5KETA

Structure of the aldo-keto reductase from coptotermes gestroi
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
328
structure length
328
Chain Sequence
SVTFHNGRKMPVVGLGTWQSPPEEVTAAIDVALEVGYRHIDTAFMYQNEAAIGKTLKKWFDSGKLKREDVFIVTKLPPIGNRAESVEKFLTKSLEALQLDYVDLYLIHLPVGFQYKGDDNLWPRGEAGEFLIDTSTDLISLWKAMEAQVDAGRTRSVGLSNFNSRQIARIVKSARIRPANLQVELNVYFQQRELVAFCRALDITVCAYAPIGSPGLANVIKARGAEVPESAKFDPLTDPVVLKIAEHHKKTPAQVLLRHCMQRDIVVIPKSTNAGRIKENFQVFDFELSKAEVDELDSLDKRAAGRRFRMDQYKGLREHPEHPYDEPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase 1
publication title The Coptotermes gestroi aldo-keto reductase: a multipurpose enzyme for biorefinery applications.
pubmed doi rcsb
source organism Coptotermes gestroi
molecule tags Oxidoreductase
total genus 96
structure length 328
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 5ketA00
2PD5A 2HV5A 1AH3A 2FGBA 4QX4A 3R43A 4QBXA 3CAVA 4LBRA 4G5DA 4JQ2A 3UZZA 4WDWA 1S1PA 3WG6A 1Q5MA 5LIXX 4AUBA 3GUGA 4WDTA 4LB3A 3WBXA 2IKGA 3KRBA 1Z89A 4PUUA 1S2CA 3V0SA 3EB3A 1ZQ5A 4EXBA 5LIKX 3BV7A 1RY8A 1PZ1A 2ALRA 3O3RA 1RY0A 4IJRA 4EXAA 2PDXA 3O0KA 3LNMA 2ACRA 2F2KA 3UZWA 2A79A 4YVPA 4H7CA 1C9WA 4WRHA 3LN3A 1MZRA 3UZXA 3GHTA 4GIEA 4YS1A 3R7MA 2I17A 3P2VA 3UP8A 1Z8AA 1LWIA 1XF0A 1AH0A 3R8HA 2PDWA 3UZYA 1Z3NA 2HVNA 4FA3A 1J96A 3LD5A 3EAUA 1PZ0A 3GHSA 2WZMA 1S2AA 3ERPA 2HE8A 2PDJA 3WCZA 1YE6A 2PD9A 4L1WA 4F40A 1Q13A 3B3DA 3DOPA 3ONCA 1X96A 2VDGA 4YVXA 1Z9AA 2I16A 4JQ1A 4XZMX 5LIUX 4ASTA 5HA7A 2PDFA 4GQGA 3LZ5A 4WGHA 4MHBA 3Q65A 4WDXA 4DBSA 2QXWA 3H7UA 4JTRA 4XZIA 4RPQA 2FZDA 3COTA 4I5XA 5AZ0A 4GCAA 2PDNA 2HEJA 1LQAA 2PDCA 1VBJA 3LQGA 1IHIA 4FZIA 1T41A 3R58A 2PFHA 4JQ3A 2IPWA 2IQDA 2IKJA 4XK2A 1PWMA 1IEIA 1FRBA 1GVEA 4JIHA 1JEZA 3BUVA 3RX2A 4R9OA 4PRRA 3CV7A 4XZHA 3EB4A 3G1RA 2PF8A 3F7JA 4HMNA 1RALA 2INZA 3N6QA 3LENA 2ACQA 2C91A 1K8CA 3UWEA 3R94A 1PYFA 4DBUA 3S3GA 5AZ1A 2IPGA 4JTAA 5JH2A 1EF3A 2R24A 4QXIA 4LAUA 3MC5A 1AZ1A 4NKCA 3QKZA 3H7RA 1S1RA 2BGQA 1ADSA 3VXGA 2PDGA 3MB9A 3FX4A 2HE5A 2PDYA 1EKOA 4JQ4A 4XVEA 3G5EA 3T42A 1HW6A 1XJBA 1XGDA 4QR6A 1MI3A 2FZ9A 4H8NA 3LQLA 4JTCA 1VP5A 1YNQA 4DZ5A 1PWLA 4Q7BA 1A80A 2J8TA 2DV0A 3V36A 3CMFA 1EL3A 3BCJA 4LBSA 3BURA 4L1XA 3M4HA 4WEVX 5JH1A 2PDKA 2WZTA 2HDJA 4JTQA 5HNUA 2PDPA 4PRTA 5DANA 1YNPA 2DUZA 2NVCA 1M9HA 4PUWA 4DBWA 4JIIX 2IS7A 3LBOA 4XZLX 2PDMA 2PDUA 1ZSXA 4GACA 2DUXA 2ISFA 4WDUA 2FZ8A 4IGSA 3C3UA 3M0IA 5C7HA 4LB4A 3LEPA 1US0A 1X98A 3UGRA 3H4GA 2IQ0A 1SM9A 3DN5A 3NTYA 3CASA 1HQTA 3LZ3A 4GQ0A 1AH4A 4JQAA 4XO7A 3UFYA 3M64A 2PDIA 1X97A 3CV6A 3ONBA 1QWKA 2IKHA 4PR4A 4FAMA 3V35A 1MRQA 1ZUAX 3CAQA 4XO6A 3R8GA 4FALA 3N2TA 3R6IA 3WBYA 5HNTA 4XAPA 2FZBA 2IKIA 2PDLA 3GHRA 4PMJA 2AGTA 2CLPA 1QRQA 3GHUA 2NVDA 2PDBA 2IPJA 4LAZA 4XZNX 5M2FX 2INEA 2ACSA 3D3FA 3UG8A 1T40A 1EXBA 4ZFCA 4Q3MA 4ICCX 3V0TA 4JIRA 2F38A 1YE4A 5KETA 4HBKA 3UYIA 2BGSA 5LIYX 2HVOA 3RX3A 2BP1A 1AZ2A 2PDQA 4JTDA 4XVDA 2FVLA 3Q67A 2PDHA 3V0UA 2ACUA 1AFSA 2P5NA 2PEVA 2R9RA 4OTKA 1R38A 1OG6A 3RX4A 3LUTA 1UR3M 4GABA 5LIWX 4YVVA 4GA8A 3U2CA 2PZNA 1ZGDA 2IPFA 3FJNA 3WBWA 4IJCA 4YU1A
chains in the Genus database with same CATH superfamily
3QY7A 1HJVA 3APYA 3RUBL 2J88A 1UKQA 4DJFD 3OG2A 4KW2A 4XAZA 1EOMA 3BAJA 1SO5A 4X2RA 2AAMA 3S9ZA 3EPMA 3P93A 2EPLX 1Q5MA 1NJJA 2R1PA 5EYWA 1P0KA 3TYBA 2WAGA 3B9OA 4DI9A 5AHIA 1DL3A 4N4PA 4KEUA 2IKGA 1GTEA 3LRMA 4XKYA 4HPGA 4IQLA 4NASA 4TMCA 4W86A 3W2KA 5U7SA 4ZMGA 5DT7A 3STEA 3EEZA 1X7FA 3QV7A 3G22A 1H2JA 4B4HA 2XVKA 3SRHA 2DJXA 3SCUA 1RY8A 3HQPA 3O3RA 4Q8QA 3P8JA 5AOUA 3NSNA 1XDJA 1B0IA 3MVIA 1MNSA 1OVDA 2E6AA 1ZU8A 4NNBA 2V9DA 3G2GA 4RR4A 5G1TA 3VKBA 5HMFA 4Q32A 4H9MA 2VZSA 1DIDA 4L65A 4LVBA 3G6MA 4A6GA 5K9DA 5KINA 3B8TA 1GPFA 2EKCA 1BYAA 2JF6A 5LXEA 1E9LA 2VRJA 1Y65A 3IACA 3CUFA 2Y7DA 3NZGA 1JCYA 2X30A 3P5ZA 1R0MA 3IVTA 3IJLA 3MI6A 2DT3A 2OSWA 1V3HA 5LGZA 1GQJA 1YIXA 2C0HA 3A21A 1PIIA 1WP6A 2DVTA 3EKZA 5IBXA 4BQ4A 2TYSA 2VDGA 5FF3A 2BVYA 2VWTA 3WQPA 3ARZA 1NU5A 4ZGYA 1VLIA 1GYLA 3LZ5A 1SZFA 4OWGA 1VR6A 6TAAA 4L56A 4PMNA 4HNCA 1XHGA 4XZIA 2P50A 3IV3A 1FWWA 2R14A 2PMQA 3A9BA 3IIVA 2ZUMA 4O4WA 3OA5A 5DN1A 4ILSA 3GE7A 4Q4MA 3WQWA 4CCZA 3BCDA 1E1EA 1Q6QA 2BTMA 3NPVA 1GQNA 2IQDA 5AYIA 4K1GA 2XFRA 5LHFA 1JI2A 3S0CA 3WLPA 4NXSA 3GSMA 1HNYA 4CD4A 1JEZA 5FEPA 2O7QA 1E9ZB 2PF8A 2MANA 2R1MA 2GDQA 1ADOA 4AMAA 3N6QA 3FAWA 3C0JA 1AD1A 1KW1A 1JVNA 2XSXA 3GDKA 3IJ9A 3WJYA 1WAWA 1ESWA 3O7UA 4Y9OA 1LWJA 5GJPA 3BGGA 1XPYA 3GB6A 3MC5A 3LTPA 4QG8A 3MJYA 1IR1A 5C9WA 4LAKA 1T6MA 1EOKA 2WKGA 1CXKA 3L0NA 2D20A 1UZ1A 3VXGA 4PH6A 2WVVB 4MJ4A 4CEXC 1TTJA 3A3WA 4UCFA 1DOSA 2YGYA 1XFBA 2AOSA 3F5JA 3G5EA 3NXFA 4C65A 3F4NA 3K4DA 2WCAA 2Z2UA 4CQDA 1FTXA 3LPOA 4G7EB 4ADSA 1LOQA 4IT1A 2FJKA 1LL7A 2OX1A 5C55A 3GIQA 1WBJA 5LNVA 1EDTA 4PB4A 4W89A 3PC0A 2P8BA 3QTGA 4JKMA 5CQ1A 5FL1A 1DE6A 3BCJA 3CZKA 1M41A 3IWPA 3GR4A 4W5ZA 1JCLA 4O19A 2PDPA 2C15A 1TUXA 1VFUA 1QO2A 4LXFA 2XIIA 1M53A 2ICSA 1OC7A 3CT7A 2PP0A 1GT8A 1JQXA 3YPIA 4AYGA 3NYDA 4C6CA 4AIUA 2OSYA 3AO0A 3IIZA 1SJAA 2O9TA 4HZ6A 1ZSXA 4GIAA 3CT2A 2DZUA 1HKWA 4Z2KA 4FNSA 5A8MA 1EEXA 3DYMA 3UZJA 3O6AA 3I7QA 2H9AA 5E70A 1X1ZA 3P61A 2FZ8A 5A95A 3C2VA 3CQIA 3FKKA 3D0CA 2YLLA 4IMDA 4GISA 4OOZA 4ZTXA 4YJ5A 2P3ZA 1FUYA 2NT0A 4JHMA 3H2AA 2GPTA 5TD4A 4UWMA 4MAVA 3F03K 3V3WA 3UFYA 3RR1A 3OQ8A 2Y88A 1KC7A 4HMEA 4PR4A 2DH2A 4LUSB 5EBAA 3NZQA 4E3VA 3A47A 3VDAA 1OGBA 4MKSA 1DHKA 4NU7A 4EPKA 1W37A 1QI3A 2Y24A 4AIOA 3E02A 1XBZA 5HNTA 3C6CA 3HFYA 4IP7A 2XINA 3A6OA 1M6JA 4RV8A 1KRCC 4DZAA 5CBIA 2VQTA 5DCBA 1V93A 2J7DA 2Q09A 4PSRA 3W38A 3M46A 4DJEC 1EX5A 1MUCA 5A8NA 3TQPA 3RLGA 3EWCA 1CNVA 3WF3A 4PUJA 2CPUA 1BRLB 4PC8A 3LY0A 1JZ6A 4Z1DA 3PTMA 4REQB 2V3EA 2VWSA 5HK4A 1FFRA 4W87A 2V3GA 4MIMA 1AA1B 1QVBA 3FEMA 4YWSA 3TCEA 3NZRA 3WJSA 3OZPA 4BQ3A 4KIEA 4C6PA 2V5DA 2GVLA 1F3EA 4O52A 1E43A 2GWNA 4KF1A 3E74A 4L7ZA 4FX8A 1NSJA 3WDHA 2XWDA 1UW9A 4HNUA 2OYLA 3TJIA 3GDBA 1MZHA 4OHQA 3QH2A 1LBFA 4ICMA 3ELFA 3T2PA 1A5OC 2VX4A 4NHVA 2QIIA 1I9CB 3XINA 1C7SA 2TPSA 3QN3A 3AROA 3AMKA 1GOQA 4UR8A 4PUNA 4AUBA 2R91A 1XRTA 4IIEA 4O1BA 1S5WA 4K37A 8XIAA 3EWYA 3PZ9A 3WJZA 3KRBA 2GGIA 3FOKA 1QK2A 1KFBA 4IFKA 1L6SA 4DUOA 1S2CA 5AKQA 4ZB2A 1XRVA 1SGJA 1H3GA 3VUSA 1ZBCA 1B3VA 1ZHAA 4ECLA 1B3WA 1MDRA 1EJSC 2A3HA 4KT2A 4C90A 1XC4A 5JVLA 1SMDA 1YQ2A 4IXHA 3OLEA 4CD5A 1CLVA 3TYUA 1R7OA 1OSEA 1DXIA 3VA8A 1HN1A 1B57A 2F2KA 3UZWA 5DXYA 1Q7QA 4WJ8A 4FS9A 4QS5A 3W7DA 2OQYA 1DWAM 4WRHA 4DF1A 5D8WA 4D6DA 5BU6A 3ARWA 5C5YA 1QJWA 2E3ZA 4WKAA 4FP1A 3O6DA 1WPCA 1L6YA 1V02E 2YDSA 3ITCA 2RAGA 5TBOA 4AF0A 4EF9A 1KFWA 1KFJA 4IM4A 5E5CA 3N2BA 3I3BA 3VDGA 2BOEX 3TIMA 1KGWA 3PUDA 2FHBA 3QMTA 2HXTA 3T4CA 4J35A 4RK8A 4UC5A 3WQCA 3ITOA 1YW1A 4YL2A 4YVXA 1Z9AA 3KBJA 1XLCA 4GQGA 4U31A 5G4HC 3JS3A 4XTDA 4P7NA 3C4UA 2YCLA 4ACYA 1US3A 3GQYA 2CKSA 3GNRA 1P5BA 2WMFA 3E3HA 1QFEA 3WD2A 4H8UA 4M6QA 1VZWA 4JQ3A 3KXQA 1EQCA 3IEBA 2CLKA 1NM9A 3TNBA 4B15A 5DO8A 2BZNA 1KRMA 4HPXA 1FRBA 1C92A 2YXGA 1J0IA 4JTTA 2UY4A 7CGTA 3GS6A 4WUIA 5HWMA 4IIGA 3FN9A 1VJZA 4HTBA 4KESA 3URAA 2D1ZA 3S1XA 2E5CA 3GYEA 1FCVA 3S3GA 1O5QA 2W9MA 4MWAD 1JZ3A 2C0AA 3M16A 3H24A 1WV2A 5E0KA 5CZTA 2QJMA 3QM3A 5BRPA 4RE4A 2ZUUA 2E28A 1R86A 3WLJA 4UFLA 5DF0A 5AC4A 1PTGA 1HJUA 2OO6A 3KOYA 3WEMA 4WKHA 1WYIA 4PBEA 1BLIA 4MDPA 3AS3A 1H1ZA 3VDHA 4S3JA 4NJJA 2JIWA 4LEFA 3PZIA 1UUMA 2YDRA 2PC8A 2QR6A 3MKKA 2SFPA 3UNDA 2Y6ZA 1KCZA 4B5UA 1UWIA 2RFGA 3EDJA 2CNCA 1XGDA 1V6TA 4R3UA 2QVHA 4LUYA 2GLKA 5AYXA 3MUCA 4RKAA 4RV3A 1LWHA 1H63A 1CXHA 3CUHA 2NSXA 4CCEA 3U4FA 4C6LA 2XVGA 4XD6A 1FA2A 1XLKA 3LHWA 1TJ2A 4CGTA 1CWYA 3GAKA 3ABOA 3F2DA 3CBWA 3AIBA 4PRTA 4CD8A 1SJDA 4U5KA 4XSMA 1W32A 4ZODA 4GUIA 1WDSA 1EP1A 5G1MA 4UTJA 1KO0A 4XZLX 3ZSTA 4E5TA 3LBMA 2PDUA 3ENLA 2FYMA 1HJSA 1UH3A 3TROA 4DBEA 2WVVA 2XSAA 4N42A 4UTTC 3M0IA 1A5LC 1X98A 2BVDA 4ORIA 3H4GA 2NWSA 1K70A 2O4QA 3LRLA 1SM9A 3DN5A 1EJVC 4G7EA 1V08A 1HQTA 3E0LA 3VC5A 1GYNA 5C71A 4DWSD 3BAWA 4L4MA 1J8VA 1GOKA 1BXCA 1YTKA 2XN1A 3URQA 4UTLA 3BH4A 3UXKA 1DJGA 3SEPA 1YPIA 1OIMA 4IHCA 1VH7A 3BARA 3CQJA 5LHEA 4ML4A 3DKLA 4WSKA 2A6LA 4RZ4A 2QDDA 4LV4A 4PMOA 1MSSA 3P0WA 1XIJA 2IXUA 4WCJA 2PDLA 3II1A 3P74A 1X6UA 2VC7A 2YKKA 2PCEA 2CIPA 3UPBA 4U3AA 3QTPA 4G1NA 4F79A 3W3OA 2V3DA 4AY8A 2DJLA 3ABSA 2VTFA 3EKGA 1QI2A 3LYEA 4UTMA 1SJCA 3AZRA 2J74A 3RX3A 4YTUA 1AZ2A 3N2XA 5IBXC 4WY0B 2OZ8A 4CU7A 2AL2B 2PGEA 4UMCA 3W88A 1XLFA 3AU2A 3THDA 1X1NA 1R38A 1R85A 1BSIA 3W7LA 2J62A 3QPYA 4O1CA 4C6IA 4YXGA 2YZ5A 1RQBA 4GXMA 4TQTA 1C8VA 1ITXA 4LUSA 4YVVA 3TOYA 2QCFA 1Q6LA 2ZX7A 3IJ8A 5REQB 2JBMA 4IPIA 5AHNA 2VT0A 4D1JA 2IPFA 3CHCA 3EZ4A 1KB3A 2HV5A 3BANA 4PB3A 2FGBA 1QHZA 3ORWA 1R3QA 1K02A 5ABTA 2VEPA 1UMYA 4QNWA 4D6JA 1A0CA 2A21A 3TX9A 1WO2A 4M81A 5FESA 1J93A 3FSUA 2EF9A 5C2CA 3QKEA 1IEVA 3ZVHA 2Y5JA 3TONA 3OLDA 1J0KA 3IVSA 1EJTC 1HKKA 1XYAA 4WDTA 4AHPA 4HP5A 3G1SA 5EB8A 4X22A 3AYRA 5CC6A 3UT0A 3E2RA 1XKJA 3QGKC 1VEMA 5FJOA 3OPSA 2CHNA 1KBKA 1JNEA 2UZ9A 2V3FA 4LVGA 4REQA 4DZHA 3WFLA 3VNZA 1MEHA 4EAMA 3S5YA 2WSKA 1NDVA 1UOZA 2ALRA 4XUYA 2ZRYA 3TOPA 2WNQA 3B0YA 3GG1A 3O0KA 4GYPA 2OEJA 1MXSA 3SRKA 2FDSA 3AWNA 4ZO8A 4HOZA 1GZGA 3W7PA 5FEWA 2REQB 1U5HA 3UZXA 1I6NA 7ODCA 1E9IA 1KQZA 4RLIA 5C9XA 1G69A 2QDHA 4FX6M 1HZYA 3W22A 4ZB0A 3M6YA 3EAUA 1Q8JA 1RPKA 3CIWA 3QC0A 5C0QA 3ERPA 3SIZA 5FF0A 3VD4A 1HGWA 4B5WA 4C6DA 3I10A 1JNDA 4UQAA 3F1QA 1H61A 2P1FA 2CZEA 2CITA 1AG1O 5L6UA 4A4AA 3IGSA 4DELA 2G97A 2WZEA 3LGDA 5CEWA 3WEZA 2YFOA 3QPZA 4HMCA 3NPWA 3K2GA 3VGBA 2E8YA 1BQCA 3DHFA 3AXMA 4JICA 3T8LA 4XKMA 4F0LA 3W83A 2DUAA 4HU4A 3PBWA 2GUUA 5CGQA 5ECVA 3UZ5A 3P3BA 2QJIA 5A6LA 3ZOAA 3OP2A 2HBVA 4NG3A 1UUOA 1OT2A 3VM5A 3W6YA 3N4FA 1NH6A 2V68A 2CLLA 1O5KA 1EP2A 3GIYA 1EDQA 3VNLA 4ENLA 4MTVA 2CHRA 4F9DA 5D05A 1S5VA 2OR2A 3DFHA 3GYCA 1TRDA 2WJZA 5CPOA 1YDNA 4RNIA 3WLNA 4U4MA 3ABRA 1NDWA 3UY8A 4P61A 1W54A 3TKFA 2QPUA 1IEWA 6XIMA 3WLOA 1SVDA 3AIRA 4DO4A 3TXZA 3VNMA 2FMOA 5AZ1A 4XX6A 3ARPA 4JKLA 4G2DA 4LNCA 4QXIA 3PS7A 4Y9MA 4GGBA 4JNYA 3UR8A 1AZ1A 1R7AA 1G4SA 3CUGA 4UQCA 1CT5A 4TX8A 3RFAA 3IPWA 1TE6A 3KVJA 3RJYA 1I1XA 4LS1A 5TF0A 1OF8A 1OG0A 3LLXA 1JPKA 1XIBA 4G6CA 3M43A 4JTKA 6CGTA 3LXAA 3L4UA 2J4GA 4Q4QA 4FLSA 3ATZA 1HJQA 5C9RA 1TZZA 4PBGA 2GJLA 5BMXA 4AH7A 4LYKA 5I2UA 5GPRA 2GVYA 1LLWA 4LOCA 2TSYA 3KVLA 1A80A 5CZJA 3CZGA 2E9BA 1ZAJA 3IVUA 1SFSA 2XM1A 4L1XA 4P8WA 1U83A 4O1EA 3N11A 2IXVA 1IZKA 5EU9A 1PV8A 3REQB 4FNPA 6A3HA 3SRFA 2PTZA 1VGAA 1UR1A 3BWWA 3KCLA 3NPUA 4O12A 2YYUA 3BLLA 2PBOA 4DBDA 4HK6A 2HCVA 3G8RA 4HNLA 3RCNA 1GQKA 5JXQA 1J79A 1JF6A 3R0UA 5KMYA 5D03A 4OV9A 1UWUA 3WD0A 5CCZA 3M47A 3OB8A 2WANA 2GSEA 3LCHA 3PF3A 4FNRA 1H7WA 2EJAA 4GQRA 2WPBA 1C8YA 1VCFA 4C5YA 2X7VA 1EC7A 4QDPA 3UR2A 2D23A 3NTYA 4KCTA 3N6JA 1VLWA 5AECA 1GPWA 2VP8A 1D2KA 2PLJA 3G6LA 2G3IA 4X9SA 3CV2A 1QW8A 4LUIA 2VUNA 4IX2A 3H2OA 3WQDA 2CETA 4MVAA 4RE0A 4GZJA 3O8AA 3L12A 1E0WA 1VHNA 3QR1A 3W2JA 4D8LA 2PCQA 1RP9A 2RUSA 1U22A 4CVWA 1XLBA 2CXGA 3JR2A 2NVAA 4GPNA 2ZWYA 4B5SA 3DHUA 4LALA 1PSCA 5D37A 1B4EA 3TVAA 3KVMA 3VIMA 5EFFA 1FH7A 4RPPA 4YNGA 4MY1A 3MI3A 4O54A 2VI0A 5KSWA 1F6PA 4J3TA 4RE2A 2P76A 1GUVA 4GNKB 5A8GA 4QTGA 4HPNA 3V0TA 3ES8A 3QSTA 4XIAA 3OVRA 5KTLA 4HJWA 4JDYA 4WJEA 3A23A 3TDFA 1RBOB 4XG1A 1QPNA 1XLMA 4U5IA 5B7YA 1T5AA 2XWEA 4H6QA 1EC8A 3B8UA 1YTDA 4JHZA 2ZQ0A 1K4HA 1NELA 3KBNA 1CLXA 5FI8A 1LRQA 2YL9A 1OFQA 1SJBA 2PD5A 1HO4A 1N82A 4ACZB 2PWDA 4QX4A 9RUBA 3GNNA 3T05A 4MJZA 2XVNA 4JD4A 3CAVA 4HA4A 4EOUA 3U9IA 4ZXOA 4HJFA 1V3LA 4BWLC 4GY1A 1E4LA 4FXJA 5CGTA 1OD0A 4RUBA 1W31A 4XISA 4P7RA 4F2TA 3LCXA 1F6YA 4H2HA 4RJEA 4XZ9A 5CPMA 4IG2B 1TPEA 1N7KA 4TVCA 2QLYA 2O55A 3EPOA 3TXVA 4G9PA 4IXXA 2AL2A 3CPRA 4L9XA 5PTDA 2F84A 5G4WA 4IJRA 1R2RA 3C56A 4CU8A 3SFWA 3AHYA 4EWND 5I06A 2FMNA 3M44A 3KDOA 3UCDA 4H7CA 3PUOA 1TMLA 3IGXA 2WWDA 1E0UA 3OIXA 3QXBA 2I17A 2PA6A 3DFPA 4A8RA 1QI0A 3KRZA 1Q4NX 3POHA 3NQ7A 5DCEA 1RUSA 4DQWA 1AH0A 5J5DA 3WF4A 4YN5A 1W56A 5C7VA 3BW3A 3S46A 3ARUA 3LD5A 1VBUA 3GHSA 5FJJA 3W29A 3VVGA 3ZVIA 1ENUA 3LTSA 1J2BA 1ZB5A 3TC3A 5D9PA 2XIBA 1CGWA 1YLVA 1SPQA 3GDRA 2E0PA 7ENLA 2Y4SA 1RBAA 1FBAA 4GI6A 3OZYA 5LA0A 3F5KA 5EMUA 3WK3A 1Q6EA 2BWGA 4PRWA 3D47A 4RNJA 3RITA 1IGWA 5MHBA 3VNDA 2OLAA 1JZ7A 1SSGA 1C90A 1ZALA 5IFTA 3LLDA 1OEPA 2HS8A 1KM0A 4LWWA 5FAGA 2FVKA 5G2WA 3HOJA 4HPJA 3LSCA 2PTXA 1JXKA 2Q01A 4FZIA 3LPGA 1H62A 4DLMA 1DXFA 2VFIA 1TWSA 2IKJA 4GJJA 4GJIA 5BROA 3OO2A 4XK2A 1H09A 1E6RA 2FHFA 3HA1A 4HT3A 2V5KA 1FCQA 1ODZA 2FDMA 3SCVA 1L6WA 4PEKA 1RALA 5G5IA 5LGXA 2QF8A 2C91A 4K2SA 1J2WA 4JL2A 4H83A 2XZ7A 3EDFA 3R10A 3LBCA 4DB7A 3CZLA 1ZPTA 1UR9A 4EPEC 4A2RA 3LU2A 1RK5A 1JDAA 4WXZA 1QOPA 1QU4A 1OX5A 2DSVA 1TPB1 3M0MA 3WK1A 1GJUA 3FYOA 3HIJA 4TV6A 5HMEA 2HVMA 1W3TA 3TFCA 3L4TA 4S3FA 2ZZ3A 3KOWA 5LZLA 2GVGA 4CCCA 3AI0A 4N9CA 3ZWTA 3GXNA 2PDYA 2Q3RA 2Z7KA 4QCEA 4H9XA 3MO4A 1EKOA 1EWDA 4AZ5A 4U28A 3HF3A 5IXEA 3AWOA 1LZOA 3K1DA 1I2PA 1DTUA 3SUWA 1H7PA 4JTCA 3WBEA 1YNQA 1D7KA 3IUIA 3UA4A 1L2QA 1EUAA 1PTDA 3W87A 2CLIA 1KM1A 3PBUA 4F4RA 4AQLA 5A6AA 5F2MA 4G56A 4B5NA 3NQ2A 8XIMA 3VDBA 5A2CA 2A0NA 7TIMA 4UTWC 3KE0A 1GK8A 1O4UA 3HJEA 4A05A 2Z1WA 5HQLA 1O1HA 1YNPA 4Y9NA 2YBVA 4GBDA 3NDOA 1G5AA 4I7UA 2FZNA 3PWAA 1XFCA 1RA5A 4DBWA 2ZXAA 3WUEA 2CLOA 1XG4A 3WEOA 3AJ7A 1R8LA 1GEHA 2I5GA 4JKKA 3OLIA 2A7PA 3DFTA 2WMKA 4QQ3A 3ZT5A 2V2HA 4GZEA 1LRNA 2P53A 4OKDA 4CQAA 1E4NA 2BLEA 3V1PA 3N3MA 2CBUA 3T2OA 2Y89A 4GXWA 2QDEA 2Z26A 1RD6A 3CUIA 3CLMA 3M64A 1ITUA 1Y5XA 4Q4RA 1TFVA 4O53A 3MSYA 4QM1A 4F66A 3TV8A 3V4BA 3CYJA 1UBPC 4IPLA 4V27A 4F3HA 2ZWZA 2PP3A 1CENA 4Y2WA 2W67A 3W02A 1HT6A 1NWRA 1QOXA 3REQA 3O6YX 2VCAA 4P8XA 2QUVA 3H54A 2OX4A 3MKCA 4ZTYA 3T0TA 1ELSA 3RLVA 3O6CA 2CESA 1MXDA 1B30A 4LAZA 4AW7A 3V7PA 1XH1A 2NXIA 1R9XA 4BKNA 3MV11 3QYSA 4N9EA 3N04A 3VMOA 1D8WA 2VEFA 3CAKA 4MNMA 4XVDA 1KGXA 2DSZA 4JGDA 1AFSA 3EYPA 2X05A 1XQKA 4MFEA 2EBNA 3KW3A 3WO8A 3TQ0A 4Q22A 4OJYA 4M56A 4A8IA 2AMXA 2QMKA 1SO3A 2A1YA 1WKYA 3ZT7A 3ATYA 5ABFB 4R88A 3VNJA 2BS9A 1G01A 3FA5A 4ERIA 1WDDA 4MDOA 3GK0A 3W28A 3NSMA 1Y8BA 3MWCA 5DQPA 2YDAA 4Z17A 2HRWA 2HQAA 1KTBA 1YPFA 1U1UA 2OEKA 1UP3A 1NARA 3G3MA 3MQTA 4QE1A 3GUGA 3MA8A 3G1HA 5A2BA 1AK5A 1JI1A 1YX1A 3EWUA 3HN3A 5A6BD 4QLKA 4AEFA 5I3JA 4PL1A 1XKYA 4IJBA 1OY0A 4EXBA 5CLTA 5JBEA 1XS2A 2VDIA 3WLSA 1V7AA 4MWAA 4OBSA 3VCCA 3N4EA 5AN7A 3CIXA 2PDXA 3KL5A 1GW1A 4PL2A 2XGIA 3OOQA 4DAFA 4UZSA 1C9WA 2NT1A 2J7CA 4I6KA 3E2VA 4GIEA 1T0OA 4R9XA 3E2SA 3EOUA 2GZXA 3MTWA 3N14A 2JGQA 2Z28A 3F4CA 4LTSA 1DWJM 3UZYA 4ACZA 4GIRA 3FA4A 2EQDA 5ECUA 1BYCA 1Y5WA 4O16A 3BMVA 3TTQA 2QAFA 3KFTA 4L1GA 3A4WA 2CLEA 1K4GA 3LCFA 2HE8A 3NM1A 4JYDA 1L6FA 2PDJA 2O9OA 3KEHA 1JFHA 3N2MA 3ZLFA 5JU6A 2YX0A 2VX6A 3VUPA 3ONCA 1X96A 4S2BA 2XZ9A 3S83A 3UVAA 4ASTA 3V5CA 1JPMA 1OX6A 3W7GA 2YZRA 2ANUA 3HFTA 2VEGA 1UWQA 3ARRA 1QNPA 4ERGA 3GNOA 3TCSA 4JTEA 2ZDRA 1SZRA 1UJQA 5I3IA 3PJWA 3TK7A 3MSDA 4XIMA 4E2VA 4DJFC 5F2LA 3QSRA 3KWXA 4C5ZA 4WY0F 2ZA3A 1IHIA 3R58A 4LUJA 2PFHA 4YCOA 1CGXA 2IPWA 1QNSA 3NVDA 4IGMA 3RO6A 3N9SA 4GMEA 4C7FA 1JDFA 5BW6A 5LNRA 2D73A 3NQBA 1DWHM 3S2CA 3HURA 4XZHA 3QZAA 2Y7FA 3ABXA 2XIQA 3S1GA 4ATWA 3PJXA 5M03A 4DWSA 1PIFA 2X8RA 3EGJA 5HNNA 1RLDA 3U2OA 3T6CA 3OODA 1M1BA 4ICNA 3NVTA 1XWYA 4U33A 3WL1A 1JR1A 3EPNA 3CMGA 3K4WA 3PANA 4Z2GA 4IMAA 3CHFA 2Q8XA 2J7HA 3WF2A 1W9PA 2WB5A 3GG0A 1UR4A 2DIJA 2FZMA 3F2CA 4MNJA 3P8IA 4P7OA 1E72M 2O7SA 2W62A 3OGSA 1SSDA 5D9MA 1PZ2A 2OOFA 5C9ZA 4EP8C 5G2HA 4LS0A 6ENLA 1VPQA 5J04A 4A3RA 5DBTA 2V63A 1VIZA 1E5JA 4AY1A 3VZZA 4A29A 4KIRA 2VVNA 3KP1A 3WLKX 1VCGA 1MRAA 3SCOA 1KBLA 1GG1A 3H22A 3KHDA 4Z2IA 4W84A 7XIMA 3DKJA 4QHRA 1G94A 2QJJA 1ZL1A 5TNVA 3W2UA 5CC3A 1RXOB 4IICA 2HPMA 3AZTA 4TVUA 1OX4B 4WX2A 5ABGA 5KITA 4YTRA 5DANA 3P81A 3R12A 1MUMA 3PWIA 4DXKA 4IQJA 3V5FA 2H6RA 4ZR8A 1TJ0A 4XUGA 1EJXC 2ZTJA 3PG8A 1K7EA 1I0DA 1I2NA 3A24A 4A21A 1H60A 3AOFA 3J7HA 3RRAA 2Z0IA 1OGSA 4LQ1A 5HWJA 3ITLA 5C7HA 1WXYA 3GC5A 1A53A 3UGRA 4IFOA 1T8QA 4UTKA 1KGUA 4EK7A 1ZCCA 4PCNA 1E6XM 5CAKA 1ONXA 3FYYA 1A5BA 1AQFA 1NF0A 3BJSA 2JIEA 3TC6A 3S1VA 4JFVA 1HKVA 1QI5A 1PCKA 3CO8A 2ZX6A 1ZAHA 1FWCC 7A3HA 3VE9A 3G1VA 3O1NA 3KS5A 4MZYA 3C8FA 1TTQA 1SW3A 2DZAA 1W8GA 2HPIA 4IGHA 4ZZ9A 2P3EA 4S3CA 3RLUA 1GVSA 3KCOA 5U4NA 4XAPA 3AHXA 2QNEA 3NQDA 3L23A 3AS2A 3HG5A 2FVMA 1S3HA 4IMFA 2HMCA 2CYGA 2EG8A 1KWGA 1SW7A 2I1OA 5F4XA 2FPVA 4A2SA 3GZ3A 2FLIA 4Q8OA 1ZS2A 1T40A 2BHUA 4QG9A 2DZSA 3NOYA 4GK8A 2B7OA 4AWEA 3UWZA 1K6AA 2Y5SA 3HG3A 4B3LA 3GO2A 1WDQA 3WFZA 2EJ1A 3VIGA 1RZMA 2PDHA 1GOMA 1A0DA 3EMQA 4V1XA 1JCJA 2DORA 3B8DA 4X3ZA 3P14A 4K8GA 2PTDA 3SCRA 4X2PA 1E5NA 2W91A 4YTQA 5EBUA 3ARSA 1FWRA 3WKZA 3WBWA 3VKJA 4ZXLA 1AH3A 1YHTA 3QHMA 3FIGA 2XFYA 4UOJA 5I23A 1A5NC 4AVFA 3ME3A 4C6MA 3AHVA 1Q63A 3WUBA 4QJ1A 3SFKA 4BY3A 2C16A 3C2EA 4KRZA 1CXIA 4M82A 4JIEA 3ZR5A 4UMBA 2NV1A 4PUUA 4WJXA 5AYZA 2ABBA 1ZJBA 2EPOA 5CJ5A 4ADTA 3ZR4A 1CXEA 3QGVA 2X2GA 2Q02A 5BZAA 1SO6A 2PLCA 3B03A 1X1OA 3BW2A 3TJ4A 4XWUA 3WDIA 3G3DA 4O18A 1G1YA 1LLZA 3R4IA 1PHQA 2DDXA 5BOOA 4X9YA 2CWXA 3FS2A 4WVXA 4AVOA 4Q8WA 3VFCA 3P2VA 4C6OA 3S9IA 3SO7A 4JCLA 2Z1SA 5ABFA 3GAYA 1JGMA 1RH9A 2XG9A 3GU1A 5E6ZA 2PDWA 1ICPA 4MB4A 2ZA1A 4UR9A 1WXJA 5D9OA 1CXFA 2PBGA 2D2GA 1JIBA 1XGZA 1PZ0A 4V1YA 1S39A 3N6HA 3OQEA 3GVGA 4NZ1A 1PYMA 3W1LA 4N6EA 3WCZA 4J27A 4P7QA 4K6AA 3CTLA 5BNKA 4PN2A 1F07A 1IV8A 2I16A 3RLHA 1GHRA 4W7UA 1I2RA 4V28A 3M5VA 5CZ0A 1GHSA 4DLFA 4EKJA 4J2MA 4LVDA 4JTJA 3P6LA 3GU9A 2A3LA 2DW7A 3QV9A 1OADA 2ISDA 2Z1VA 2WCGA 4QGCA 4ZOEA 4V2XA 2GVJA 1NAL1 2QGHA 1XSIA 1WX0A 3GWQA 3I6RA 5HUOA 1WZMA 1IIHA 2A3CA 3WDRA 3KHJA 2VUYA 4W8AA 1R9ZA 1ISVA 4B5VA 3OEXA 1YYAA 5MKGB 2OGJA 3GDTA 1Q7ZA 1PWMA 1OYBA 3QFEA 1BXNA 1VPXA 3KDNA 1HO1A 3V16A 1G4EA 3EB4A 1OZMA 2BGNE 1TKKA 3NWRA 3GBEA 3PBGA 3TUUA 3F7JA 3I68A 4M6UA 3G0XA 4TX9A 4UTHA 1ME8A 1IZJA 3BOXA 2J9YA 1Q8AA 2OOGA 4D8AA 3K1GA 1PO9A 4WSHA 3WD1A 4H8VA 5CPSA 1TQXA 1Z69A 2ZUVA 4LAUA 4PMQA 4AD0A 2Y61A 2VFFA 1EBHA 4UNLA 3MV01 1PS9A 3C0LA 1V4YA 1ADSA 3SQLA 3UESA 3OBAA 4GYKA 3LB0A 4J9JA 5IRPA 2VYOA 1JL8A 2OMAA 1PAMA 3FNDA 4UMAA 2VGIA 3TJXA 1RP8A 1EHAA 3MP3A 2AQOA 4H8NA 3DHDA 4OGZA 2GDVA 3B0VC 4XKYB 2BHYA 3U5YA 3WD3A 1XLJA 3WELA 1FXPA 1UPMB 2A2IA 4GKTA 1AW5A 1PL9A 1V7YA 3PG9A 2WSYA 1JAEA 3Q37A 1I2OA 2HK0A 3PZUA 2ZRVA 4LGXA 4J3VA 3BW4A 3KOXA 1KLYA 3QY6A 3HBLA 4M1RA 5HNUA 4GX9A 5EPDA 1UP0A 1GVOA 1BF2A 4R7OA 4DYJA 1CBGA 3N18A 2CXEA 3DFSA 5AVHA 3K8MA 2NQHA 3EOLA 3ANUA 2VRQA 4H3DA 3BCFA 1M9HA 4D2JA 3L65A 1QBAA 3A5FA 2D0HA 4X60A 1SO4A 4A22A 4LANA 2D2OA 1V6VA 4WOQA 4LAOA 1TWIA 2VRKA 2E7FA 1ZCOA 2XJ7A 3G77A 1XCXA 3ZXWA 1A50A 3MHUA 5A1AA 1BSLA 3WF1A 3FJLA 5BRBA 4CQCA 1V0LA 3BMWA 2OCZA 2O0TA 3GDMA 2WC7A 2IQ0A 3I65A 2WMHA 4PTDA 1ADDA 2QCGA 1NDYA 4O14A 1VFHA 6REQA 4N7QA 1OB0A 3FY1A 3FDGA 4M1BA 1PHWA 2IKHA 4HU8A 4UTIA 4MWAC 4HNNA 1AQMA 1H7XA 4F2BA 3TP4A 4DO7A 4JBRA 3ZJ6A 2C3ZA 5AY7A 4M80A 1PPIA 3ZR6A 4KWOA 3PTKA 2NZLA 2WPGA 2INFA 4RDVA 2DPEA 2ABAA 4PZVA 1OX4A 2JF7A 2C71A 4AHOA 1I75A 2HNHA 2VFDA 4DXXA 1PDZA 3MCMA 3VC6A 4JY8A 3R25A 4IWWA 1OGGA 3NAVA 1FWIC 4PMJA 3SDOA 3OGRA 4JTUA 3WMLA 1PKNA 3AXIA 3BJFA 2OB3A 1ZENA 2WC3A 1ZNNA 1J9YA 2XYLA 4LC6A 1ISXA 4DJEA 4JIRA 3EEGA 2J7BA 2XN2A 4GZIA 1OYCA 2OODA 3L4ZA 2OSXA 3MMWA 3D46A 1ONWA 3HQOA 2CC0A 4GCXA 4Z1YA 1E4IA 2P5NA 3FW6A 2Z24A 4LS2A 2E09A 3LUTA 4B9ZA 1OFOA 3R13A 1FKWA 4GC3A 2ON3A 1C7TA 2ZA2A 4I9AA 2DP3A 1UBSA 3VOFA 2EG6A 4KMQA 1F76A 3OHMB 1QT1A 4KFPA 1N8WA 2TRSA 5F1UA 3B8SA 4ATLA 3R43A 4QBXA 1XBVA 1EA9C 4LBRA 4XTIA 3THAA 1HIZA 1M7JA 1VFFA 4M5PA 1E6ZA 6PTDA 1ICSA 3FAXA 3SAZA 2ZRZA 4QLJA 3WBAA 3FEQA 2XH7A 3BZGA 3RCMA 3HGJA 2J24A 4LB3A 3GXMA 3WBXA 1UG6A 4I5RA 4PTVA 2YSWA 3V0SA 4S3DA 4DWSC 4A3HA 4XAFA 3S6DA 1VFOA 4A8LA 3PULA 1JDEA 3CLWA 1ML1A 3WNOA 3I3EA 1LQ0A 1U33A 1ZAIA 4ZFMA 3SCQA 3UXAA 5K7JA 5DMMA 1AL8A 3T07A 4UFHA 5BWFA 3NEHA 3H8AA 4IMCA 4WR3A 3ARYA 4IFRA 3B0UX 5I09A 3BAYA 5I3HA 3ZSSA 5D2WA 3NR0A 1Q66A 2VCCA 4MOZA 2V30A 3R7MA 1KR0A 3UP8A 1WA3A 3CL6A 3R8HA 4NQ1A 1R2SA 3SQMA 3TSDA 3WUGA 1CIUA 4KCVA 4S1FA 4MG4A 4WSJA 5FJUA 3APTA 2V82A 3DGBA 4KPLA 5LNSA 1TMHA 3EXSA 2GUBA 5EGRA 1XL9A 1FWAC 3UF9A 1A4MA 2QCNA 3CU2A 4L1WA 1IE7C 2OT0A 3SUUA 3TMLA 1Z7AA 1A3XA 2ISWA 3LS9A 3SBFA 3PZGA 2F8QA 3GTIA 2HS6A 2DSKA 1FCUA 1WDPA 2J75A 2X1SA 2ASHA 3FFSA 2YXXA 2AQVA 4I5XA 3ZS4A 4BQ5A 1EGVA 4CCDA 3DIPA 1KA9F 4L80A 4UFJA 4TO8A 1LQAA 3LHUA 5AHLA 5CSRA 3G24A 3WFAA 3HG2A 2NUXA 3CJPA 2H8ZA 3CUXA 2ZUWA 4GNJA 3W00A 1TO3A 3DC0A 3N12A 3AC0A 1E9YB 3WUFA 4JIHA 1X8CA 1SYTA 3CV7A 4X0VA 2PI6A 2WNNA 3L4XA 2QEZA 2QHAA 1W1TA 3BAIA 1CZ1A 3WH6A 2X0SA 5DY3A 2NX3A 5K9XA 1HX0A 3MSRA 1P1XA 1PKLA 3PNZA 3NL6A 1ONEA 3SZ8A 3AAMA 1R46A 4MUPA 2AAAA 4WHBA 3BOFA 3WK2A 2QULA 2JFEX 4OVXA 3SI9A 3LMZA 3QKZA 1BTMA 2E5BA 4I9MA 4K39A 1QCWA 2ZADA 4D9PA 1KXTA 1I4NA 3I7RA 2GFTA 3LX9A 1EB3A 1UR2A 2HE5A 4ZCWA 4YYFA 1DJNA 2D24A 1JUKA 3FLUA 4CN4A 4PTWA 5CG0A 2PU0A 2VR5A 2FZ9A 4JZ5A 2RDTA 2OGYA 3EX2A 2W5FA 3H55A 1VP5A 3WLRA 4IFKB 5KZ6A 1PWLA 3PR2A 4C6JA 3QY8A 1HKMA 5TIMA 3O0FA 1PXGA 4PODA 2B31A 1UA3A 4ZQOA 4L4PA 1AW2A 1PX3A 2QCMA 5DRIA 4HSHA 4DF0A 5JH1A 4ZOAA 1VQTA 1QHOA 4IX0A 2A3AA 2ADAA 4ZSUA 3GTXA 4G1KA 1W3IA 4NJKA 1UC4A 4LX4A 2Y70A 1WXZA 1Q6CA 2H3DA 2NVCA 1Q65A 3VD3A 3NZ1A 1GEQA 1OCNA 3NURA 3CZ8A 2C7FA 2IS7A 2A3EA 1K1DA 1H5VA 3WQ8A 1VCVA 5JBFA 1W9UA 1JULA 1WKFA 3LCLA 3RMEA 3GH7A 5BRQA 3CNYA 4AF0B 2AGKA 5JQ9A 3PPGA 2JKPA 2MNRA 1O68A 2DZBA 4UTTA 2PWFA 2J27A 5FSEC 3JUGA 1RK6A 4YPJA 2G3MA 2PDIA 1KFKA 4MM1A 4UR7A 3ONBA 3M0HA 5BXPA 3C2OA 3H6OA 3R89A 1CCWB 1ZUAX 2VX5A 1KXHA 1XXXA 2Z6IA 2RJHA 2UY2A 4Z0SA 1OYAA 2O56A 2YCLB 1DE5A 4UB9A 2GQ9A 4C7DA 4CU6A 5KZEA 5CG7A 2W63A 5EFDA 4FOJA 4QE5A 3H53A 4HSNA 3RJXA 2ZZ5A 2HTMA 1XYZA 5IM51 2GVEA 1VB9A 3F4DA 5J5RA 1PIGA 2BV9A 5I0DA 3UG8A 1YE4A 1J10A 2BSLA 2C8NA 3W7JA 3M0YA 1MFUA 3UGVA 1K9EA 2G37A 4GQQA 2VFEA 2VC9A 2DEPA 4AZBA 5BWAA 4HN4A 3QW4B 1BQGA 4J3UA 4M8UA 4E4FA 2BOGX 1JG9A 3C8NA 3CB3A 3LDVA 4ZO6A 2D3LA 4I5UA 3RX4A 4IIHA 3MU7A 5ABHA 1GZ1A 5ENLA 1OCJA 1UWRA 1OD8A 5LIWX 4PULA 1A5AA 1IIGA 3H2NA 1ECQA 1LM1A 1MEIA 2XN0A 1EJUC 1XLDA 3QHNA 4DUXA 4HN8A 1UR8A 1GWJA 3OYZA 1TPVA 2YA0A 1VRXA 3LGEA 4JY9A 5GNYA 4DZIA 2PWUA 3PAOA 1FP8A 2W4XA 4LJ3A 3NQMA 4E3TA 4RDYA 3T2QA 3EA1A 2Z00A 4ZQRA 3VYLA 2KAUC 1MWOA 3IUHA 3R79A 1KBBA 2RGLA 4C1NB 1PKYA 1Z6KA 3TSBA 1Z89A 2D2HA 3T44A 4R27A 2OO0A 4M7SA 2VD8A 3T1GA 3FVDA 4QROA 5D33A 1OJXA 5T8GA 1W0MA 5LIKX 3AIEA 5D2YA 4J3SA 3UJRA 1M04A 2XH0A 1CI1A 1OM0A 1RY0A 3WQFA 5E9XA 2CLFA 3SUVA 3LK6A 2YLAA 3CPUA 3VD5A 1XYMA 3L4VA 3B06A 4R5EA 3IRSA 4JIQA 5DMYA 1LG1A 2AQWA 1B90A 3WZ0E 3KX6A 4QG6A 3UEQA 3GW0A 1V6XA 3L21A 1LWIA 4PMVA 1J0HA 1WUFA 5HAOA 1V02A 3VKAA 3ITYA 3EWXA 3N2OA 3WJWA 4CNSA 1GVQA 3ZFHA 3QPEA 3WENA 2WV8A 4O11A 1TVPA 4JXCA 3U2ZA 2QJNA 4XZBA 1ZRQA 3CH9A 2ZUTA 3TAOA 1DORA 3BTNA 2J13A 1UH4A 4D6EA 3LCIA 5KEZA 4H01A 1ALDA 1RPXA 4QE4A 3BLIA 4B2DA 5D2TA 2WO5A 1VC4A 4HVXA 3ID7A 1TV4A 3H7UA 5AB3A 3Q2DA 4ZL1A 4WK9A 3TR2A 4RPQA 3GNDA 1KM3A 2RDWA 3KM8A 2PDNA 3OA3A 2Y62A 5AFDA 4JNMA 2DSUA 2YOCA 1EZWA 1UMLA 2PU1A 2OPJA 3T55A 4WQ6A 2VEIA 3N15A 4GXPA 4ROPA 2DU2A 3M0XA 3I4KA 3TU9A 1L8NA 2CZVA 2V38A 3OU8A 5AYYA 5M1TA 1W3LA 3BUVA 4R9OA 2OG9A 3UWUA 3N73A 3CUJA 1IT8A 2G8ZA 1DQXA 3HGSA 4WKFA 3C2RA 1TJ1A 2RDUA 1UPPA 4DRSA 2J7EA 1C8QA 2IW0A 3GU2A 5EKYA 1UZ4A 4P8VA 1E3XA 1OFBA 1KWKA 3MANA 2NV2A 1NIUA 1LOLA 4IGNA 1I60A 2E25A 3U6WA 3WLTA 1HL9A 1V3KA 3PM6A 3N3TA 1UOKA 3O05A 4HKPA 3RM8A 3TN5A 5HXMA 5C9UA 1GW9A 1W8SA 1LOSA 4NZCA 3MWAA 4KS0A 4LNYA 1D7FA 3DH7A 4AX7A 2BGQA 1E73M 3MJMA 3POCA 4B5TA 2PDGA 2QS8A 2XH4A 3VGFA 1JYVA 4AD3A 4GVHA 3MO7A 4OOUA 4QJ4B 3KOZA 4JQ4A 2WYSA 5GNZA 3ZVHB 4J3ZA 1CGYA 4GG9A 2I5QA 2G3FA 4M24A 1UD4A 3CGTA 4L5ZA 1ZTVA 2YB4A 2WXDM 3WQOA 1NQ6A 1XLAA 3LQLA 1QOQA 4ERAA 1F6KA 1XYCA 3GH4A 4WF7A 3UETA 2YL8A 3BGJA 2BY0A 3ISIX 2EGZA 1GKQA 1YDYA 4FHAA 3M4HA 4WEVX 1C91A 3VOJA 3MUAA 3ZJ8A 4JTQA 3SCNA 1JUBA 3EB2A 4S2CA 2P10A 5DT5A 3UW6A 3H12A 3WD4A 2HK1A 3W72A 4PMZA 3GM8A 4DM1A 4PUWA 2GQ8A 3E0WA 1QPRA 2VHLA 1RJRA 2VGGA 1M7PA 3UXIA 2ISFA 5E6YA 3U4AA 1FHVA 3IV8A 1I8JA 2G50A 5GJNA 1GGOA 4LB4A 3BG5A 4TR9A 1S5NA 1U2YA 5HQEA 2Y7GA 1TV2A 3BL3A 1LP6A 2AL1A 3LOTA 1R3SA 1R47A 1SQ7A 3UCQA 4JQAA 1N2VA 4KERA 1W5NA 4LSBA 2VKZG 2QF7A 2ZXQA 2PS2A 4H9UA 4XO6A 3R8GA 3C5QA 1RJPA 1FWFC 4FR1A 5A6JA 2PURA 1K9FA 4RDZA 3UU0A 4QLLA 4FX7A 3KZPA 3S2NA 1G7VA 1P0NA 3TYEA 3CWOX 4N02A 5A8QA 1BKSA 4MNKA 3A12A 3CO4A 5FJRA 3W7KA 3W74A 1ITCA 2AGTA 4JFWA 4HK5A 4KKXA 4UTUA 4NX0A 1LBMA 2WHJA 4J1OA 2BB0A 2P88A 3U48A 3VIJA 2UWFA 4S3BA 4H8HA 4YYCA 3CXOA 3MP4A 1J4EA 2OU4A 3IK4A 4GZ7A 3VI2A 2V2DA 1W3JA 2OZ3A 4PB5A 5KETA 5A5WA 1BYDA 4QS6A 2VX7A 2WJFA 3S5SA 4HYRA 5D38A 2ODOA 1J0YA 1MQPA 2ACUA 4KH2A 4US6A 2Z1BA 3L5LA 4O4VA 3RGTA 4CNTA 4GO8A 2PRHA 3VMNA 3GY1A 8RUCA 3GR8A 1XDLA 1GJWA 1E4MM 3HMJG 2O9RA 3A4JA 1V0MA 3NXLA 3D5HA 3EWBX 4G7FA 4NAEA 1JZ4A 3AMCA 4QFUA 3SCSA 2HXUA 4Z2JA 3ABQA 3FDKA 3VE7A 5DMLA 5H8UA 3HJZA 1E15A 1POKA 3E38A 1XUUA 3H7VA 2P0IA 1FWBC 1S2TA 2NQZA 3W73A 1V3JA 4PCTA 1HL8A 1W5PA 2C14A 5DFAA 4BWLA 3WY1A 1KXVA 1GCYA 2CZDA 4LV9A 4GX8A 4D1IA 3XISA 5EY5A 3CS2A 4CVUA 4KGLA 4ZSTA 2QCLA 4JCMA 1SR0A 3PBYA 1XLLA 2VENA 3AJXA 2V5JA 1KFCA 3GTFA 3C2YA 3RAOA 3WQVA 3WQ4A 1UWTA 4BF7A 3LNMA 4YVPA 2C19A 4CKQA 1DPMA 4GWEA 3ICJA 3AIQA 1KXQA 1Z8AA 2QIWA 4DIAA 4IIDA 4MYXA 3EOOA 3PSVA 3TLLA 1J96A 4E4UA 1XIGA 2GOUA 3VOIA 4LRTA 3UXLA 1FX6A 3LERA 1EPVA 4H6KA 1P1MA 4PUKA 4HYVA 1H41A 1M7OA 4TXEA 1OF6A 3S5NA 4E2BA 4UOZA 1FWDC 4PCFA 2J8FA 4NYYA 3NYZA 1FQ0A 4A3QA 3SSZA 3MUXA 4C1NA 4HU0A 4JTHA 1OT1A 3KTSA 4XZMX 3UG5A 2GDUA 3MW7A 3GXPA 1AQ0A 2QMJA 3B40A 4B5XA 4ZO9A 2B7PA 4IUGA 1WE5A 2WSPA 2ISVA 4MB1A 4PE8A 1CB7B 1JYWA 2CFFA 1SZGA 3TQVA 4HHPA 3JZUA 1UC5A 1DWGM 2DY3A 4H9TA 2QPSA 5AZ0A 1OQFA 4FLRA 5H2ZA 3CPGA 2ATSA 4D6GA 1H11A 1B2YA 2VR4A 2ZC1A 4ES4A 3LHZA 5I78A 3HZ3A 4AZIA 4AISA 1M68A 1Q3NA 3JRKA 1FHLA 1Y0EA 4GFSA 3RR4A 1CGTA 1F8IA 3HV9A 3K46A 4O8AA 4UNKA 3NG3A 3WN6A 1GNXA 2W61A 1OABA 4NILA 2QCCA 3L67A 5HDRA 2E1WA 1PKMA 2YBTA 1PX4A 4AWSA 4B4FA 3RO8A 3ZM8A 1RQEA 3GFZA 2DQXA 1RJQA 4HMNA 1BF6A 5CPNA 1N8IA 3LENA 4PEEA 1AQHA 2Z2BA 2R1KA 5JBDA 4NF7A 2GQAA 4CNPA 4HK7A 3DBNA 5I3DA 2XVLA 3BDKA 2QCDA 3RYSA 3KAOA 1LDCA 4BZYA 1XYLA 2O4MA 3TTYA 1THFD 4ZOCA 2Y2WA 2EPNA 3DYOA 1QUMA 3IARA 3NQEA 3IIXA 4IP4A 2I9EA 1V5XA 4ORMA 1CYGA 4W7VA 1TX0A 4L9ZA 1PTAA 1NOWA 1FKXA 4NZ3A 1TG7A 3H4WA 3O06A 4ZQCA 2BXYA 2WMGA 1IWPA 4NI8A 5M5DA 1UIOA 4JDBA 4FEZA 4R53A 1ECEA 4XQ6A 4NZ4A 1KKRA 4Q4SA 5B80A 3Q58A 1UWSA 2DV0A 3UWYA 4Z08A 1L9WA 1H0IA 3WQ6A 3N9RA 3MMDA 1ME9A 2HDJA 3ALGA 1XCWA 3LI1A 2O92A 3N2CA 4OECA 3WMCA 4UTWA 5AVNA 3SN0A 3T08A 2ZDSA 1VKFA 1FWNA 3GDLA 1QMLA 3SGZA 3M7WA 4KQNA 2I14A 1HXJA 1H50A 4W93A 2GJNA 2R1LA 3QMRA 1FWTA 1UASA 3P7YA 3W26A 2NV9A 2J66A 1OCQA 3HPFA 4F8XA 2OT1A 3HM7A 4BI6A 3AYTA 3KS6A 3KBSA 4NZFA 4BQ2A 1AUSL 1DJHA 1G4TA 2EEXA 2DVXA 3K4AA 4ZQNA 3USBA 7REQA 1FP9A 2WHMA 1X97A 1RCQA 3O2LA 1XGEA 3W86A 4FAMA 1XP3A 1P7TB 4W85A 2OWWA 1GVYA 1P6WA 4RW3A 1XG3A 2EPHA 3WBYA 2FB3A 3M41A 3DCPA 1OC6A 1Q7MA 4ZQPA 3L5AA 1RR2A 2OQHA 1W5QA 3T0CA 2NWRA 4GUHA 3GHRA 4US5D 3OLGA 1G6CA 1V51A 3O07A 1CGVA 3CQHA 3BXWA 2NVDA 4QJ3B 3M0ZA 1LF1A 4NSBA 1QW7A 1PVNA 5C70A 3VX0A 2NX9A 3ALFA 3CQKA 3UYIA 2JKEA 4PUEA 5CLWA 2KX9A 4HHLA 4FOKA 4QSHA 3NGFA 1GQLA 4N6FA 4RZ5A 3EWDA 4AU0A 4MLRA 5A3HA 4UOQA 2YR1A 3ZLHA 2VMFA 3WH7A 3VFLA 4NYUA 3OZMA 2JEPA 1DQWA 2QVNA 2EKGA 1UR3M 4LBUA 4MADA 3TFXA 1YBQA 1AJZA 1S5MA 3FJNA 4B91A 3NA8A 5EMYA 3STGA 1XLHA 2RDXA 5EMLA 5EMMA 5E0CA 4E6MA 1GZJA 5F4WA 5A69A 1FHUA 1S1PA 1W1YA 1OCBA 4L64A 4Y8EA 4E2OA 3LHTA 3SJ3A 3E0FA 1F9CA 3LHYA 3BGAA 5A8PA 1KTCA 2CBJA 4PMRA 4Q8NA 2RGMA 1K6WA 1QR7A 3TQKA 3U0HA 4IIBA 3AXKA 1G7UA 3IUDA 3K13A 4KETA 2GJRA 3KL0A 3UVIA 1QWGA 3GFYA 1Q6GA 4MPQA 3NL3A 1UWAA 3TYDA 2VJXA 1UA7A 3FJ4A 3EXTA 3IJDA 4Z0JA 1VFSA 2A79A 2ZIDA 3DI1A 5BU9A 1MDLA 3Q94A 4WZHA 4C6FA 3VIHA 4AD1A 1RCXB 5H91A 3TN6A 3QBUA 4OBTA 4JOMA 1TYGA 2I5IA 2Z2AA 1KQYA 1VBGA 1W9VA 3MKVA 3IJ7A 5HJYA 3JZEA 1UCWA 2NQJA 2DT1A 3O16A 2QYGA 1E1CA 2WM1A 3QZEA 2VZUA 3NO1A 4UQDA 2YA2A 4WGXA 1Q13A 5CZKA 1B3YA 3HU7A 4HTYA 1R9YA 1VHCA 2JQXA 2G4JA 4GRSA 1KFLA 1MW1A 4PBFA 1QASA 1QNQA 2WNWA 2NXHA 2CWNA 4NZJA 4WGHA 3DBPA 1UD3A 4MHBA 5D9NA 5T9BG 5D30A 2J47A 4CEUC 2GJXA 3COTA 5FEZA 2V2CA 4Y9PA 3V75A 2Z27A 1ZBVA 1AL7A 3PSWA 4R85A 2B81A 1RVGA 2WC4A 2VC6A 1SFJA 4OU1A 2ZRWA 1EF2A 3I6EA 3HPZA 3R11A 2QV5A 4DJFA 1M01A 1SZEA 2FB2A 3DAQA 3GXDA 2JE8A 1XBYA 2B4GA 4GYFA 1KV8A 3MUIA 3F4WA 4MNLA 1DJIA 1TA3B 3RN6A 5GQBA 5CH9A 3F5LA 4M0XA 3UWQA 3NZPA 3G1RA 1NFBA 3RU6A 5CZSA 2X0HA 4ROQA 4GGHA 1LG2A 4HA1A 1L6GA 1PDYA 4JTAA 4TOQA 4ZVJA 2ZE3A 4K38A 5JH2A 3DFOA 4C6QA 1XRSA 3RMJA 1FHDA 1S2WA 3DYPA 1UZHA 1JZ8A 3IAPA 5F2IA 1W3NA 2J9XA 3ARQA 4W8BA 2LLEA 4D6CA 1H7OA 2WOQA 3TE9A 3EDEA 3ES7A 1F74A 3F4VA 3AIWA 5ABEA 1IXQA 4XBKA 2Q6ZA 3MB9A 1Q4WA 2DFAA 1BAGA 4XVEA 3OVQA 2BXVA 1QNRA 3MP5A 2BXZA 2GK1B 2QCEA 3DDMA 3NOEA 3HGRA 3IIPA 2X16A 3UPMA 1N8FA 5GNXA 2YCKX 1KTNA 3BZJA 3A4XA 3E0VA 5AC7A 2WSQA 1S38A 4CLMA 4JN6A 3ITTA 2J8TA 3OHIA 4KWSA 3S6OA 2ZC8A 5EA9A 4MWAB 2EPMX 5I79A 2VL4A 3M6DA 5FJPA 1ZLPA 2OWCA 3VK5A 3SGGA 4FXFA 3KBWA 4HU3A 3SSJA 1A47A 2XFFA 1ZBKA 2A7RA 2BG5A 3U8GA 1DYSA 1PB0A 2CBIA 1XRFA 3CHDA 1DHPA 1CB2A 5HWNA 2DZPA 1P6CA 1PEZA 3LBOA 3IJQA 3T78A 1EBGA 3RNDA 2PODA 3U3HA 5FF2A 1W1PA 5T9CE 4N9BA 2VCBA 3BICA 3C3UA 2RJGA 3MUY1 5JUVA 4PMUA 2PLKA 3EDDA 3GLCA 3BK0A 2W79A 3CASA 3KTXA 3QV6A 4U2YA 4EIVA 3VIIA 2HSAA 4XO7A 1AD4A 1TR9A 3LA4A 4UQBA 3CV6A 2Z4GA 4JL1A 3VM7A 5C2GA 3PBMA 4O1DA 2P0OA 3EXRA 2YCEA 4S23A 4MY8A 3SURA 1JD9A 3VD7A 4JN7A 3G18A 1MYRA 1NFPA 4Y6GA 1XSJA 2VEKA 4M19A 3P0XA 1K7FA 3NPXA 1XIFA 5AHFA 1LBLA 2GL5A 4GD0A 2PPGA 1C8XA 4H41A 4Q4OA 1F4AA 4NNCA 1CPUA 1DQUA 3VGGA 1DXEA 3MYOA 1RA0A 2ACSA 4L61A 3NO5A 3HGOA 1EXBA 3S5ZA 4S3AA 2WVSA 4QIUA 1HL2A 3L2LA 2RHGA 2HVOA 3RU8X 4DWSB 4CD6A 4HCDA 4FNTA 1KRBC 2NLYA 2FVLA 2XTKA 1NF7A 3VU2A 2Y5EA 1IT0A 1LJYA 2Y0FA 4LUTA 1K77A 4B16A 1B5TA 4LY8A 1P7TA 5IDIA 3T0DA 4GA8A 1WOBA 3M5XA 4FMVA 2MUCA 3S42A 2C79A 3MI2A 3O15A 2POZA 4M3PA 1DJYA 2BX7A 4AC7C 4DJDD 1KFEA 3CWNA 4JYEA 1PX8A 4R7WA 5M17A 2WBKA 5H6HA 4EVZA 4I7WA 3W7HA 4G5DA 5E93A 2Y8UA 4HGXA 1LQ2A 3W7NA 4HMDA 2L5HA 3OIHA 5K4ZA 5AYBA 2I9UA 1OBAA 1SUXA 1LYXA 5LIXX 1S2VA 1PJ9A 3G0SA 1TV7A 1K9DA 1JDCA 2F7FA 5JIPA 3E6EA 1TIWA 3MSGA 2QKFA 2HWGA 5F7UA 4YWIA 4WOZA 3ZWSA 5EMJA 3SADA 4F0RA 1UROA 3GTHA 4DYKA 4DI8A 1SW0A 2W92A 3BV7A 4R33A 2A6NA 1I0BA 1JDDA 1FFQA 1A3HA 4FOUA 5DLCA 1P0EA 3SY5A 2POTA 1VYPX 1QO5A 2YPIA 5DX7A 5BMWA 2GWGA 2WMIB 1ODUA 1Q2RA 5A8OA 1MZRA 1HUVA 4D6HA 5A6MA 4POCA 1TELA 4PUMA 1B9ZA 3INPA 2ZUNA 3LCGA 2FH6A 3QQ0A 2FJUB 1A3WA 4Q7IA 4N9DA 3N19B 3GVWA 3NL2A 3IANA 3WJXA 4NJGA 3T9PA 4AZCA 3A5VA 2WZMA 1JFXA 1P0DA 4H9ZA 1FOBA 3GBDA 1VS1A 3H26A 1JZ5A 3W81A 4GLEA 4J7RA 3L9CA 1UB3A 4DUVA 1YE6A 1UKSA 4F40A 8CGTA 3HMCA 4O1FA 1ZY9A 1AJ0A 5HINA 1XR2A 2Z25A 3AS0A 4YTTA 4NXKA 3SM0A 4RDWA 1JRCA 2VELA 3Q45A 3TZFA 3MCOA 2ZBTA 3Q65A 1W1IE 1I45A 1A5UA 2YW4A 3FCPA 1OC5A 1LLOA 3IIOA 4JTRA 2XIMA 4OIFA 4QSFA 1QPQA 4JX5A 3GR7A 1TJPA 1QNOA 4DPQA 4GCAA 1KLZA 2QUUA 3PFRA 4DVOA 1K03A 3CUZA 3M0LA 3T4WA 1ISYA 2GJPA 2WLYA 2XIJA 3PFMA 5HPCA 4NAFB 3FSTA 1FWGC 2CLMA 1CEOA 3SQSA 1Z32X 4BCEA 1EA0A 5I02A 1O60A 1W9DM 3H2FA 3HO8A 3HTWA 1JYXA 4W88A 4AB4A 2INZA 1YNYA 4AIEA 2OKTA 3MBDA 1AVAA 4LVAA 3AFBA 3S6TA 1XV8A 1JCNA 3JU2A 1PE1A 4AWTA 2BOFX 2E40A 3K30A 1E0TA 2J78A 5LNUA 3CIVA 2PZ0A 3WX7A 4YMZA 1GOIA 3H70A 3H7RA 3QOMA 2DVUA 4F9JA 1O94A 2F61A 3BC9A 3FX4A 3MPGA 1GVRA 1WBHA 2VOMA 3T42A 3DEQA 3SIMA 2QZRA 3W27A 4W9TA 1D9EA 1REQB 1VJSA 3KRUA 1UD6A 1E6QM 3VTRA 3GKAA 3NQ8A 1EWEA 3HPXA 3C0QA 1JPHA 1TA3A 2W3ZA 5E1QA 3AALA 4J28A 2X1IA 3WSUA 4DNHA 4S3KA 1P43A 4HHHA 3XIMA 5HJLA 1X7IA 2PWEA 1K8ZA 2WZTA 3QQ1A 4TV5A 2J9ZA 2R82A 3U7BA 3HPSA 3QGAC 3MMUA 1B31A 2WZHA 3BOLA 2DUZA 5GJMA 9XIAA 3WNKA 5AC8A 4OZOA 2E6FA 1VBRA 3L2IA 2V5LA 5A6TC 4JIIX 1ME7A 3DECA 3KVKA 1W91A 3A9IA 2ISSA 3ECQA 4DO5A 2VD9A 3GC4A 3DG3A 4LVFA 1E70M 5CPLA 8TIMA 4ZB5A 1KCKA 5BXTA 4GNVA 3LLFA 3IGUA 1EPXA 4RXFA 3GVRA 4MPKA 1FDYA 3UR5A 3UCCA 2GK1A 3TW6A 5FEXA 4UFIA 3PTDA 4L6DA 1F3TA 4QITA 5CPTA 3KTCA 4O10A 2JKAA 3FHQA 1WKEA 1XD0A 1HVQA 1OIFA 4B3KA 1POJA 1NEYA 5HATA 1O7AA 4AZGA 3KRSA 3CAQA 5FF4A 3NM3A 4MFDA 4IOTA 3N2TA 3R6IA 3NCOA 4J3XA 3W23A 5A6KA 2OZ0A 2IMRA 5MF5A 3AMDA 2GUYA 2VVSA 4XD5A 1OFAA 2R94A 3KBVA 3NSXA 3IJ6A 3L68A 1EJ7L 3TN3A 2F9RA 3GHUA 2C6QA 2PDBA 1EIXA 1ZP4A 1IXNA 1R3VA 3FKRA 2EPKX 3GX9A 5D02A 3QVQA 3FJ6A 4QDWA 1TR1A 2A85A 3A13A 4GI4A 1OINA 4C1KA 3H21A 4CQ8A 3U2EA 2UV8G 2E1DA 1B3OA 2X7WA 3RILA 2PDQA 3GXIA 3FXGA 3MDWA 1MFVA 1W1VA 3P5YA 2V8ZA 1Z41A 4GUFA 4NJHA 3RM9A 2ZX8A 1HTIA 4OTKA 1OG6A 2Y1HA 3PY2A 3W71A 4P2VA 1NWTA 1MW0A 2OWXA 3CYVA 3M5ZA 1VAHA 3UPWA 4BR1A 5HBFA 3SCWA 4O0QA 4WIWA 2VURA 4O0ZA 4ALDA 4E0CA 1X8FA 4UTFA 1EGZA 5BXSA 3U2CA 2Z7GA 3KLKA 1UHVA 3KOFA 2EAWA 5LA2A 4NRSA 2FTWA 1NQKA 1KCLA 1M3UA 4QDMA 4GVGA 1Z44A 4QJ5B 3UQNA 1J0ZA 3NFUA 4PTXA 4ZO7A 3CAWA 3GW3A 5HANA 1FH8A 1LT8A 3UZZA 3CWHA 4WDWA 4BI7A 4GYJA 4GI8A 3WG6A 4P5UA 1GYMA 5BYWA 3DERA 2QUMA 1JYNA 4LCRA 2Q8ZA 3B4UA 5B7ZA 2WKLA 4MF4A 4PTNA 4GINA 4EPBC 1OFRA 3STPA 2OVLA 1NY1A 2ONEA 3N1AA 1TRIA 4BS0A 1J18A 1WDWA 2PGFA 4A3UA 1KR1A 3THQA 1H49A 3PWGA 4C60A 4TIMA 4PFMA 2VOTA 4GBUA 4M6VA 2WQDA 3NQCA 4KGJA 4BEUA 2XUCA 2ALDA 4KBXA 1XCFA 1OFPA 4FIRA 4C6NA 4B90A 1UYQA 1XDMA 1PZ3A 4HQVA 3LTYA 1TCMA 4GC4A 7TAAA 2YIHA 1WUEA 5L9FA 2J8GA 4YHEA 3TN4A 2XU2A 4HPHA 3KZSA 3ZJKA 4O15A 3TWBA 1JCMP 2P8CA 4FA3A 2JK2A 2BHZA 2BY3A 4AIBA 2V5CA 3V5OA 5I7GA 2E8ZA 2OLHA 2DZXA 3PZMA 1J6PA 3PHAA 6REQB 1TPUA 2ZZ4A 5FACA 4GOAA 4OBRA 1V3MA 2E6YA 1P6BA 1O5XA 3EWZA 1AMYA 3ANYA 1B1YA 3S1UA 3THUA 3S47A 5D2VA 1TE1A 1LROA 2AKMA 3QV8A 3EA2A 2WKJA 3I7SA 4PMXA 4IQEA 1IF2A 3CK5A 1U1JA 5LXXA 3VIOA 3LNPA 4LCSA 3V18A 1XLIA 2I7GA 4EPDC 1OHLA 2WMIA 4L6HA 2H3BA 1EEPA 2PDCA 3PP7A 1Q6OA 1TX2A 2IQTA 4AG0A 3LM3A 5CBJA 1QPKA 2E5DA 5HR6A 1O5RA 3ZYZA 4KEVA 1JUEA 4PCPA 5I77A 4MB3A 1HG3A 4K1WA 4C1LA 1QNVA 2PSNA 1XIIA 1X38A 1BRLA 4CD7A 2CZFA 1YMYA 4Q6XA 2XHYA 3S9YA 3D6NA 4IQDA 5EL1A 3GFXA 3CC1A 3WH5A 4PCSA 1K8CA 1FXQA 3UWEA 1RLCL 1PYFA 1WQ5A 2HBXA 1IWAA 2R24A 1US2A 3OVPA 2DIEA 4CNNA 2G3NA 4UUIA 3SUSA 3LSBA 2VR2A 1MQQA 1AW1A 4XSLA 2W0UA 3WDQA 2AMGA 1D3CA 1UP2A 4B92A 4UQEA 4JPGA 5D09A 4US5A 4ZBCA 4CNOA 1E6PA 3QJAA 1F61A 1LCOA 3WLHA 3P82A 4AX6A 2W6RA 3H4XA 3DFNA 3DZ1A 2GGEA 2OYKA 2QJHA 2ZZ1A 2R1NA 1XJBA 3R8RA 4QR6A 2DQWA 4CQ9A 3UA3A 3LMYA 1E0VA 1AJ2A 4INFA 1DV7A 4NAFA 1IXOA 4Q4KA 1H1YA 1HJXA 1EFZA 3LCWA 1QAPA 2R6OA 2VFHA 3ITGA 5T91A 4BFAA 4HYWA 2A4AA 3MYPA 5FAJA 2ZZ2A 4KCWA 3BMXA 4LRSA 4ATDA 3PZTA 4Q8PA 3KL3A 3ZIZA 4NVTA 1XLEA 2A3BA 5FKYA 4MB5A 3DUGA 2GGGA 2A7NA 4I9JA 2CERA 2PRMA 4NZ5A 5D32A 3FHAA 3AXXA 3TWAA 3S1WA 4LH8A 4Z42C 3M1ZA 2F6UA 4JFUA 4GACA 4M7TA 2DUXA 4MLJA 1RV8A 3BSHA 4Q4PA 1EGMA 4WDUA 2D0GA 2WVUA 4BF9A 1BTCA 2Z1XA 4FF7A 2HNEA 2ZX5A 4KEZA 1BVWA 3SW6A 1NP2A 1M5WA 4JX4A 1REQA 1HVXA 4GQ0A 2PC4A 2G96A 1HKJA 4O0KA 4JS3A 4AXNA 5DELA 2WLZA 3W1PA 3V35A 1TWZA 3QOKA 4U3CA 5A2AA 1MRQA 3OYXA 4O17A 3LPFA 3UG4A 1N55A 4OFCA 2ZICA 3QR3A 1VEOA 4KWUA 3PZQA 1RCOB 2QUNA 1GG0A 2YW3A 3KLLA 1R87A 1IXPA 2IKIA 3TTEA 3PPCA 4Z1CA 1J0JA 2DSWA 2BBFA 1XQLA 1FCBA 4LYQA 1O12A 3CQ0A 3NGJA 2IPJA 3UJFA 1DTNA 1MUWA 2BODX 3W1MA 3PZVA 3D3FA 2VZTA 4AY7A 4S38A 1L8PA 1R6WA 1FWSA 3K8KA 1XINA 2ZUSA 5F2GA 2BP1A 3G1YA 3TYCA 3MY9A 3LRKA 4BK9A 4FO4A 3E49A 4CUCA 3V0UA 2YDQA 1Q6RA 2PEVA 4HOXA 2VDHA 3UNTA 3A64A 1MEWA 1FWJC 1GOXA 4IPJA 3W70A 1TV8A 3PNUA 1L2UA 1JD7A 1W1B1 4Z1BA 3VIPA 2V0TA 2YYTA 1GOOA 3VKCA 4E38A 2PZNA 2Y63A 4J5NA 1S2UA 1XM3A 5I00A 5BOFA 1A5CA 3CV1A 3L7RA 5HPOA 4K36A 2GYIA 2HZGA 3VZXA 4C6BA 4I90A 4X0NA 3S8HA 1HJWA 3NUKA 3QHOA 3LHVA 2Q71A 3MZ2A 3W7QA 3FVMA 1VYRA 4MAZA 4QP0A 4I3GA 1E6SM 2VQUA 3W07A 1NOFA 3NQFA 2YJQA 5A6SA 1XYBA 2PAJA 3A22A 5FA5A 3VNIA 4Q8VA 1W3HA 4CN6A 1X6NA 2W27A 4R7JA 3EB3A 1WAUA 1W9XA 1ZQ5A 4JIPA 3P80A 4QNEA 3M0KA 1A5MC 3PUGA 4EXAA 3ITVA 1QW9A 2A5HA 2YCJA 4IPNB 1EO7A 5I3FA 1AMKA 2WWCA 3B97A 4O8RA 2ZVIA 5CC7A 3W84A 2NW0A 4AWUA 3LN3A 3STCA 3GHTA 4YS1A 2OKOA 3BSGA 1TJRA 1YRRA 2FHCA 1XF0A 1ZFJA 4E8CA 3SN1A 1GVIA 1R3WA 4IF2A 1X6LA 3AIVA 4HB7A 4LYRA 1P0BA 1QATA 4DYEA 4K7VA 2F2HA 3DESA 1IR2A 4OE7A 2XM2A 2NSOA 1BPLB 2TAAA 3QC3A 3B3DA 4Z2LA 3DOPA 2C18A 5XINA 3NO3A 4KEMA 1YXDA 3UJSA 3RPMA 1DJWA 1L0PA 4N0RA 3CZJA 1BWLA 2QJGA 4NJIA 1UJPA 2BDQA 4K3ZA 4HZ8A 3OJGA 1GORA 3DXIA 4RNFA 2OELA 3ARVA 4JN8A 5J8LA 3W1RA 2C13A 1XIHA 3SB0A 4FPSA 2Y8VA 4XBSA 4KRUA 3UD6A 3VNKA 5LNWA 4IL2A 4NX5A 3BG3A 4HNTA 3STFA 1XX1A 4F0MA 1G0CA 1E56A 2WM0A 4GY0A 4QISA 4E2DA 3OVGA 4DUWA 3AYSA 5HOSA 3BG9A 3LGGA 1IEIA 1CDGA 5BCAA 3U7VA 3AMGA 4JR5A 4HOWA 4X61A 1VF8A 4Q6JA 3QLDA 2WZIA 3KBMA 2ACQA 4LF2A 5I03A 3MCNA 4LU0A 1ZP3A 4WY0A 3IAQA 5LA1A 1A5KC 3E0IA 1NP0A 2C1GA 1M65A 1HGYA 2XIOA 4O28A 4CN1A 2FPYA 3WH9A 5I5RA 1TWWA 1FDZA 5REQA 2J7GA 3C52A 2FFCA 4AMCA 3B05A 4IIFA 2JEQA 3SY8A 3A4AA 4RXGA 4A8NA 1XW8A 5CKSA 1UD2A 1HFBA 4W5UA 3W82A 4Z1AA 3VABA 1WKDA 4MKNA 2ZXBA 4DJED 3U57A 3UJ2A 3RM4A 5CSSA 4JAWA 3WNMA 4EXQA 3W7OA 1YEYA 4XB3A 1B3ZA 2VZOA 4DZ5A 1TPFA 4UFMA 1MVYA 2BMBA 3SY1A 1JRBA 2OTDA 3URNA 4F2UA 1Q6FA 3W7EA 3V36A 1H51A 3E5PA 1K8XA 3BURA 3MHFA 2VEMA 1IYXA 4IH3A 3VGHA 4D6FA 3UWWA 2NQLA 1EX1A 4N2YA 1LORA 4OUEA 4LPCA 2E67A 5I3KA 3VIKA 3RIKA 2YCIX 3OBKA 1V8EA 1KRAC 3BE7A 1DWIM 1E40A 6ALDA 4DJDA 1T8XA 1XIDA 2REQA 2PTWA 1K8YA 1DVJA 2OQLA 5SWUA 2F6XA 1NWUA 3K8LA 3QW3A 4FLOA 4IGSA 4DM2A 4I7VA 4MSSA 1BGGA 4Q8MA 1FVPA 3W4RA 2E68A 3AISA 4JNZA 1C9DA 1EJRC 4I8DA 1XIEA 1JCXA 1G4PA 5FJIA 6XIAA 1AH4A 3VILA 4K7YA 1CECA 3PK7A 5G4EA 4M51A 1YDOA 1QWKA 4RNHA 5HMSA 3OW1A 4E8GA 2VFGA 1MNZA 4AFYA 1BWVA 1BG9A 3NNTA 4FF5A 3T0BA 1D3GA 1XD1A 3G1FA 4ZOBA 3DFYA 1YTEA 2QCHA 2EG7A 2RH9A 5LSMA 2J25A 1OWQA 1V6YA 3PTQA 1ZBWA 1S46A 5C54A 4QQUA 3QQWA 2CLPA 3B0PA 1QRQA 3DG7A 3OBEA 3BLOA 1T99A 3DC8A 3PPHA 1IEXA 2C1HA 5F1VA 2PUZA 1JPIA 2DIKA 3DFQA 4FIQA 3NQVA 1D3HA 4GUGA 5CJNA 4IZGA 2QQ6A 1WZAA 3B0XA 3C2FA 3M07A 3UYCA 4FNUA 5LIYX 1EC9A 3M7SA 2GGHA 3OG3A 2DT2A 3VD9A 2KZHA 1RD5A 2R9RA 3FK4A 4AC1X 4EF8A 4ADUA 1TZ9A 1BFNA 3MBFA 1U30A 3RRXA 3NQGA 5D4YA 5F4SA 3M0VA 3VX1A 1W5OA 2OJPA 1TPDA 4P7LA 4YU1A 3G1XA 3UG3A 2ZOXA 2GSJA 3KCJA 4GI9A 4PTMA 1DEDA 4PYSA 1VFMA 3W1AA 9XIMA 3TYAA 4L4LA 2FTPA 2VXNA 4YIWA 5C2XA 3RCYA 3UJEA 3I3DA 1C93A 2FFIA 1VFLA 5G1YA 1IQ8A 1LT7A 2O9PA 3L4WA 4KFNA 3CL8A 4GO9A 2D3NA 1Z42A 5DRCA 2PRLA 3W53A 1I2QA 1IZCA 4NT0A 1WDRA 2XPKA 3GUWA 3CEUA 3S2JA 5JMUA 3S2MA 3IS4A 4LC8A 4L9YA 1PZ1A 4GYPC 1R2TA 3E1F1 4X63A 4J4KA 4NIRA 4W7WA 1J11A 2ACRA 4MMWA 1YADA 3P84A 2OEMA 1ONRA 4J40A 3GVVA 1G9HA 2UY3A 4ONVA 5DMNA 4JTLA 4NRRA 2CU0A 1OK6A 4DXVA 1TIMA 1Z3NA 2HVNA 3UBPC 3BPWA 3GNXA 1V6WA 2PWVA 1QBBA 3KP0A 4FNQA 4K8HA 4EWJA 4I9TA 2Z1KA 5XIAA 3E2QA 3I4EA 1TWDA 4Z2HA 4KFOA 3AICA 3EWWA 3TSMA 5FD0A 3BVJA 4BJHA 2H90A 3MZNA 1DIKA 4DHGA 2WJEA 4QAIA 2HJPA 3BQ5A 5LIUX 3W01A 1F05A 1QXLA 3BV4A 2I57A 1SZNA 1DJQA 3KWSA 4AD5A 4WDXA 4XBJA 4DBSA 3WLQA 2QXWA 2B0MA 4DWDA 4V33A 3LV6A 3ITXA 3AYVA 3WQ5A 5HULA 5FIPA 4U2ZA 4IMEA 3RPTA 1W1A1 2FZDA 4GY7A 3TR9A 3F2BA 3VCNA 1C3FA 4GVFA 2UY5A 3VGEA 1UKPA 2QGYA 3G1DA 2X1TA 1H7RA 4RL3A 3W75A 1VBJA 3WF0A 4ZEPA 3ZZ1A 3ANVA 4RCXA 4GH1A 1G67A 4XV0A 4AAJA 3TEVA 1GVEA 3UR7A 4MJMA 1V03A 2QAPA 3RX2A 1TTIA 3W25A 3N13A 4K68A 3LI0A 5TQLA 3W2NA 3MVTA 1TV3A 1WZKA 4URIA 4KRTA 3RHGA 4GHRA 3VPLA 3B9NA 2ZRXA 1JJKA 5A6BA 1K9TA 5AHMA 4OQVA 4DBUA 4TU1A 4JTIA 2IPGA 1M03A 1A0EA 1U1HA 5HUPA 1UIPA 1DIEA 3PB0A 5JIWA 3VINA 3HV8A 2E77A 4IL0A 1W9BM 4UXDA 4EE9A 1EHNA 2ESCA 1GJPA 1JPDX 2J77A 4NAEB 4W4QA 1WZLA 4GH3A 1UZDA 4GJ1A 3GC2A 1WOAA 4ZENA 3GVQA 4JTFA 1T7LA 2BVWA 2YB1A 3OZOA 4FXRA 4FR6A 3ZT6A 3BQ6A 4DF2A 3TC7A 1PBGA 3EBVA 2F6KA 3W76A 3NJ3A 4AZ7A 1S5TA 1XIMA 2ZFAA 2EO7A 4IG2A 1TPH1 3EKLA 3PPFA 1HKIA 3DENA 3AHTA 4LBSA 3W1TA 4YLWA 5FL0A 3CL7A 4S39A 5CBBA 2WMJA 2VGBA 4L4OA 5KZMA 2X1RA 4RE3A 3UERA 4GE8A 1LL6A 1R3TA 3FGCB 1MXGA 2G5WA 4UQ9A 1YDVA 1RSCA 3C0SA 1LRTA 2OXNA 3EMCA 4H6EA 4BI5A 2PP1A 3TA6A 3SUTA 3TTOA 1V3IA 2V5BA 1OFDA 1W1ZA 4OT7A 3CB8A 5K3VA 3H2CA 2CZ5A 2YL5A 1T96A 1GKRA 4BF5A 1VJIA 3BLPX 3JVAA 3GIPA 3LZ3A 4ZE4A 3BO9A 1UKOA 1W3KA 1DWFM 2NLIA 1WCGA 1BEUA 5FJTA 2X1UA 3BLDA 1V79A 3W7RA 4R34A 4HZ7A 5AC5A 1V77A 1RBLA 3WLMA 3B8VA 1A5SA 4FALA 1KCXA 2ZZ6A 3GXTA 8A3HA 3T0AA 1AODA 5BOEA 3MUZ1 4EACA 1RQHA 5IFPA 4S3GA 4UCGA 1YPXA 3HB9A 2FZBA 2DT0A 1YXYA 4FXSA 3VKKA 3TYZA 4WD0A 5CAHA 4PGLA 3QEZA 1H4PA 4K8EA 4GIYA 5FCZA 3P62A 2D69A 4RZBA 1F2JA 2DGAA 1RAKA 1E0XA 4P8UA 3WIJA 4KWVA 3WDJA 3ZLGA 2XDFA 2DH3A 4EAYA 3L2MA 5E9AA 1HF6A 3FXYA 1ISWA 2C1IA 4L6OA 1EZ2A 4JTDA 4B2DD 1ICQA 3Q67A 1LL4A 1CTNA 3WNLA 2X42A 1IT7A 1YKWA 3CMJA 3TZNA 4MZ1A 3S5OA 3M0JA 1R5YA 3WMSA 1E3ZA 2QPXA 1Q85A 2QCDB 3OGVA 3APGA 3FA3A 3P67A 3PN8A 1TCDA 5CGMA 2ZCGA 5DBUA 3UY7A 5CJMA 5AHEA 3TNOA 9CGTA 2H8XA 1R3YA 4MGGA 3D3AA 1HP5A 5IOBA 2Q8LA 3C3NA 1VPYA 4XD4A 1XUZA 4XD3A 4BEQA 1TZ7A 4JQ2A 4TUFA 3AU6A 1IWBA 1CX9A 2PWGA 4U10A 2WHLA 1SFTA 2ATMA 1NOUA 2CCRA 2BY2A 3BLKA 1QDSA 3B9AA 3VIFA 4FB7A 1F5ZA 3THCA 1W5MA 2WHKA 3ARTA 2G41A 2DW6A 1DP0A 3QMSA 3RF9A 2DZWA 4C7GA 5HR7A 3PUEA 1S3TC 3EX4A