E6ZA 3MBDA 2E0PA 3MUZ1 1C9DA 4LBSA 2VR5A 2G3FA 1XQKA 1HFBA 3IVTA 4PB4A 4QG8A 1R30A 1H09A 2V2HA 2BGNE 2VURA 3AIEA 1IT7A 3E2VA 2PB1A 1UMLA 3M0VA 1L0PA 4DBUA 1RBLA 4C1KA 4AMCA 3L68A 5DLCA 1XDMA 3W1MA 2E67A 4XUGA 3VO0A 2TODA 4XZBA 3UXIA 2FPVA 3W70A 3FJNA 2XJ7A 2Z27A 1TPVA 3UFYA 3WLKX 2VX6A 4MSSA 3VIHA 2FVMA 3B3DA 3MP5A 1R47A 1NF7A 1KO0A 2V63A 4F2TA 1OFRA 1IR2A 1G5AA 4O1CA 1PDZA 1QO5A 3WO8A 3G1AA 3T05A 2ZOXA 2CEQA 4LT9A 1BPLB 1EC9A 2ZC1A 1JDEA 3THDA 2EKGA 1E40A 2OSWA 4F0MA 1JQXA 3GH5A 2DORA 5ABGA 3HIJA 4J40A 1Q66A 2RUSA 5FAJA 5AHMA 3RX4A 2OMAA 3NQDA 2BVTA 1BG9A 2XN2A 3MTWA 1MXDA 2PP3A 3OA5A 2YZ5A 4LX4A 3HPXA 1EYEA 1KC7A 2P8CA 3RLVA 4H83A 4Q8QA 1TR1A 3AMLA 1FXPA 3OVRA 2CCRA 5A6BA 3LRLA 3UT0A 1TELA 5ABEA 4IPNB 2VCBA 4C6OA 1NY1A 4HPXA 5IXEA 4XQ6A 4P7QA 3ZM8A 5IOBA 2E3ZA 4HNOA 3CHEA 3LCHA 5AC6A 4N9DA 4I9AA 2FB3A 2A3CA 1ZBCA 4AD2A 1KRBC 2PRHA 3RNDA 1ZJAA 4DI9A 2OSYA 3LRMA 2GSJA 4NP7A 1Q85A 3EB3A 3UZXA 4LVGA 2OODA 4IFKA 5EMMA 3DKJA 4M7SA 1TJ0A 2ODOA 4V15A 4LCRA 2ATMA 2GOKA 4UTLA 4HU8A 1QNRA 4QIUA 1XUZA 4BEQA 4MZ8A 3LQLA 3VFLA 1DWJM 4S3JA 3AXKA 1LLWA 2PWEA 4FOJA 1R3RA 1FDYA 2VEIA 1UZDA 4KESA 1IEIA 3G1DA 3LD5A 3PZTA 5HNUA 5HBFA 3CO8A 1JPIA 4GBDA 1TCDA 1RALA 3H2OA 2P53A 5GJPA 5HPCA 4Z2IA 1BGAA 4Q7BA 4S2CA 4US5A 3E2SA 4ADTA 1MEWA 3F4WA 1Q8AA 3W71A 1R3SA 3KZPA 4WJ8A 1G4EA 3IRDA 3GG1A 4YCOA 1OX4B 1LOQA 3RPMA 4JTAA 1PIFA 4DUOA 2FH8A 4DZIA 3LBCA 4ZFCA 4F48A 4JCLA 2WC4A 1NWSA 3G1SA 4U4MA 5JMUA 3N2TA 4YVVA 1PWMA 3DFTA 3GTXA 4C91A 2WBKA 3B4YA 2ISSA 4PB3A 3GH7A 5A2CA 3QH2A 4LU0A 1BXNA 2WMFA 5JUVA 1QNPA 1XLFA 1V6TA 2PWHA 4IF2A 4H9TA 3EX6A 3BJTA 4JL2A 4O1EA 4JN6A 1LOLA 5DANA 5D04C 2FZNA 2PTXA 3SY1A 2AMXA 1QHZA 2VDHA 3NO5A 4RW3A 2ZX9A 4IIFA 1JCMP 2GSHA 2V81A 1RVGA 1E3ZA 1TYGA 4I7VA 3FJ4A 1YLVA 3HGSA 1FRBA 5A8PA 4LRSA 3TOPA 2KAUC 1ZRQA 4YIWA 3UZWA 5I02A 2ZZ6A 3MYPA 3GYEA 2XPKA 3WQDA 3VKDA 2A3BA 4OT7A 2V3GA 3QPZA 5FJTA 2QIWA 1KWKA 1ZB5A 4JNYA 2P1FA 5I7GA 4OTKA 2Y5EA 4IJBA 4RCXA 4ZBCA 3MQTA 1O94A 1PVNA 4OOZA 4OVXA 4YPJA 4KETA 5K2ZA 3WD3A 4GD0A 4ZO8A 3ZWTA 3IK2A 4GO8A 1EUNA 1UBPC 3AUOA 1S5TA 1YBQA 1KTCA 4BA0A 2XVPA 1GW1A 3LQGA 3CTLA 1EL3A 1OCBA 1SZFA 3VMOA 4QAIA 3C2VA 1TJ1A 1EPXA 3ITTA 1HIZA 3W2MA 2QAPA 1T96A 2WC3A 1VFHA 5LZLA 2IXUA 3BLKA 3MMTA 2FPYA 4K38A 5JQ9A 4IJCA 4NJIA 2V5CA 3GW0A 1ZP3A 4UCFA 4C6IA 3M0HA 3H6OA 2V3FA 4YJ5A 2HBXA 1U1HA 3I65A 3GNPA 4AVNA 1REQA 5A8NA 4P7RA 1HJSA 1H7NA 3VE9A 5EMKA 1DTUA 3TNBA 3W88A 1XINA 1IQ8A 2O4QA 2RAGA 3EYPA 3R89A 1QPNA 3BANA 3HJZA 3ONBA 1KR1A 4HYRA 1LYXA 1QDSA 3OP2A 3AIVA 3N25A 3S83A 2VZSA 1Q6LA 2PDQA 4KS0A 5AC7A 4ORIA 4DO4A 3QHMA 3DFYA 3QC0A 3PHAA 4JNMA 4JAWA 3MV01 2ACSA 3EB2A 3U5YA 1AZ2A 3N4AA 4MYXA 1BRLB 2Y62A 1A0EA 2PD9A 1QOPA 1M6JA 3CT2A 1T5AA 4WDUA 4A8RA 4F4RA 3IGXA 4YYFA 3OPSA 1XI3A 3IIVA 1UD8A 3QGKC 4Q4PA 3JW7A 3VGGA 4KW2A 2PU0A 5C2GA 4JX4A 4MF4A 3A64A 5K4ZA 4W88A 4DBEA 5I09A 1V6UA 1UC5A 4TX8A 3NPWA 1GOOA 3T08A 3W9ZA 2GQ8A 3VD4A 2G5WA 4CQAA 2OZTA 3F4DA 1QWKA 3VVGA 4GZJA 3B0YA 4DJFC 1SJAA 2IUZA 3HFYA 1XLHA 4P7OA 3DFPA 4XTIA 2VEPA 1KM5A 3LV5A 3QZEA 2WCAA 1RAKA 4DAFA 1QTWA 3GY1A 4C6CA 2XU2A 1GOXA 4UQEA 3CQ0A 1B30A 4H6QA 2ALRA 1MRQA 1O66A 3W7IA 4QRNA 4O8AA 2R8WA 3GVGA 4LXFA 1U2YA 1H49A 3KWSA 3ZR6A 1XWYA 2GGEA 5HUPA 2NSXA 1PXGA 4C6BA 2A5HA 4FNUA 1X1NA 3PUDA 3PF3A 3RCYA 3LTPA 2IPGA 4S3CA 1J2BA 4TVCA 3A3XA 4JXCA 1OF8A 2BV9A 1SJCA 3CUXA 1VIZA 2VVNA 2XHYA 4L1WA 3UG4A 2QCGA 4IUOA 3UYIA 4NXSA 4BI5A 5J5DA 3M1ZA 1PV8A 3UU0A 2C79A 2GDVA 2QHAA 4O18A 2YJQA 2A6NA 3HG4A 3UW6A 4W87A 1Q45A 1ODUA 3P62A 3UXKA 1TPEA 1XH0A 2PLCA 3FLUA 3LSBA 4Y90A 3BV7A 3LZ3A 2P0OA 4NYYA 5RUBA 3U9IA 3S3GA 1U5VA 1I2PA 5GNXA 4HIBA 3GVWA 3BQ6A 1W3JA 1S39A 4B3ZA 3LK6A 2XIBA 1K6AA 3WDHA 4HN4A 2JBMA 2GJPA 4JOMA 1QI5A 1V3KA 2XVKA 1WXJA 1GVSA 2CU0A 3PK7A 4NNAA 3GAYA 1JCTA 1RCQA 3WNNA 1KM4A 1NSJA 1A5AA 3F5JA 3VKCA 5G2WA 1AQHA 1HVQA 3IARA 2VR4A 5TQLA 3S1GA 3P5ZA 4GNKB 8XIMA 3W22A 3FGCA 1TPC1 2VVSA 4Q8MA 5HJLA 2FZ9A 1BF6A 1HJQA 5HA7A 4J9JA 1GQLA 2GZXA 4PUWA 3KWXA 1XH1A 1XYLA 4H9XA 4MGGA 3GSMA 4OKDA 3FS2A 1MXGA 2E1WA 5AOUA 4PTNA 4CU8A 1U33A 3VNKA 3QHOA 4FF5A 1EX5A 1EJTC 2WOQA 3BCDA 4GI6A 1Q6FA 1KKOA 1GT8A 4IMGA 4RZ5A 1FHDA 3LCWA 5EGRA 1W9BM 3WFZA 3EA3A 4HA1A 1XGZA 3TTEA 2C71A 1YEYA 2WVVB 1X6UA 5G4HC 4H8HA 2QNEA 3THUA 2CIPA 1J0YA 1XKJA 3TONA 1TWWA 1R9XA 4KFNA 1QI4A 4JIHA 3GTFA 3AAMA 3AHVA 2PWUA 4DO6A 1VPQA 4DBWA 1Y0EA 4HA0A 3SCVA 2C0HA 3DCPA 2Y2WA 1YMYA 3WQVA 2XGZA 4A4AA 4UR9A 1TKKA 3S9YA 4EAMA 7CGTA 1C91A 1K3UA 5FF7A 5LIYX 1RA5A 2PTDA 2QQ6A 3IGHX 4E2OA 4D9PA 4H9ZA 1FWJC 4LSBA 1WDPA 5HDRA 4O0KA 3CV7A 5CPQA 1K8ZA 5DT7A 1OYCA 1OGSA 4GQ0A 1GK8A 1CEOA 1MEHA 4JICA 5DMYA 1ALDA 1ECEA 1JI2A 4QS5A 5L6UA 3DC0A 3PB2A 1UH4A 4RXFA 1SZEA 3GK0A 3G18A 1VFUA 1V02E 4MJ2A 3I4KA 2UWFA 2XIJA 4JYFA 2Q71A 4PZVA 3KTSA 2AKZA 1OZQA 2NLYA 1XLKA 1E4IA 4JIQA 1L6SA 5BXTA 3TEVA 3FDKA 2PS2A 4JIIX 1YE4A 1ZAJA 5AHEA 3UA3A 4FXFA 2F9RA 2DV0A 1M41A 1DJWA 4OFCA 1V0KA 4MFDA 3VD3A 4IGNA 4UTIA 3SI9A 2NVAA 2ZXAA 5G4EA 2ZRZA 4Q8UA 3CU2A 2CZEA 2GQAA 3L4YA 1ME7A 3O6CA 2GPTA 1DV7A 3CL8A 3GXNA 3PZIA 4B5NA 1P0KA 2BSLA 2XG9A 1IZJA 1EP3A 3GU1A 5D09A 3SW6A 1M7PA 2VGFA 4YN5A 3R6IA 4Z17A 1ISXA 1V3HA 3L67A 1E9LA 1SZGA 2Z25A 4H04A 2RGLA 3UWEA 1WZLA 1SR0A 3LLFA 1DORA 5BOEA 1US0A 5BROA 2EHHA 4DF0A 4NXKA 3CWHA 3AMGA 1M04A 3BZJA 2J8GA 5C54A 3PP7A 2Q6ZA 1Z42A 1P0DA 2XSBA 3W81A 1DKWA 2QV4A 4A6GA 2XVNA 1CWYA 1CXLA 1ZFJA 2YR1A 4HT3A 5DX7A 3RM8A 1VBHA 3V1PA 1KTNA 4FI4A 3UR2A 3C2RA 4RPPA 4I9JA 1R8LA 2VC7A 3T09A 1XSIA 5AYIA 3EOUA 2QJIA 2V6AA 3VGEA 1N55A 1V0MA 2XGBA 1E72M 1GYMA 2ZBTA 5EY5A 3SUUA 4W9TA 3VZZA 1E6NA 2QF8A 4GUFA 3WNPA 4TMCA 4UC5A 4DWSA 3ZJ8A 4DJFD 5CJ5A 3ABZA 4UQAA 1UOZA 4B2DA 2NV2A 2OELA 5TNVA 4HQVA 3AOFA 2DH2A 2OWCA 4D8AA 4MLRA 4WDXA 3OLEA 3ZMRA 1PIGA 3B0PA 3LSCA 2H8XA 4LBUA 3ABXA 4EX4A 3ZZ1A 2BHZA 3G77A 3KFTA 4DZ5A 5KETA 4UOZA 1E4NA 2OXNA 1XFBA 1XQLA 3SY8A 4R88A 5C6MA 1JG9A 5CQ1A 2FIQA 3R0DA 1UD6A 2ZXQA 3M16A 5BMXA 1NH6A 1FX6A 4O14A 3C2FA 6ALDA 1GTEA 3STPA 4LYQA 3LCXA 4EPEC 2UY4A 1XLEA 1UR1A 3MUCA 1NTHA 2GGGA 4UB9A 3NXLA 1JRBA 4Q8TA 3EOEA 4RZBA 4WLCA 2IPWA 1S5WA 3WNLA 2WC7A 3ALFA 4B92A 5BCAA 2D20A 2J27A 4R3UA 3V35A 4L6HA 4X2PA 4WZHA 3M0JA 3W1PA 4IQEA 3GQYA 5C9WA 1L2UA 3NDYA 3W4RA 2J7CA 2YYTA 4L80A 3O16A 4QCEA 1XDLA 3OBKA 4NIRA 3L21A 1EBGA 1GW9A 2WMHA 4DB7A 1KFLA 3NZGA 3NZ1A 1GQNA 3HPZA 3TE9A 4HB7A 1JXKA 4KCWA 1LQ0A 3LPOA 2HK1A 4HHLA 4LCSA 4C6LA 3Q4DA 3UP8A 1KQYA 2YDAA 1OINA 4HKPA 2BTMA 5D2YA 1W1VA 1OM0A 2IS7A 4YMZA 3TX9A 3WH7A 2UY3A 2CLHA 3P2VA 4B16A 2ZA1A 4N4QA 3ZXWA 1D9EA 5C7HA 3P0WA 3ITYA 3O3RA 3NWRA 4O50A 1AJZA 5HPOA 3DFQA 1CPUA 3GR7A 2AL1A 7ODCA 3M0IA 1PKMA 2VDGA 4S3BA 3GHTA 4CQCA 4O17A 4M1RA 3AXHA 3P74A 1SZRA 2Y61A 4ROQA 2DW6A 3OYZA 2VEKA 3VIFA 4MJZA 1YNYA 4P5UA 5F7UA 3HM7A 3BLPX 4C6EA 1PHQA 1PDYA 4M6UA 4Q7NA 5E0CA 1KCZA 2ZVIA 3HQPA 4HN8A 2QJNA 4I8YA 5I78A 1HKIA 1WA3A 2QDGA 1QW8A 5REQB 3PBGA 1POJA 3EB4A 4QG9A 1FWTA 1LRTA 1WYIA 1B0IA 2C0AA 3STEA 1S3HA 4PMJA 1A5UA 1CXFA 1MUMA 1ZJIA 4N6EA 1QU4A 2NXIA 2W3ZA 5FL1A 1Q8JA 3RFAA 4HU4A 2QF7A 3SCOA 1ISWA 2QDDA 1TJ2A 3MBFA 1P0NA 4PMRA 1B90A 4HJWA 1DIOA 1NOFA 4PRTA 1OFOA 3NSMA 5DMLA 1FWBC 1GOMA 2CBIA 2NXHA 4Y9PA 3W3OA 2AQWA 3KOFA 3KOZA 2ADAA 2GK1B 4HP5A 3DERA 4CVUA 3CBWA 2E25A 3INPA 2YSWA 2E5BA 3UR8A 4Q4MA 3II1A 5DF0A 1Q6EA 2WXDM 5BYWA 4D2JA 1I1WA 4RE3A 1K1DA 2CERA 2C19A 2L5HA 4IXXA 5E93A 3BGAA 3MCNA 1GOQA 3EMQA 3G3DA 3A12A 5CXPA 2HROA 3A4JA 1NQKA 2BVWA 4A3QA 1ZCCA 3QR1A 3ARYA 1RV8A 3W75A 3W27A 4NAEB 5DXYA 4B4FA 1NEYA 3M0ZA 5HAOA 3STGA 2P10A 3RN6A 2PD5A 3UZ5A 1E56A 1TUFA 1QHOA 4A29A 1ZL1A 4IFOA 1PBGA 5KEZA 1LLZA 6CGTA 3N2XA 3HQNA 2C14A 1KTBA 1UYQA 1M3UA 3DHPA 3EXRA 1UIPA 2ZRUA 3SFWA 4I5UA 2DZBA 2WNQA 3M7WA 3EDEA 5CZJA 2WVUA 1KM3A 1UA3A 3IJ9A 4QM1A 3ARUA 1CXIA 3IWPA 2OR2A 2WANA 2QIIA 2HE8A 4XSLA 4O57A 3GIPA 1MW2A 1QUMA 3TTSA 3ZS4A 1H62A 2A1YA 4ZSTA 3WZ0E 1K6WA 1TV2A 4MUZA 4C6MA 3WK2A 1YXYA 4R53A 3TSBA 1M65A 2V30A 2VR2A 4PTMA 2HCVA 3PUOA 1KFWA 3QTPA 4MFEA 2X05A 3U2CA 4QLKA 2GJRA 1Q7MA 4LTSA 1ZPTA 1T41A 4MTVA 4QX4A 2X0HA 1RCXB 1P1XA 1WCGA 4FLSA 5TF0A 2I16A 3NGJA 3TAKA 2BG5A 2GOUA 3V1HA 1EGVA 4GJ1A 1OIMA 4GX8A 2PF0A 4AVFA 4EVZA 1H1YA 4ML4A 2OYMA 2QUUA 4MWAA 3TLLA 4NL1A 1UH2A 3WNMA 2P50A 2Z6JA 3AS1A 2FVKA 5JVLA 2BVYA 1SFSA 2BWGA 1V7YA 3MUIA 2NV9A 3GX9A 3OW1A 3WDIA 3NQ6A 3BAKA 4F9DA 4KWOA 3N19B 3PZ9A 5J5RA 3NO3A 2D2OA 2QJMA 4ACZA 2W91A 1V08A 1YDYA 3VNJA 1AQ0A 1W3NA 3PPGA 1O5QA 9CGTA 2GQ3A 3QPEA 3W72A 4BFAA 4EK7A 1B54A 3T55A 2B81A 2Y24A 3L65A 3KBSA 3ZLFA 4L9YA 2X16A 4XUYA 2G50A 5BMWA 3OTRA 2W5FA 2QULA 2BGSA 2G0WA 2UV8G 1XH2A 1OB0A 2ZZ5A 4A22A 1FBAA 2Y0FA 1JUBA 4YYCA 2Y8VA 2GFTA 1P48A 4MY8A 1RP8A 3VOHA 4XTDA 4EKJA 4CNTA 4R34A 4A2SA 4DYEA 2CBJA 4F2BA 3TVAA 2WLZA 4WSKA 5C9ZA 2ZXDA 1UJQA 1XR2A 2E8YA 1H7XA 3A9BA 1O1ZA 1S38A 3QVQA 2RDWA 1B9ZA 4ZB5A 2A4AA 2EPNA 4H9VA 3R0KA 1IF2A 4CCZA 2V3DA 2XWDA 1QHPA 1Q6DA 1SFJA 4FF7A 3TYAA 4URIA 4JTHA 4UQBA 3BCJA 4OUEA 1SW3A 1YXCA 2BY3A 2R6OA 1R87A 2VTFA 4QAWA 1GQJA 1K03A 4S2BA 4Q4OA 3VNZA 3C3UA 1TZ9A 1GOKA 3P0XA 2R82A 3BCFA 4UTWC 3DUGA 3ZSTA 4PULA 3MHFA 3ECQA 1TTPA 3QQWA 5AB3A 4TR9A 4GQRA 4P61A 1NWUA 3MKKA 1M68A 2UY5A 2J88A 3UPWA 4FMVA 2X1UA 1U1UA 3T8LA 1JYXA 3BICA 3TA9A 1UIOA 3CMFA 3CEPA 3T78A 2F8QA 3W7CA 2A21A 1D3GA 3CMGA 3WN6A 1GQIA 1TPUA 3EBVA 2ICSA 2Z1SA 2GGIA 4REQA 4R27A 4NSBA 4D6JA 1QW9A 4K8GA 1JYNA 3L5LA 3E0IA 2FVLA 1R9ZA 4JIEA 1WBJA 1EO5A 4Q22A 4ILSA 3R8RA 3S1VA 4R5EA 2WKLA 1VLIA 1DOSA 1H7RA 1I75A 1K4HA 1XYAA 5A94A 3R94A 5D9NA 1UASA 4B5UA 2EXOA 2PBOA 4QFUA 4YNGA 1PS9A 1F6YA 3RR4A 2BHYA 4DJDC 3M41A 4WGHA 3WL1A 3TJXA 2PC8A 3GNNA 3G2GA 3LHTA 1JR1A 4J3UA 3M43A 2RH9A 3SUSA 1YRRA 3N18A 4BF7A 3TC6A 4PFMA 4QNEA 2WW5A 1VFSA 1F6KA 4F79A 2R9RA 1XRTA 4HZ8A 3TJ4A 1V6YA 3CYJA 3NXFA 4BHYA 2W9MA 2B7NA 3NURA 4HNTA 5FAGA 4DF1A 1XLGA 4N9CA 4CD7A 3HTWA 1HQTA 3TTYA 3HBLA 3U0HA 1XYBA 1OWQA 2FDSA 3GNDA 4LY8A 4KIEA 2VJXA 1I8JA 4IXHA 3T7VA 3N2OA 3LUTA 3C0SA 4L6DA 3RLHA 5CBBA 1O6IA 4H41A 3NTYA 3ARPA 1ENUA 2X30A 1H0GA 2OGJA 5IFPA 1NVMA 2R24A 3H26A 3B8SA 1EP1A 3NQ2A 1ONEA 1MO0A 2NUXA 1Z48A 3N1AA 4XV0A 2NQ5A 3ZFHA 1VH7A 4KT2A 2DZPA 3AS2A 3L4TA 5AZ0A 3GNOA 2V67A 3MP4A 1GVQA 2WMKA 4CEXC 4F0RA 5CEWA 3MSRA 5GPRA 3DYPA 3SY5A 1CIUA 2MUCA 4C1LA 5E1QA 1IEXA 4ZMGA 2FHCA 5CZSA 1OFAA 3WQGA 3WDRA 1NFGA 1OHLA 4Y2WA 1E6SM 5DCBA 3ONCA 4FPSA 2EPMX 3BMVA 3VINA 4FX8A 4I90A 1HGWA 2E77A 4Z2HA 3ATZA 2YZRA 4ZO7A 4Z1CA 1W9XA 3WYZA 1TO3A 1W1A1 4M51A 5HANA 3C0QA 1EJ7L 3DYMA 1W9DM 2J77A 1SFTA 3LHWA 4ES4A 2VZUA 2ZZ2A 4JPGA 2NWRA 3TK7A 3UNTA 5KMYA 2J6XA 4ERAA 3PZMA 5IM51 5C5YA 2A3AA 1OYBA 4LVBA 3VIIA 1H0IA 3DG6A 1H60A 1H11A 2HPIA 4O10A 3K4DA 2I7GA 4AC1X 2OX4A 4DM2A 1XLJA 3HG2A 4Q8VA 3WLHA 2WMGA 2TYSA 1FWWA 3G1YA 3WUBA 1P6BA 2VI0A 4IQJA 2J8TA 4QBXA 4IGHA 1GCYA 4NU7A 5JXQA 4TMBA 4IMEA 1EF2A 3PZNA 4NZ3A 2PGRA 3QYQA 4AMAA 1CLXA 3ANVA 4W84A 2Y6ZA 4NT0A 3QOMA 4UNKA 3H2CA 3O0FA 2XM2A 3AHTA 3BARA 1UHVA 3ARVA 3GRIA 2EKCA 1WOAA 5EA9A 3U7VA 2YIHA 1LL7A 3C4UA 3M0YA 1GOWA 1FY6A 2H9AA 5AYZA 1UC4A 3WX7A 3WDQA 1V0LA 1D7KA 4OBRA 1M9HA 5CZ0A 1SM9A 4M6QA 1UR3M 1VFFA 5IRPA 3OA3A 1VEMA 2FGLA 2YDSA 1KXQA 2XFRA 2PAJA 3AROA 3A47A 4WEVX 1IT8A 3KL0A 4PUEA 3P14A 3FJ6A 2YCKX 3AHXA 2OJPA 4JFUA 4FX7A 2OKTA 2YL8A 1EHAA 3FX4A 1PKYA 1BWLA 2ZTKA 3PVFA 5CGTA 1JIBA 2J9XA 4TU1A 5BNKA 3KRSA 2XH0A 2PU1A 3R25A 2BX7A 2FZ8A 5CCZA 4WKHA 5FL0A 3RJXA 1BYDA 3P82A 2ONEA 3EMZA 1EGMA 2B7OA 3W73A 3LLDA 1B9BA 1E5NA 4ZE4A 2E6FA 2OEMA 3WJWA 1IZKA 2D73A 3FSUA 2OU4A 4C7GA 5G5IA 1K7EA 3GAKA 4D8LA 4O0QA 3WF1A 4XWUA 1N8WA 4HK7A 4U33A 4JKLA 3UY8A 3QJAA 4WDTA 2Z2UA 4C1NA 2X7VA 3CIWA 4LUJA 4J5NA 4WUIA 1RY8A 1CLVA 4XKYB 2VC5A 1I2OA 2OX1A 4MIMA 3GXPA 1LQAA 4JQ2A 2R91A 3NQ7A 4RDVA 4D6DA 3GXMA 2Y7DA 2Z7GA 1EPVA 1TV4A 5AZ1A 5AHLA 2I57A 3KUMA 4JTUA 2DU2A 1ISYA 4G7FA 4KEMA 5LHEA 1TV3A 2Q02A 3UVAA 5M3WA 1FFRA 2QV5A 3AS0A 1D8CA 1DWFM 2WAGA 3BV4A 3OQEA 1KCXA 2WPGA 2YBVA 1F7BA 4W8BA 5CSSA 2AQVA 2WMIA 2YB1A 4DJDD 5C9XA 3NL2A 3CZGA 1H41A 2HJPA 3BC9A 2WHLA 3BAYA 4BY3A 3ZQ9A 1PZ3A 3W83A 1HKWA 1N82A 2BS9A 4CD4A 1E6QM 5DN1A 3Q94A 4UQDA 2GWNA 1FWDC 1NWRA 3HFTA 3SCRA 3SADA 2PSNA 3K1GA 3M46A 3V5FA 4AY7A 4BQ4A 4IWWA 3SUWA 2WHMA 2HWGA 2XN0A 4ZQCA 3DIPA 2G8ZA 5U7SA 5DMNA 1A0CA 4LUSA 2PGWA 1Q7QA 2ZZ7A 1H63A 1LRNA 1Z32X 1XLCA 2J7FA 3WQ8A 3BOLA 3GG8A 3M5ZA 4ERIA 3VMPA 1KXTA 3UWYA 3FJLA 2Y4SA 3USZA 1J0HA 3NGFA 3ZJ6A 4DHGA 5I3IA 4FZIA 3NZRA 4Q33A 2POTA 4ZZ9A 1WDSA 1YYAA 1EBHA 1K8XA 2ZE0A 4J3TA 1PYMA 5EB8A 4W7UA 4W5UA 8A3HA 1XLMA 4Z2KA 2HS8A 1EIXA 4G7EA 4NZCA 5TBOA 4CQ9A 2V68A 2F38A 3TN4A 1H5VA 3M07A 4JN8A 4CNUA 2W66A 3QV9A 2VL4A 5AYBA 3A5FA 4R7WA 1HKMA 1TQXA 1WZMA 1J9YA 4HMCA 3APTA 3H21A 1NAL1 3CUGA 3FKKA 3EWUA 4JD4A 3AALA 4G56A 4O28A 2R1PA 3LCFA 2PGEA 2ZUMA 2BODX 2H8ZA 1VJIA 1OCJA 3P80A 2E1DA 3O6DA 3PZOA 3W6LA 1SPQA 1OVDA 1OQFA 2HXTA 3P84A 3WUGA 4AIOA 2FMNA 1FKWA 3CLMA 4ACYA 2XINA 3HV8A 2VQTA 2PWDA 1EP2A 5ABFA 2WWDA 3L23A 3ES8A 4L64A 3NQAA 4GG9A 1CGTA 1V7AA 3PTMA 5C70A 3EGJA 1HN1A 2Z0IA 5GJMA 1GQKA 3V7PA 3WELA 3IIOA 4O1BA 1W3LA 4IMDA 4XZLX 2PE4A 4GGHA 5CLTA 1E1FA 5EBUA 2E9BA 4F2UA 1OCNA 3ABSA 4QROA 4UTTC 1TTJA 4NI8A 4FNRA 4RK8A 5D2VA 3VM7A 1JDAA 5HNTA 5EMUA 4OECA 5E9XA 1SO3A 4NG3A 1Y65A 3CAQA 3NSXA 2CNCA 4Q8NA 4XIMA 1J12A 3CV6A 4ADSA 3O05A 4GYPA 1RBAA 5A6TC 1HNYA 2WK2A 1FCUA 1FP8A 1H50A 1MZRA 1R86A 4K8EA 1AUSL 4GA8A 3ZVIA 5D02A 2C13A 4DI8A 3N13A 2HK0A 1EJRC 2WVSA 4G5DA 1K7XA 4FNQA 3U4FA 2RHGA 4PCPA 1J79A 2C1GA 1LCOA 3AYSA 2Z4GA 2FTWA 3FDGA 4PEKA 4IPJA 1K02A 3CHFA 1VBGA 2YFOA 3E9AA 5DCEA 4W89A 4AZ5A 5I07A 3OZOA 4JTSA 1WUFA 1V3IA 5D9PA 3Q67A 1G69A 3XISA 1F3WA 1TPFA 1VYSX 1NDVA 4AHQA 3W7KA 2HBVA 3CC1A 3WJZA 3I6RA 3VE7A 3WEOA 2CKSA 4HGXA 4YWIA 4QISA 1ZBVA 2W63A 2JE8A 4S23A 5FIPA 4Y9AA 1EZ2A 4M80A 1EKOA 1SFLA 4UTJA 3TROA 1C8XA 3HB9A 4YVXA 4XD5A 1QMLA 3WLTA 2VDIA 2X41A 3L7RA 4Z08A 4H1ZA 3ABOA 4NASA 4A3YA 1TCMA 3IV3A 4PCSA 2REQA 3NDOA 4MJ4A 3MO4A 4X63A 1W3IA 4LYRA 1XL9A 4QP0A 3WJSA 4KFPA 2GVEA 2WKJA 3ABQA 1FUYA 1W9UA 1XIEA 7XIMA 1AQFA 3WNOA 2XZ9A 3GHSA 1VJZA 3AJXA 4LYKA 4MKVA 4ORMA 1GVIA 1A5OC 2EO7A 3QBUA 1L8PA 1ME9A 1TVNA 4DPPA 4HK5A 1LG1A 3S42A 2PTZA 5CAKA 2WLYA 3B03A 1DHPA 3BJSA 3U7BA 5KITA 1A5LC 5LYRA 4UIOA 1KW1A 1GKPA 1PKNA 1BLIA 2DQXA 2AKMA 3RCMA 4HU3A 3PG8A 3UJEA 2QCMA 5H2ZA 6A3HA 4DY1A 4FNTA 1F3TA 1NF0A 2HV5A 2QCDB 1XIBA 5AYYA 1F5ZA 3ITVA 3NIYA 3NOEA 3HURA 1AJ2A 5AY7A 4I8DA 2WSRA 2YCLA 2J62A 3A13A 3LPFA 1W3HA 4FSAA 1JCLA 2DQWA 3TAOA 3G1XA 3C86A 3E1F1 3OLIA 1L6YA 4C6FA 3MZNA 2GJXA 2VX7A 1HT6A 4M82A 1J4EA 4FXJA 4EPDC 2BBFA 4DBSA 4YHGA 3OGSA 3BGJA 4I9TA 5BZAA 2A3HA 2DIJA 3SUTA 3TQ0A 1LUCA 2ZUNA 3BXWA 3DDMA 1RCOB 4GY7A 4AFYA 2OQHA 5F1UA 4GFSA 3L4VA 4JS3A 5D2TA 3E12A 1UB3A 1HW6A 4DJEA 1F61A 2W27A 3MSDA 1ADDA 1AH4A 1Z6KA 1E71M 5F2LA 3GNXA 4O52A 4RLIA 2DJXA 5SWUA 1RHCA 3P8JA 1KR0A 1TA3A 2BLEA 4PN2A 1S2UA 3ICJA 4V27A 1YPXA 2CESA 1DXIA 4C6JA 3WLOA 3GIYA 3AHYA 4A35A 1IGWA 1IZCA 1TR9A 4QJ5B 3AMCA 3NVDA 3BWWA 5DRCA 1E1EA 3ARRA 3HGOA 2Q01A 4W7WA 3WBYA 1QI0A 1UP0A 2QR6A 1RUSA 3SCPA 3F1QA 3F7JA 2XH2A 1UKSA 4ZA0A 3VC5A 3WQ4A 1XXXA 3M5VA 3L9CA 4MY1A 1EWDA 3F4NA 3AJ7A 3MUY1 1QNSA 3TCEA 4Z0SA 2V3EA 2ZX6A 4FHAA 3PBWA 5MKGB 1U30A 1NP2A 4L7ZA 1X96A 3NQ8A 2D0GA 6REQA 1JZ2A 4RDZA 4UMCA 3FA3A 4HNNA 4WSHA 1A4MA 3VD7A 5F4XA 3M0MA 3RHGA 1LLOA 3REQA 4GC3A 2H90A 3UXDA 5J04A 2AL2A 1KBBA 5I24A 5I0DA 2VELA 4E4UA 1YE6A 3QF0A 3NYZA 5D8WA 2OOGA 1ZALA 5CG0A 4R7JA 1BXBA 1VKFA 4NAFA 1D7FA 1BYCA 3R7MA 3CH0A 1OD8A 1S2AA 3FV9A 4IPIA 4XB3A 1E0TA 5CH9A 3EDJA 1VF8A 3SSZA 3N11A 4H00A 1H2JA 1KA9F 2D2HA 1RJQA 3VGBA 4HNLA 3CHCA 2ZA2A 1B3VA 5G1YA 2NT1A 2G4JA 5C7VA 1T8QA 1XIJA 4RPQA 4DF2A 3XINA 2C91A 3B9EA 1FCBA 4E3TA 1FWIC 3QHNA 5G4WA 4AD1A 3OJGA 4K68A 7REQB 5FF4A 3TYCA 1ZLPA 3TA6A 4AEFA 2OWXA 4NJGA 1ZQ5A 3SRFA 4UQCA 3B8IA 1W5QA 2G3JA 3IPWA 4XBKA 4XD4A 1EYWA 1DEDA 1NM9A 4LY4A 3TW6A 1Q4WA 3AU6A 1PTDA 2JGYA 3RK8A 3G0UA 1ITQA 1VJSA 2HQAA 3UVIA 3NOYA 4GXMA 3PZGA 4KEZA 4I7UA 2X1IA 3HG3A 4ZFMA 4CCEA 3PBYA 1UKPA 3FCPA 1I9CB 1BWVA 2QJJA 4EIVA 4J1OA 5HR6A 4DNMA 4YXGA 2VHLA 3B05A 1A3HA 1KGXA 3H8AA 1KXHA 4C5YA 5JH2A 1POKA 9XIMA 1JNDA 5BXPA 5BOOA 3BTNA 1GWJA 5AFDA 3TOYA 2J7DA 1UR0A 2PRLA 3FEMA 2BNJA 4C6QA 3CH9A 3T0CA 2GGHA 3JZUA 1IT0A 3DBPA 4DZAA 4DUWA 4GIYA 1OABA 4NRRA 4O8RA 3L4ZA 4JNZA 4HSNA 3WNKA 2JIWA 4U5KA 2CXGA 2FZMA 4I6VA 1EA0A 3W7MA 1GVEA 2WNWA 5KZDA 2PDGA 1XFCA 4Q32A 3VABA 3GZ3A 3RRAA 5HJYA 3IAQA 3STCA 3WD4A 3SFKA 3W82A 1MNSA 5C55A 4H19A 4AHPA 1OT2A 1Q7ZA 3UZZA 3H4WA 4LNCA 1OF6A 5U4NA 2LLEA 2DT3A 2DUZA 3AMKA 1K9DA 1R3TA 4JKKA 3UGVA 3IIPA 3M0XA 1W9VA 1KM2A 3AXMA 3AICA 1XSKA 4HK6A 4XZMX 3DC8A 3KRZA 1IR1A 3GW3A 1A49A 4ZQNA 1A50A 2FHBA 4HSHA 1JCYA 4CD8A 3TYBA 3GVQA 4XD3A 2RJHA 1RZMA 2NVCA 4TX6A 1IXNA 4Y6GA 3NO1A 4F0KA 1CNVA 1U1JA 1KV5A 3KS6A 2JK2A 4IM4A 2VUNA 4AAJA 1X6NA 3NM1A 1RP9A 3L12A 3H2MA 1CT5A 3MS8A 3ZOAA 3MVTA 1ZGDA 3GR8A 3IV8A 4QXIA 2DFAA 2PCQA 3HF3A 3A4WA 3MMUA 3PZQA 4FOKA 2VGIA 2GUUA 5DQPA 5T91A 2YGYA 2E6DA 3BZGA 3HMCA 3SR7A 4LOCA 2C3ZA 1C90A 1ICSA 1XCFA 4N7QA 3WLPA 3BURA 3KBJA 2H9AB 1O12A 3RUBL 2NX9A 3CAKA 1VQTA 5B7YA 4YCPA 2E6YA 1W91A 2EPKX 2PWVA 1LWHA 3O6AA 3UWZA 1RQBA 3P81A 4WHBA 4DZHA 3EWCA 3WF2A 1XW8A 3EKGA 3WLJA 3GU2A 1XCXA 1WO2A 3IJDA 1ONXA 3SCSA 1WAUA 2PDKA 3W00A 1W0MA 2V5BA 3RR1A 4MZ1A 2E9LA 1XD1A 1J10A 3V0UA 3GS6A 4JKMA 3NZQA 4Q8OA 4J28A 3UJFA 4UTMA 3A24A 4L1XA 2INEA 2Y88A 4IIEA 3BSMA 3VOFA 1CGYA 3ID7A 4JFTA 3AZRA 1H1ZA 1XCWA 1UR4A 4J35A 3IUHA 3JUGA 1BKHA 4Z1BA 2ZRYA 1QXLA 3VXGA 1JFXA 4IP5A 4PMQA 2V2CA 3K8LA 4H8NA 3W1NA 5A2AA 4GC4A 5DELA 1MXSA 3QV7A 3WQ5A 1B3OA 2ATSA 1MW0A 4HMNA 3K8MA 5A95A 2FQIA 2B0MA 1F6PA 3S5SA 4LGXA 3BVJA 1G9HA 1WV2A 1DWHM 4DXXA 3KDNA 3AC0A 1XYZA 1W2VA 3M6DA 5E0FA 2I17A 2OT0A 3COTA 4IHCA 4RL3A 3NA8A 2INFA 5CGQA 2EF9A 1UKQA 1HP4A 3TDFA 4AY8A 2J25A 3OLGA 3DFOA 3SGGA 1ZAIA 3H23A 4LS1A 6TIMA 4MNMA 4NI3A 2G4FA 4Z1AA 5FI8A 3H24A 1AL8A 4CN1A 4XK2A 4B5VA 4L4LA 3QV6A 2GVGA 2VUYA 1FWFC 1FWCC 3W7RA 5B7ZA 3W37A 4AZHA 1ADOA 1TG7A 4AYSA 4WF7A 3VIJA 3VOIA 2ZRXA 3B4UA 3VYLA 2WSYA 3NPVA 4D6FA 1I0BA 4XVEA 4X0VA 1QK2A 5CC6A 3TIMA 2WMIB 2A6LA 3D5HA 1MVYA 3R8HA 3M4HA 5BRQA 1TB3A 1JPMA 4C6PA 4NJKA 2HRWA 2OFJA 2B31A 4JTGA 4O54A 3FVMA 1OC6A 3U3HA 4BQ2A 3QY7A 3SECA 4TV6A 1VHNA 3UD6A 4KKXA 4L9XA 1MFUA 1J0IA 1J6OA 1EDQA 3OQ8A 3W85A 5H91A 5F2GA 4RZ6A 4HHHA 5IBXA 1XG4A 3NSNA 1UR2A 2HEJA 5JH1A 8TIMA 2J8FA 4QEHA 2PTWA 4OJYA 2C1HA 4UFJA 1UD5A 3SCTA 1EQCA 2TPSA 1JRCA 4A2RA 4F66A 1VFTA 4IG2B 3MP3A 1GG1A 3CZLA 3WMCA 2WZIA 2XFYA 3GKFA 5C0QA 1EC7A 4RV8A 3WSUA 4S3GA 3C2YA 3LTYA 4L9ZA 2VC9A 2RDXA 1GG0A 3IACA 3UYCA 5AC8A 5M03A 3NZPA 1MZHA 5A6BD 2HVOA 3KX6A 5GJNA 4HNCA 2JALA 7A3HA 4GI4A 3DHUA 1JPDX 4X22A 4CNPA 3VC6A 4DQWA 2VZTA 3EPOA 1UPMB 3S0CA 1YPFA 5BRPA 3GU9A 2Z1XA 3WDJA 5ECUA 4JN7A 3STFA 3VZYA 4WRHA 4OBSA 1V79A 1VLWA 2G41A 5LIKX 3BK0A 1TJRA 1XBYA 1UWAA 4AVOA 1E6PA 8RUCA 5HQEA 5D4YA 1ZP4A 2WCGA 4N02A 3H55A 3RMJA 4LWWA 1ZJHA 1UUMA 3MWAA 2XZ7A 5BRBA 4Q3MA 4CLMA 3GKAA 2DW7A 1AL7A 4DUXA 3H54A 4BQ3A 3NM3A 4GI8A 1WXZA 5CKSA 3CWOX 2NZLA 4TQTA 4RV3A 1TPH1 3NQBA 3N6JA 1D8WA 1Q2SA 3Q2DA 1X8CA 1DE6A 4J3SA 3QMTA 4QDPA 3L2IA 3KL5A 4LANA 5A8GA 1TV5A 2JIEA 2XWEA 3MKCA 2ALDA 3C56A 4GPNA 3TMQA 3LXAA 3I6TA 2Z1KA 1VBUA 4WY0B 4US5D 3WQFA 1DIKA 5CZKA 3H70A 5LIWX 2Z29A 3TNOA 4HYWA 4A3RA 4Y9OA 2PCEA 2C18A 4M5PA 2ZZ4A 1SO4A 4ENLA 3S8HA 4OHQA 1AD4A 1WNOA 3ITLA 2VX4A 3QEZA 4CD5A 2VM8A 4YTUA 1TSIA 3LY0A 3E0LA 1A53A 2BVDA 3EOOA 1CW2A 3T4CA 1CB2A 4Y8EA 3APYA 1IYXA 2V5LA 4A8NA 1ZHAA 1DPMA 1N8IA 1IXQA 1E73M 2BOEX 2WVTA 3QZAA 1AJ0A 1TZ7A 1GKRA 2VRKA 1GONA 4HHPA 1XD0A 3W7PA 1U5HA 3OLDA 3VM5A 4NVTA 3CO4A 1E1CA 3PTDA 3UXLA 1WDWA 3ZO9A 4HOXA 4XZWA 1M53A 3GVVA 1HZYA 2IKJA 5CC3A 5TAOA 1VP5A 1R7AA 3CPUA 4H8VA 2WHKA 4NYUA 3KCJA 3FY1A 2OGYA 1ZSXA 4MWAE 4XSMA 3SN4A 1THFD 3SJNA 3WMLA 4IPLA 1QI3A 3N9KA 5DY2A 3WDPP 4CQDA 4POCA 2PDXA 3W23A 1ITCA 1JJKA 2VD8A 3G1HA 5HMEA 1JDFA 1Q3NA 3R0UA 2AGKA 5G2IA 1E0XA 4O12A 1PAMA 4IOTA 3LCIA 4U2ZA 4D72A 3CB3A 5I77A 3LRKA 4M6VA 3VZXA 4CQBA 4UQ9A 1DJYA 1W5PA 2V82A 1PL9A 3VFCA 4JTTA 1J93A 2Q3RA 4LALA 1ADSA 2ZE3A 3GDRA 5BOFA 3N3TA 4GX9A 4D6EA 1XPYA 3WLLA 3EWDA 1PPIA 4RKAA 1A5NC 2ZUVA 4GRSA 3DAQA 4HHMA 4JEQA 3MSGA 1WDDA 4Q4RA 3WLRA 4MG4A 2D23A 1VCGA 4K7YA 4UNLA 4Z1YA 3A9IA 1KV8A 4CU7A 3AXIA 2FTPA 2VCCA 1DP0A 2PDIA 3TUUA 4C6DA 2Y8KA 1J0ZA 2IPJA 1LROA 1F4AA 2BFGA 1GJUA 1Z3NA 2XSAA 5CPNA 1Y7VA 4MY9A 3L4UA 3R5EA 1GHRA 3UXAA 3QR0A 1Y5XA 5FEWA 1Q2RA 4ZO6A 1TE1A 2I5IA 4DX3A 2J6VA 4D6GA 3H2AA 3MC5A 1MQQA 5I06A 2UY2A 1EJSC 2XSXA 4B9ZA 1ISVA 1FWNA 3BMWA 1TX2A 3C3NA 3VNIA 3W7DA 3NVTA 1E0VA 1QCWA 1SVDA 4UTHA 3LENA 2J74A 2PC4A 3UR5A 3RM4A 3FAXA 3DBNA 3OIXA 3RLUA 3ZVHB 2JKEA 5I3GA 2ZKMX 3B8UA 3TN6A 2ZUWA 1A3WA 5H8MA 1DJZA 1SO5A 1EOMA 3NFUA 5D30A 5LKYA 1TWSA 3TLQA 3D47A 3K4AA 3SEPA 5E6YA 1S3TC 3WUFA 4RDWA 1TV8A 3L4XA 2P5NA 4ZQRA 4NILA 3VNYA 2PRMA 2MNRA 4GACA 3SCQA 4GLEA 4V33A 4MYAA 4HYVA 2O9TA 1Q6RA 3HA1A 2PURA 3W84A 4AWSA 3PFMA 3LPGA 2QUVA 3RCNA 2B7QA 3TZFA 3VKJA 2J7HA 1FH7A 4DWSC 4MADA 3AMDA 4UFMA 4W5ZA 2DDXA 1WXYA 4HMEA 2XFWA 3I10A 2Z2AA 1B3ZA 3W1AA 3PWGA 2NX3A 7TAAA 4U10A 4LAMA 1EX1A 4OU1A 4FLQA 3MV11 3U48A 1U83A 2BP1A 1Q63A 2YPIA 3G0XA 3WK1A 2ABBA 4TTUA 3MI2A 1E9YB 2WNNA 2J13A 1GNXA 4GYFA 4Y8FA 4ZOCA 4G8TA 4O13A 1BVNP 5A8MA 3VDCA 4AB4A 4FIQA 3OVPA 1TA3B 1GZGA 1D3HA 3D46A 4PTWA 1DTNA 3LGGA 3W7OA 3RU6A 4BJHA 4GUIA 3T8QA 1ZJBA 2X40A 3GTIA 3VOGA 3A3HA 4GKLA 7ENLA 2J9YA 3S5NA 4V1XA 2O4MA 1RA0A 4FIRA 3KTXA 4HCLA 3VX0A 1WZAA 2WSQA 4KEUA 2G3NA 3DFHA 5DMMA 2P76A 3OG3A 1NWTA 3MJMA 3JVAA 3S2MA 1JGMA 1LBMA 1XG3A 3GE7A 2FTYA 2EJAA 3TQVA 2FB2A 3DOPA 3MDWA 2TMDA 3VIKA 1FFQA 3HPSA 1YDVA 2VC6A 2OG9A 1GVRA 1XDJA 3MUXA 1W1B1 3W1RA 1B2YA 3KE0A 4U28A 4IMFA 2PDBA 1BKSA 5DRIA 1SO6A 3S9ZA 4IMCA 4IH3A 1ME8A 5BXRA 3VPLA 1BRLA 4LNYA 2FJUB 1H7PA 4QE5A 5LSMA 1ICPA 2CBVA 4F0SA 3QY8A 5H8UA 3REQB 2SFPA 1KQZA 2AL2B 2ZZ3A 1R3WA 1HL2A 4BZYA 2PLJA 1DIEA 2WB5A 3CIXA 3VDHA 1YQ2A 4GH3A 1V6XA 1QBBA 2XTKA 3PBMA 2D22A 3TW7A 4AC7C 4RNFA 4Q8WA 1LM1A 4DM1A 4HU0A 1R46A 2V0TA 1JNEA 1EEXA 1IEWA 4E4PA 1XX1A 2ZUSA 3DYOA 2O7SA 5A8OA 4RE2A 3AS3A 1P6WA 3EXTA 4M8UA 1QNOA 2V5DA 4B9YA 3BG3A 1KB3A 2FGBA 3CASA 2WHJA 1NFBA 1C8VA 2CZVA 4CNOA 4E4FA 1JZ5A 2CZ5A 3SQLA 4PTDA 4AZ7A 4XZIA 5C71A 1B1YA 3OODA 1RXOB 1TPB1 4XAFA 1MNZA 3P5YA 3APGA 2VMFA 1K70A 4ZB0A 4K37A 4QQUA 3IEBA 3IJ7A 4JGDA 3FAWA 3NNTA 5LGZA 1ITUA 3FK4A 4BK9A 2B4GA 1Q13A 3SGZA 4LRTA 2NW0A 1KM1A 2EPOA 1TRIA 2CFFA 4S3FA 3N73A 2CXEA 3ZR4A 3I3DA 2DUAA 3WFLA 3UG8A 3FIGA 4W85A 1EEPA 3WEMA 3B0UX 4PCNA 4BWLC 1UKTA 2YBTA 5I3KA 1VFLA 2VOMA 4PUKA 4U2YA 4UOJA 2OYKA 4IZGA 4PFHA 4LYPA 1V6WA 3FSTA 5HQLA 2OZ0A 5BU6A 5A6AA 1XLBA 4IISA 4AF0B 3BPWA 1RH9A 4NX5A 5LGXA 4H6KA 3N4FA 1E6RA 1R2TA 4WOQA 3KW3A 2GSEA 3VCNA 1T40A 4NY2A 4JIPA 4HVXA 3IGSA 2XN1A 4OGZA 3E0WA 5HNNA 4XZHA 2PWGA 3W7HA 4N0RA 2Z1VA 5HULA 3CT7A 4DXKA 2OLSA 3GUGA 1C7TA 2D2JA 1DJHA 3EDDA 4PGLA 3TJIA 3ME3A 1PZ1A 3H12A 3UY7A 3EDKA 2CETA 2NT0A 4KERA 4N42A 3HQ1A 1E4LA 1L2QA 2Y63A 1ISZA 2WJZA 2Z1BA 3N6HA 3WQOA 4PCFA 5K3VA 1UUOA 3PJTA 2PFHA 3SIMA 2YX0A 4YTTA 4GY0A 3QOKA 3MY9A 2YA0A 1ZTVA 1VRDA 1A5MC 4AH7A 3T9PA 1JYWA 1WE5A 1HUVA 2X09A 3IJLA 1OFEA 1WX0A 1R0MA 2O0TA 3LZ5A 2TSYA 3F4CA 2VENA 1H4PA 3TP4A 1S46A 3PNUA 1F3EA 2P0IA 3QFWA 1BG4A 5LNWA 5HMSA 3EX1A 4PB5A 4INFA 3AYVA 1HJWA 1G7UA 3GTNA 4WIWA 2WVVA 5CJNA 2BXYA 3URBA 3MCOA 1YNPA 3N34A 4AY1A 2QZRA 3WMBA 4JZ5A 3V3WA 3W1TA 3DEQA 2YL5A 3JU2A 4EPBC 4UR8A 3URQA 1ML1A 3G3MA 1CGXA 2QGYA 4WKFA 4R33A 1DJGA 1XLDA 5CLWA 1BVZA 3S5ZA 5GVJA 4MMWA 4B2DD 4JCMA 2NUWA 3N9SA 3BG9A 4C65A 1TQJA 1PZ0A 4F0HA 3MJYA 4J2PA 4EXBA 1R3QA 4AZCB 4GCAA 1FHLA 1X7IA 1M7OA 4LF2A 1PUDA 3VAVA 3GZAA 1Q6OA 3DI0A 3GFXA 1A3XA 2BY1A 3AYTA 4OV4A 3O63A 3UNDA 2VFDA 1BVWA 2QLYA 4EOUA 4GY1A 4JX5A 4MNKA 4X60A 2DT2A 1QRQA 1UD3A 3BE7A 4MWAC 5DBTA 2DSVA 4AD5A 3ZR5A 4ONVA 5DY3A 4B5WA 4AWTA 2FYMA 1J18A 4JIRA 1UWIA 5E09A 6TAAA 3R43A 3KHDA 5DO8A 3EWXA 3G1RA 3LM3A 3M44A 2DEPA 4C6NA 2J7EA 5I6SA 1FWAC 4PH6A 1VB9A 2J9ZA 3KHJA 3QSRA 3OZMA 3HG5A 3E0VA 4JQAA 3KP0A 4LAOA 3VIPA 1MMFA 2YKKA 3KBNA 1ZS2A 4ZSUA 4A3HA 2HXUA 4QNWA 4MOZA 3TU9A 1WQ5A 1AH3A 4L5ZA 3CQHA 3H4XA 1O95A 1SJDA 4AZIA 1BYBA 4CQ8A 3T0DA 1VCFA 3GM8A 4PE8A 3R8GA 2Z6IA 3N2BA 3ARSA 4HZMA 3EKLA 1EOKA 4M56A 1NU5A 4K1GA 2QCFA 2INZA 3W7EA 5D8ZA 2BHUA 5ENLA 2VCAA 3WF0A 2FGZA 3QQ0A 2VYOA 1LG2A 1QASA 3W26A 3K4WA 4CVWA 1SMDA 4CNNA 4ROPA 1LT7A 4KRTA 5FCZA 1LWJA 1NQ6A 4TX9A 1AD1A 1BF2A 1X6LA 4JHZA 2QPUA 3LXBA 2IMRA 1C29A 2PDNA 1I2RA 4MHBA 1IWBA 4JFWA 3T2QA 2XUCA 3WY1A 2HVMA 5G2HA 3LGDA 4AD3A 1E9ZB 3WF4A 3MU7A 1JZ8A 4C5ZA 4JY9A 4AUBA 4QGCA 3SZ8A 5GNYA 4BF5A 1XHGA 2OEJA 1HG3A 3SN1A 4IP7A 5J8LA 3HPFA 3PR2A 1SYTA 1TE6A 3VDBA 2EEXA 5HNRA 2XIQA 4GIRA 4B4HA 3FFSA 2PODA 4JYDA 5DBUA 4IGMA 1L8NA 1E51A 1GYNA 4TO8A 3S5OA 1KWGA 1K8YA 3W7GA 4AD0A 4BQ5A 5K7JA 1EC8A 5BWAA 3LB0A 3W24A 5I03A 4EP8C 5DCDA 1IV8A 1FA2A 3SCNA 2ZUTA 3UZYA 4EANA 1E70M 1V5XA 2EBNA 2OCZA 1LL4A 3WIJA 3NG3A 4F3HA 4GQQA 1WZKA 5D38A 1KBLA 4EWND 3NL3A 4O0ZA 4CU6A 1Z69A 1WUEA 2DUXA 1GVFA 2CZFA 4PRWA 2NQ9A 3WH6A 2OOFA 3A22A 3FA4A 5D9MA 1CGUA 5EMLA 1LZOA 1CENA 2GDUA 3GFZA 4ZOEA 1KRMA 2A7PA 3LGEA 5FESA 1CZ1A 5HOSA 1N8FA 2R14A 2HVNA 2WCSA 3IUDA 3LMZA 1PX4A 1LQ2A 4PSPA 4XIAA 4DAIA 4XBJA 4BWLA 1Z41A 1GUVA 1O1HA 3O9NA 5EU9A 2YDQA 3VIMA 3PPFA 2Z2BA 1PCWA 3H4GA 2FKPA 1GPFA 1W1YA 4JX6A 3KVJA 3ZWSA 3KBMA 3ARQA 4M3PA 1T99A 3VX1A 4O15A 1S2CA 4FP1A 1YTEA 4OWGA 2WPBA 1UOKA 1DBTA 4WR3A 3QC3A 2QDEA 2YLAA 1FHVA 3C61A 4RZ4A 4AG0A 1W9PA 4B91A 2QMJA 2JEQA 1EH9A 4IFKB 3HGJA 3WQEA 3V36A 2CW6A 3Q58A 4IX0A 1Q4NX 1DXEA 4TXEA 3B06A 1FH9A 4W93A 2DJLA 4P8VA 3MO7A 3PUEA 3W53A 3SGUA 5C2CA 2J4GA 1CX9A 3T81A 1JPKA 3EOSA 4HTBA 3FYOA 3LDVA 1R6WA 4WSJA 3QQ1A 1L6FA 2POZA 1GTHA 1AMKA 4Q4KA 1F76A 1KFCA 3GXDA 3I7QA 3BSGA 2Y85A 4UZSA 5HATA 3MKVA 2DGAA 4HA4A 4IIHA 4F9JA 3BMXA 1I45A 4JTQA 1DXFA 4MNLA 3PBVA 3UWQA 3OBEA 4PEEA 1SMAA 4PMUA 2C6QA 2R1MA 3S2JA 3LHUA 3WQPA 4ALDA 4E5TA 5A6SA 2YB4A 1DVJA 4YS1A 2E9MA 2VFFA 4DNHA 2FZBA 3VUPA 3G24A 3NPXA 3F2CA 3GH4A 1VZWA 1VRXA 2X2YA 1B57A 1OCQA 3BW2A 4CNSA 1HKVA 1GZJA 1M03A 2QPXA 1XYCA 5REQA 2GL5A 5HJXA 1H5YA 1HO1A 2D24A 1OG6A 2HISA 3IS4A 1RBOB 1QBAA 1FQ0A 2BOFX 4GJIA 4P8UA 3ARZA 1E1CB 3EPNA 4GCXA 3UBPC 3DENA 1T8XA 1U5JA 4MPQA 4B15A 2XH4A 4G6CA 2B7PA 2YW4A 4F40A 2D3NA 4NRSA 3I3BA 1F8MA 1L6WA 1EZWA 1G94A 1JDCA 4K8HA 1EA9C 3W2KA 4MWAD 3TC3A 3ITOA 2YCEA 3A6OA 1KBKA 3W02A 1MWOA 1PWLA 4I7WA 5IHSA 2OSXA 4H8UA 1WOBA 3KOYA 2WQDA 3WLNA 2GK1A 3MUAA 1OX6A 4GABA 3LERA 3L5MA 3QRHA 1XRVA 1EGZA 3GC5A 2NQZA 5K9CA 1O60A 2EG7A 3AU2A 4DUVA 1PB0A 3GBEA 1A4LA 2ZICA 4MAZA 1LBLA 1TMLA 4H7VA 4HPHA 1SR9A 1MDLA 3K5XA 5XINA 1G1YA 3L5AA 1ZBKA 4NAEA 1AMYA 1QO2A 5LA2A 3BDKA 3UG5A 4JTEA 4CKQA 1YBQB 4H4IA 1ZZMA 5H1WA 3CAVA 3CV1A 3CHDA 4GNJA 2E28A 4Z2GA 4GVFA 1JD9A 4GK8A 2DY3A 3UERA 5AVNA 5A1AA 1ZUAX 4UFLA 2CKRA 1E9IA 4HPGA 2GGJA 3VKKA 1TZZA 4OOUA 1REQB 1VBJA 4Y96A 5D32A 5G1MA 3TQKA 3QGAC 3AIRA 2QCLA 2DSKA 2UBPC 2YXGA 4FB7A 3EEZA 4MPKA 1X8FA 3RX3A 1KFEA 1TV7A 1WKYA 1UWRA 1AQMA 4GKTA 2FFIA 2O92A 1UQZA 3F2DA 2F2KA 1V8EA 2AOSA 4UTKA 2DZAA 3B9OA 2DSUA 2VFGA 3M5XA 1NELA 3TSMA 4S3EA 1YTDA 1QNQA 2BOGX 3H2EA 1JQVA 2FMOA 1K77A 4XO6A 5A6LA 4LS2A 4H01A 4X0NA 1W32A 2A85A 4CD6A 3NAVA 3R79A 1AODA 1EXPA 1TIMA 3FEQA 2DIKA 3HOJA 3G5EA 2PF8A 3CZKA 4FLRA 3SB0A 1OK4A 3PWAA 1Y8BA 1UJPA 1YHTA 3J7HA 2PDWA 4ML9A 3PS7A 3RPTA 1FTXA 2ZX7A 2A7NA 1EO7A 5LNVA 3AHZA 4AEEA 1VCVA 5D05A 2C16A 1TWDA 3MI6A 3TKFA 1JDDA 2X0SA 1DYSA 3DG3A 2ACQA 1W3TA 2IW0A 3DFNA 2BXZA 3SRDA 2EG8A 3SAZA 5KZ6A 3ITXA 2Y70A 2ACRA 2PGFA 3RAOA 1K9FA 4ASTA 1PX8A 1IWAA 2CC0A 4N6FA 5CC5A 5MHBA 1V77A 3DN5A 3OVGA 1X1OA 2PZNA 2XIOA 4LAKA 3BW4A 3F2BA 5D2XA 3WJYA 5C8BB 4Q4QA 3UGRA 4BF9A 2GQ9A 3WH8A 4F8XA 5F1VA 3MI3A 5B80A 3V5CA 3KVKA 2CZDA 2Y7EA 2XVLA 1J0KA 1YKWA 4GUHA 1W5MA 3TTOA 5M5DA 3OVQA 3EA1A 3W2JA 3ARTA 5BU9A 4IGSA 3UWVA 4GO9A 4NJJA 5EKYA 3UETA 3U4AA 1OC5A 3TN5A 1EJUC 4PMYA 2DT1A 3GVRA 4IJRA 4M81A 4UXDA 2EJ1A 1HJVA 2NV1A 2DZWA 4TVDA 4P7NA 1W56A 5HUOA 1YADA 3QY6A 3TW9A 5KZMA 3RILA 3TQPA 5I3DA 4KMQA 4XZNX 3CLWA 2DVUA 4JHOA 4GI9A 3URNA 3I7RA 2OZ3A 3VD5A 2BASA 3BLFA 3UPBA 4QHRA 1DQUA 1YTKA 3RLGA 1R5YA 4KCVA 1UZ1A 2JKAA 3MB9A 2O9RA 4EACA 3HZ3A 1LJYA 3VIOA 4MNJA 2PDYA 4XO7A 1TVLA 3USBA 3W28A 1CXKA 3FGCB 3KRBA 4FAMA 2QXWA 1RVKA 4KQNA 4ZENA 3ITCA 5E70A 2F7FA 3NQCA 5TD4A 3FXGA 1OFBA 5LNUA 1KLZA 2J79A 1MRAA 4DBDA 1V3LA 1I0DA 1UWSA 4H6EA 4LEFA 2NXGA 4QE1A 1G01A 3DGBA 1PX3A 3L2MA 3UCQA 2Q8LA 3CUJA 3U6WA 2A3EA 1A5CA 2RDUA 2QUNA 2X7WA 2VFHA 2G3MA 4W7VA 2V8ZA 3ARXA 4DVOA 1KD0A 4E3VA 1WDQA 1P1MA 4QSFA 1RQHA 3OGRA 1K9TA 3CJPA 2R1NA 3AZSA 4N9EA 2PUZA 4Z2JA 4YL2A 1XS2A 2EG6A 1RD5A 3H53A 4M19A 3MMDA 3RO6A 3DXIA 3GO2A 2RJGA 1QK0A 3N6QA 2VNCA 4NQ1A 1TTIA 1FOBA 4AXNA 4R85A 4M6PA 4E2DA 1JEZA 4MVAA 4GYPC 3RM9A 4W86A 3VD9A 5CGMA 5LIUX 3SDOA 4B5XA 4QDWA 2QT3A 1E43A 1F4HA 2PZ0A 3PAOA 5AYXA 3NDZA 3QW4B 3DHDA 4ZCWA 1JUKA 1XGDA 4Q8PA 2Q8XA 3LBOA 4K36A 4CN4A 1K9EA 2O7QA 1H1NA 4IMAA 3E02A 4P2VA 3K30A 3AQUA 5LXEA 1EQPA 1JXJA 2V9DA 5HWMA 4S1FA 4FXSA 4GXWA 3UCDA 1FWRA 3EAUA 2YA1A 4DRSA 1MEIA 3CZEA 3VU2A 2QPSA 4H7ZA 1S2WA 1AW5A 1C8QA 4HNVA 4WVXA 3E5PA 2YBUA 2CYGA 3F5LA 1MI3A 4LFYA 1E6XM 4PL1A 2IQDA 3FVDA 4NKCA 1E15A 3N3MA 2ZWZA 3W2LA 3HJEA 1QI2A 1X38A 3VUSA 3VNLA 4AISA 2PLKA 1CDGA 1XICA 3RX2A 1JAEA 2J7BA 2A7RA 1V0NA 3GDBA 3JS3A 3OYXA 4TV5A 3M0KA 4A3UA 2YFNA 3LYEA 5FF3A 3S9IA 3GG0A 3BGGA 3SRHA 1V93A 4MAVA 1K7FA 2GVJA 3DI1A 1OEPA 3QGVA 4OZOA 5D37A 4KPLA 2RDTA 1TFVA 4YVPA 2TAAA 3NQFA 4L4PA 3NQMA 2PEVA 4JR5A 3TYZA 2A0NA 2DVXA 1WKEA 5EYWA 2VO5A 4EXAA 3CGTA 4FA3A 3T2PA 1W1TA 2Z7KA 3AIQA 4QDMA 4ZGYA 1R85A 3H7RA 3RXZA 1IGSA 2BDQA 4G1KA 1Z9AA 4NX0A 1XIIA 3CTTA 3SJ3A 3U2OA 1CECA 4L4OA 5FKYA 3KCLA 4AIUA 3WBEA 1W6TA 3WD1A 4DWSB 2PI6A 2C1IA 4RNIA 3S4TA 3A23A 1W2PA 3I6EA 5A6MA 1BQCA 1JUEA 4O4WA 3UF9A 1NDZA 4QE4A 1KCKA 3GUWA 5D2WA 2AQOA 3CWNA 4E38A 1ZY9A 2JFEX 5EBAA 3HV9A 3LHYA 2VKZG 3CHVA 2PDLA 1XF0A 1Z7AA 4J4KA 1ODZA 4A05A 1C7SA 3OBAA 1HJXA 4HTYA 4HJFA 1JD7A 3W0KA 4XG1A 1QFEA 5K9XA 4D6CA 1QOXA 5LNRA 4TTGA 1I6NA 4ZODA 3ZIZA 5KZEA 3WCZA 2EGZA 1DQXA 3TYEA 5D33A 1G0CA 3CQKA 4QQ3A 3CUIA 3EWYA 2E09A 1VPXA 1I2QA 4NF7A 2ZFAA 2PBGA 1IHIA 2WYSA 3QPYA 4JYEA 1XKYA 1VR6A 3T0BA 5A5WA 5A6JA 2JF7A 4DJEC 5IFTA 3T40A 1AW1A 4J3XA 5ABHA 1C92A 3G0SA 1B4KA 2O9PA 5C9UA 1HXJA 3DFSA 1TREA 4C7FA 3C52A 1FWHC 1QT1A 2V69A 4U31A 1A5BA 3LX9A 4IQLA 4XKYA 2YCIX 1RQEA 3E96A 1UR8A 4CUCA 2VFIA 3WQ6A 3B8WA 2D2GA 2CLMA 1V3JA 4LC6A 3PTQA 2WJEA 2NQJA 3TMLA 3ZT6A 3IJIA 2VZOA 1UZ4A 4UR7A 4V1YA 2W6RA 4RR4A 3CQJA 5FEPA 3S6TA 4JTLA 1B5TA 5MF5A 1EF3A 4LC8A 1QR7A 3PM6A 2CHRA 1DIDA 1D2KA 4M1BA 1EJWC 3LI1A 4LB3A 4DJFA 3T44A 4O16A 2ZYFA 1UH3A 3JR2A 2NUYA 1SQ7A 3OEXA 4MM1A 3VCCA 2YCJA 3W86A 3F03K 1TRDA 1CXEA 1P7TA 5ABTA 1ECQA 1GEHA 5CSRA 1MW3A 1L9WA 9RUBA 3WFAA 5XIAA 1W37A 3N2CA 3UESA 3DG7A 3CUFA 4GVHA 3CUHA 4JQ4A 2D69A 1Q5MA 2Y8UA 2DT0A 3N04A 1LL6A 1OADA 1QOQA 3W2NA 5CSYA 5FJJA 1JZ6A 1OYAA 2VRQA 1IXPA 1C3FA 2A2IA 3TXVA 1OFQA 4J3ZA 4O1AA 1F73A 4PC8A 3SRKA 5FA5A 1PZ2A 2YOCA 4PTVA 3OG2A 1LBFA 3R13A 1KNWA 1VAHA 3M0LA 1NIUA 2CWNA 3AWOA 4UFHA 4Q6XA 2DH3A 4DO7A 3TTQA 1SU5A 3MSYA 1UW9A 3B9NA 1UWQA 1RJPA 5FOOA 3KLKA 3UA4A 3A21A 3B8DA 3R4IA 4LUYA 3LPPA 1OY0A 1XC4A 5KSWA 4GVIA 2XFFA 3LCLA 4K6AA 4IIGA 3W1LA 1JULA 4PSRA 4ZXOA 3A4XA 4PMVA 2FHFA 3TYDA 2DSWA 3O1NA 3FOKA 1R9YA 4YHEA 4UOQA 2CLOA 5AHFA 4ZQOA 2BGQA 3PJUA 2ABAA 3PULA 1KGWA 4DPQA 2C7FA 2NQHA 3AZTA 4AIEA 4UNIA 4C7DA 3W6YA 1RK6A 4KGJA 1F07A 1XPGA 2ANUA 3E74A 1Y5WA 2VOTA 4GQGA 8XIAA 3LMYA 1US3A 1OJXA 4LV4A 5AC5A 3CL7A 3W7JA 4YTRA 2ISWA 4UBPC 4QS6A 5LA0A 2D3LA 2VXNA 3CXOA 2HS6A 3WD2A 2Y7GA 2NSOA 4LUTA 4L56A 2F6UA 4U3AA 4ZE5A 3TZNA 1VIWA 5D9OA 1FVPA 1QPOA 3P60A 3EOLA 4UTUA 1HKKA 4LQ1A 2ZVRA 4S3AA 4JTRA 4KCUA 1YDNA 1H3GA 3G22A 3GB6A 5TIMA 3WENA 3BSHA 2VX5A 1BSIA 4B3KA 3QN3A 3ATYA 3UPMA 3S6OA 4IUGA 3W87A 3VK5A 3DHFA 1J0JA 2WSPA 5PTDA 4E6MA 3BG5A 3WBXA 4GUJA 1WP6A 3LU2A 3LNMA 5M17A 1CB7B 4G1NA 2ZDSA 4RW5A 1JF5A 2W67A 3EWWA 1J5TA 3S1XA 5I3JA 3RF9A 5LNSA 2CLFA 2BMBA 3N14A 3XIMA 3TR2A 4IIDA 2PDMA 1E5JA 3WK0A 3NPUA 3THQA 4EAYA 3NQVA 3VCRA 3G6LA 5DEZA 1BWKA 4JTJA 2D0HA 3LCGA 1VS1A 3ZYZA 5EFDA 2ZRVA 3FN9A 2W92A 2MANA 4C90A 4JY8A 4PUUA 3IJ6A 3KP1A 2PDUA 3H22A 1I1XA 2E6AA 4MWAB 1KRCC 3M47A 8CGTA 1OFPA 3GR4A 3SQMA 1H7OA 1J96A 3POHA 3O8AA 1IEVA 1FHUA 1Z44A 3O6YX 3HQOA 3VILA 2OLHA 5JIWA 3BW3A 4K3ZA 3KZSA 5DFAA 4HZ7A 1BD0A 2P88A 5HINA 1MFVA 4ACZB 4EPKA 6XIAA 1T6MA 4XAPA 1DWIM 2YYUA 4ECLA 1YW1A 2PDHA 3HN3A 1JF6A 1OG0A 1PYFA 3WJXA 2VEFA 3DESA 3WEZA 3HGRA 2CLIA 5A69A 1MYRA 2YL9A 4KGLA 4ATLA 3GXIA 3TV8A 3LNPA 4AZ6A 2OLAA 3AISA 3BJFA 2QCHA 4DJED 1XIDA 1XLLA 3ANYA 4GMEA 4NZ1A 1UPPA 3MZ2A 1PHWA 3S1WA 4AHOA 5T26A 2WO5A 3BAWA 5JBEA 1Y5VA 1VEOA 2KX9A 4JTDA 3RMEA 2GYIA 3UG3A 4B3LA 1C93A 4JTCA 1EHNA 4LS0A 3EEGA 3VKAA 4AU0A 3NJ3A 2X1RA 2QJHA 4HPJA 2G37A 2WQPA 2CPUA 2A3LA 2QMKA 2J66A 3VNDA 5CBIA 3A5VA 4X9SA 3DZ1A 1UD4A 1LORA 3AWNA 1B3WA 3TH6A 3W07A 4FO4A 3LXCA 3ES7A 4WKAA 1UKOA 3JRKA 3LEPA 5FD0A 2HTMA 5HQMA 1P43A 5CPTA 4MJMA 2DZVA 1E0WA 3KBWA 3K8KA 1N2VA 4IL2A 3SN0A 1LT8A 3CYVA 2CLEA 3V0SA 4FOUA 3L0GA 2OYLA 4RE0A 3GC2A 3POCA 4I5RA 3S1UA 3DKLA 2QCDA 1WBHA 3RU8X 3W29A 2IKHA 4JTIA 1G4SA 3MYOA 3IANA 1G7VA 3QKEA 2HNHA 4WOZA 1SZNA 4HPNA 3EZ4A 5FEXA 1WAWA 4US6A 4LEQA 1PTAA 4FK9A 3OHMB 1NARA 1W1PA 4REQB 5AVHA 3R58A 1LOSA 2PDJA 2ZRWA 3LV6A 2OEKA 3QW3A 3KVLA 1VFOA 2VT0A 1N7KA 4S38A 4HCHA 1F74A 4C60A 4JL1A 4UCGA 4Q4SA 1B3XA 4MLJA 1S5MA 4K1WA 2GUYA 4V2XA 3UJRA 2ON3A 2HDJA 3PZVA 3MPGA 1LP6A 4FX6M 3PTKA 5I2UA 2E5DA 2I9UA 1E55A 3S6DA 1AA1B 4WJXA 2J75A 5IBXC 4K7VA 3OHIA 3W38A 1UWTA 1C9WA 4QCFA 2Y7FA 1UMYA 3W1XA 3I7SA 2Z26A 3ELFA 4NJHA 1WPCA 1E0UA 3GIQA 1XC6A 2I14A 1G67A 2GLKA 3DECA 3UR7A 1RPXA 4JTFA 3FW6A 3EXSA 3ZT7A 4MDPA 3VDAA 4LVAA 4BS0A 5H6HA 5I3FA 3M7SA 1LWIA 4PUDA 3KS5A 2F6XA 6ENLA 3MANA 3TWBA 4QSHA 1W5OA 1NP0A 1KCLA 1XV8A 1G4TA 4UFKA 4ZO9A 5FJIA 3B8VA 3CS2A 4UMBA 3ABRA 3D3FA 4XD6A 5FF2A 3W1UA 1YDOA 3CMJA 3AI0A 4AX6A 4WJEA 4PMNA 3PBUA 4GFIA 3G8EA 1M7JA 3M5YA 4HNUA 4AIBA 1AZ1A 3KRUA 3UQNA 1U22A 1S1PA 3C0LA 1MUWA 1I60A 4JTKA 1S5VA 3QXBA 1H61A 2OB3A 5MKGA 1QVBA 1VPYA 2AAAA 1SUXA 9XIAA 4GZ7A 4LV9A 1FXQA 4OIFA 1SSDA 1PKLA 1IIGA 1K4GA 1BHGA 2CLKA 4W4QA 4FR1A 2J47A 1RLCL 3NL5A 3A3WA 2JGQA 5E5CA 2ASHA 4ATDA 3W6MA 3QR3A 1KFBA 3KDOA 4KRZA 4EE9A 2GVLA 2OVLA 3SBFA 2EAWA 5HXMA 3ENLA 3N4EA 4Q7IA 4MB3A 2QEZA 3KOWA 2Q09A 1O5RA 3C8NA 1D3CA 1FWEC 1QJWA 2DZSA 5FJRA 3G6MA 1KBIA 1FP9A 5F4SA 4PCTA 7PTDA 3TR9A 1I2NA 3OOQA 4N9BA 4UWMA 1GJWA 5LHFA 3TYUA 3GDMA 1O5XA 3H7UA 4TOQA 2NVDA 3CEUA 5E0KA 3M9YA 2VP8A 4PBFA 2VGGA 2CITA 2X42A 4AWEA 2OWWA 5HWJA 2QS8A 3BOFA 4NUWA 4GISA 2I56A 1VYRA 5JIPA 2GVYA 3WBWA 3CUZA 2DSZA 1V03A 1XLAA 4GIEA 3WG6A 1IXOA 4GE8A 1JZ7A 3GHRA 7REQA 1SW0A 4HOZA 3T0AA 4PYSA 2G3IA 3MW7A 3IAPA 1B3YA 1G4PA 1QNVA 2OT1A 4XKMA 3CPRA 2O56A 4PMOA 3N2MA 3QTGA 4YTQA 3B8TA 3I3EA 2E4TA 1OC7A 1P5BA 4MZYA 1HL9A 1TTQA 4BCEA 1DL3A 4U5IA 2F2HA 1ZAHA 1GORA 1VC4A 4QTGA 4X3ZA 2CLLA 2PTYA 3LS9A 3KAOA 4TUFA 4KFOA 4D1IA 4FR6A 2WZHA 2VWTA 4QG6A 3WF3A 4N4PA 4L65A 4X9YA 2XH7A 2YLLA 5C9RA 1CCWB 4FNPA 5XIMA 3CL6A 3Q45A 3V16A 1AK5A 1XSJA 4HCDA 2ISDA 1KM0A 4LVFA 1BAGA 1PCKA 1JFHA 1SJBA 3U57A 1J2WA 4IICA 2QUTA 1F9CA 3P93A 3WL0A 4DYJA 3ALGA 4CCDA 3CIVA 3PAJA 1SSGA 2X1SA 4NNCA 5HMDA 5FJUA 3WK3A 4BR1A 3PJWA 3LN3A 1YXDA 4GHRA 2QAFA 4XISA 4XZ9A 2W61A 3Q37A 4G9PA 4LB4A 4DEFA 3VIGA 1LTDA 2C8NA 3AIWA 1VEPA 3E2RA 1DQWA 3G1FA 2FJKA 5I79A 2DIEA 4AX7A 2Z00A 4J27A 1BFNA 2F84A 1M7XA 4NNBA 2QVNA 3UCCA 2ISVA 3L2LA 5E9AA 4HSOA 3LHZA 1WB0A 3GC4A 2Y89A 3QMRA 2PP1A 3OIHA 5T9CE 2WJDA 3BLOA 3EWZA 1JZ3A 1OGGA 4WDWA 4FXRA 2WKGA 4LW7A 3W01A 1G6CA 1VHCA 3HMJG 1CBGA 1YNQA 4RNJA 1TJPA 3O06A 3RIKA 1W17A 3EX3A 4A8LA 4JFSA 4EXQA 3IVSA 2XVGA 2JF6A 4A21A 4H9YA 2I5QA 3BLEA 3GXTA 4P8XA 1ZCOA 2PA6A 3OU8A 4C1NB 3IIXA 2J7GA 2V38A 4S3KA 3P6LA 4ZTYA 1EIBA 1HKJA 5LA1A 2W79A 3F5KA 1MQPA 3JZEA 4GVGA 2Y5SA 3O0KA 2CHNA 2PDPA 1CGVA 3RRXA 3C2OA 2YDRA 2WZTA 4OQVA