5KETA

Structure of the aldo-keto reductase from coptotermes gestroi
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
328
structure length
328
Chain Sequence
SVTFHNGRKMPVVGLGTWQSPPEEVTAAIDVALEVGYRHIDTAFMYQNEAAIGKTLKKWFDSGKLKREDVFIVTKLPPIGNRAESVEKFLTKSLEALQLDYVDLYLIHLPVGFQYKGDDNLWPRGEAGEFLIDTSTDLISLWKAMEAQVDAGRTRSVGLSNFNSRQIARIVKSARIRPANLQVELNVYFQQRELVAFCRALDITVCAYAPIGSPGLANVIKARGAEVPESAKFDPLTDPVVLKIAEHHKKTPAQVLLRHCMQRDIVVIPKSTNAGRIKENFQVFDFELSKAEVDELDSLDKRAAGRRFRMDQYKGLREHPEHPYDEPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Coptotermes gestroi aldo-keto reductase: a multipurpose enzyme for biorefinery applications.
pubmed doi rcsb
source organism Coptotermes gestroi
molecule tags Oxidoreductase
molecule keywords Aldo-keto reductase 1
total genus 96
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5ketA00
4XZMX 3UG8A 2ALRA 4XVDA 3WBWA 4Q7BA 1PWMA 3H4GA 3LZ5A 3UYIA 4JTCA 4QBXA 3CMFA 4QXIA 2PDGA 1US0A 3F7JA 3T42A 2IKIA 3LEPA 4GABA 4JQAA 1PYFA 3H7UA 3LN3A 5HNUA 3VXGA 4JIIX 2PDWA 2C91A 4WDTA 4EXAA 5KETA 3CAVA 3G1RA 1EKOA 3B3DA 2PD5A 1HQTA 1EXBA 4WEVX 1PZ1A 1AZ2A 3H7RA 4XK2A 1Z3NA 2BP1A 3EB3A 4YVXA 1GVEA 1UR3M 1X98A 2IQDA 3V0TA 4IJCA 5DANA 2WZMA 2FZ8A 4GIEA 2NVCA 2IPWA 4PRTA 2R24A 1VBJA 3UZWA 1EL3A 1YE4A 3KRBA 4ZFCA 1C9WA 4XZIA 3WBYA 5LIYX 3COTA 4FA3A 1LQAA 3O0KA 3CAQA 2ACQA 4XZHA 4GA8A 1RY8A 1T41A 1Z89A 2IKJA 4H8NA 3QKZA 3V36A 2DV0A 4MHBA 5HA7A 3U2CA 1VP5A 3EB4A 4LAZA 4JTQA 1ZGDA 2F38A 5LIWX 2I16A 3N2TA 4PUUA 3M0IA 3R94A 2PDLA 3Q67A 4XO6A 4XO7A 4HMNA 1Z8AA 4GQGA 3UFYA 2ACRA 2A79A 4LBRA 4HBKA 3ONBA 4LAUA 2PDQA 2I17A 2VDGA 5AZ1A 3CV7A 3LQLA 5JH2A 1A80A 2PDFA 2PDJA 5C7HA 4QR6A 4GACA 5LIKX 3LENA 3DN5A 4WDXA 1ZQ5A 2PDYA 5JH1A 1JEZA 3LBOA 2ACSA 4ASTA 4DZ5A 4Q3MA 2BGSA 1SM9A 1Q13A 4ICCX 1XGDA 1MZRA 2PDKA 3BCJA 5LIXX 4JTAA 3R7MA 4AUBA 4JQ4A 2PDNA 1Q5MA 3NTYA 4WDUA 3GHUA 3RX3A 1IEIA 4LBSA 3BV7A 2FZ9A 4PUWA 4JIHA 1QWKA 4R9OA 3C3UA 3R43A 1AH3A 4JIRA 4PRRA 3MB9A 2FZBA 4JQ1A 4JTRA 3S3GA 3UZXA 3LD5A 1ADSA 3EAUA 1AZ1A 2PDCA 2IQ0A 4GCAA 5LIUX 4FALA 2PZNA 3R58A 3N6QA 1QRQA 1S1RA 4JTDA 4RPQA 3D3FA 4DBSA 2WZTA 1X97A 1R38A 3M64A 4I5XA 1S2AA 4WRHA 2PDPA 2FVLA 1S1PA 4XZLX 5M2FX 2PF8A 2HVOA 4YVPA 1PZ0A 1OG6A 4EXBA 2INZA 3BURA 3UWEA 3V0UA 3UP8A 1AH0A 3ERPA 4XZNX 3LZ3A 2PD9A 2NVDA 2IS7A 3LNMA 2HEJA 2FGBA 1YNQA 2HVNA 4OTKA 2AGTA 1K8CA 4WDWA 4WGHA 3CV6A 1Z9AA 2HE8A 1YNPA 2PDMA 2IPJA 3UZYA 2F2KA 1EF3A 2ISFA 2J8TA 3R8HA 2BGQA 3P2VA 1X96A 4YVVA 4XAPA 2IPFA 3ONCA 2PEVA 4F40A 5HNTA 4XVEA 4G5DA 2FZDA 4PMJA 2QXWA 3Q65A 3GUGA 2PDXA 1J96A 1PWLA 3DOPA 4YU1A 3WCZA 2PFHA 2ACUA 4PR4A 1XF0A 2PDUA 4H7CA 4NKCA 2DUXA 3R8GA 2PDHA 3G5EA 3FX4A 3WBXA 2INEA 1XJBA 1T40A 3GHRA 4YS1A 2HE5A 3CASA 3RX4A 4DBWA 2R9RA 3V0SA 4FZIA 4LB3A 2PDBA 4L1WA 2IKHA 1LWIA 3LUTA 4QX4A 3GHSA 2DUZA 2HV5A 3UGRA 1AH4A 2P5NA 1M9HA 4JQ2A 1FRBA 3UZZA 3MC5A 2IKGA 1IHIA 3M4HA 4IJRA 4DBUA 2PDIA 3LQGA 5AZ0A 4FAMA 1HW6A 4IGSA 1RY0A 1YE6A 1MI3A 1MRQA 3O3RA 3GHTA 1S2CA 3V35A 3FJNA 4LB4A 1AFSA 2IPGA 4GQ0A 3BUVA 3WG6A 4JQ3A 4L1XA 1RALA 3R6IA 2HDJA 3RX2A 1ZSXA 1ZUAX 2CLPA
chains in the Genus database with same CATH superfamily
2DT3A 2BB0A 1AJ0A 3TJLA 3MJMA 1JPMA 1UZ4A 1KFJA 4ZQNA 3PAOA 4HN4A 4LWWA 1G9HA 4IGNA 5C2GA 3TFCA 1JCNA 3QM3A 1US0A 4TR9A 3U8GA 2VRKA 4DNHA 1H7PA 3DC8A 2V68A 3ZIZA 1O4UA 1B9ZA 3BW3A 2HXUA 2XSXA 4KGLA 2PDWA 4W86A 4DZHA 2G3MA 3D5HA 4XUYA 4AAJA 5TBOA 3KVLA 3WH7A 2GVYA 1UR4A 5D2XA 1JDAA 5LNRA 3QFWA 3JZUA 1PZ1A 1KB3A 2YXOA 2ZRXA 4PMNA 3B8TA 3WLSA 1A3XA 3TROA 3TMQA 4KEMA 3VIFA 2WZMA 1K6AA 4FR6A 2I7GA 1OT1A 3L7RA 1C8QA 2OWWA 1MDRA 1KLYA 1CXIA 1TUXA 5I3KA 3EX3A 1PSCA 1G67A 1LLWA 1GORA 2CNCA 1NQKA 3S2NA 3IVTA 3S47A 2BVYA 3PWIA 4FOJA 4US6A 3URAA 2QJMA 1R2TA 4O4VA 3KTSA 1Q2RA 1TPC1 2HRWA 2W67A 4AHOA 5DF0A 2X2GA 2PGRA 3MYOA 1JPIA 4J2PA 3O8AA 2HCVA 1EC7A 2YBVA 4H6RA 4QROA 3V36A 1FCVA 2OLHA 4JTQA 3DFQA 4WOQA 2X7VA 5GQBA 2YYTA 5FJJA 8CGTA 3O05A 3P80A 2ZZ2A 5LYRA 1SUXA 4UTIA 3B8UA 3I3BA 2OR2A 4OHQA 1V6WA 1WPCA 1BPLB 3WL0A 2JE8A 1Q2SA 1FWWA 4L6DA 2Z26A 5HQEA 1QU4A 3CV7A 3MSGA 4PMRA 5T91A 3M43A 3WMBA 1XYZA 5CC7A 4WUIA 2CHNA 1P6WA 4LANA 1IXPA 2OMAA 4LY8A 2VUYA 4MLJA 2EPMX 1NY1A 2RKXA 3EMZA 3BPWA 3XINA 1UYQA 1LP6A 2AL2A 4UB9A 1AQFA 3WDRA 4YIWA 3NZPA 4J3SA 3A9BA 4L80A 1SZEA 1MZRA 3F2CA 5EFDA 3W83A 1XYBA 2WLZA 1ICQA 1ONRA 3OYZA 4LBSA 3AFBA 3EKGA 1E56A 3TYCA 2VHLA 3EEZA 4PMVA 3UT0A 2X1UA 2UWFA 3MMWA 5A6AA 1QWKA 5J8LA 2NQ9A 4IFKB 3KL5A 2OKOA 2XH2A 3RCYA 1Y5VA 4IF2A 4AZCA 4PA8A 1R9ZA 4TMCA 1V93A 1WOAA 3VOGA 5AYYA 5D9OA 2EPNA 1MFVA 3WO8A 1ADSA 4GUIA 5GNXA 2E6AA 3PZQA 2R1KA 4CQBA 2WQPA 3VE9A 5EBAA 4Q4QA 5I24A 2WZTA 5FEPA 3TXVA 2CETA 2DSWA 2VNCA 4J40A 3SUUA 3U5YA 3QR3A 4ZXOA 5AECA 1DXFA 4R53A 1P48A 1IIHA 1O68A 3IGUA 4L61A 1RUSA 5BWAA 3WQGA 2E1WA 4AB4A 1DIKA 3ZFHA 5C71A 2A4AA 3CT2A 2ZDRA 6PTDA 4MKVA 1OT2A 4KEUA 3NIYA 3MMDA 3SRHA 3WBEA 1NSJA 2XGZA 3WD4A 1MW1A 2V3GA 3LRLA 2HS6A 2Y61A 1U5VA 2PP0A 1YPFA 2FGBA 3MDWA 1Q8JA 3TWBA 4I9JA 3WLKX 2AGTA 3PTKA 1RVKA 3ATYA 1SO5A 1WDQA 3H12A 2CESA 4HYVA 4HA0A 2WBGA 4BEUA 1FQ0A 5AOUA 3MSDA 5E9XA 1B3VA 3ABRA 3AXHA 4OUIA 2ISFA 1TYGA 4H00A 4CNNA 4D9PA 1MNSA 1PZ3A 1WQ5A 1O7AA 3W1NA 4F8XA 1RCOB 5I3IA 2QJHA 3LS9A 3OHMB 2ABAA 4XVEA 3ZR6A 4LVAA 1PE1A 4N9EA 1CI1A 2ZZ4A 3NO5A 1H7RA 1GQNA 2OZ3A 2Y5SA 4X2PA 2E1DA 3REQB 2DVUA 3OEXA 3WQ4A 1RXOB 5HR7A 3GTNA 1K03A 4LY4A 2DUXA 3WQPA 3QZ6A 3UR8A 4X60A 5EMKA 4S3BA 2WKJA 3BGJA 2DZVA 1FP8A 4H2HA 3GHRA 4PTWA 4O16A 2F6XA 4IL0A 3WQVA 1WX0A 2VENA 3HGRA 2H3BA 2R1PA 3SCUA 4DBWA 4DF2A 2ZUVA 1J0ZA 1EC9A 4IPNB 4FMVA 3UF9A 1OIMA 4ZQRA 2OCZA 3NL5A 3GHSA 3OG2A 3BW4A 5TQLA 4K2SA 4I5RA 4FO4A 2X7WA 4I7VA 1IHIA 1KM3A 1ZCOA 2J77A 2PC4A 1X6LA 4GXMA 1JF6A 4FB7A 4HPHA 3GNOA 3V35A 5KSWA 8XIAA 1N82A 2PGEA 4RDVA 3FJNA 5G4EA 1UWIA 2OSXA 3IWPA 3APTA 3KBVA 4M81A 1XH1A 1V5XA 4PMUA 1ONWA 1NEYA 4UQBA 4JTSA 3VDBA 1IR1A 2OOFA 4I6VA 1W9PA 4E2OA 3UG8A 9CGTA 3WBWA 1EPVA 3LZ5A 3UYIA 1OFEA 3K4DA 4N7QA 2ZA3A 2PTXA 1S3TC 3P61A 4J4KA 3KE0A 5FEXA 1PEZA 1N55A 4P8XA 4Y7EA 2QJIA 3GNXA 2HVMA 2A7PA 3UU0A 1TO3A 3MSYA 4LS2A 4CCEA 2J66A 2VURA 3MS8A 2CZEA 4JIIX 2QJGA 2ZXBA 2QEZA 4WDTA 3GDKA 2VD9A 5GJMA 3G1XA 3SADA 5AHFA 3LU2A 1SW7A 3OJGA 1B3YA 1JPHA 2VRJA 1AZ2A 1TR1A 1Z3NA 4A8RA 4FNSA 4FX7A 1CWYA 3ICJA 3VZXA 4MWAC 2VL4A 4O57A 3T07A 4P8VA 1ONEA 4DPQA 3KEHA 1R47A 1BQCA 5CZSA 4MDOA 4K8EA 1WA3A 3W7CA 3N17A 4PRTA 4GO8A 2AQWA 1LJYA 5PTDA 3MHUA 1VBJA 1RLCL 1H49A 1KR1A 3KXQA 4ZFCA 4N9DA 3GC5A 2FTYA 4GVHA 3FIGA 1QI4A 3WLIA 2NT0A 2OEMA 4O0QA 3RDKA 2WMIA 1TJ1A 1TA3B 3OVRA 1FH8A 3BE7A 1LZOA 4E4UA 5JIWA 3QKZA 3QVQA 3UZJA 1KFBA 1BRLB 2PS2A 4CEUC 5A1AA 2GSHA 4C1NA 3M5ZA 3FS2A 5HUPA 3I6RA 1TPFA 4S3KA 3EA3A 3P60A 1R9YA 2CLOA 3W23A 4C1KA 2NQHA 3BANA 4ATDA 4HZ7A 5HWNA 4HMNA 4J7RA 1S2TA 3ES8A 1QNOA 3T44A 1FWBC 4AEOA 3TFXA 2YL6A 4E5TA 5D02A 3APGA 3O7UA 2I17A 4M6PA 3CQJA 4D6DA 5A2BA 5C9UA 4RE3A 1AVAA 3OB8A 2PODA 3W82A 3CGTA 2FMOA 4NX0A 3PNZA 1WKDA 5LIKX 1UP3A 3I7RA 4E38A 1M65A 3KL0A 3DFSA 1T7LA 4IIGA 4DZ5A 2I5QA 4TMBA 2H3DA 4S3CA 5FF7A 3VOJA 3WQ6A 4LV9A 2Y7EA 3EX1A 4TXEA 4WSKA 2J47A 4L56A 4R7OA 5T8GA 1E6QM 5CBBA 3ZZ1A 4CQAA 1TSIA 3TP4A 1ALDA 1XG3A 3MANA 3H2CA 1GJPA 4NRSA 1PKYA 4KQNA 3RF9A 3U5UA 1XPYA 3W2KA 3AALA 2PDCA 2X1TA 3WLPA 2IQ0A 4YTSA 1D8CA 3W24A 1OGBA 4B15A 2RJGA 3W2NA 3FDKA 5ABEA 2I57A 4RPQA 2DIEA 1T0OA 1WBHA 1VIWA 1OFBA 3NYDA 1KFLA 4HHHA 4LC6A 1SPQA 3LLXA 1A5SA 4OECA 4US5D 2PF8A 4UFMA 3ARQA 2UY5A 1QATA 5BXTA 1EP2A 3NO1A 3WF4A 1JFHA 3N15A 1NQ6A 1A5MC 1BXNA 1J12A 2HNHA 4PH6A 1QW8A 5REQB 3NCOA 1NP0A 3PB0A 2OB3A 2G95A 4NU7A 3N18A 4A3YA 1TTJA 4ZB0A 3MYPA 3SZ8A 2ZZ5A 3QV9A 1GVQA 1JG9A 3W53A 4DLMA 1ISWA 4UR7A 3VD9A 4JEQA 4UFKA 2GOUA 1KCLA 3FXYA 3ZLGA 2DJLA 5A69A 3EDEA 1S5WA 4O12A 2J6XA 1M1BA 1U1JA 5M17A 3LOTA 3R5EA 2IPJA 1D7FA 4FX6M 1P0EA 3ZR5A 4YXGA 2NSXA 4QCEA 3BMWA 4O52A 1EH9A 1X96A 3DFOA 3EB2A 2X0YA 4RV8A 3SCSA 3TNBA 1B3ZA 3EYPA 1ODUA 2OZTA 4U33A 1H60A 1UKQA 3BCFA 1WDDA 1BSIA 3APYA 3C0QA 4PEEA 2EF9A 2FH8A 4AWUA 1DYSA 4PMOA 2F6UA 2C1HA 3E6EA 5H6HA 1FHDA 1VYRA 4F48A 1VFMA 3VTRA 4B5XA 2GUYA 3B0UX 1XYAA 3RLUA 2QCDA 3S9IA 4A6GA 1OB0A 2UZ9A 4ERGA 4KGJA 3WBXA 1SO4A 2GVJA 4D8ZA 3S1VA 4F0LA 3W7DA 1B31A 2ADAA 3EDDA 1GZGA 1ML1A 1TTPA 3NEHA 2OQYA 3G1DA 4DN1A 1JZ7A 3EPMA 1FWNA 5TF0A 3WNLA 5CC3A 4L1WA 1XW8A 2Z4GA 3IUHA 3QW3A 4DJDC 2ZX8A 1PO9A 3NUKA 1ZJHA 2PCQA 4Q8UA 3FJ4A 1GK8A 1SFLA 2Y24A 4G1NA 1AW2A 2VRQA 3QGKC 1KA9F 3KZSA 3NQEA 4IJRA 2PDIA 2OXNA 1FWJC 3NDZA 3MU7A 5F4SA 2JK2A 2WNNA 1UUOA 1W1B1 4FNQA 2KZHA 2G4JA 3ITOA 3BUVA 2ZCGA 2HDJA 4F79A 4E3TA 1QW7A 2AQVA 1HKVA 5I79A 1TQXA 2HBXA 1VJSA 1GPWA 2FZMA 4C6IA 1P4CA 1XLLA 2BNJA 3GW0A 3LCIA 5ECUA 4LALA 2HSAA 3MJYA 2VC5A 3HBLA 3F5LA 3MA8A 1R87A 2RDTA 3LV6A 4J28A 3F7JA 2CLKA 3SCNA 1QT1A 4R33A 5LGZA 3A24A 4MY8A 3CQ0A 4AXNA 3RILA 3FXGA 1JAKA 1B4KA 3R0UA 2ATMA 3P62A 4JGDA 4MJ4A 1HKJA 1D3GA 3B3DA 4TV5A 4NZ3A 3C0LA 3UWQA 4J35A 3MKCA 2WCSA 2YCJA 3HGSA 2XIBA 3AHVA 5CPMA 3PUGA 1O6IA 1TZZA 1ELSA 1X98A 3WK0A 3XISA 3CU2A 3WNNA 3U4FA 3W1LA 5DANA 2WKGA 1TCMA 1TREA 3QR1A 4D1JA 2O0TA 3ZJ6A 2J7BA 3EOSA 1EL3A 1ICSA 1M7PA 3VO0A 1GQJA 4S2BA 1KCKA 3LM7A 3ZS4A 1R85A 4AZ6A 5A8QA 3QBUA 1OK4A 4J3TA 4UOZA 2DORA 3WQOA 2QUTA 2P0OA 4YWIA 3VVGA 1HG3A 3ZT6A 3KDNA 1VFOA 1KKOA 2YPIA 2ZZ3A 3DG7A 3NQ7A 2DV0A 1EBGA 1W3TA 1D8WA 2EEXA 1LRTA 3CL8A 1Z7AA 4LUSA 5IDIA 1G4SA 4DWSB 4LV4A 4RNHA 2F38A 4PUUA 4PMYA 1ZU8A 4QEEA 1U5HA 1JIBA 2OX1A 4DAFA 3Q67A 3RXZA 4XO6A 4HMCA 3I3EA 1VC4A 1XFBA 4LQ1A 3SDOA 2FB3A 4GY0A 3CZJA 5CGQA 4LAUA 4I9MA 3W1AA 1KCZA 3R8RA 4WCJA 1C90A 1P5BA 2XFYA 2BVDA 1GOMA 2WZHA 3W22A 3GD6A 3JS3A 3WYZA 3ZOAA 3C86A 3HPZA 2DSZA 1F07A 5I23A 1VQTA 4Q3MA 3W2JA 1XLHA 5IM51 1RPKA 3E0WA 1F9CA 4X0NA 1R3RA 1XLCA 3SCPA 4FP1A 1RSCA 2WJZA 4B16A 4PUEA 4O15A 2QUUA 3VM7A 1JCJA 4EKJA 3L4VA 1LLOA 1JGMA 1QOXA 3NM3A 2MUCA 3NXFA 1XD0A 1UIPA 2B7QA 4JIRA 3ITCA 4ZCWA 5CLTA 4AY7A 1POKA 5I2UA 3AYSA 4IP7A 3TQKA 2VFIA 1JDDA 2YL5A 3OVGA 3UXKA 1E0VA 3Q45A 4FSAA 3GXDA 1GTHA 1UR9A 1OCJA 2WCGA 4LNYA 2ZUNA 3IJ9A 5I3DA 2WSKA 2EPLX 4XZLX 4B5NA 2D1ZA 1WE5A 4GCXA 4DJFA 2FMNA 4GXWA 5FACA 3QHOA 4IMFA 2INZA 1KQZA 4GI6A 4G1KA 1HIZA 1LOLA 1W17A 1WUFA 2G97A 5BU9A 2ICSA 3W7HA 3B4YA 3T0TA 2WMFA 1W54A 4FNRA 1UD3A 5IRPA 3UWYA 5DCEA 5U7SA 3MV11 3OG3A 4AD2A 4RK8A 4AZHA 1G7VA 3N14A 4I7WA 4E4FA 3SY5A 1HJUA 3KOFA 4E2VA 4WDWA 3ARSA 3PJWA 4WGHA 2YXXA 3QGVA 5HJXA 3SIMA 3L2LA 2YZRA 2NLIA 2NXHA 4CU6A 1SJBA 3T6CA 4ZO6A 1X8CA 1MXGA 1MEIA 1RBOB 4RNJA 1W2VA 2W4XA 4EPDC 1EP3A 3BSGA 2QLYA 1H11A 4W84A 3SQLA 4CN4A 2AKZA 1JI1A 2BXVA 4O1CA 2WPGA 4YYFA 1PAMA 3NL3A 4DAIA 1C8XA 5I3HA 3ANYA 3S42A 4PMZA 3BJSA 1XR2A 1W5MA 3T55A 2YKKA 4JFWA 1CIUA 3GVWA 4PR4A 2B7PA 1EJXC 4F2BA 4JAWA 4H7CA 3CMJA 4N02A 2Y7FA 1IQ8A 1XKJA 2ZUMA 4ZXLA 4O11A 4NAFB 2DGAA 3HG4A 4MIMA 3C4UA 3WFAA 1XIDA 3DFYA 3ZLFA 3VX0A 3C2VA 4MWAA 4YS1A 3DFHA 4WGXA 3ZVHA 3K1DA 3A5VA 4IMAA 4S3AA 1XGEA 2I5GA 1HXJA 4KIEA 1Q45A 2Y5EA 3VINA 2QF8A 3A13A 1LF1A 5U4NA 3LUTA 3ARUA 4UTWA 4TVDA 2YBTA 4BQ4A 3H4XA 5AY7A 1VFFA 3WLHA 4XIAA 3WELA 5MHBA 2RGMA 5EKYA 1E1EA 3QTPA 3CM4A 3M47A 4REQB 2ZX6A 1F3EA 1ZAJA 3CTLA 3RG6A 1FH7A 3SFKA 3OA5A 4U5IA 4GYPC 4XZMX 2X30A 5BNKA 4KS0A 3BOLA 3ID7A 1E9ZB 2Y4SA 2NV2A 3CYJA 4QBXA 4CNUA 4C1NB 3MWAA 2R94A 5I06A 2PDGA 2Y88A 4NUWA 2WLYA 2A7RA 1OG0A 3NWRA 3DESA 5CC5A 3VPLA 2IQTA 1OM0A 5HNUA 3K8LA 4DZIA 3LGEA 1E3ZA 1E0TA 1W5PA 1BYDA 1EA9C 1GJUA 3M0ZA 4EXAA 3FAWA 4H41A 4RKAA 3QY6A 1CXKA 3LHVA 1XX1A 2QQ6A 1FCUA 1TV2A 1BGAA 3N6JA 1GVEA 4ZQMA 3TR9A 1UR3M 3UETA 2YB1A 4Q8MA 3W1UA 5I3JA 4DZAA 3H55A 4HHLA 1RQBA 5JBDA 2NVCA 1VLIA 2WJEA 2IPWA 1R46A 2R24A 3EOUA 1AQMA 1EX5A 4H83A 5F2MA 3H8AA 4I7UA 3NJ3A 5CZTA 2DH3A 3H2AA 4JEJA 1QOQA 4OKDA 4DJEC 4IPLA 3SY8A 2D20A 4FS9A 3KW3A 4R5EA 3CQIA 4UCGA 4X63A 4BI7A 1E1CB 5FJTA 5FJPA 2AQOA 3LI1A 3B40A 7REQA 2DZXA 1VP5A 1XRTA 4G6CA 1XP3A 4AYGA 4H19A 1BVNP 3V1HA 1IXNA 4TX9A 4E4PA 1ZGDA 3CWNA 3ALFA 3QW4B 3RCMA 4PCSA 3SECA 1FWGC 4JX6A 5JBEA 3GRIA 1U1HA 4RZBA 3VIGA 2VC7A 4UR8A 4FLRA 2VEFA 1DJYA 4MZYA 3SB0A 8TIMA 2FVMA 3A5FA 3M7WA 1XIBA 2ZX7A 5F4WA 2ZX5A 1J6PA 3VNDA 3WMSA 2OYLA 4UTFA 5C9XA 4W7UA 1MW2A 1QBAA 1MUMA 1LCOA 1EJRC 4W5UA 3HM7A 4AQLA 1J93A 2VI0A 1RQHA 1ZAIA 4CD4A 1VF8A 3H22A 4JFUA 4YJ5A 3DN5A 3VIMA 4IGMA 3GKAA 1T8XA 3LM3A 4ZODA 1UASA 4JY8A 1PHQA 1ODZA 1ZBWA 1Q13A 3STPA 4TTGA 3VIKA 3THQA 1OGGA 1I45A 4ZQOA 4IIBA 3IS4A 4Q22A 2C13A 4IGHA 4WDUA 1I60A 2BXYA 1M7OA 4UOJA 3N2XA 2J6VA 1V4YA 4O0KA 5LXXA 3L2IA 4D6EA 3UJFA 2VP8A 3RYSA 3RN6A 2CXEA 4O13A 4PRRA 3PUOA 4KCVA 3M7SA 1C8VA 3LD5A 4D8LA 3IIOA 3FGCA 2Z2UA 1XIJA 1LLZA 4FALA 2WHJA 2INFA 3N6QA 2V82A 3RPTA 1GKRA 4N6FA 4RPPA 3C2RA 1E5JA 4A05A 2PWEA 3L4UA 1CT5A 2BY3A 2ZFAA 3A4XA 1MQPA 4EPKA 4IJBA 4JTIA 5FL0A 3NQVA 3VI2A 3VKDA 1NF7A 3MHGA 2AMXA 4ZTXA 1JVNA 1IWAA 1XRVA 3HURA 2OELA 4H2CA 4NX5A 5XIMA 2PSNA 3K30A 4YCOA 2V2HA 3VNYA 4AWSA 2XVPA 4Y9OA 1F4HA 5FF0A 1SVDA 3MT1A 4XZNX 2FIQA 4QM1A 2P3ZA 2J9ZA 1TZ9A 4RNIA 5DRCA 5C9ZA 4GNJA 2HROA 3SQMA 5B7YA 3M41A 3PZ9A 2C18A 4Y9MA 4PFMA 2JIWA 2BHZA 2HS8A 3CV1A 1V08A 4M24A 1F74A 1ZJIA 4H9XA 4S23A 4RZ4A 3GQYA 3L66A 1OFDA 2PDMA 4DJEA 4WVXA 2XVNA 4L64A 3PJXA 3B8SA 1G4EA 3FYYA 4ORMA 5IBXA 1CB2A 2REQB 3A3WA 3T8LA 2ZZ7A 3B8IA 2V3DA 3LTSA 2W63A 4M6UA 1GVIA 4B90A 3TQVA 3ONCA 4ZE4A 3EA1A 3OODA 2VEKA 2WHKA 1CGWA 3W4RA 2VZTA 3A3HA 3A9IA 4OV9A 5JUVA 2YOCA 3E5PA 3IARA 4O8RA 4PULA 4WX2A 4UTMA 2ZXDA 1PWLA 3DOPA 4IFRA 4KESA 3U3HA 5EB8A 3SR7A 5M03A 2VEGA 3WK1A 3S1UA 2WO5A 4MGGA 3C0SA 1W31A 3RO8A 1N8FA 5A94A 1DWJM 1UQYA 5A6LA 1JXJA 5HMEA 1I2OA 1WAUA 4GJJA 3VIPA 4DF1A 3V5FA 2E5CA 3BDKA 4OFCA 3DX5A 5K4XA 3C8NA 4E8CA 1I2PA 4UFLA 1JUEA 4CD6A 4Z1YA 3E02A 2BOEX 4X61A 2G41A 5G4HC 2AL2B 1WNOA 2PDBA 5KTLA 2SFPA 2Y0FA 3P3BA 2FDSA 3MVIA 4Y9PA 1BTCA 1YYAA 4FR1A 2QV5A 1Q66A 2HV5A 3CZKA 1GEHA 1E4IA 4WY0A 4FNPA 1B54A 3UZZA 3CUFA 2HTMA 2GSEA 2EKCA 1RBLA 2XVKA 2HPMA 3R4IA 4BWLA 4WD0A 2NX9A 4P8UA 2TSYA 1OABA 2P53A 4GMEA 3TONA 2XN0A 3AYRA 1M04A 4H8UA 2P88A 1MO0A 3HA1A 4QNEA 4ROPA 4GINA 3A21A 3UPWA 2C6QA 2J9YA 2PE4A 2QDEA 3NM1A 2XPKA 4RW3A 4Z0JA 3B0YA 2CBIA 3UWUA 3WQDA 5BW6A 2DPEA 1GVOA 4Y8EA 4P7RA 3W87A 1TUFA 3KCJA 1GVRA 1H4PA 3IVUA 2E0PA 4P8WA 2FTWA 4UNKA 3W7OA 4HA1A 3AU2A 4MB3A 3W9ZA 1XINA 4QSFA 4KCUA 2XH7A 3T09A 2WNQA 3TZNA 1NFGA 1S5NA 1I1WA 4CQ8A 1TPVA 2A85A 2BOGX 1OYBA 2Q8LA 4IJCA 4AD3A 1RP9A 3LHTA 1I75A 2VGBA 2VZSA 4EPEC 3VA8A 3U7BA 4S3DA 3FEQA 1XYLA 4G8TA 3S5YA 2VFFA 1SQ7A 4DJED 3AIEA 3GH7A 1QR7A 3TSBA 1XSJA 3S2JA 2XU2A 4BY3A 3SURA 3QQ1A 1CLVA 3T2QA 2JF7A 4UFJA 4WY0B 3GYEA 1KGXA 3CAQA 7PTDA 3B0VC 1KW1A 4BCEA 2V81A 1L6WA 4F4RA 3WQFA 3RPMA 5AYBA 4GYPA 4DYKA 3RUBL 4D1IA 1TX0A 5D2WA 1M7JA 4LGXA 5CH9A 2GUUA 1GQIA 2HMCA 1YW1A 3GDBA 1JUBA 1H5VA 3E5BA 3JR2A 4AWEA 3QC3A 5G2HA 1H62A 3MMTA 4AIUA 1K70A 4R3UA 4HNUA 1Q6QA 2ZRVA 1U5JA 2X8RA 2IW0A 3ARVA 1B4EA 3GY1A 1US3A 4Q7IA 5IFPA 3GNRA 2X0HA 1O12A 3H2MA 4YYCA 3W28A 1IEQA 3PP7A 3VNMA 4BZYA 3CS2A 4J1OA 4RE0A 3RK8A 3UWVA 3ARWA 1Y65A 1CLKA 1XL9A 1NTHA 3SCRA 4MYAA 1FBAA 2J9XA 1D7KA 4HK5A 5AC6A 3HGOA 1W9UA 2BVWA 4ASTA 1ZENA 3QGAC 1QOPA 3OZOA 5KEZA 4HB7A 3MQTA 4CU8A 1KM5A 4JTAA 5DY2A 3N19B 4MUZA 2ZTKA 4OWGA 1KWGA 5DY3A 4U3AA 2XSBA 5C2CA 3TDFA 1IT7A 2E25A 3HPFA 1KXTA 2H8XA 3EWXA 3M44A 3BLEA 5E6ZA 1MUCA 1VCGA 5XIAA 1RCXB 3AIVA 3WLNA 3LHUA 4DO6A 5HMFA 1AH3A 1M7XA 2DZTA 2NX1A 1P43A 1C29A 1W5NA 4WF7A 1LM1A 4KWVA 4LEQA 1M01A 2FZBA 2RJHA 5CZKA 3HV8A 3PANA 2PF0A 1UH2A 4GCAA 3AHYA 2O9OA 4EK7A 1IE7C 5GPRA 3VGDA 3BAKA 4DBSA 3M64A 4WZHA 3BQ6A 2GDVA 2HQAA 1Q7ZA 2Z6IA 3W86A 5CXPA 5M2FX 5C2XA 3CEUA 2HK1A 2ZIDA 4FI4A 4MVAA 4C5YA 1FTXA 3PC0A 3S5NA 1RJPA 4JDBA 4Z1AA 5C7VA 3AMCA 1EJTC 1REQA 4H6EA 2P10A 1VR6A 4OJYA 1OX5A 4EX4A 5LA2A 1MW0A 4JYDA 3I7QA 2CLIA 1QHZA 2A3CA 4F3HA 3BQ5A 3NR0A 1CXHA 2CBUA 4MKSA 2RAGA 2CIPA 3QN3A 3QSRA 5D2VA 3WLTA 1MMFA 2V5CA 3TZFA 1N7KA 2J8TA 1NOFA 5FEWA 3NZQA 1KBIA 3CPGA 3MWCA 1BG4A 5C6MA 3VGBA 3PR2A 3C2FA 3R13A 4QG9A 1K9FA 1TWZA 1J96A 3VMPA 2ACUA 4WQ6A 2VCCA 1FWFC 2W6RA 2DZAA 3IIXA 3H21A 3EDJA 1PIGA 2Z1XA 3L0GA 4S3JA 3M6YA 1E51A 3LHYA 4RZ5A 1O5QA 2ZRUA 4AIBA 3RLGA 4HA4A 1Z42A 3LGGA 4GKLA 1QWGA 2WNWA 5REQA 2HE5A 1IWPA 3QSTA 2Z6JA 4FLOA 4CNSA 3O6DA 1HKKA 4AVFA 2EKGA 3WKZA 4CLMA 1YXYA 2POZA 4LB3A 1UR0A 1CX9A 4IPJA 2VR5A 3NNTA 1UMYA 1QHOA 4QJ4B 2P76A 1Q6RA 2DUZA 4C1LA 1K1DA 4O17A 4AZCB 1HN1A 4FLSA 5A6TC 3M4HA 3LMYA 3TVAA 2I14A 3LQGA 1HJQA 3AIBA 1MXSA 2ZRYA 3I10A 2PTWA 3GS6A 3S6OA 5D8WA 2PTDA 1XH0A 1C3FA 4NYUA 2V5KA 1XBYA 3TC6A 3FVDA 1RALA 1A4MA 4I8YA 3ALGA 2C7FA 2AMGA 5D2TA 4M1RA 1TJ0A 3M0HA 4Q7BA 1TB3A 2EXOA 3CQKA 3T2OA 3G1HA 4DEFA 1TRDA 3P84A 2V0TA 4FXFA 2NV1A 3B9DA 5J04A 2GJRA 5EMLA 3GU1A 3SUSA 1PB0A 1FWSA 4V2XA 5CZ0A 2OO6A 3TV8A 4ECLA 3AHXA 3ITXA 4CN1A 4PMXA 5K2ZA 3HN3A 4PEKA 4JYEA 5FF4A 3H7UA 3DHFA 2WZIA 4MWAB 5DMYA 4OVXA 4L7ZA 3MUXA 4CGTA 5KZDA 3TQ0A 3VXGA 2E8ZA 4LS0A 1U2YA 4P7QA 4LH8A 1CLXA 1B30A 4C65A 4BKNA 3G1RA 3QOMA 3W7KA 3VGGA 2F2HA 1XLMA 4JR5A 5FEZA 2ZKMX 2XGIA 3DFNA 5BROA 1GVFA 4AMAA 1ZPTA 1CXEA 2EBNA 3ECQA 1SZRA 2Z1WA 1OBAA 1AL7A 4IX0A 4GXPA 1VLWA 4IIEA 3DGBA 4KEVA 3GNDA 1W9BM 3URQA 6XIAA 4DX3A 3HMJG 5AFDA 3S8HA 1RV8A 1UZ1A 5FCZA 4Q32A 3PHAA 3GTXA 4GUFA 4TTUA 4K7YA 3EWYA 3SSJA 5ECVA 5CBJA 2O7QA 2B4GA 4FA3A 3P7YA 3PF3A 3CT7A 3HG3A 3TH6A 5D05A 1B9BA 3OGSA 4HCDA 1KR0A 3GG1A 3IANA 1M03A 1S2WA 3V3WA 3W1QA 4ZOEA 2ZVRA 2ZUTA 4FNTA 1XICA 2EPHA 4JHMA 4WXYA 4KFOA 5A8MA 4RXFA 1QNPA 1VPXA 3H70A 3TMLA 1XCXA 2FGLA 3W07A 3LERA 4XO7A 4M5PA 1XDLA 4LUTB 2XH4A 2R8WA 1F5ZA 5CSUA 2Y85A 4JX5A 4W5ZA 4GQRA 3QOKA 1KWKA 4M19A 2BBFA 4HBKA 4XG1A 1Y8BA 1CNVA 2JBMA 3QQ0A 3LPPA 4CNPA 3OBKA 3U6WA 2JEQA 2NUXA 2Y63A 3DHUA 2PPGA 3GDLA 4GNVA 1NFBA 5KITA 3DI0A 3LRKA 1RHCA 3UG5A 1XYFA 4LYRA 2JKAA 3M0JA 1GONA 3ZWTA 5BOOA 3MPGA 1SM9A 4XSMA 2GWGA 3QY7A 4HSOA 3SSZA 2WAGA 2CKSA 2YA1A 1G5AA 4BF7A 4D6IA 4QAWA 3EX4A 4DXKA 3KVKA 5LA1A 1BWKA 1BF2A 5A6JA 1T6MA 5FAJA 3UJ2A 2FZ9A 4PB4A 4F66A 3WDQA 2HNEA 1V0KA 6ENLA 1GW9A 4B3LA 1Z41A 1DJXA 1AODA 1BD0A 3STGA 4E2DA 4QGCA 1QFEA 2NSOA 1VENA 3VDHA 3B04A 1YDNA 1BQGA 4J3WA 4GIRA 1DIOA 3L5LA 5C54A 2G3JA 3H6OA 2WQDA 3NXLA 3CWHA 5HANA 4QIUA 1ZTVA 5CCZA 4I9AA 2PDPA 2FVLA 4U2ZA 3KOWA 2QNEA 3OIHA 2WPBA 4CNOA 3N13A 2DJXA 2DZUA 3RM4A 1DJGA 3UWZA 1JUKA 4BR1A 3V0UA 3G8EA 3BG9A 3H2EA 3P14A 5GJNA 3CH0A 1PTAA 1HZYA 2HISA 1Q6EA 1EO5A 1BSLA 1W0MA 3VOHA 2PP3A 2GGHA 4JIQA 1TWSA 2NQLA 1K8ZA 1FHVA 2XFWA 3E38A 3LA4A 2J8FA 3CQHA 1J18A 2BY0A 3BGGA 1ITUA 5G2WA 4Z42C 3AHTA 4GX9A 4Y2WA 1TCDA 3R89A 1EF3A 4UR9A 1X38A 1VJIA 1J2BA 2QJNA 1BFNA 2PEVA 3VGFA 3MSRA 1DOSA 4Z2HA 2GL5A 2GJLA 2W61A 4F0RA 1UOZA 2VFEA 3TK7A 1J11A 1JYNA 4KIRA 1TPH1 3W7PA 4LUSB 5FF3A 4NJKA 4DYEA 3E0FA 3FGCB 4AZ7A 1Q6DA 3R8GA 2FKPA 4A35A 4NJGA 3BWWA 4W8AA 4Y96A 2OX4A 1UZHA 2R1MA 4ZE5A 3KVMA 4UTHA 5AC5A 3R1ZA 2EG6A 3DH7A 4LCRA 5LNSA 3VIOA 3NYZA 1TKKA 5EFFA 4BWLC 4W85A 3A64A 3N3MA 4NSBA 3V0SA 3W76A 1K7EA 4H9YA 4ZO8A 3F5KA 1AMYA 3AIUA 1VRDA 3NOEA 1LWIA 6REQA 1GGOA 3GNPA 2ZADA 5DO8A 1UD6A 5BOEA 3MHFA 2J25A 3VD5A 3WF1A 1BGGA 3WK3A 5KMYA 5HAOA 4WJ8A 1O66A 5FSDC 4IGSA 4AHPA 2OQLA 3GZAA 1XPGA 1MVYA 3O3RA 3BJFA 3FYOA 4WHBA 2E09A 5J5DA 2I9UA 3W7LA 3M0VA 4J3XA 4WK9A 2G3NA 3AS1A 2ZUWA 4V1XA 1D3HA 1ESWA 3VM5A 1XLAA 3VOCA 5AHIA 1PWMA 5HJLA 3WLJA 3WBAA 1V6VA 4MPQA 3WDIA 1FKWA 3CMFA 1CGYA 2F9RA 3FN9A 3G1FA 2OT1A 2WJFA 2FJUB 1EHAA 1G01A 1BF6A 1DQUA 2BWGA 1GHSA 5XINA 2A3LA 3MCOA 4B5SA 4F9JA 1XCWA 4QJ5B 1J10A 4ZGYA 1JI2A 1P7TA 3ISIX 3T78A 5G1YA 3KHDA 3KBWA 1V3LA 3O6YX 3GDMA 2WCAA 4HIBA 3TN3A 3G8RA 3NQDA 4Q4OA 3TYDA 3KOYA 5BXPA 1OFQA 2PGWA 3TW9A 2CCRA 1MW3A 2JQXA 5HDRA 4ADUA 3PPCA 2ZUSA 2RDWA 4IT1A 4RDYA 4CUCA 3OHIA 1DJWA 3VGEA 3KBMA 3W72A 2OTDA 3T9PA 2CERA 4P7NA 4ACYA 4DUWA 1A5UA 1H2JA 3BSHA 3P5YA 4MAVA 4E2BA 3QPZA 3CB3A 4AF0A 4BEQA 2J24A 4HNLA 1LDCA 1W1TA 3UY7A 4KERA 1OWQA 1RY8A 3FA4A 3AU6A 2V5JA 2IKJA 5CQ1A 4M8UA 2J7EA 3R12A 3W2LA 1GT8A 5CJMA 1TPB1 3HO8A 3UXIA 1KBKA 1IT8A 1IEXA 3RIKA 1IEWA 4PTXA 2QJJA 3LCFA 4IISA 3THCA 2GWNA 4Z17A 3MV01 4HPJA 4GQQA 2WM1A 9RUBA 4MKNA 3W6YA 2JGYA 3N2TA 5M5DA 1CZ1A 1AUSL 1MRAA 1RAKA 2XDFA 2D3LA 5G4WA 2Y7GA 4OT7A 2Q6ZA 1RVGA 1PIFA 5E0FA 2DW6A 3H54A 3CUIA 3SRKA 3IEBA 3AO0A 4JBRA 4UQ9A 4LBRA 4WOZA 3QJAA 2QMKA 3I4EA 2VDGA 1X39A 1UC5A 4IPIA 4Y90A 1PX8A 5AZ1A 1RCQA 3BGAA 3S9YA 3B0XA 3O15A 4MPKA 4GVFA 4XAFA 3BAJA 1XHGA 5DT5A 1ZQ5A 4IUOA 4GZ7A 2W92A 3UCCA 3NO3A 3B9NA 4K1GA 3IACA 1DWFM 1CENA 4HA3A 1V6UA 2QIWA 1UA7A 3VCNA 4DELA 3VNKA 3OYXA 2YW3A 4QE1A 1LL4A 2QUMA 2ZE0A 3INPA 3AQUA 2WHLA 1TELA 4QQ3A 4XQ6A 4PSRA 3KTCA 3UPBA 4HKPA 5RUBA 2ANUA 1GVSA 4UBPC 1XWYA 1FWTA 1YDOA 2DFAA 4DY1A 1PUDA 3W1XA 2G0WA 2BASA 8XIMA 1ITXA 1JNDA 3W74A 3PM6A 3W7IA 3AJXA 2WSRA 4C6PA 4GI8A 3BG5A 3PY2A 3VGHA 1I9CB 1LT8A 2ZRWA 1KM4A 3URNA 1XFCA 5BMWA 1IYXA 1E40A 4ZTYA 1X97A 3WEOA 2VGGA 1S2AA 4DLFA 4DIAA 1H51A 4QFUA 3FSTA 3PS7A 2C16A 3KVJA 4EP8C 2QUVA 3AXMA 2JIEA 1W3IA 4H4IA 1PL9A 2PC8A 1I1XA 3TXZA 4LYPA 3I65A 5CC6A 1V0NA 4MNMA 4IHCA 1ME9A 4OV4A 3SRDA 2PI6A 5I00A 4O28A 2QVNA 3F03K 1QPOA 3TTOA 2FVKA 1MFUA 3CLWA 4ZEPA 1MSSA 3CIWA 1F4AA 2ZA1A 3VIHA 1RJRA 1L6SA 1L8PA 1PCWA 1KCXA 5BRQA 3TLLA 3W7NA 4CNTA 3O16A 4OBRA 1ZP3A 5D37A 2CZDA 1TTIA 3PZTA 5I77A 1AW5A 4LBUA 1PJ9A 1FFRA 1NAL1 3HJZA 1HL9A 2HXTA 1IF2A 3UZYA 5F1VA 3VILA 1KTCA 3BZJA 3UW6A 1OF8A 2BSLA 4JTUA 1UW9A 1UZDA 3RR4A 3S2LA 2W79A 4UMBA 3OP2A 1NOWA 3EX2A 3MW7A 4HZ6A 1K9TA 2ZYFA 4H1ZA 4ONVA 2WXDM 3MUAA 2YBUA 1EC8A 2FZDA 4JX4A 3AUJA 4XIMA 3WQ8A 3Q65A 3R79A 1E72M 3EPNA 1EOMA 1CTNA 4HJFA 1GOXA 1S5TA 3OGRA 3OBEA 1TE6A 5HNRA 5JVLA 1IR2A 5AYIA 3LLFA 4C6JA 3T4CA 3HG5A 2Q71A 3I7SA 3PZUA 1K7XA 1GTEA 1ISXA 1FWDC 4JICA 4NZ4A 4X9SA 4X2RA 4HYRA 1LBFA 4B2DD 4ZL1A 3CC1A 2Q8ZA 3LHZA 3AYVA 4RXGA 3TAOA 3Q94A 3QR0A 4GH3A 2WV8A 1QXLA 2W27A 3OVQA 4ZR8A 4HTYA 1QI5A 2QCNA 4A29A 1B3OA 1PCKA 2VR4A 4JTGA 4X22A 5D30A 1ZJAA 3QQWA 2OGJA 1UBSA 3TA9A 1FRBA 3L9CA 5H91A 3VNLA 5DEZA 1QK2A 4IPPA 4FAMA 1WZAA 4GFSA 3STEA 4OOUA 2MANA 3FHQA 1XI3A 1E4LA 3H7VA 2OPJA 4AISA 4D6FA 2E67A 4TQTA 4PTDA 3LMZA 3DI1A 2X1SA 2AL1A 1LBMA 3E0LA 4LYQA 2L5HA 2ZQ0A 1SU5A 4Z2KA 3URBA 3P0WA 3H4GA 2ZC1A 4AZGA 3TYUA 1C91A 1L6GA 1KKRA 1P0KA 1J2WA 2W5FA 3JVAA 3FKRA 2OG9A 2Q8XA 4B5WA 1K8YA 2MNRA 1X1ZA 2DSUA 3LEPA 4HCHA 4GABA 2VVNA 2VDIA 3LYEA 3GXFA 4PN2A 4EF9A 3VD7A 2QDHA 3TN4A 4QRNA 5DCDA 2QCDB 3QRHA 3L4YA 1H5YA 2PD5A 3NQ8A 3STCA 3PBYA 4H9TA 3EB3A 4GZIA 2J78A 1V6YA 2Y5JA 3GYCA 1UD5A 2IQDA 3EEGA 4C6KA 4BQ2A 1HL8A 4Z08A 4KRUA 1XC6A 3OBAA 1X1OA 2ZUUA 2OEJA 4GK8A 3WZ0E 1HTIA 1AJZA 3K4AA 3YPIA 2XG9A 4NJIA 3SUVA 1ZAHA 5H1WA 3PTQA 2Y6ZA 1V51A 5CJ5A 3CZGA 1UKTA 4DF0A 4AG0A 3MTWA 4M56A 3PBGA 3NQ6A 1GYNA 4REQA 3AMKA 3C8FA 3T08A 4D6HA 4NILA 4FPSA 2PAJA 1L6FA 4RX0A 3TYAA 4LXFA 8A3HA 1NWUA 1A5BA 3VDCA 1QBBA 4R88A 1GJWA 4HCLA 4JTEA 4TVUA 2I16A 4W88A 2QR6A 4ORIA 1GOWA 2YXGA 3MMUA 3IGHX 1E3XA 2FJKA 3HPSA 3F2DA 3WMLA 5ABFB 3W7RA 4GQGA 5F2IA 4ATWA 1NJJA 4MZ1A 1W6TA 5M3WA 6A3HA 4UTLA 3PPGA 4LUTA 1FOBA 2P8CA 1MZHA 2PDQA 4MAZA 1PKLA 2BDQA 1RD5A 1SJAA 1G4TA 3SAZA 2XM2A 3ZR4A 2GPTA 3AIRA 2PRHA 1D9EA 1M5WA 2WC4A 3LTYA 3SO7A 2GFTA 5LHEA 3RM9A 3TJXA 5K7JA 4HOZA 4AD4A 3M5XA 4V15A 1S3HA 3QTGA 4JFTA 1WXYA 4ICCX 2A3EA 4FOUA 3MUY1 5FL1A 1W32A 3R7MA 1VYPX 1EOKA 5AN7A 1V8EA 4C6NA 3GG8A 4WIWA 1OVDA 3SN4A 2VEPA 4NI3A 4ZBCA 3VC6A 1GEQA 1TVLA 4PCTA 3ARPA 3ATZA 3W26A 3L5AA 1EZWA 3MB9A 2Q01A 4A2RA 1N8WA 4ACZB 4JTRA 3HFTA 4N2YA 1J5SA 3GM8A 5CAKA 1UP0A 3LXBA 1TV4A 2QMJA 3WY1A 1GG0A 4DJFC 1SZGA 4B9ZA 4HOXA 2CU0A 3DG6A 5GVJA 4C6CA 4MY9A 1V3MA 4B3ZA 4CU7A 1SYTA 2XIQA 4AY8A 3PZVA 5IDZA 2QPXA 3KDOA 3E12A 1FKXA 4RL3A 3LSCA 1S38A 3G1VA 2V38A 3LXAA 5TD4A 3QLLA 3GVQA 3UVAA 2G37A 4LYKA 5FJOA 1WO2A 1HJVA 2D24A 2DUAA 3ZVHB 3EA2A 4POCA 5DQPA 4GUJA 4DVOA 2VZOA 2V3FA 4M6QA 5D9PA 3S4TA 2VX4A 4O1BA 1FXPA 1K6WA 5DN1A 5LKYA 3KHJA 3A6OA 3ENLA 3GDTA 2HEJA 3UZ5A 1VH7A 1YNQA 3NPUA 4E0CA 4U3CA 2V2CA 3WD2A 1K8CA 2Q09A 1XXXA 4MFEA 1LROA 1ADOA 1KRCC 2OGYA 3SN0A 1WV2A 2Z1SA 3KUMA 1YTDA 3PB2A 4LVGA 1E6ZA 4NG3A 4M82A 1VIZA 3RJYA 1JD7A 1Z6KA 2F2KA 4G56A 4F2UA 1LUCB 2YCIX 2WVVB 1Q8AA 3QC0A 1LQ2A 3U2OA 1ITCA 3NQGA 3KAOA 4XAGA 1GKQA 5TAOA 3KL3A 3KOZA 3LPGA 4Q6XA 4GJ1A 4F40A 2RDXA 3NFUA 5FJUA 3U9IA 1KV8A 2R91A 3S5SA 1VBUA 3TA6A 3GG7A 1FP9A 1W3HA 2GQ9A 3N11A 3L65A 4IQLA 3ARXA 2NV9A 3K4WA 2PDUA 5CKSA 1V3JA 3WLRA 1ZNNA 3L23A 4IP5A 1WCGA 3WFLA 4C91A 3TC3A 4AIOA 3KP1A 1IZKA 4LOCA 1OX6A 3UERA 4PC8A 2Y2WA 1YTEA 3PG8A 2INEA 3ZM8A 2ZZ1A 5FAGA 1CPUA 2A3HA 3CHFA 5GNZA 4J9JA 1A49A 5ABTA 3DBPA 1SSDA 4KFPA 5CSSA 2QDGA 4JKLA 5A6BA 1A50A 4NNBA 1PS9A 1V77A 2QCHA 5HWMA 2GJXB 3WNOA 5HINA 2GDUA 3WJZA 3BCDA 2E6DA 3SBFA 4ENLA 1N8IA 2V9DA 4AEFA 4PGLA 3AS0A 3TAKA 1JRCA 1CW2A 5HJYA 4GC3A 4JQ2A 2NXIA 4JTHA 2IKGA 3V75A 1UWSA 5JXQA 1ZLPA 2PZ0A 1HJWA 3MDUA 3E96A 4GQ0A 3WG6A 2WBKA 5H8PA 3MP5A 3E2QA 3NEVA 2Z00A 4PMDA 2GDQA 4Q4RA 2E9BA 4KWOA 1ISYA 1F6KA 2E7FA 4S1FA 1K77A 2F6KA 4JTFA 4MTVA 3LSBA 3QMSA 3WNPA 3QF0A 1W3LA 2XIIA 1JGIA 1QPQA 4MOZA 3GR7A 3IUDA 4K39A 1AQHA 4JL2A 3VE7A 1F3WA 3NPVA 3WDPP 4C5ZA 5LNWA 4JY9A 5LA0A 3N6HA 3VDAA 4JQAA 3VCCA 2B81A 1FFQA 4U31A 3S0CA 2YLAA 1CXFA 5ABFA 3SCQA 3EDKA 1UD2A 5EPDA 3TIMA 1WXJA 1GG1A 2TRSA 1UG6A 1W37A 4L9XA 4P7LA 4CQDA 1JZ4A 4YTUA 1GOOA 5A8PA 3CAVA 4K36A 1E0WA 1UPPA 2VM8A 2GGGA 4EAMA 1EXBA 1FWHC 3WNMA 1H63A 2ZICA 2AKMA 3UCQA 3PBUA 3CK5A 4LT9A 3PTDA 2TPSA 4O0ZA 4PUDA 3HQOA 2PWHA 3V0TA 1VKFA 1QASA 4L5ZA 5D9NA 2Q3OA 2OODA 4UTKA 1E6RA 3WUFA 3N9SA 2YLLA 4MM1A 3LX9A 5AB3A 4QHRA 1OHLA 1OFPA 2AAAA 3VU2A 3WBYA 3SGZA 1EYEA 4QDWA 2OU4A 1DORA 1Q85A 3KWXA 1TQJA 5A3HA 2C19A 2Z28A 3JRKA 2A1YA 1P6BA 3BLDA 1QAPA 1T41A 1LTDA 4DWSC 3CJPA 5HWJA 1UCWA 1TWDA 2ZC8A 3V18A 3JU2A 4AD5A 1XIIA 3EB4A 4H6KA 2IXUA 2VXNA 1XQKA 3S9ZA 2QW5A 2W3ZA 1J0HA 3IJ6A 3PUEA 4B5UA 4HZMA 3PJUA 4PFHA 1AJ2A 3NQ2A 4M51A 1OFRA 3RNDA 1Z8AA 3UNTA 3F4NA 3IIVA 3O1NA 3EZ4A 3MP3A 4DWSA 3L4XA 1QUMA 1B57A 3W1PA 4EF8A 1QI2A 1I2RA 5EBUA 3CHVA 1ME7A 3VX1A 5AHEA 2J7GA 1HUVA 1RD6A 3TKFA 3SCOA 1EIXA 3KFTA 3I6EA 2OYMA 1LRNA 4O8AA 1DPMA 1ISZA 4UNIA 3M46A 1IZJA 1XGDA 3NVDA 1KTNA 5LIXX 4BK9A 4AUBA 3WD1A 3W7QA 2PDNA 3IGSA 3G6MA 3GHUA 1IEIA 4R7WA 1V0LA 1A3WA 3N25A 3OZPA 4DBDA 1F3XA 5E93A 3E9AA 2Z24A 1CGXA 2A0NA 4QITA 6ALDA 1ZZMA 2ZA2A 3EOOA 5E70A 4QE4A 3UZXA 4HU0A 1G4PA 4PCFA 2H9AB 1WAWA 1BKSA 3VKJA 1R38A 3L68A 3S2MA 2PWFA 2NQ5A 3TTQA 1S1PA 4LX4A 5CAHA 2Z7GA 4N42A 3EGJA 2OJPA 4O50A 3AMDA 1KNWA 1O5XA 2CLLA 7ENLA 4U4MA 1OG6A 2Z0IA 1HT6A 4BQ5A 1YQ2A 1M6JA 3CL7A 4ZB2A 4O10A 2TYSA 1OYCA 5G2IA 1R3VA 2GVGA 4GYFA 2I56A 2I1OA 4ALDA 3K46A 2DW7A 4DBEA 2QGHA 4ZVJA 4GH1A 2G8ZA 2QF7A 1HKMA 2YZ5A 4IQDA 5D8ZA 1H0GA 2O9PA 4O1EA 1K3UA 4IIFA 2WMJA 1EO7A 1ADDA 7TIMA 2QKFA 3L67A 4JTLA 2WW5A 1EUAA 4PBFA 4F0HA 5I0DA 2PWVA 1VFLA 4DYJA 1A0EA 2QPUA 2GJXA 4V28A 1S2VA 1E5NA 1EJVC 3CAKA 3WUBA 2CC0A 1WOBA 4YN5A 2HK0A 5C5YA 2WHMA 1OYAA 1NDVA 5C55A 4DXVA 2XN2A 1GOQA 3VD3A 2G4FA 3TUUA 2O4QA 3P2VA 3W01A 4KBXA 4YVVA 3USBA 2BXZA 1H3GA 2WSYA 2YDQA 1A5AA 1HL2A 4HNOA 1CB7B 3W29A 4AVOA 4LVBA 1H7NA 4UUIA 4HMEA 4PMJA 4MJZA 3KP0A 3SCVA 1L9WA 4A3RA 1E73M 1L0PA 3MP4A 3UCDA 4FHAA 1W1VA 1DTNA 4Z1CA 3GNNA 2FHCA 4BFAA 3BAIA 3CH9A 1UUQA 1KM2A 1JPDX 1RH9A 2FHFA 2VKZG 3GWQA 4GYJA 1E9YB 3DFPA 4H7VA 3KRZA 1OADA 1TIMA 3RU8X 1JQXA 1TFVA 4I9TA 3ZLHA 4ZSTA 4LUYA 3L4WA 3T81A 2P8BA 1TRIA 1A3HA 3IK4A 3S6TA 2G96A 4MYXA 3EMQA 1F6YA 2NX3A 2ALDA 2IKHA 2GQAA 3BO9A 3QZAA 1R6WA 3ZWSA 4ERAA 1B5TA 5DMLA 3UGRA 2ISSA 4LFYA 4BA0A 2P5NA 1OCNA 5F4XA 3VKKA 3L0NA 3CHEA 3C0JA 7A3HA 1L6YA 4AEEA 3N2OA 2HWGA 3PAJA 3VKBA 5B80A 3M0LA 1YE6A 3R11A 1MRQA 2FPVA 3DXIA 5C70A 4AC1X 1XUUA 1XISA 3KLLA 3LCXA 4IICA 3G6LA 2XUCA 4YL2A 2H6RA 3E1F1 3A47A 1XLBA 4S2CA 3AZRA 3CZ8A 2NVAA 5A6BD 3AIWA 1ZS2A 3G22A 4J2MA 3C56A 2ESCA 2DQWA 3M5YA 1P7TB 4IM4A 2ISVA 2YYUA 2OSYA 1XLGA 4JPGA 3GSMA 2BODX 3WL1A 3UXLA 1UROA 3T42A 2QV4A 3PBMA 2E40A 1EGVA 1UWQA 1E55A 3UXAA 1UKOA 2YIHA 4ZZ9A 1UP2A 4ICMA 4AFYA 2JGQA 2C91A 3MO4A 1UJPA 3G18A 4JNMA 4US5A 1DQWA 5F7UA 3GKFA 1JDEA 4JFVA 5K3VA 3F4VA 2POTA 5DLCA 3U48A 2J8GA 4HHMA 4GYKA 3ZT5A 4HGXA 4HQVA 3R0KA 1XIHA 3HJEA 3WQCA 2CZVA 4BQ3A 7CGTA 1UMLA 2ZZ6A 2O7SA 4HU3A 1YDYA 3NPWA 3ZT7A 3QV6A 3H2OA 4NRRA 2Q3RA 1REQB 4JHOA 4JIEA 1C9WA 4GHRA 3FA3A 1LQAA 4LPCA 1XYCA 4W4QA 4DWSD 4GA8A 3UR7A 3AMLA 1HJSA 1QI0A 2F8QA 2WMIB 3EX6A 1PKMA 2Y1HA 1J4EA 1JF5A 3DKJA 5FI8A 3GXNA 3P5ZA 1NWSA 4TO8A 1QJWA 3LV5A 1WZLA 2WK2A 2Z2BA 4PTMA 3C52A 4JOMA 1XLKA 3A4WA 1BG9A 3G3MA 3W85A 1OC7A 2PA6A 1GQKA 4NQ1A 4DI8A 1VHNA 2XFRA 4LNCA 3MZ2A 2A3AA 3VAVA 4PUNA 2YJQA 2P1FA 3MI6A 1JCXA 2F7FA 1VFSA 4I90A 2F84A 4GLEA 3CMGA 1P6CA 1KLZA 2CHRA 3H53A 2WVUA 2CLEA 3WD3A 2O9RA 4D8AA 1OFOA 2XWDA 2PDYA 5JH1A 2TAAA 4IOTA 2D73A 3MUIA 3LBOA 3IAQA 1DL3A 5C8BB 4UQDA 5H8UA 4W7WA 1FXQA 1DIEA 1G0CA 5M1TA 4Z2GA 4I6KA 5I09A 1UD8A 1RPXA 1JYXA 4NJJA 1WKEA 3N73A 6CGTA 4PUWA 3W84A 4HNTA 2Y8VA 1XIGA 3LB0A 5KINA 3NQFA 4GX8A 2X40A 5I3FA 3W1RA 1W5OA 4GJIA 2DT2A 3P82A 1UOKA 3EAUA 1JULA 2WSQA 4Y6GA 3CTTA 3O9NA 2EHHA 3W0KA 1E70M 2PZNA 2W0UA 3ZVIA 2V69A 4ROQA 1UH3A 1BWLA 1JRBA 4G7EA 5C9RA 4CCCA 4KRTA 2YCLB 4JKMA 4KCWA 5BWFA 1EZ2A 3PJTA 1R9XA 4C7FA 1DBTA 3II1A 2V5DA 1EJWC 4F0MA 3GW3A 5I6SA 2YDSA 4GIYA 2NQZA 3WLLA 3IV8A 3EXSA 1JD9A 2W66A 1F05A 3W1TA 4QJ3B 1C7SA 3WMCA 1BTMA 3GXIA 1KXQA 4WJXA 4JD4A 2CW6A 4XB3A 2OZ0A 3NAVA 3D3AA 2C0HA 2GLKA 2UV8G 2G5WA 3AMGA 4XZWA 1DJHA 3POHA 3S1WA 3LXCA 4XUGA 3BAWA 1R7AA 1VEMA 4QDPA 4XAPA 3TN6A 1I8JA 2ODOA 4RR4A 3BK0A 3OLIA 4G5DA 2GQ3A 3CHCA 1J6OA 2EJ1A 2TODA 2QXWA 2HZGA 3CIXA 5AC8A 4WSJA 1HGWA 4AD0A 1X1NA 3M0KA 3E2RA 1DJQA 1QPRA 1UBPC 1W3KA 4ZQCA 1E1CA 2CXGA 1BAGA 2WC3A 4GRSA 4GE8A 5FA5A 1BEUA 3EWWA 2J7CA 2QIIA 1SMDA 1JR1A 2WVSA 1EF2A 1MQRA 1CYGA 1JZ2A 4JNYA 4BJHA 1T40A 3T1GA 2C79A 4YTQA 4N0RA 1GW1A 3VABA 4NHVA 5D04C 3GXMA 3E3HA 2PWGA 2XVGA 3WDHA 4W89A 2QT3A 3QH2A 4RW5A 5E6YA 3FFSA 1QDSA 5L9FA 3VFLA 1H7WA 1YLVA 4LRTA 3L4ZA 2PGFA 3N12A 1B0IA 4FF5A 4MFDA 4CD5A 1JCYA 5EA9A 3TOYA 1O5KA 4LCSA 1EDTA 2WVVA 4JYFA 2XVLA 4K3ZA 1AMKA 5K9XA 1NDZA 4MY1A 3S2CA 1HW6A 2C1IA 1RY0A 1U83A 3L4TA 5G1TA 1JJKA 5HNNA 1BHGA 2E28A 4OU1A 1AFSA 5CG0A 2OQHA 4JQ3A 4M6VA 3CO4A 2ZXAA 1ZUAX 2CLPA 1KV5A 1J0JA 4TU1A 4XKYA 1RBAA 3UR2A 1LUCA 1DP0A 3HMCA 4FNUA 4PUKA 5CG7A 3SFWA 2ISDA 1C9DA 4QXIA 4HPGA 5HULA 3PPHA 2DIKA 1MYRA 2CPUA 3WJSA 2AOSA 4QISA 3SI9A 3H2FA 4OQVA 1E43A 4NVTA 3QHMA 2CHOA 2Y7DA 1FDYA 1HGYA 3N9KA 4UQEA 3Q4DA 1OY0A 5DBUA 4GVGA 4J3VA 3HU7A 1EKOA 1HQTA 3EWBX 1VFTA 1F2JA 4FXSA 3KBNA 3HF3A 4RDZA 4GUGA 4XWUA 3V4BA 3G0SA 3WQEA 1WUEA 1QHPA 4QLLA 2WC7A 2BOFX 4G2DA 4L4OA 3WDJA 4TUFA 4NNCA 2PBGA 2VEMA 5JBFA 5JIPA 3KWSA 4MNJA 4GY7A 3VD4A 1TJPA 3Q37A 4S3FA 4EOUA 4OBSA 4Q4KA 3UQNA 4AZIA 3TW7A 4XZIA 4MNLA 3VOIA 3W2UA 3GIQA 4Q8QA 1WZMA 4PCNA 2J88A 3VKAA 1KBJA 3RRAA 4FIRA 1Q4WA 4EACA 1E6PA 2DT1A 2O4MA 3GBDA 3ZMRA 3CBWA 4MHBA 4YNGA 4YWSA 6TIMA 4F0SA 3BAXA 4GZEA 4Q8TA 2QULA 1RK5A 4EWND 2PLMA 2H90A 1IIGA 3RM8A 4ZSUA 4MUPA 4AC7C 3TYEA 3LPOA 3THUA 3H23A 5GJPA 2VQUA 1E6NA 5FD0A 2PDLA 1SFJA 4QS6A 7XIMA 1QMLA 3PZIA 5EMMA 3IRSA 1NOUA 4YTTA 5CZJA 4WKFA 3TLQA 3W00A 1W91A 1C8YA 1FH9A 4IWWA 4RE4A 2ZRZA 3HTWA 1EUNA 2XGBA 4XX6A 2GGEA 4ATLA 5BMXA 1OGSA 3SUWA 1I0DA 2KX9A 5JH2A 3ANVA 4L6HA 2GVEA 1A80A 3L5MA 3BH4A 3DCPA 3LI0A 3V1PA 2OEKA 3IIPA 1PTDA 1XLJA 1P0DA 3GVGA 2VOTA 3AXIA 1E71M 1HFBA 1XLDA 3FHAA 3RHGA 5BRBA 2XSAA 1BWVA 4OGZA 4F9DA 1VB9A 1KXVA 2BGSA 4M1BA 1JL8A 1SZNA 1M53A 3T4WA 1I0BA 1CEOA 1DHPA 4IMCA 5D03A 1NWRA 3PPFA 4AD1A 4PE8A 5HPCA 3B9OA 3B8WA 1OFAA 4PODA 3H26A 4ACZA 1Q5MA 3RX3A 1E0UA 2FYMA 2F61A 4XAZA 1JFXA 1Z69A 1J5TA 3NQAA 4L4MA 4UQCA 1R3QA 2WOQA 3G77A 1TJRA 3GC2A 1V3IA 4TX6A 4C6QA 4RDWA 1XBVA 3W02A 4QEHA 1EEPA 1VPYA 1W5QA 1UWUA 2ZBTA 1YPIA 2B7NA 5FKYA 5CJNA 1JDFA 3DGRA 4LAKA 2VOMA 4X0VA 3VZYA 4PB5A 1W9DM 1X6UA 1ZY9A 3TR2A 1S1RA 3NDYA 2QZRA 4NJHA 4WRHA 4IIDA 5EMUA 3C6CA 5A95A 2QS8A 3L21A 1E6XM 3WF0A 5CGTA 4YVPA 1JZ3A 5KZ6A 1H7OA 3FCPA 4AHQA 4YMZA 1XUZA 4FLQA 2VUNA 3W3OA 1SFSA 3UP8A 4DXXA 4IQJA 1DE5A 1H41A 4DHGA 3IUIA 2Y70A 3IRDA 3GTHA 2BY2A 1UR1A 3RMJA 3S6DA 2VGIA 4NNAA 2WSPA 3GO2A 5D09A 4R27A 4OE7A 4PBEA 3HZ3A 4J5NA 3P93A 2IS7A 1DXEA 3UA3A 3TNOA 3GC4A 2D0GA 4WSHA 5JMUA 1LWJA 4CD8A 5A6MA 2VX6A 3TCEA 1MEWA 5I7GA 3BVJA 1EDQA 1YHTA 3AJ7A 4XBKA 4P5UA 4NZFA 5I78A 2CBJA 1ZBCA 3PN8A 2OWXA 1O5RA 1UR2A 5E09A 2XINA 1TMHA 1IWBA 2CWNA 3TX9A 3UWWA 1EP1A 4G7FA 2D0HA 3NG3A 1MUWA 3AAMA 1H61A 2WB5A 2QHAA 1TPEA 1ME8A 3EDFA 2VYOA 1Q7QA 5EYWA 3M5VA 4DM2A 1XRSA 5E0CA 1KRMA 3OZMA 3WCZA 3ANUA 5CPTA 4JFSA 4NKCA 1MNZA 1TV3A 4Q8OA 4XBSA 1LQ0A 1GZJA 3FEMA 5AC4A 2EJAA 1X7FA 3SGUA 1V7AA 2I9EA 5DMNA 1QNSA 2BHUA 2YA2A 4GQBA 4HSHA 2DY3A 4EANA 4HPXA 2BMBA 3UA4A 4HP5A 4X3ZA 1UIOA 3FY1A 3F4CA 1YBQA 2JKEA 6XIMA 3AZSA 1FX6A 1XSKA 5G1MA 3WEMA 4A4AA 4XTIA 2WMHA 3AWOA 3NURA 4HNVA 5L6UA 3RMEA 2D22A 1Q6GA 2OYKA 4KEZA 2EG7A 2ISWA 3TCSA 1OX4B 2XIMA 1ZL1A 1E15A 3CUXA 4RJEA 5D4YA 3H24A 5C0QA 2FZNA 3G3DA 1DTUA 2E68A 1RQEA 3KBJA 3GHTA 3CUJA 2GSJA 4LUJA 2WWDA 1S2CA 4DJFD 1S5MA 3W7EA 2CZFA 3B8VA 1GWJA 4ES4A 1I2QA 3DYPA 3M0MA 1VBHA 2GGJA 3LCGA 3UJRA 4D6GA 4Z2IA 2D69A 1Q63A 4P7OA 2DZWA 2VR2A 3NQBA 5FOOA 2VCBA 2VFHA 4LVDA 4E6MA 1EWEA 2ABBA 3PBVA 1W1ZA 1NELA 5E1QA 3WENA 3BLKA 2R1LA 2WNZA 3BLFA 3GVRA 4CCDA 3IV3A 1S2UA 3EWZA 2HBVA 3IJIA 1EHNA 1QO5A 5SWUA 1AK5A 1VD6A 5J5RA 1NP2A 4WKHA 3VYLA 1IXQA 2WANA 5LSMA 4J27A 1T5AA 2CWXA 2BLEA 1A47A 2A6LA 3DYOA 4LU0A 3O2LA 2YA0A 4WEVX 5BCAA 3DIPA 1WYIA 4CQCA 3TWAA 3ARTA 4NZ1A 3CO8A 1XYMA 3GLCA 1B2YA 2FZ8A 2EAWA 4AX6A 5K4ZA 1TMLA 3QEZA 1GZ1A 3S1GA 4GY1A 4PL1A 4NP7A 1WDPA 3OPSA 4GWEA 3VMOA 4IFKA 1WZKA 2YDAA 3A23A 2V3EA 1LORA 1R5YA 4W87A 3ZQ9A 2GZXA 2WYSA 1KC7A 3C2EA 3GFYA 4M3PA 4XISA 3BLIA 3CHDA 3LK6A 1EX1A 3AS2A 1FWCC 3MCMA 4KW2A 3T0DA 3C3NA 1K9EA 4EWJA 2OKTA 3ME3A 3P67A 5AKQA 4GVIA 1XKYA 2BX7A 1BYBA 4JTKA 1YNYA 3UG3A 1JYVA 1J0YA 1BXCA 2FB2A 4B4HA 1A4LA 3GTIA 4L9YA 2JKPA 3AXXA 3UNDA 1ZFJA 3U0HA 2Y62A 1EGMA 3W38A 4Z2LA 2CLMA 1XIFA 1LBLA 2ZTJA 2VZUA 3E0VA 4Q8NA 1YMYA 1RLDA 3ONBA 1A53A 4DB7A 5LZLA 1TG7A 3G24A 4NXKA 3IJDA 2BFGA 1HP4A 4KF1A 4UOQA 5HXMA 5A8NA 1B1YA 3S83A 3WX7A 4F2TA 1XCFA 2PDJA 3ZJ7A 5C7HA 3BV4A 4XD3A 3CLMA 3WJWA 4IXHA 1A5OC 2DP3A 2YSWA 4HU4A 4NZ5A 3PUDA 3WUGA 4GG9A 4IMDA 5DT7A 5IHSA 5ABGA 3TYZA 2NXGA 3ZXWA 1V3HA 4W93A 3BCJA 2E9MA 5K9CA 4JQ4A 3W6MA 4D6CA 4M29A 3ABXA 2XIJA 1XQLA 4IX2A 1BYAA 1WDWA 4K8HA 1EA0A 1TIWA 1KTBA 1TV5A 4CVUA 2EQDA 4Q33A 2IMRA 5MKGB 3D47A 3LY0A 4K8GA 1VYSX 1ECQA 4AX7A 1OINA 4MJMA 3R58A 2VWSA 1BYCA 3WH9A 2BZNA 2OOGA 1LL6A 4FXRA 3GAYA 2V6AA 1PX4A 2ZE3A 3RLVA 2XN1A 5CEWA 3GBEA 2PCEA 3S46A 5I3GA 2CLFA 1A0DA 2FFIA 2E5BA 2HVOA 2VQTA 1JDCA 5I07A 1QVBA 4EXBA 3ABSA 3UWEA 2D2GA 1IGWA 1JZ8A 1VS1A 4XSLA 2LLEA 1LG1A 5CSYA 2J4GA 2ZWZA 4PSPA 1AH0A 2X09A 4QG8A 4EPBC 4XKMA 2G50A 3VUPA 5HMSA 5H2ZA 1PZ2A 4Q7NA 2O56A 1XS2A 3PSVA 1MDLA 6REQB 1SSGA 1RK6A 3K1GA 1O94A 2HVNA 1VRXA 1TE1A 2HJPA 2DVXA 4MJ2A 1KM0A 3P0XA 2C15A 2P50A 4NF7A 4AW7A 4Q8VA 4M7SA 1RR2A 4S3GA 4HMDA 1U33A 2XH0A 1KFKA 1EXPA 1XLEA 3UBPC 3V5OA 3R8HA 1ENUA 1RA5A 3CXOA 2C8NA 4O4WA 1Q7MA 3ZSSA 4ILSA 3GX9A 3C5QA 3GH5A 2G3FA 4M7TA 3IVSA 1YEYA 4DWDA 3WK2A 1ZJBA 3ABOA 4R34A 1A5LC 4UFHA 1AL8A 3F2BA 2JFEX 2D2OA 1VFHA 4GKTA 4LW7A 1VEOA 2V2DA 2E8YA 3IJ8A 1POJA 1XJBA 3BOXA 3FV9A 1V02A 3MO7A 4NAEA 3G2GA 5GNYA 3QXBA 2ZDSA 4WY0F 2ZX9A 1FA2A 3CASA 4AY1A 5DFAA 2DVTA 3BMVA 1EJ7L 3RO6A 4E3VA 3VFCA 5CLWA 1WBJA 4JDYA 3ABZA 1ZP4A 4BI5A 5AHLA 4O14A 2X1RA 2XHYA 4KWWA 5CPSA 9XIAA 5ABHA 5LNUA 4PTNA 3VKCA 2R14A 4IZGA 3OGVA 1KO0A 3CYVA 4XD4A 2XWEA 3RR1A 4QJ1A 1A5NC 3W27A 1R8LA 1OX4A 4LF2A 5EL1A 3ARRA 4B3KA 3LG3A 4R7JA 3KX6A 4MMWA 2PRLA 3MUZ1 4CEXC 4LB4A 2GJPA 1TV7A 5IFTA 3DECA 1OD8A 4UMCA 4LRSA 4ZQPA 3WN6A 3TTEA 1THFD 1NIUA 1Z48A 4JTCA 5CGMA 2J79A 5HPOA 4DPPA 2XYLA 2R1NA 1J0KA 4I3GA 2PB1A 2ATSA 1CDGA 4XZ9A 4CD7A 2X16A 1KFCA 3M0YA 5LXEA 4KFNA 1DVJA 1IEVA 4MZ8A 5HR6A 1S5VA 1KRAC 3BJTA 1UHVA 2BS9A 1H50A 1OSEA 5AVNA 1S39A 3ZJ8A 1UC4A 2VFGA 5DX7A 4C6DA 3UVIA 2B31A 3W37A 4JZ5A 4HK7A 1T8QA 2RGLA 1D2KA 5B7ZA 4DJDD 3B05A 2J7DA 3AISA 1X7IA 1R3TA 3TTYA 1XRFA 4M0XA 4GI9A 1OEPA 1ISVA 1ITQA 3PZMA 2GQ8A 5BXRA 3WIJA 2FLIA 1FHLA 3JUGA 1PHWA 4QDMA 2X0SA 3ITYA 1ZBKA 4ZB5A 4RCXA 3WJXA 3PWGA 2E77A 1Q65A 2X2YA 1XBZA 5T26A 4GBUA 3DBNA 1EYWA 4PTVA 3MI3A 2XISA 3L12A 1YE4A 3W81A 4E8DA 5F2GA 4IFOA 3WNKA 3EOLA 4QP0A 3OOQA 3COTA 5BZAA 4TVCA 3O0KA 2Z27A 1U1UA 4XZHA 2YGYA 4L4LA 1Z89A 2NZLA 4WLCA 3GVVA 4H8NA 3RPDA 4UXDA 4TV6A 1X8FA 1R0MA 2Z7KA 3LDVA 4CVWA 1R2RA 4DUXA 2EO7A 3CL6A 4JN8A 2RHGA 2FPTA 4NYYA 4H8VA 3OIXA 2C1GA 2V5LA 3VIJA 2VEIA 4PYSA 4LAMA 3TTSA 3O07A 3O6AA 5ENLA 1US2A 3HIJA 3UFYA 1WDSA 1J01A 2A79A 4EE9A 4UZSA 1GYMA 3CZEA 1VCVA 1HP5A 1VEPA 3L0KA 1YRRA 1W1PA 2YR1A 1QCWA 4G9PA 2XZ7A 5FIPA 2QCLA 3D6NA 3KCOA 3SJNA 4DJDA 3CUHA 1P1MA 2FHBA 4GBDA 1O95A 3LENA 3QPYA 3XIMA 1PXGA 1Q6CA 3GK0A 1UQZA 4TOQA 2PMQA 2X41A 3D46A 1UWRA 4B5TA 1ZCCA 4MWAD 1V0MA 1F76A 1NM9A 1FCBA 3P81A 2PDKA 3T7VA 4I5UA 3GAKA 3M1ZA 1ONXA 3LRMA 1R3SA 1J9YA 3RFAA 2A6NA 1H09A 4JCLA 1UWTA 3K8KA 2VFDA 3DDMA 1EJSC 3ARYA 2WMKA 3NQMA 2BHYA 4JIHA 4R9OA 1RP8A 4I8DA 2VX5A 1OZMA 4HYWA 1DJNA 1V6XA 4LUIA 4JQ1A 4MLRA 4C6LA 3SQSA 4U2YA 1AQ0A 1CECA 5JQ9A 3K13A 3TYBA 1FWEC 2A21A 1LYXA 3W7MA 3I4KA 3EXRA 1YTKA 1QNRA 2J75A 2ZVIA 5A5WA 5H8MA 5E0KA 4GGBA 1BRLA 4N9CA 2VDHA 1NFPA 4NAFA 2XZ9A 1Y7VA 4PCPA 1YXCA 4AMCA 5BOFA 4QCFA 3W73A 1A5CA 3W2MA 1J79A 4HSNA 2QCEA 3NQCA 4UFIA 4KWUA 1FWRA 3CPUA 1SFTA 1H1ZA 3VZZA 1KM6A 4B92A 4UWMA 3GDRA 5HBFA 4X9YA 5DRIA 4W7VA 3S5OA 4JTJA 1XSIA 2O92A 3HQ1A 1LRQA 1OIFA 2D2JA 1M68A 3KM8A 1DWAM 2PD9A 2WMGA 2WM0A 5D2YA 4IXXA 3EWDA 3WQ5A 1FCQA 1KD0A 3PTMA 1JCMP 5CPQA 1E1FA 5HUOA 4OTKA 1E9IA 1EPXA 2ASHA 4XTDA 2HE8A 3NSNA 3NVTA 1ZHAA 4F0KA 1IXOA 1J0IA 2WVTA 5BRPA 2BY1A 1JXKA 4OBTA 3IJLA 2XIOA 2YW4A 5AYXA 5EMJA 1KBBA 3AROA 2H9AA 3IAPA 1C7TA 1DEDA 3U2ZA 5HNTA 2RFGA 3OZYA 3PK7A 4H9MA 2PP1A 4HJWA 2B7OA 3MKVA 1I4NA 2QYGA 1G94A 4N9BA 3DC0A 3N34A 1CCWB 1TVNA 3PSWA 4PB3A 3E0IA 4QAIA 2PU1A 1NH6A 3EMCA 4ZA0A 3ITGA 1Q6LA 1NWTA 2OWCA 1GCYA 4C6MA 2YB4A 2B0MA 3OA3A 2AAMA 4AYSA 2R6OA 5EU9A 1CGVA 4OUEA 2QUNA 3LTPA 4GUHA 3QLDA 4N4PA 5G5IA 2CBVA 4D72A 4IG2A 5FJRA 2YCKX 1YIXA 1IV8A 4JN7A 3B4UA 1WDRA 4P2VA 1GHRA 2R9RA 4R9XA 3PVFA 1LG2A 1KGUA 4H6QA 3TEVA 1PKNA 4UQAA 1VGAA 1X6NA 2DU2A 2QVHA 4JNZA 2X05A 1F3TA 2Z1BA 3N2BA 1ICPA 1AH4A 4KWSA 2PTYA 4LCQA 1M9HA 4K6AA 3KS5A 4HHPA 5F1UA 4OOZA 4Z1DA 1QI3A 4XBJA 2PLCA 5AHNA 1PBGA 3SW6A 2GUBA 4NXSA 1UD4A 5IXEA 4A3HA 4LC8A 4HT3A 1Q6FA 3ZSTA 5HQLA 2YX0A 1KGWA 3N9RA 3TU9A 1YDVA 3RX2A 4MWAE 2E3ZA 1ZSXA 3DHDA 1H1NA 2CLHA 1TA3A 1JQVA 5BXSA 3BTNA 1SW3A 1F8MA 2ALRA 3WD0A 5A2CA 5EMYA 3STFA 4NZJA 2H8ZA 3T8QA 4ERIA 5E5CA 4A8NA 2XFFA 3CB8A 4PMQA 3THAA 3CAWA 3KRSA 7REQB 4K7VA 4HOWA 5A6KA 5CPLA 2Z1VA 3S1XA 5KZEA 3W71A 4HZ8A 2RH9A 2DSKA 2J7HA 2ON3A 4A8LA 3LNPA 4GZJA 3LCWA 4DI9A 1L8NA 4PUMA 3WLMA 3VCRA 1C92A 3EKLA 4CN6A 3BLLA 4PBGA 4RNFA 3OTRA 3WF3A 1H1YA 1EQCA 1VPQA 4XZBA 3TSDA 3OLEA 4YVXA 1W1YA 1JAEA 2UY3A 4FX8A 3BICA 3CNYA 3UR5A 4HTBA 4GIEA 3USZA 3QZEA 3DUGA 3BARA 4AWTA 3CIVA 3CZLA 2NUYA 3DZ1A 3GXTA 1L2UA 2GK1B 3RRXA 3UZWA 4Z1BA 3KRBA 3KTXA 4A3UA 4U5KA 3N4AA 3W7JA 4FEZA 3C2OA 1TX2A 3WUEA 3WLQA 1HJXA 2VZVA 3WF2A 2ACQA 1WKYA 1Y0EA 1JZ5A 3GR8A 4QNWA 1YADA 3UESA 2ZXQA 4GC4A 2X42A 1YX1A 4YCPA 3A4AA 1SJDA 5D38A 5DXYA 5DMMA 4HD5A 4JIPA 4LAZA 3BOFA 1PDZA 4U10A 3CPRA 3PZOA 5LHFA 4KPLA 1HX0A 3JZEA 1OQFA 4G7EB 3LGDA 3R94A 1RA0A 1BLIA 3OQ8A 2BGNE 4NI8A 2NQJA 5FF2A 4LVFA 2PUZA 3AZTA 1YKWA 1F61A 4H9VA 2E6FA 3POCA 3ITVA 4B5VA 3UG4A 2NT1A 5D9MA 3GIYA 3CUZA 3C2YA 3ITTA 3LQLA 1Z44A 2FFCA 3OO2A 2NW0A 4UIOA 3DKLA 1LOQA 4MDPA 2DEPA 3O6CA 4UTWC 4GACA 2D0FA 5D32A 4L1GA 3T2PA 3QV8A 5AVHA 3TJ4A 3UXDA 1V79A 1QPNA 3MZNA 3HQPA 1HO1A 2YFOA 4B91A 1GQLA 2FH6A 4MB5A 1OCBA 3VIIA 3V7PA 3PZGA 2VELA 4ZO7A 3RITA 1SR9A 2Z29A 2D3NA 4A21A 4ZMGA 1L2QA 3NGFA 3P8IA 3R43A 2BV9A 3KLKA 3T0AA 2QAFA 3V5CA 1G69A 4MSSA 4UCFA 3ABQA 2XJ7A 4AZ5A 4UNLA 3BLOA 4WKAA 5HMDA 3F1QA 2CEQA 1AZ1A 1MEHA 4KETA 1K9DA 4JL1A 2QCCA 1OK6A 1Z32X 1E6SM 4JTDA 2DH2A 1E4NA 3NZGA 4TX8A 4GOAA 4I5XA 4PUJA 4GFIA 3EOEA 1SO3A 4UMAA 2BTMA 3G1AA 3NGJA 3NPXA 1HF6A 1K8XA 3MCNA 5A8OA 1BVWA 1IZCA 2NWSA 3AI0A 3FW6A 3ZJKA 4GNKB 3N4EA 1PPIA 3L2MA 1JPKA 4BF9A 8RUCA 1TJ2A 3W25A 1FWAC 4IG2B 1XC4A 1DHKA 1CGUA 3IJ7A 3H4WA 1F7BA 3LZ3A 4B4FA 1FDZA 4IP4A 4GPNA 1PX3A 3RCNA 1R3YA 2Y8UA 4GGHA 3SIZA 5T9BG 1KFEA 3J7HA 1DV7A 1Z9AA 1E9LA 1KM1A 4EVZA 3WEZA 4Y9AA 2ZOXA 4Z2JA 2D23A 3HQNA 1FVPA 2C71A 2PLKA 1MWOA 4RLIA 4GISA 4KRZA 4IH3A 4DRSA 4MB4A 3TQPA 1UR8A 3LHWA 5HOSA 3ELFA 3OU8A 3B06A 3AC0A 2CYGA 4K68A 2ONEA 3GFZA 4H7ZA 4TIMA 3JW7A 4YTRA 1R3WA 3GUGA 1TPWA 1V3KA 3QFEA 1P0NA 4Q8PA 5EGRA 1VZWA 4P61A 4IQEA 3FOKA 4YU1A 4NZCA 1XF0A 4CKQA 5DCBA 3O0FA 5IHRA 4O1FA 2GJNA 3MUCA 5CPNA 4Z0SA 3QYQA 4ZOCA 1XM3A 2PDHA 3G5EA 3O63A 3PFMA 3GE7A 2GVLA 4NY2A 3NL6A 2E9LA 4RE2A 4FOKA 4BI6A 4XD5A 4JN6A 1SW0A 4AVNA 1OJXA 4H9UA 4C6BA 2VO5A 2A5HA 4ADSA 3EWCA 2PWDA 1DE6A 3DYMA 2UBPC 1HVQA 3WH5A 1KRBC 3SY1A 4E8GA 2QCMA 1DIDA 3CUGA 4IUGA 3SRFA 3I6TA 3HB9A 1XDJA 2CKRA 4QG6A 4C90A 4QTGA 3FYPA 1NARA 1EBHA 3FKKA 4A8IA 4QLJA 5CPOA 4DBUA 4XD6A 4DM1A 3U57A 1QTWA 3TOPA 1MI3A 4V27A 3WH6A 3NZRA 1HO4