5KG9B

Crystal structure of the gp120 v2 antibody re505-22 fab from igh- and igk-humanized mouse
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
218
structure length
218
Chain Sequence
QLVLTQSSSASFSLGASAKLTCTLSSQHSTYTIEWYQQQPLKPPKFVMELRKDGSHNTGDGIPDRFSGSSSGADRYLSISNIQPEDEAIYICGVGDTIKEQFVYVFGGGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody RE505-22 Fab heavy chain
publication title Immunodominance of Antibody Recognition of the HIV Envelope V2 Region in Ig-Humanized Mice.
pubmed doi rcsb
source organism Mus musculus, homo sapiens
molecule tags Immune system
total genus 44
structure length 218
sequence length 218
chains with identical sequence L
ec nomenclature
pdb deposition date 2016-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kg9B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kg9B01
1FNSH 3LEXA 4KHTH 3KPRD 4PRAB 2CLVB 3DJ9A 5IEHA 3T04D 3OKLA 1JE6A 4MA3A 4TPRH 1KN4H 2AXGB 4L4JA 2J6EH 2BNRE 3ARGC 3CX5J 4WO4C 1UH4A 1ORSA 3O41B 3ZDZE 4POZD 4S2SA 4WW2B 3SDCD 4YUEL 5FV1L 3IVKA 5K9OB 5EZLA 4XVSL 4UAOB 1S7SA 4Y2DB 1I1AA 5BS0A 2YS4A 2MSPA 4JHAH 2FWOB 5AEAA 2XKNB 1MJ8H 1S5HA 1OPGL 3F5WA 2BZDA 3SY0A 1VB9A 1U3ZA 3FT4B 1UZ6E 4EXKA 5JUEH 4DEPC 2X4RB 1YEFH 4KK9C 4OM0L 3FQXB 1RUPH 1R5IA 3P73A 3U7WL 5TDNA 1TZHA 3DPBA 5F6IC 1PY9A 1LEGA 3EDKA 3UBXG 2O5ZH 3QULA 1WUNT 1G6RB 4IRSD 3HFMH 1T6VN 1G0XA 4JPVL 1UB5A 2R1XA 4JFPA 5IIEB 2A6DB 3TYGH 1TJGH 3SDAB 4P2OB 1AGEA 4G6FB 1V8HA 2BCKA 2AK4D 1P1ZB 1S8DA 3RL2B 5DK0B 3F7QA 3RPIA 3SQOH 2A6KA 1LE5B 5FDYA 4M5YL 5HHPB 3RWEA 5EO9B 4OJFH 1M05A 4HWEH 4PJHE 4HG4J 2PTUA 2WUCH 5HHVL 1R0AL 4X6DB 1IC7L 2QHRL 2C7UA 5HYSG 4ODUA 1NEZB 4DFIA 2P5EE 8CGTA 1OAYL 5ABDE 2JJVA 1ITBB 4N9OB 1N3NA 4GRWE 4MXWL 3G6JF 1FL6A 3P11H 3B3IB 4N8CL 3DURA 1LNUA 5DJXA 5ESVB 3HPJA 3RY6C 5C08D 3OHXA 3QDJD 3R0MA 4HV8B 5FGRA 3TZVA 1MCNA 3C09C 4NRXA 4HLZH 3UJJL 3OZ9H 2X1PA 4N0FA 1VKXB 1MY7A 5BV7L 1H3PL 1S9XA 3HTLX 4DKDC 5DMKB 1F42A 4JRYB 2VLRB 4PB9H 3VXMB 3U4BH 3FTGB 3RWGB 1KXQE 3QB7C 4EDWL 3NZ8A 4NQSB 2OL3A 4HJ0D 5E94B 1R5VB 2Z4QA 3MJ8B 2AJSL 5D6DA 3FO0H 4PV9A 1S7XB 3I02A 4IJ3C 1K3IA 1TCRB 1Q0XL 2HWZH 1BQHB 2HJLA 5F1KC 1KTDA 1ERNA 1LHZA 4MXVE 4ZFOB 2UZXB 3BH8B 4U6YB 2WUBL 4ZXBB 1CFVL 3GSVB 5DEFB 1Q94A 4A6YB 3QUYC 4ZD3L 3MLTA 5A3ID 2Z31B 1OCWH 3OKKA 4GG6A 2EIZA 3KR3H 3T2PA 5ETUA 4ZQKB 4NHUB 5TDOB 4QHLB 2C1OA 1S7VA 2DF3A 4XRCB 1EFQA 3ELAT 5FGBC 2AJYH 1MCIA 3TFKC 3FL7A 3MUY1 4HF5H 3RWJB 4MMXC 3BRDA 1TTUA 5IQ9A 5ANME 1JGDB 1NDGB 1RQ5A 4OB5H 2O26U 4EZMA 1GJIA 1Z5LA 4G8EB 2GCYB 5GRZA 3BH9A 3CC5B 4WHCA 1Z6JT 5HHOB 3OTTA 3L3DB 4QT5A 3MLZH 1FO0B 1FJ1B 4X6BA 3MRRB 4DCQB 1K85A 2VDOL 1JIBA 3TA3C 4JFDB 1GGYA 3VE0A 3UTSA 5KVEH 4LPXA 2W0PA 3JZ7A 3GHBH 3ARFA 3HR5A 3Q0HA 4S11A 2RIKA 5D1QB 5D2LE 4RFEA 3D2UB 3MRNA 3QIWA 1NEUA 2QKIB 1FORL 1YY9D 5DRWB 4B53A 3C6LA 3WJLC 5DJ6A 4TTGA 2P8LB 4I48B 3ROLB 2VISA 4HK0A 1B0WA 5F71A 5DDHA 4B41A 2XXMB 2VDML 3HC3H 3P4LA 4JRXA 4XMKL 1X5LA 1G7LA 1KJMB 5CMAB 4L9LA 4OZ4B 3B9AA 5CLTA 2BVTA 1FDLL 2X89D 2Z91A 3BDXA 2VLMD 4OLXL 2P8PB 3SJVA 2L4OA 1IGJA 2NY5H 4MNQA 5IJKC 5IMOB 4GQ9L 1RUQL 1U8IB 4JN1L 4TVPL 2YWYA 4HIIB 2ID5A 2APXA 3K46A 3QZWA 5KVDL 3ROOB 4NN6B 4D0CB 1KCUL 1XFPA 2JCCE 3HZKA 3EO9H 4IDJL 4JN2B 1A22B 1FBIL 4P4KB 2VLKE 3IJHB 3BAEL 3QUMA 1NSNH 1HHKB 2R2HA 3G5VA 5DA4A 4YLQT 1UVQA 5HYJB 4J8RB 4QRRE 3KPOA 5JW5A 1JGLL 4E41D 1H5BB 1OD9A 2ED8A 4PPTA 1F58H 3QDGE 3SDDD 2AJXH 1N7ML 2IFFL 3LMJL 2XZZA 2X9YA 4AG4L 2GKIA 3K4AA 3HNVL 3MNZA 3OKOA 1YA5A 1CDUA 4OQTH 4AIZB 4GG8A 1MCCA 1P5UA 1QLEL 2GT9B 3EGSA 2FX9L 4NQVB 3LQAC 4U4BA 3N1GC 4XCEA 4ESKA 4GMSL 3L7FB 4PRID 1I8IB 4MJ5A 5GPRA 3S97C 4WEBL 1XR9B 5I1JL 2YPKA 1IVLA 1F8TH 1MI5B 1DDHA 4NFDA 4PYGA 3LS4L 5GZOD 4P2RD 5FYLD 4X6EA 3EYFA 2H2PD 5SWZB 3RTQC 4XZUA 4F3FA 2D9CA 1OP5K 1K8DB 3IAQA 1RZ8A 3EJZC 3UJTL 2YUXA 4G6KL 1MHEA 3RWHA 5H37G 5J7CC 3DSFL 2VWEE 2BNQB 4XNMB 1IAKB 3C5ZD 2JF1A 2ADIB 4GAJL 1I3GL 5CEXB 4AYFA 3KPSA 3KLAB 3CZFA 2XN9D 3JV5A 2ICCA 2Y72A 2Y7QA 4KMTL 4XNUH 4PV8B 1QR1B 2OJEB 2OSLA 1KOAA 4GRMB 1A7BA 5DO2D 3C9NB 4XXDA 4QHUA 5C6WH 2B8OT 1MPAL 2YEZA 1DBBL 3RL1A 1QO3B 2NY4B 3QEQD 4NJ9L 3DIFA 5FGCB 3C60A 4G7VL 4JY5L 5JHDA 1FE8H 2AV1A 15C8L 4M02A 1A2YB 1X6LA 1DLFH 1ADQL 3RGVB 2V9QA 4KI5C 3ARQA 4TQEL 3TO4C 3I6KA 5D1ZD 2GAZB 3QIUB 3TN0D 4K3EH 4OIIL 2R9HD 4HMDA 1R3JA 2GEEA 4PJCF 3JTSA 4JY6B 4Q6YA 2IFGA 4GRWH 4NO0D 4LLVA 5HGHA 4MX7B 4LCYB 5HPOA 5D2NB 5C0FA 1HNFA 2QV2A 5DEZA 2VDLL 1WZ1L 3FZUC 4XVJL 2J8HA 2FR4A 4GKNB 4JZJA 4UQ3A 3WDIA 5I8OL 1CE6B 2AXFB 3G5YA 4F7MA 3TT3L 5J13B 3GIZH 4CN6A 1OT1A 1P9MC 1Z2KA 2OM5A 2JB6B 5LKNA 4ODTH 4TPRL 3MA9H 1SEBB 4EN3B 3NCJH 3UC0L 4CMMA 1RIVL 2UWEF 4NRZA 1B0GA 5FO9A 2XWTA 1EEYA 1FFPB 4KTYA 3LZFH 3K1DA 1PD6A 1WIPA 4ZS7L 1T7XA 5EC2A 5SV3A 1FIGL 3FHAA 1DQDH 5F96H 3GK8L 1FN4A 1ZSDB 1U92B 2J4WH 3CMOL 5DD1L 1BLNB 4BELD 2VQTA 3MQIA 3PWNA 1BIIB 3ARDD 4LPVA 4NO2B 3GFUA 2C4XA 4PGDB 4XAWH 4JO3H 2O5XL 4EUPH 1XH3B 3EO1A 1YEFL 5ITBH 4YH6A 4JFQA 5T3ZD 4WJ5B 2F15A 3IDXH 1XF3A 2HJFA 4HK3N 3K8KA 2FDBP 1G1CA 5SWSA 3TNNA 1ROWA 5F7FA 5E2UH 5ADOL 1ZA6A 1BBJB 3MOAH 3PF2A 3VGAC 1BD2D 5DRNA 5I8KH 3EO0A 4OGZA 4LSUH 3OB0K 1U58A 1UGNA 3BD5A 1TQBC 4YIQB 1TJGL 2X4QA 3TESA 2COQA 5DSCA 2CD0A 4UILL 1N64L 2PXYD 1AGFB 4GXVH 1XF4B 1WVZA 3BZFA 2R29H 1BMGA 2D7OA 3RGHA 1KCSL 3QQ3B 4PJAB 1FVCB 4MNHA 3MJ6A 3ZT6A 1T89A 2OJZL 3E2HB 4FQXC 5KAQF 4N68A 4P59H 5I1IL 3KPRE 4HGMA 4LSQH 4BZ2L 4J3VA 2VITB 1VFBB 2MWCA 3IDJB 4GBXC 5T1DH 2HN7A 4I4WA 4G42A 5TDPA 4Y4FB 1XGTA 4LLDA 1HSAB 3OGCA 1K4CA 1YN7A 2BFVH 1MCSA 3P0GB 2HT4C 2KZWA 1B6UA 1F90L 1UYWH 4R6UA 4D9LL 1PZ5A 2AEIT 3GM8A 3WS3B 2DQHH 5HDQH 1B2WH 1WBYA 3N85H 3VFSB 5AD0A 1F3JA 2OZ4H 1RZFL 1FIEA 3IXAA 3O9WD 4OCRH 4YHOL 1IGFH 5F7DB 4MB4A 5EU7E 5F93C 3BD3A 4KRPC 3QHFH 3BVNA 3VWJB 5DFTA 2X44D 4ALAL 1GGTA 5DVNA 4G6AD 3NN8B 4X9BA 1W0VA 4E0RA 5F9JA 2NY2B 4JFEE 2FIKB 4I18B 3U4EB 4K9EH 2IBZY 5JQHC 4ZG1A 1EVTC 4UT9L 4XPFH 2AK4E 4ISVB 5E70A 2VLLA 5KZCB 4PJ9B 2D0HA 1MF2L 2WBJD 3P3YA 5D7SL 4RNRB 5KS9B 4AY0A 2XKUA 3JWOH 3NH7H 1E6JH 3GMOB 2YOCA 2HTLC 1SY6H 2EIEA 4NQDB 3VFWB 2EDDA 1JBJA 4ZUSA 2VDRL 1CE1H 4NM4H 3H9SD 4XBPB 1QBAA 1X6NA 4M93B 1A7QH 4WENB 5FK9A 4JANB 5C08E 1AKJA 4GKZB 3QDJE 1JNHB 2PYEE 2W1NA 2AAVA 3MRJB 1RZKL 5GHWL 3SCMD 4M6OH 3GMLB 3CCHB 3U30B 5L88H 1AHWA 1JHTB 1TPXB 1CR9L 1ZK9A 4Y2DD 2FX7H 1DUZA 4IRJD 3N50A 3LD8B 1Q38A 2NX5A 1T20B 1SJVA 4X4ZA 2XA3A 1S7QA 2ICWB 4Y5XC 1JK8B 3KPPB 3VRJA 1UZ8A 4P0DA 1WZLA 4DW2L 4DUVA 5F1NA 1FNHA 3QQNA 4YDKH 3HMWL 5IBLD 5BV7C 5I1AB 4YGAB 1NGZA 2VC2H 1K3ZA 3QXDB 4HIHA 5DVOA 1T22B 2W0FB 4NOBA 5LGKA 1RI8A 3QCTH 2EKSB 2O5YL 4L1HA 1CLYL 3QQ9C 1GGIL 1VERA 3HC3L 5CJXC 4FNLL 4XP1L 1INQA 2VDNL 5IROA 1AXTH 2FB4H 4Y1AA 3K2UL 1SJEA 25C8H 2PCPA 4L8SB 4X9FA 5C71A 4JFYB 3UPRB 1C5CH 2DWDB 3B43A 4U05A 5DXWA 3QWRD 3H3BC 4IIQA 1H8NA 3LKPB 1JNJA 1MCHA 1OP3H 1HN1A 4ZFZB 4KUZL 4U6HA 4JPKH 5GRUL 2UY7A 5FF6B 1YJDH 3PQYA 2Y06L 1CLZH 5F9OH 1PKOA 3WFBL 3I85A 1CGWA 3B5TA 4YNYB 2W0KA 3L5XH 1JRHL 3LS5H 5EU6B 1M7DB 4WHYH 5MHSD 3QPQC 4KV5E 4X6FA 5JPNB 4EJ1C 2OR9H 4Q9QH 2NQCA 5HY9B 3HLAB 2E7LC 3ULSB 3O6FD 2JIXA 5J89A 3BHBB 3M1BB 2DLIA 3E1F1 4XGZA 2VLRD 2XZAH 3W11C 1NGXA 4JFHD 3ZE2F 5GISL 5BJTB 1A3QA 5KBNC 4OCSL 1E4XL 1FFOB 4YDVA 5C0AD 1TVBA 4D9QD 1KCVL 4P3CH 2DBLL 1G7MB 1JNLH 3AU1A 1NC4A 3G5XB 4XB7A 4ELMF 3CMGA 4RAHA 1BZ9B 8FABA 4LEXL 4G5ZL 4NO3B 1YMHB 3RDTC 5D7JC 5MEOB 1HYRC 3IDMB 5J6HA 1RMFH 4V1DB 3RY5A 4ODWB 1IT9L 4WV1C 2DIBA 4YBQD 4ZXBD 2YPVL 4AZ8A 4FFVC 1FH5H 1YQVL 5TPWL 3WIHH 1P6FA 1UJ3C 4AT6B 2XZCL 5DRZB 3HZVB 3DMMD 4LVHC 5FB8B 2AJUL 4R7NA 1D5ZA 3X3FH 3QHTC 4P4RB 3AVEA 1UEMA 4I13B 2VQ1A 2VXSL 2UYLB 3HZMB 2MCG1 4XVUC 3VXRA 2AEPL 2EE3A 1M71B 4PFEA 4J4PA 4ZFFA 5F89A 5HYIA 1ZEAL 2OXHA 2ATKA 3F7VB 4XXCA 2B1AL 4Q7DA 2YD8A 4WFED 2X9WA 2D4FA 3QPXH 4G8FA 2FYYA 5LQBL 2IG2H 4W6WB 2Z92A 2GK0A 4RIRB 2ITCA 3BQUB 2QQKL 5DMIL 5DJ2B 5GGQL 1YN6A 2V5RA 2C1PB 3PWPD 3X3GL 2JJSC 5E6ID 3F58H 5E00A 5GRJL 2EICA 3R0NA 3KGRA 4P2RE 5FYLE 1RJZA 4P5KA 5H2BA 4BUGA 3KXFA 5E08H 2XNAB 4HZLB 2Y5TB 3HC4L 1P4IL 3D39A 3ULVE 3VXSA 1A7PH 1TETL 4PJBA 4XTRD 1R24A 5BZDB 5KSBA 4Z95H 4JFOA 3GIZL 1X5JA 2FIRT 1I7RA 1W0YT 3V4UH 4NQEB 1JZ2A 1EV2E 3P4OA 3Q3GA 1ZHBB 3GSNA 3T77B 5JR1L 4LNRA 3WIIL 1X5YA 1Z3GH 3CJJA 4RFOL 2XG5A 3LEXB 5KSUA 4Q0XL 3AM8C 4N90D 1IEBA 5IEHB 2XN9E 3OKLB 1HQ4A 4NZJA 4MA3B 3P9LA 4PIRF 1VGKB 1JTOA 5DMGD 2BVQA 4ZAKB 2J4WL 4X83A 3PE9A 4S1QL 1ORSB 1W0WA 1UXWA 2QQLH 4HWBL 5C3LD 4RX4A 4S2SB 3CDCA 3EYQD 1OSZA 3CIQA 5IHUH 3IVKB 5EZLB 4H5SB 4YO0B 1S7SB 4XPGL 1QEWA 2CRZA 1BFSA 1S5HB 4PRHE 3F5WB 3PWUB 3OAUH 3PHSA 4YDLC 4P2QA 5F9DC 4K94H 3SY0B 2IAND 2IPUG 4Q2ZA 4XWGH 3RVXD 3PHOA 3PL6D 3A67H 5T1KA 3T3PE 1R5IB 4PJ8A 5TDNB 4M4RA 4CU8A 5F7WC 2J8UF 2ZUQB 3QEUA 2ADGB 4YBLB 3IFOB 1LO5A 3L5WA 2R1XB 4JFPB 3VFOA 2CXGA 2AQ1A 1AGEB 5SWZD 1U3HC 4PJIF 3DRTA 2DLGA 4PJGE 3RWEB 4QNPE 5EOCL 5T5NF 5JHLL 2FEEI 5HI5C 4U1KA 1NC2A 4ODUB 1MJUL 1G7IA 3GGWB 1NAMA 5BZWB 5IT2L 2BFVL 4PB0H 4Z7UF 5IB2A 1AXSA 3O6KH 1N3NB 4U1JA 4I3RH 5BRZA 3BZEA 1DBKH 1UYWL 1UFUA 4KQ4H 1G0YR 1MCQA 2CXKA 3OHXB 5CD5C 4KJYA 1CICC 4OCRL 4N0FB 5EOQH 4MCZA 3DO3A 5GGTL 5EBWA 1S9XB 5T3ZE 1TNNA 4W4OC 1LP9B 4C54A 3O45B 4U7MA 3OKYA 3IDNB 1U8MA 1BD2E 1EGJH 1IC5H 4C56A 3QI9D 2WIIB 1WF5A 1N59A 4S1RL 3AMLA 2Z4QB 1CGUA 5D5MA 4U0RC 3O6LL 4J3TA 3I02B 3ABZA 3LKRB 3U0PA 2O61A 3MRKA 2HJLB 5GJTL 3GBLA 1JPFA 3JWOL 3LRSB 4PJXE 3WN5C 1HQRB 4L4TB 1BFOB 4WO4A 5B38G 5LVEA 2EDHA 1WT5C 5CGYC 3NIGE 1CBVL 4PJGB 1Q94B 1JRHI 3EDEA 3OKKB 4GG6B 2EIZB 1BAFH 1FC1A 3BE1H 2AABL 2X4TA 5ETUB 4YWGL 1A7QL 5I19L 3V5DA 3R1GL 1G7PA 1QSVA 1NANI 5FUOL 2ICWJ 5JDSA 1WC7A 5D93C 4BK4A 5F3HB 5IVXB 3B83A 5HGAA 5IEKA 1E4XI 3UYRL 2IJ0C 1IAOB 1GZQA 1Z5LB 1ZTXL 2CDFA 4HUNB 4IS6B 4YDIL 1ZLSH 1DL7H 3BH9B 2QSCL 3QDMA 4QT5B 3L3IA 5J57B 2P5WA 1Q9WA 5DD0H 1NBVL 1R3HB 1SBBA 1GGBH 3V6OA 4P3WA 3VWKD 4RGNB 1MIEH 1YEJH 3VE0B 4PJEE 2NY6C 1BQSA 2P8MA 2LTQC 5C09A 3BIAX 5LJYH 1RJYB 4NC2B 1J1XH 3EIFA 2EYRA 1A14L 4M1DH 1GPOL 3MRNB 2VZVA 3G08A 2OTPA 1ETZB 2MHAB 1JWMB 4GRLA 4X9HA 1N6QH 1N8ZA 1G7QA 3F62A 4DUXA 3SKNB 2VISB 4DZBA 4F9LC 1NKRA 3DXAA 4M61A 5DDHB 3LN4A 1MRCL 4PJXB 1U8HA 1NH6A 1I1YA 1IGIL 4F57L 2V5MA 4X6CA 1G7LB 5E6YA 4GXUM 4Y5VC 4L9LB 5IM7A 1I9IH 1YDPB 2B0SL 4JJ5A 1MAJA 3RY6A 2HJKA 4FN0A 5EU5B 5C0BA 3I3DA 3BP7A 4MNQB 3CXHJ 4QOKA 3H9SE 3W5NA 1OM3L 2EYSA 1X5XA 4F7CA 4JHWH 3HUJA 5ILTL 3V52L 3WXVL 1FZKA 1YJDL 3QFJE 1QRNA 5JQ6H 2CR3A 5C0CA 2RAMA 1QZ1A 4ZSOA 3ZSSA 3HG1E 5H94A 4NZDA 2XG4A 1YC8A 4OTXL 1MH5A 5J11B 5FYLH 2BX5A 2NR6D 1I7UA 1NEZG 2ZNWA 4Y5YB 4WFHD 3Q2CA 4KTEH 4HQQL 1UVQB 3ULVH 3D9AH 1UKSA 5DVLA 2XTLA 5FIEA 3WL9A 2FGWL 4QCIA 5DJCA 4GKOA 4EI6A 5CSBA 2IAMB 1TVDA 3KPQA 4D2NA 4O00A 4EXPX 3E3QC 4LLQA 4YXHH 3OKOB 2QQNH 2VZTA 4QTIH 1LO3L 1YYML 1T03L 1T2QH 4PJ5D 3FB8B 1E27A 5AAMA 3EGSB 1HOCA 5JMRA 3KYMB 4OZHA 1RMFL 2YPKB 3UBXA 3H2WA 2NY2D 4LAQL 4MVBD 3RWFA 4Y88A 4EEEA 4ZUVA 3ARWA 5D7LD 4PJ9D 4EI5B 4XZUB 4Y4KD 2XQYK 4UINL 5T33L 3LQZB 1IGML 4F7EA 1RZ8B 3MOBL 4HXAL 1BQHG 4FMFA 4QXTB 3RWHB 2X4UA 1EIBA 2OYPA 4YDJB 3EOBA 4PG2A 1FAIL 2DD8L 2EDJA 3QFJB 4NQDD 2R69H 3STZB 2NY5C 3AMKA 3X3FL 2YUVA 4QWWD 5AG8A 1ACYL 4WY7L 1KJ2H 1OARL 2ATPB 4MAYA 2NY7H 4Y0GA 5HYSA 2GTZA 1PSKH 3KPSB 4M8QB 1KN2H 3MA7A 4OBSA 5CCKL 2VH5L 3G6JB 3TCLA 2Y7QB 4LSPH 2AXJA 5FM8A 5C2BH 3VA2C 1AC6A 3VG9C 1OW0A 4HJJH 5DLMH 3V2AR 1QSEE 2WINB 2ZKHL 3BIBX 4XXDB 3UP1A 4LL9A 2IG2L 2IQAB 3DIFB 4JFHE 3C60B 2R0KL 3OF6D 1T4KB 5C0AE 1FZOB 2DI8A 1IZJA 1YQ2A 4PP2B 3KPLA 3I6KB 4ZS6C 4KDVA 1NGYA 5GS1A 1U8KA 3RQ3A 5DQ9B 4HWNA 1H8SA 3IU4H 1R3JB 3VD9A 1SBSH 4P23C 1F6AB 3WO4C 1YECH 1CXHA 3GJFA 5HGHB 3KNBA 1C5DA 2DL2A 3NABL 4R7DA 5JNYA 1U8LA 2IPKA 3JXAA 4H88H 1QPPA 5I1HL 2FR4B 4JZJB 1VHPA 2DKSA 3INUH 4UQ3B 5C07D 1OAKH 2CLZB 3RVWC 5KVMC 4P5MA 5T3ZH 4ZFGH 4FFWD 1TJHH 4HH9B 4PP1C 4YX2H 4HX1A 3KPMA 1CS6A 3PDOA 1KTLB 1OAUH 4JGMA 1AD9B 3OAZH 1KXVC 4CMMB 5C9JB 1S78C 4NRZB 1B0GB 3N9GL 1EEYB 3QBTB 5KSAA 7FABL 3MCLH 3N06B 1FN4B 2VXUL 4ZPTA 1QSEB 4H0HB 4X7EC 4QKXB 4D3CL 3B2VL 2F54D 3EJJX 3IETB 3DHMA 4M6MH 4N1EA 4PJDE 1PLGL 5CWSA 2ENYA 3C2SA 4MJIA 1IM3A 1I3RA 3OPZH 4Z7WA 3H9ZA 1ZA3B 1RFDL 4JFQB 5I6XC 5HI3C 4HIXH 3ZO0A 1WFNA 3NACL 1T04A 4G6JH 1NFDE 5SWSB 1MJJA 3PWPE 3MRBB 2YK1L 5LWYH 2AV7B 4LVOB 4FQQA 1CVSC 1ZA6B 4H1LA 4QRTB 1MEXL 5DRNB 2VSCA 4NZRL 4DN4L 2YD3A 5C0EA 4X5XA 2VIRA 3MYZA 3PNWB 3GMRB 1U58B 5HI4C 3BMWA 4R4BA 1QBLH 5I1KH 2X4QB 5D6CB 1OY3B 1HINL 5DSCB 4JCLA 3WSQH 4V1DD 2H1PH 4XP5H 1BBDH 1DSFH 2DBJA 4ZYKB 2QTEA 3BZFB 4QRPB 4O4YL 4E5XA 2J8OA 3CFCH 4H26B 2V2WA 2PW1A 3DUHA 4M1CC 2P44B 5D8JH 2PO6C 3GI9H 5JOFA 1OF2A 3ZYIA 3MRPB 5GZNC 5CP7B 3G04A 3SGEH 5DA0B 4I4WB 5A16A 3D6GA 5TDPB 4PR5A 1WBXA 3MRFA 3EBAA 5DK2B 5LCVH 4MDIA 4LLDB 3S34L 4JKPL 3TO4A 3OGCB 4LSTL 3T08A 1YN7B 3PGFH 4M48H 2OMNA 1SHMA 4JG1H 3TVMA 1W72A 4HKJA 1WTGT 4NHCL 1QKZH 1YYLH 3ZE1F 3VFGL 2ARWA 1XF2A 5JOPE 2GY5A 2IANE 5FHAL 1OGAA 3MUJA 5AD0B 2HKHH 5EZOH 2YR3A 5IG7A 1C12A 1JL8A 3C2AH 2R4SL 3D69A 4U2ZA 3EYVA 4IMKC 3G9VA 3T4AB 1FC2D 1P9MA 1MWAL 4P3DA 2HH0H 1A1OA 3T2NH 4Y19A 3H6JA 1FZJA 3VDCA 4JM2C 1W0VB 5IESH 1X4XA 3LOWA 1U8JB 4FTVA 2PYFA 1FGVH 2YPLA 4OI7A 2A0LC 5DQDL 4F37F 1AGBA 3W39B 1INEH 2ICEA 5F88A 4G9FD 3MGOB 3NFPB 1Z9OA 5E8EA 1B4JH 3ZE0F 2YRZA 3DBXB 3HE7A 4NQED 3WD5L 2J5LB 1ZANH 3S36H 3ULUD 1I4FB 3KYKL 1CGSH 1QUNA 4ZUSB 5FM5O 4KVCH 3WFCL 4APQC 1YPZE 3REVA 2V5SA 1AKJB 2DLEA 1X5AA 1CIDA 2JELH 4QRUB 2BVEA 4PGEB 3T0BA 4YQXH 2NZ9D 5AZ2H 5L2KD 5F7NC 1I1AD 5BS0D 1DUZB 2VOTA 4POYA 2X70A 1SQ2N 4PUBL 1CTNA 1MHPL 2OP4H 3VRJB 4R90L 3HMXL 2G60H 4BSVB 5F1NB 1OP5H 3CVHH 4I2XE 1JFQH 3ARPA 1N6QL 2BC4A 2E9WA 2ITDB 4HIHB 4P46B 4MSWA 4R2GD 2DN7A 1KIQB 1PKQA 5D7IF 3BKCL 4NJAH 3MV7A 4PJCB 4OCWH 3BP5A 1IL1B 1KLUA 4FQLH 4NUGL 2FHCA 4CADB 1KT2A 2HG5A 2PCPB 3QUZA 4K9EC 4LIQH 5JDJA 1IC4L 2ZCKH 5B4MC 1IJ9A 1B3JA 3MV8B 3EOYG 4LSRH 1IGCL 1RIHH 5M7QA 3TIDA 2FGZA 3JWOC 4FFZH 3D0LA 4IIQB 4PBWD 4K3JH 4DZ8A 3UZQA 5BXFA 1J0JA 3VMOA 3S35H 4WEUD 5I1EL 3AREB 5L7XH 3L3GA 4JB9H 1HHJA 5CJBA 3PQYB 1T0NA 1CXFA 6FABH 2UWEB 3L3OA 5GGVH 1A3RL 4HZAA 4KK6D 1UADC 3D9AL 3VI3F 3TZVD 4X6FB 4HWZA 3MFFA 2B1HL 1FSKC 1QTYT 4KHXL 5B39B 1OWRM 2EYTA 1AXIB 1DQLH 2JIXB 2V17L 5A40E 4YXKH 4GW1A 2HKFH 4XGZB 3CX2A 5E4EB 1AC0A 2Z8VC 1YEKL 1FFRA 3T0VA 4MZ3A 1QVOB 2X7LA 1T0MA 1AE6H 1AJ7L 3GSRA 5M94B 4OZFH 1NGQH 4LHUG 2VWEC 3HB3D 4TUOB 4Q9RH 1NC4B 8FABB 4WEMB 2CKBL 5IGXH 2EDQA 4RZCB 2D2OA 1IAIL 4A2LA 2RR3A 3LEYH 4DGYL 4LLMA 4ZNEA 4X80H 1UB6A 3B2UC 5J6HB 3A6CL 2CMRH 1XIWB 5IK3B 3RP1A 1OB1A 3LIZL 4MA7L 4YR6A 3QCUL 5ALCH 3ZKNC 3BGAA 1QBML 4G8GA 3F65A 3PUCA 4IHOA 5E2WH 1MCJA 5FCUL 1JYXA 4XPTH 4KPHL 1TCMA 4YFDB 5DUBA 1M7IA 3SO3B 1BVKA 3HAEB 4Y5XA 3U9PH 3ARBB 5TF1H 2F5BL 4XCNA 4E42A 5E5MA 3MV01 5SX4H 4LLYA 1NBZA 4KKAC 5C2BL 1UACH 4DGVH 3VXRB 1AY1L 5C0JB 3BDYL 1NJ9A 3HI5H 5GGRY 2QADD 1YJDC 3PHQA 1MAML 5B8CB 5E5UB 2DQEL 3GNML 4LCWD 4ZFFB 1J1PH 5F89B 3X11A 1FFQA 3L3JA 1JF1A 2E6JA 2CH8A 2B39A 2W60A 4DJMA 3OB0H 2XI9A 3U1SH 1HH9A 3R4DA 4KUCD 3UTQA 4G8FB 3RKDC 2UUDH 1PAMA 2FYYB 3UTSD 3REWA 2Z92B 1BFTA 2IPTL 1X5KA 3ARRA 1U93B 2ITCB 2X4PA 3BYTA 4K8RD 4LFHD 4WW1A 4PJ5E 3SE8H 1NBYB 3ARFD 3FT2B 3QJHA 4PGCA 5DHYB 1CL7L 2VR5A 1M6OA 1Q1JL 2D03H 3D3VD 3KAAA 3FO1A 4XP4H 1E6OL 3QIWD 1YECL 1FNEB 1G9NL 3W9DA 3C6LD 1FVEA 2W38A 3TT1H 2SEBB 2J88H 4P5KB 5D7LE 3KXFB 2A77L 4ZPVA 4O5LL 4ERSH 3S3SA 5DJ8A 3BESR 4JRXD 3VXSB 3D0VB 5KSBB 4JFOB 3V5HA 5ALBL 3PJSA 3GMMA 4HDIB 5T1LA 4DGIH 1HIMH 1I1FA 2FO4B 4YX2L 3SJVD 4HC1L 3P4OB 3Q3GB 1BOYA 3GSNB 2CQVA 4XI5D 2A83A 1KCLA 3IRPX 4MNQD 1WWWX 4HPYH 3AY4C 2E7LA 4OCYH 3MFGB 5I1GH 4RDQF 1SEQH 2X40A 4NN5C 3LN9A 4PLKD 3P0YH 3CFDB 1HHHA 1HQ4B 4O2CA 5T5FH 3P9LB 3VJ6B 2BRRL 3QIBA 4UUJA 1KGCE 4TSAH 5HVHB 4MWFA 1NLDH 3CGTA 3MRCA 3SOBL 4M6ML 4H8WH 3B9KB 4NT6B 1OSZB 2RBLA 1D5XA 4GAYB 3RDTA 1UQSB 1UM5L 1KB5A 3DNKA 4Q2ZB 3DVNA 4LGSB 3LDBC 3RHWK 1IRAY 2A9ML 2NXZD 2PKDA 4KQ3H 1MWAA 5T1KB 1F3DH 4PY8J 2BP3A 1J8HA 4UOW0 1UJ3A 2XT1B 1KJ3H 4CVWA 2VO5A 4KROB 3ZE2E 2LV4A 1X4YA 2NY1D 4Y16B 4WUKL 4YEEA 2EH8H 1NCWL 3BZ4A 1LO5B 4P99A 2ZOKB 2BY0A 3VFOB 4POZC 1EHNA 4Z7VF 3SDCC 3MBXH 3I2CL 3I9GH 1AGCA 3BUYB 5C07E 2BHYA 4Z7QF 1JGUH 1GOHA 3ECBB 1DLHA 5ISZA 4M6NH 4F80A 2E6QA 4K71B 5HHXL 3GI9L 2VLJD 1E0OB 3DRTB 3HNTH 5HHNA 5BOPA 1IEHA 2OTWA 1GYAA 4C83A 2FJHB 1MIML 4X4YA 2D3VA 1KBGH 3OKNB 1KC5H 3QUXB 1UH2A 3O2DA 5EU7C 5IMMA 2CIKA 2R8SH 1T2JA 3GRWL 1G7IB 3MTRA 1NAMB 3MV9E 3O8XC 4JG1L 4RGMB 1AXSB 1ZMYA 3FQRB 1N0XL 5KTEL 4Q9CA 3Q5OA 4IRSC 2F54E 3OKDA 5J9PA 3MXVL 2VYRE 3VGEA 3O2VH 2GSIB 3RA7L 5FO7B 1AH1A 2G2RA 3WHE0 3GSUA 2I5YH 4OD3H 1T1ZA 2X9XA 4IOIA 4MCZB 4Z5RA 4D0DA 3UEZA 5EBWB 5L0QC 2AKRA 3BKJH 5CEYA 3IU3B 3M8OL 3P4MA 1U8MB 3P30H 1UM4H 5JHDD 3GI8L 4K94C 2CIIB 4C56B 4NPYA 5EUOA 4LF3B 2R2CA 4P9HH 1HK6A 5BO1L 1N59B 2GI7A 5T1MA 3UO1H 3DV4A 1CD8A 1S9YA 5D5MB 3GJEA 4WVRA 3AM8A 1Q0YH 3QXAA 5D9SB 1I7ZA 1LE9B 3JTTA 4ELMB 2XA8H 3B6SA 4FXGB 3QHZL 4JR9L 3E6HA 3MRKB 5C86A 3WNPA 1JPFB 1B4JL 3ARGB 1UT9A 4QRQB 4WO4B 1UXSA 2H32H 1PZUB 1IQWH 2J7LA 1JNNH 3V4PL 2IH1B 3V6ZA 3GO1H 3OJDA 5SX5K 3O0RH 2X4TB 4WWID 4JVUA 3V5DB 1LDPH 2KH2B 1G6RL 2E5EA 3MV9B 2DICA 5CIPH 1AP2A 1MFAH 5E5RB 2R23A 5JDSB 4HJ0C 4XMPH 4EQ2A 4D0BA 5HGAB 5IEKB 3HI6H 3FB7B 4YQXL 2WP3O 2VTFA 5F6IB 1JUFB 4X98A 3VDBA 3BIKA 3QDMB 1KTRL 1MNUL 3L3IB 3QXWA 2P5WB 1Q9WB 1IAII 2YKLL 3OG4B 4G3YL 5DZNA 4PRPA 5ESAA 2HLFD 5LGHL 4LLAA 5FECA 4XP9H 2C3WA 2FZ3A 5HJ3A 4C59B 5A3IC 1JFQL 3PV7A 4FG6D 5C09B 2ZCHL 3T0EA 2FLRT 4NCDA 2BVUA 2DQTH 4NNYA 4IMLA 4P9ML 3DYMA 4BQ6A 4LSSH 1L6ZA 1DBMH 4DVBA 1F3DJ 2CKBA 4OFYD 2Q3AA 2DQDH 3UTZA 1IGYB 3H9YA 1N8ZB 4UOW1 1J9CT 2V7NA 1FNGA 5E8DH 3RX7A 2J8UE 1YNKH 4LIQL 1UEYA 4G9FE 3LN4B 4M61B 5KJRH 3HS0B 3HE6A 3RZCA 1KCRL 2O93L 1I1YB 3QO1A 3IDYC 1N6UA 5F7EL 4U1LA 1ZT4A 2J6EA 4JJ5B 4QRSB 4M5ZH 1BM3L 1S3KL 2HJKB 2RHEA 1WAAE 5A43C 3T09A 3C09B 1RULH 3BP7B 1KLFA 3WS6A 2VXVH 1F2QA 2D31B 4ODVL 4U1IB 2GITA 2EYSB 4F7CB 2RJMA 4W81A 5F7MC 3MACH 3U0TA 1FZKB 3SDXF 1A9BA 4N0YL 1QRNB 2UZIH 4OM1L 5E0QA 4M43H 2P48B 4ZSOB 1BOGA 3CU1A 5H94B 1YY9C 4OGAD 4U6VL 3SKMA 4HUXB 4ZFOL 3BUTA 5L2KE 5BVPH 3BO8B 4Z7UE 1MQ8A 4LARL 4A6YL 5BS0E 2PTTA 1KEGL 4LASH 1DQLL 4IJ3B 5TJWK 4GMTH 4F7PB 4PG9A 4HGKC 3ZDZF 2M8XA 4ZTPH 4C55A 1X5GA 3MBEA 3KPQB 1E4KC 5J56B 4YHPB 4XWOD 4CJ1A 1SYSA 3WHE1 3VXUA 4LLQB 1NGQL 1AQKH 5CJOH 3QUYB 4QHMA 3K4DA 4Y8AA 4NBZB 1F45A 1E27B 5ICXA 1RZGA 1HOCB 4R8WL 4ETQB 2ICES 4OT1H 2AEQH 1RURH 1UZ6F 2KQNA 1KEMH 2KPNA 1FO0L 4OLYL 1BQLH 2CMRL 1N26A 1OGTB 1INDH 4HHAA 5IW1B 4FZEH 1NUFA 3C6SB 5EPMA 4PGJA 4HC1A 1RJLA 5HHMB 4RA0C 3RRQA 4OZGA 3SDDC 1LGVA 1MAKA 4PJIB 2X4UB 2GTWB 3EOBB 3NA9H 3W0WB 5EOTA 3LV3A 1OD7A 5CP3H 4P57A 3TA3B 3V0VA 4YPJA 1KCKA 2LVEA 2XKSA 3U82B 1OAQH 3SGKC 1LO2L 5HYSB 1CG9A 4I5BA 1FYTB 1UWXK 2VDPH 5I2IA 3MA7B 1NUGA 3BW9B 2HVJA 2OMBA 2EEAA 1AKJD 1J0KA 4L4VA 3DX7A 4UMGA 4FQ1H 2YD7A 4OZIA 2DTSA 2NW3A 5D71H 5EB9A 5GZOC 1J5OL 3I6LD 1ZHNB 4OGXH 1DUYA 3EDFA 2H2PC 4I3SH 5IFJB 5JW3L 1CLOL 4RISL 4PRNB 3SE8L 2JJUA 5HHQA 2NX5D 4PY7B 4NOFA 4PJ7A 1I3UA 3OSKA 4MGXA 3MCG1 2Y6SD 1EZVX 2DMBA 1IKFH 4RRPG 3KPLB 4W70A 1NGYB 2YMXL 3CDYA 3EDDA 3C5ZC 3JWDH 4JO4H 3U4AA 1S9WA 2V7HA 4BFGA 4TUKH 1A6UH 5CZVL 1FFNA 3H42L 4LQFH 2ZPKL 5ESQA 3MX0A 4R7DB 1U8LB 4KKCD 2EE9A 2IPKB 4RMTA 5BVJA 3TWCL 4R26L 5DO2C 4FQ2L 4NQCB 4Y1AD 4AMKL 2FD6L 4HFUH 1F00I 2N1KA 1H0DA 4HAGA 1Q9LA 3IF1B 1CGYA 2ZNXA 4HCRL 3P0YL 4HX1B 3KPMB 3MNVA 3F6IA 1H3VA 1YMME 4I0PA 5CZXD 2HFGH 1NLDL 5D1ZC 5FUZL 3TN0C 2ESVE 2R9HC 1RUMH 3PABB 4K3DL 4K23L 2NTFB 3BSZH 5KSAB 4LCWE 3VFUA 1JV5A 3UX9B 4JM2F 2QSQA 1MHCB 4GW4A 4AK1A 1BIHA 4PRAA 2CLVA 4HS8H 4YHKH 5CWSB 3UTSE 1GGCL 2VQUA 2AXGA 4MJIB 1UA6H 3T3ME 1I3RB 1PBYA 3QEGH 4Z7WB 2JIXD 4LPWA 1NMBL 3MODL 1N4XH 3RTQB 4ZO6A 1KJ3L 1WIUA 1QSFB 1T04B 3VGBA 3D3VE 2NTSP 1HCVA 4H1LB 3H7LA 4PYHA 4XC1H 4KZDH 2XKNA 4XNXH 1MCPH 2VIRB 1RHHB 1NC4D 2H2SD 1N5AA 5D2LF 4JRXE 3FT4A 4M6NL 2X4RA 5EFIA 3B9EA 1MLBA 5I73C 4UIMA 1KXTB 1EHLL 3SJVE 1E4WL 3ARDC 1CDGA 4NKDB 2AJ3A 3X17A 1KBGL 2FH8A 3CLEH 2V2WB 4WWKA 2PW1B 5HDOA 2ZG3A 3CK0H 1JHKH 1OF2B 1X44A 5IIEA 3SE9H 3FFCB 3G04B 2ZCLH 4IOFD 2EXWD 2C4FT 2CJUH 5DK0A 3RL2A 5CUSH 4XCCL 1HDMB 3TO4B 1LE5A 2GFBA 5HHPA 2Y5EA 5EO9A 1CFNB 3PDGA 3MRQA 1W72B 4HKJB 2PXYC 4J4PD 5D70L 4RBPK 3V0AC 5EBMA 1NEZA 3QG7L 1DBAL 5IQ7H 3UZEA 3WKML 3MUZ1 4NWUL 2W9EL 3HNSL 5DUML 4JVPA 1A3LH 5ESVA 3D69B 3PP3K 5GGRA 4B0MM 4JG0L 3SKOA 5K9QI 4PREA 1Q0YL 4P3DB 1MFDH 4IRZL 1VKXA 3B5GA 3KDMA 2X4SB 4FTVB 1EEZB 4WHDA 2F53B 1J0ZA 1AGBB 4JRYA 2Q8AL 3KXFD 5L6YL 5HGGS 2G75A 4HPOH 3VXMA 1MQKH 2ICEB 3AB0C 3FTGA 4R0LC 3D39D 5IOPA 3VXSD 2VLJE 1WBZB 4NQSA 4KY1L 3NFNA 4Z6AT 5E8EB 1KJVA 5E94A 1R5VA 4B5EA 3MJ8A 2E3VA 3O9WC 3P2TA 3WMSA 2JTDA 1UM6H 2P4AB 1BQHA 5IBUB 3SE4A 1ZLWK 2ZSVB 1HZHL 4Z76B 2LVCA 4G6AC 4A6YA 2NY0B 4JFXA 2YSSA 4OFDA 2WQRA 2L0DA 2Z31A 4PJHA 1HH6B 3VGAB 4K7PH 3FAWA 2EIDA 4OLWL 1GHFH 4NHUA 4RX4D 1WISA 3B9DA 5I1DA 4QHLA 3OAYK 3B4NA 3BGFC 4XRCA 2OXGA 2P5EA 2W91A 4HKXB 4LRIA 2E9JA 2WBJC 4JQVA 2X70B 2ZUTA 5JHDE 4MB3A 1HKLH 5KW9L 4P2QD 1Q9KB 3RWJA 1RU9L 4LSSL 4ONHA 1NCDL 4XNYL 1DN2A 3CXDH 1NDGA 3DECA 3JV4B 4HIJA 5T1KD 3GJFK 1X5HA 3CC5A 2X1OA 4FQXB 5HHOA 2BC4B 4HH8A 4PJ8D 1FO0A 1DE4A 1FHGA 1FJ1A 5E8DL 1PKQB 4KROD 1XGYL 3BN3B 5ICYB 4FABL 1EJOH 3KVQA 4JFDA 4X99B 4GBXB 5BCAA 3KLHD 2BY2A 2A2QT 3SCMC 4ODHL 2YRLA 4WW2C 5DFWH 3WDJA 3IS0X 5BW7C 4JKWA 4MLSA 5D1QA 4JZOA 5C0ND 2F58L 4IRJC 1L6XA 5DRWA 1R3IH 2P8LA 4I48A 1BEYH 4DWHA 5DD5H 4QEGA 3ROLA 1T80A 3NCYP 1A5FL 4AM0A 1VACB 1B0RA 5BXFB 2OL3H 1NC2D 5IBLC 4KK8D 1V7NL 4EUPA 1KJMA 4KRPB 3L3GB 2AGJH 1UC6A 3MRGB 3L3OB 2P8PA 4PD4K 2WBWB 2JJWA 2E9BA 4K7FB 5BRZD 7CGTA 4F58H 4NP4H 4TOYH 1XGPA 1B9ZA 1U8IA 3GKWL 4HWZB 3MFFB 3Q6GL 4WI2A 4M9OA 1U8OA 5EC1B 3ROOA 4D0CA 3MNWB 1E4JA 1NFKA 3P9MA 4F7TA 2EYTB 2ZG2A 3S8WA 1HE7A 1X7QB 2H45A 4P4KA 1BJ1H 3LEVH 4GW1B 3UPAA 5DWUL 5FUCE 1RVFH 5J3HD 2HFTA 2X7LB 3FONA 3QWOA 1OAZH 1T0MB 4WTZG 5HYJA 4NGHL 2X5PA 3MGAA 4UV4H 4FQHB 1H5BA 5AYUL 4X4ME 2NY3D 4NKOB 1X5FA 1S5IH 3O2WL 5F1IB 1G1YA 4DOHE 4F33A 4APQA 4LLMB 4KDTC 1UB6B 3UZVB 3O4OC 3S4SB 4FP8H 5EWIH 2QJDA 2VXQH 5DURD 4YR6B 4LRNH 3LKSB 3MLRL 1TDQA 4M62L 2JB5L 4U7SA 2GT9A 3UTTB 4YHYB 1ZGLM 4NQVA 4OFVA 3O6FC 1VFUA 2OK0L 3L7FA 3O81A 4FQCH 4K8RH 2BVOB 3GHEL 1XR9A 2P1YA 3PXHA 3ZE0E 1MI5A 3EW3B 3CU7A 1F4WL 4OD2B 4ZO8A 2X1WL 5ID1A 5EU4B 1F5WA 1BVKB 1HXMA 4Y5XB 2OZ4A 5E95B 2R4RL 4XCNB 4E42B 1Y6KR 1CZ8L 1NBZB 1YC7A 3ME0A 1K8DA 4MA8H 1B88A 3ZT7A 3ESUF 3PHQB 1AR1D 4OGYL 1CFQA 4HS3A 4NDMB 1GAFH 4U1NA 1JF1B 2W60B 3M17B 3QDMD 4ZNCD 2BNQA 1RIUH 4XNMA 2EDWA 2JCCA 4RWYH 4YBQC 5ENWB 3S88H 1MFEL 3CFKA 4X7SH 4UT7H 3REWB 5IB3B 2VXTH 2HFEA 2X4PB 4WW1B 5C09D 1KELL 4PV8A 4QRRA 3DMMC 1QR1A 2OJEA 1I9JH 4PGCB 4GRMA 2YD1A 4PS4H 3C9NA 1M6OB 3FO1B 1V05A 5KOVC 3BDBA 5DI8A 3W9DB 4LQFL 1SY6A 4GRLD 3QUMH 5DHVB 1QO3A 2DM7A 2YBRB 3LVEA 4LSVL 5SWQA 1CF8H 3SE3C 3DXAD 1DFBH 4HFUL 2AERT 1N0LA 1CN4A 5I75C 3RGVA 4OSUL 3EAKA 3S5LB 3U83A 2KUTA 1JGVH 4TVPE 4LP5A 3V5HB 3GMMB 3A0OA 4JDTH 5T1LB 3I50H 1EMTL 4JY6A 5C0BD 5DFVC 5D96C 2A83B 4OLUH 4QOKD 2HFGL 4MX7A 4LCYA 4XC3H 5FYKL 1I7TB 4D9RD 4TRPH 5D2NA 3H8NA 1QRND 3BSZL 5C0CD 2Y07L 2D7NA 4XMLL 1J7VR 4KMLB 1WEJH 5TFSH 4UUJB 3RIFF 1B90A 5E6IC 4MWFB 1CE6A 1HKFA 3X12A 1QYGL 2R56L 4HW6A 1AR2A 1D5XB 4ZUTB 1K5NA 5DT1H 4EN3A 3RDTB 5D7JB 4XTRC 3VI3E 2NX5E 4NKQB 5E7BA 1FYHB 1V3JA 1KB5B 3IFLL 3U79A 2R1YA 1XF1A 4X7CC 3DVNB 2BSSB 4AQOA 1PY4A 1ZSDA 1BJ1J 4OKVB 1UJ3B 5B39G 1BIIA 1AI1L 2KDGA 3WFEH 4PGDA 3MRLB 4YUEH 1M7XA 5DMGC 4LVHB 4XNZC 4XVSH 1JN6B 4FQPA 4M3JA 5D7IB 4RCAA 5C7XL 4UV7L 4RAUA 5EIIA 4Y1AE 1OPGH 3EYQC 4HUWB 1FQ9C 4ZTOL 2HT2C 4F15C 5KANI 5F9WC 5HHMD 2EXYD 4OM0H 3RAJL 3U7WH 5HHNB 2OTWB 1IQDA 3RVXC 4YIQA 4HK3J 4JDVB 3PL6C 4HMCA 1JPSL 1AGFA 5IMMB 2CIKB 4MAYD 1VFMA 3SBWA 1U6AL 4N1CA 5DJAA 2J2ZA 3QQ3A 2BHZA 4PJAA 1FVCA 1YEGL 3O4LB 5KAQG 1RZJL 1Q9OA 4L3EB 2F5AL 2A1WL 4LU5L 1NKOA 2H8PA 2VN4A 4TNVK 5DEGA 4M5YH 3HAEG 2VITA 1VFBA 2K1MA 4OD1L 3ULUL 1WTLA 4HIEA 2NPLX 4H8WC 5D1XD 3GSUB 4Z5RB 5HHVH 1R0AH 1YY8A 1IC7H 2OLDA 2QHRH 4Y4FA 4DN3L 1OAYH 3ZTJH 2CUHA 4WI7A 4GW5B 4MXWH 3ORJA 5EUOB 4N8CH 4JKLA 2APVA 3DV4B 3P0VL 3K8LA 3WS3A 1S9YB 5CKGA 3HCVB 4MNGE 3UJJH 4LHUA 1I7ZB 4D8PB 1E28B 5BV7H 1H3PH 3VWJA 5CHNB 1A4JA 1YNLH 3JWNC 3V0WL 3G6AB 4KZEL 4EDWH 2LU3A 3V6ZB 3OJDB 1TZGH 2AJSH 4I18A 3U4EA 4YDLB 1DANU 4NM8L 3GEWB 4ISVA 3QI9C 3FQWB 1KULA 1Q0XH 4I77L 1V5JA 1AP2B 2R23B 3DX8B 4RNRA 4JPWL 3BT2L 2H41A 1JHLL 2WUBH 5KSAD 3GMOA 1CFVH 4KGLA 2VL5A 5C92A 4GJTB 4ZD3H 3BP4B 1KACB 3VW3L 2I60H 4PRPB 2XWJB 3A6OA 1JNHA 3T0EB 3MRJA 2P7TA 1U3HB 3EOAB 4NNYB 1K6QL 3GMLA 1QNZL 2FECL 2R0LL 2D7PA 4F9PA 4DVBB 4OLVL 1JHTA 5DUPL 3UTZB 4MNGB 1DVFD 4YXLH 4P9HC 3RI5K 1DJSA 3JUYA 4NNXA 2E9IA 1T20A 1A7OL 1EFXB 2ICWA 2VDOH 3D39E 1JK8A 3KPPA 3ZKMD 4UDUB 3DVGA 1LDSA 3O8XA 4JO2L 4PJBE 1LVEA 2MKLC 3NAAL 4OF3A 3QO1B 3TBWB 4XPAL 4U1LB 4EVNB 1ZT4B 4R96B 3QXDA 4Z7VE 1T22A 3OXSA 2W0FA 4AEHL 3VWKC 4JFEA 1CICB 1XT5A 1MUJB 2LAAA 4FMKA 1JPST 1FORH 4WHTB 3U0TB 4G9DB 1A9BB 5L9DH 1KYOK 4RMSA 4X9GA 4U1HB 5K9JL 2BDNH 4XMKH 3SKMB 3IKCA 5JXEA 2DQFA 4BQCA 1FDLH 1JVKA 4OLXH 3TVMD 1M4KA 4U0RB 3VCLA 2PTTB 3LKPA 5JW4Q 2CPCA 3C08L 2DTML 4GQ9H 1RUQH 4P2QE 4JN1H 4TVPH 5FF6A 5KVDH 1Q8MA 1OGAD 2PYEA 2Q7YB 3RY4A 3WLWC 4GAGL 3WN5B 3MRMA 1KCUH 5GGVY 4UV4L 4YNYA 4ZODA 5EU6A 5EIQA 4IDJH 2MPAL 3TJHD 1QFWL 3BAEH 4QHMB 4PRDB 4CRPA 5ICXB 5JPNA 5TH2B 1EX0A 2PF6A 3CX5K 5HY9A 3HLAA 3Q6FA 4Y19D 4R4FL 1A6WL 3TBSB 1CXKA 3LAFA 1WCBB 3BHBA 1JGLH 3QG6B 4FTVD 3S37X 2YPLD 4MDJB 5CJ5A 5D93B 2NR6C 1N7MH 2IFFH 3LMJH 4JO1L 1BJ8A 5C9KA 1II4E 4HHAB 4J3XA 4KKLD 1MLCA 4AG4H 5EPMB 1FFOA 3HNVH 4K8RL 3D18B 3RNQA 1Y6MR 3FAXA 4DKFL 1QFOA 1QLEH 3G5XA 4ODXB 5HBBA 3HE7D 3DUSA 1YMHA 5MEOA 1HSBB 4LPYA 3NCFB 2HAZA 4JAMB 1OL0A 4L3AA 1NCCH 3EOTL 3LCYA 4GMSH 1IMHC 2WQ8A 3IDMA 3P9WB 4WEBH 1U95B 3V0VB 5I1JH 1SM3L 2NY6B 2Q1EA 5ECJE 2LTQB 3LS4H 5BRZE 1KIRA 3E3QE 5GXBB 2GIYA 1CG9B 4I5BB 3O6ML 2HVJB 2NY0D 5HD8D 4POUB 4XCFL 2IALB 2NY2C 5DRZA 2C3GA 4MVBC 3UJTH 3O3BB 4G6KH 1OLZA 2P49B 3QQ4B 5FB8A 2DJ4A 2YD6A 4PJ9C 4Y4KC 4OAWA 3DSFH 3RUGF 4P4RA 4IOSD 4CNIA 2F74B 5FYJD 5HHQB 4HG4K 2UYLA 4PJ7B 5J4MA 4Y5VB 4GAJH 4ELKA 2XRAL 1M71A 1J8KA 4ZUWB 4QWWC 3QUML 4RQQA 1IARB 4KMTH 3F7VA 1I85A 5EU3B 4YAQA 5D7KD 4X0KA 3MV7D 1MPAH 1FFNB 2CSPA 4RIRA 3BQUA 2BOCB 4NJ9H 2X10A 4QGYA 5DJ2A 1NGPL 4G7VH 4JY5H 5F8RC 3QUZD 4RGOL 2X2YA 15C8H 2C1PA 2DLFL 3LQMA 1ADQH 1Q9LB 5AUMA 3RU8L 4EBQL 4TQEH 4NKIL 2B20A 1C5BL 3FRPG 3CDGB 3TYFB 4OIIH 3MUGA 6CGTA 2XNAA 1VFOA 2Y5TA 5TFSL 3NIGF 3BN9D 4WI5A 4O58L 5F7HA 3SDXE 3UJIH 1JF6A 2Q20A 1WZ1H 4XVJH 4JPIB 1ZHBA 3L3KA 4ONFL 3T77A 1JV5B 3DX6A 4FXKA 3OKEA 5INCB 2Q8BL 1F11B 3C5JB 3TT3H 4GW4B 4N0CD 4TN9A 1GCFA 4X8JB 4H25B 4N5UA 3BPOC 1VGKA 1I8LC 4ZAKA 3ZTNL 5DC4B 3UC0H 2IBBA 1DZBA 1D5BB 1RIVH 4FFWC 4BFIB 3GBNL 5DD6B 3OMZA 4ZS7H 3WFEL 1FIGH 2CLRA 1DBJH 3GK8H 4O51B 4H5SA 4YO0A 4PJEF 3RNKA 5IMLA 3CMOH 5DD1H 3PWUA 3DXAE 5E9DE 5C6TL 3JWDC 1N5AB 2DI7A 2O5XH 4X6CE 4Z0XB 5EFIB 1MLBB 2MKWA 4UIMB 3HI1A 5C0BE 4CVUA 2AJ3B 3VG9B 4G8GD 5JO5A 5ADOH 2ADGA 5B3JE 4QOKE 5DZLA 4WWKB 1RD6A 2X1XR 4HD9A 4D9RE 3LKQA 3IFOA 2J3SA 1M1SA 5C0CE 1J18A 4U6XA 3OB8A 2EDYA 2QEJA 5E8OB 3TPUB 4P48A 5IB4A 3SDXB 3F7RA 4UILH 3MLPA 1N64H 1VADB 4N0UE 1VGEL 1HEZA 5IW3A 4MCYA 3BMVA 1H15B 1T66C 2K7QA 2FECI 2GFBB 2NMSA 5T5NG 1AO7B 2C5DC 2OQJB 3H3KA 1KPUA 3FMGL 4P2YA 1KCSH 1QLRA 3MRQB 3BJ91 4WFFE 1S7TA 3WHXA 1MCOH 3U7YL 2OJZH 3SGJC 4P23B 5EBMB 2XN9A 1A6ZA 2IPUK 3WO4B 5I1IH 1NMCC 4LCIH 4PBXA 5CEZL 3VMPA 4BZ2H 4WW2F 3MLUL 1IBGL 2BNRB 3GGWA 5BZWA 4M7KL 3W82A 1NDMB 1ACZA 2XZQL 3F7YA 4PJFF 4LDOB 1OTUD 5GGRB 2YN5A 2Q86B 4J6RL 3SKOB 2DRUA 4PREB 4PRHA 1F90H 5E9DB 4OZHE 1J0HA 5EG6C 3UROR 3CVIL 3KDMB 4D9LH 1LP9A 4S0TD 4UNTA 1CFBA 2Q76B 4GSDL 1JWUB 2I07B 3LRGA 3O45A 3IDNA 3IFPA 4O2FA 4P5TC 3TN0A 4BQ8A 4MHHI 1ITCA 1RZFH 1YNLL 1N5YL 2G75B 4YHOH 2Y1VA 1ZV5A 5IOPB 1MHHB 4Y2OA 5D72L 2WIIA 2VDQL 3NFNB 1TZGL 1KJVB 1UJTA 4ALAH 4A2MA 5D4QA 3TJEL 4I9WD 5J1AB 3LKRA 4HKBB 1VEOA 3LRSA 5I6XB 1HQRA 4L4TA 1BFOA 5C8JB 1JPTL 1VEPA 4X6DF 3RIAK 4UT9H 2CGRL 2V5YA 2YRPA 1I8KA 3QIBD 4PJGA 4LP4A 1P4BL 5GGUB 1MF2H 4JFXB 2YSSB 4PJHB 5D7SH 1B6DA 3WNKA 2WNGA 3S37L 1JTPA 5I1DB 2I60L 5JW4N 2DS4A 3WKNA 5FHBL 2P5EB 1K4DB 3MMEB 4MQSB 3E0GA 1ZWIA 5ACZB 2EE6A 4GRWB 2VDRH 3HPLB 3Q1SL 1XZ0A 5F3HA 5IVXA 1L7IL 1X5IA 4JDZA 2DLTA 2W59A 4O2EB 4ONHB 1Q72L 4HIJB 1FL5B 1IAOA 2NXYB 4FFVD 4IS6A 1J8HD 2J12B 4YXLL 5E7FA 5AWNL 1DE4B 1RZKH 2XFXA 5GHWH 3VD3A 1R6VA 4ODBD 4RRPA 1R3HA 3EDJA 4NSKB 1P84J 5SV4A 3ZDYF 1CR9H 1IM9B 4JQXC 3G6DL 4H1LG 1NCNA 2F19L 1RJYA 1X4ZA 4FHBD 4K3GA 5EZIL 5GS3A 5JW3H 2ADJB 2MMXA 3C8KB 1V7ML 1UWXH 1D9KC 1PX4A 1UKQA 4JZOB 5C1MB 4DW2H 3GSOB 3UYPA 1I1AC 5ISZD 1P69B 1ETZA 2APWA 2MHAA 1NL0L 3HMWH 4NWTL 1JWMA 4ZO9A 1EHXA 3CFIC 3SKNA 1F2XK 4ACPA 5L9DL 4HT1L 3QXTA 4AM0B 1B0RB 4PJXA 2O5YH 1CLYH 1GGIH 3F8UB 1Z0MA 5JPMA 2BDNL 4FNLH 4XP1H 4EUPB 2VDNH 5I0ZA 2ARJB 4R2GC 1YDPA 2A6JA 4TYUA 4HBCL 3WXWL 3K2UH 5EU5A 2OI9C 5KVFL 1T7YA 1XGPB 1HILA 3VDAA 4JM2B 4MJ2A 2GJ6D 1CDCA 2M2DA 3QXUA 4WI9A 1U8OB 5CSZA 3P9MB 4F7TB 1T3FA 5ANMB 3MLYL 2IQ9H 4KUZH 3RWCA 5GRUH 2Y06H 3MRHA 1OTSD 2BNUB 4PJDF 4Y5YA 3WFBH 3QWOB 3FONB 3O9WA 3LKNA 4O9HL 1JRHH 1JYVA 2LU4A 5E1AA 1PYWB 3UDWA 2IAMA 1NFDF 1QSZA 2VABA 4QXGL 5I15L 4KK6C 1T21A 4F33B 4ZO7A 4APQB 4U1MB 3D85B 2ZOLB 1H9VA 3UTPD 5D2LB 1CGXA 1NANH 2K7PA 3TZVC 1IFHH 4DQOL 1RK1B 5A1AA 3WV0A 3IRZA 4OCXL 4UTBL 3FB8A 4NNPL 5GISH 2WMPA 3ZHKA 1NCCL 4OCSH 1E4XH 3KYMA 1KCVH 2DBLH 4L8DA 3TNMA 2E7CA 2XOTA 4JZNA 2FHBA 4LEXH 4G5ZH 3L3HB 5ID1B 1C7TA 4L3CA 1HXMB 1F02I 2ZUSA 3HZYA 4EI5A 1ZS8B 1CLCA 3LQZA 3A6BL 1A4KA 1K8IA 4L8CB 3HB3C 1IT9H 4ZOBA 4JHBA 3N1FC 3H9SA 4QXTA 5IBUG 4L5FL 4N1HB 4YDJA 2YPVH 1CFQB 1YQVH 4HS3B 5TPWH 2ZJSL 3QFJA 3STZA 2EECA 4U1NB 1YEDA 2XY2A 2XZCH 3RVVD 1OGAE 3ES6B 2JCCB 1RY7B 3HG1A 2ATPA 5CINL 5IHLB 3SCMA 3CFKB 4DTGL 2VLKB 4M8QA 4JFFE 2V2TB 2AJUH 1U42A 3SO5A 2H9GB 12E8H 2NNAB 3G6JA 2HFEB 4WUUD 3T0ED 2VXSH 4QRRB 4KH2A 4PRBB 3WIFA 1CXEA 2WINA 2AEPH 2PTVA 3QDGB 3CAFA 4XAKE 5DI8B 5MP6L 2YPLE 4BH8A 1ZEAH 2IQAA 4Z0BL 2B1AH 5SWQB 2RGSA 2QADC 1A6AB 1T4KA 4QTHB 1JMZA 1FZOA 3HE6D 3RZCD 5LQBH 1LEKB 4PP2A 4X5LA 5ADPL 2IMNA 4OF8A 5C0RL 3GZKA 4G6ML 1D6VL 1CCZA 2QQKH 5DMIH 5DQ9A 5GGQH 4WI6A 5IR1B 1F6AA 1FSKB 2DQGL 3X3GH 1RUKL 5GRJH 4K8RC 3ARFC 3UJIL 3QNZA 4H20L 4NUJA 4K55A 3QWRA 1ULVA 3QIWC 3HC4H 1C1EH 1P4IH 3C6LC 2CLZA 1TETH 4KAQL 3I6GB 3X12B 4HH9A 3VFTA 1K5NB 1TTGA 2XQBL 4XHQA 1KTLA 1YPZF 5JR1H 3WIIH 1AD9A 4RFOH 1RUAL 5C9JA 2R1YB 4Q0XH 2WSKA 3RFZC 3MBED 4M9PA 2ERJC 1DBJL 3VXUD 1QSEA 4NQXA 3O6FA 3IETA 4M03A 4S1QH 1VPOL 4HWBH 3MV7E 3EYOB 3VI4E 4QYOB 3IXTB 4WDIA 4XPGH 1ZLWH 1L0YA 1ZA3A 3MR9A 5C0AA 4DKEL 3RVUD 1LD9B 4RAUB 5EIIB 5I16A 1PJ9A 2XTJE 1R5WB 4ONOA 2MOVA 5F70A 1F4XH 4BM7A 3J7HA 4ODSL 3MRBA 1GIGH 2AV7A 1BP3B 3VXQB 4QRTA 5MENE 3DRQB 3DO7A 2YUWA 3BPNC 1EEUA 2EC8A 3PNWA 3GMRA 3OAYH 1IQDB 3UMTA 3S4SG 5D6CA 2NXZC 3RX5A 1LK2A 2E8YA 3V6FB 3ET9F 1FL3A 1OSPL 3OKMB 3GIVA 3PV6A 4ZYKA 2AJVL 3LPFA 5DJAB 1NGWA 4LDLB 2NY1C 4QRPA 3GJFH 35C8L 4S1DD 1MCOL 4H26A 1Q9OB 3VG0L 5ITFA 5DZOA 4L4VD 4XHJD 4LCIL 2H8PB 5DEGB 3OXRA 4ORGA 3MRPA 4UB0L 5EOCH 5CP7A 3GSNL 4G7YL 5JHLH 2UY6A 4HIEB 3SE3A 1RHFA 3SGDH 1YY8B 1MCFA 1SJHB 4HLJA 4FQIH 4KC3B 5DK2A 1MJUH 5EORL 5A2JH 5IT2H 4RMUA 2AS5M 2OS7A 5F8QC 1I1CA 1XGUB 4X7TB 2NCMA 3AGVA 4WTZA 1U91B 4NN5B 1A9EB 2AP2A 3V4VL 1G9ML 4KJPD 4LHUB 1LO4L 5GGTH 4XPHL 2BSTB 5I74C 2DL9A 1MCDA 3T4AA 2WLZA 4G8GE 5MENB 4TULL 5EIVA 1A4JB 1ZXQA 4MXQD 2N4IA 4CBPA 1CD0A 3KWWA 4NBYB 5E6ZA 2BVPA 4GXUN 3I3EA 2DQJL 1U8JA 4S1RH 5BMFL 1BWMA 1TIUA 2EDOA 3O6LH 1H3TA 3IJSB 4OUOA 4S1SL 3S5LG 3PWJB 3W39A 1U8NB 2ENSA 4GT7A 4CW1A 3LDBB 5M95B 3MGOA 3CD4A 3NFPA 4I0PD 4KMQA 3UAJD 1TITA 2HT3D 2R0WL 5GJTH 1JCKA 3KPRB 3N1MC 3OX8A 3DBXA 3ZL4L 1CBVH 2E7BA 1ED3A 2VL5B 1CFSA 1I4FA 5FKAA 4CGTA 1S9VB 4PLJD 5HGDB 4NO5A 1BREA 2AABH 3GB7A 5I9QB 4MQXD 5AAWA 1JF5A 4YWGH 5I19H 3R1GH 3SDCB 3FQUA 4PLOB 5FUOH 5EO0B 3PDDA 4XCYB 1NAML 2P7TB 4QRUA 1CU4L 4I8DA 4PGEA 2HVKB 1A1NB 4K7PY 3UYRH 2EDTA 4HUMB 3V8OA 5HXMA 4YDIH 1ZTXH 2WBKA 2QSCH 2XICA 4NNXB 5L8LB 5IFAL 3ISWA 2R0ZL 5JXAL 1NBVH 2FJFA 5F97E 3DVGB 3O8XB 4BSVA 2X42A 4G8IA 2ITDA 2RCSL 4OKDA 4P46A 5DJDA 3OXSB 1KIQA 2HLFC 2HRLA 1JGEB 1KB9J 1A14H 4JFEB 4I9WE 3KLSA 2CK0L 1GPOH 2F9BT 5ID0A 3HRZA 4WWKD 4PJCA 5KS9F 4HUVB 2BMKB 2YC1B 2AK4B 4FG6C 1IL1A 5L0QB 4CADA 3DUUB 3SDAD 4P2OD 4G6FD 5FUCC 1MRCH 4Z7OE 1ORQB 1FG2B 3MV8A 1MJ7H 1IGIH 4F57H 1XCQA 3MZGB 3IKCB 2DQFB 2B0SH 5HYQA 3BWAB 1SMOA 1DEDA 1FPTL 3VCLB 5L8KB 3AREA 2IQ9L 1OM3H 5EOCJ 3WXVH 3V52H 5C08B 5ILTH 3QDJB 4ENED 2PYEB 1DQJB 2UWEA 3IDIA 3SKJL 3V79C 5JW4M 3MRMB 1J8HE 1T89C 5H37H 3PWLA 2A9NL 4OTXH 4XP6L 4XPBL 1A7NL 5LXGL 2KBGA 5B39A 3Q6FB 4HQQH 4OGAC 4BZ1L 3QI9A 4PGBB 1IFHL 1MREL 4HXBL 2FGWH 4I2XA 4JRYD 4MD4B 5ISZE 4Z7NF 3VXMD 1MLCB 1QVOA 1NCBL 4JHZA 2Z93B 1C08A 3RNQB 1LO3H 1YYMH 4OF0A 5FFLA 4TUOA 1T03H 3DUSB 4RZCA 1QFUL 3VMNA 3GSXB 5K9KB 5DD3L 5CJQL 2VLME 1XIWA 4KK5D 4LAQH 4LPTA 5IK3A 2YD5A 1KIRB 2G9HB 4JM4L 2GUOA 4D94A 2GJ6E 2WWKO 4UINH 5T33H 2Z31D 1IGMH 3C8DA 2Z0BA 3MOBH 3DWTA 4HXAH 3ZYOA 1R3LB 2P5ED 1FAIH 2DD8H 3HAEA 4OAWB 12E8L 3ARBA 4KKNA 1I8MB 1BJMA 4CNIB 3IGAA 1ACYH 4M4PA 4WY7H 3IDYB 1OARH 2APTA 5C0JA 3CDFA 2P47B 5B8CA 4ELKB 1Y18B 3TV3L 2AJZA 4E41E 2NXYD 4UTAL 4G43A 5CCKH 2VH5H 4RQQB 5HHOD 3VFRB 3J8F7 2ZKHH 4YAQB 2DOCA 3CZJA 4JFDD 4X0KB 1DN0A 1KLGB 4WCYL 3EJYD 1U93A 2V6HA 2VDKL 3K0WA 5CIPA 1NBYA 3FT2A 2X4OA 1ZGLP 2R0KH 5J12C 5DHYA 5ERWB 3LH2H 1AHWC 5D1QD 2UZYB 1D5IH 4PRIE 1X3DA 3D2UD 5AUMB 3TIEA 5GQBA 1FNEA 3MLXL 2SEBA 1HWHB 2HFFB 2Y6SC 3MUGB 2V2XA 4MAUL 3DOSA 4C4KO 1C1EL 2B2XL 4BSWB 3D0VA 3NBNA 3MLVH 3NABH 4HDIA 1EERB 2FO4A 5IWLA 3NIDE 5I1HH 3L3KB 5EO1B 3DX6B 4FXKB 3OKEB 1NPUA 4KFZC 5IROC 4KKCC 3FRUA 3S6CA 1D6EA 4Y8DC 4M1GL 3CFDA 4HUUB 2AXHA 3VJ6A 2VR9A 4JGUA 3GKZA 4WUUE 3MJ9A 1P7QA 4J23A 4P4KD 3N9GH 4XX1G 3SDDB 4IIQC 2CLRB 7FABH 3B9KA 4NT6A 5FOBA 4GAYA 2VXUH 5GSRA 4JLRB 5HYJD 5CZXC 3RNKB 1UQSA 3QEQE 5IMLB 1A0QL 4D3CH 3B2VH 2YWZA 4LEOA 3MLSL 5F1OB 1P2CA 3ZZ1A 4YHZL 1F4XL 1FGNL 3IKKA 1PLGH 3QRGH 1P7KA 1GIGL 4DVRH 1QPXA 3JVGA 5EA0H 1RFDH 3HI1B 5MERB 3NACH 2DQCH 1IKNA 4J7RA 2I9TA 3SPVB 5F7KC 4GFTB 4P2RB 2YK1H 5JO5B 4Y16A 1MEXH 4NZRH 4DN4H 3LKQB 2ZOKA 1MI5D 4MMZC 2K3TA 2HMID 4YC2C 3R06A 4U6XB 1H3XA 3ULUF 1WAAF 3AS2A 5IB4B 3BUYA 1HINH 1OAXL 1X9QA 4LDEB 4RWHA 3ECBA 5ACMA 1EO8L 2WAHA 3IFNL 1GOGA 1HEZB 3THML 1D7FA 4MCYB 2XPGB 1T83A 4N8PA 3E8UL 4HLZG 2H2SC 1KPUB 2FJHA 3C5ZB 4O4YH 1QLRB 3RVTD 1S7TB 3OKNA 3WHXB 2BY3A 3QUXA 4QXUL 4B50A 3PIQB 1KF9B 2XN9B 1A6ZB 4XT1C 1PG7X 4FQIL 2BNQD 5FA3B 2MFNA 3WNOA 3K80A 1ZVSB 3R8QA 3CXHK 3VXUE 5FA4B 3FQRA 3NCCB 1ZT7B 2CDGB 4FQJL 1FVDA 3RUGE 4LQ1A 3F7YB 5KVGL 1KENL 1LO0L 4JREC 4JKPH 3S34H 4LSTH 1IEAB 3K81A 4QRRD 3QEQB 5CBEB 2GSIA 1WIOA 4PRHB 5FO7A 3LRHA 3TO2B 2ZUVA 3LQAL 4IOFC 2EXWC 4NHCH 3FO2A 3L6FB 1EVUA 3VFGH 2NY4D 1UWEL 3V7AG 3IU3A 4I3GA 1XGQB 5FHAH 5D1ZB 3IFPB 4O2FB 3TN0B 5FO8B 1GH7A 1KJ2B 3GBML 1RPQA 5TE6L 3WUWB 4KVNL 2CIIA 4J4PC 3RGVD 1CTOA 4LF3A 4OZGE 4LMQI 4XXCC 2R4SH 3QIUD 3U0WL 3QFDB 1JTTA 1MWAH 1LILA 1PVHA 5CILL 5D9SA 1LE9A 4LGPB 4ELMA 4IBLT 4FXGA 5GRXG 5C07A 2N56A 1Z9MA 4JY4B 1A7RH 1BFVL 2CK2A 3ARGA 5DQDH 4QRQA 3TBVB 4LBEB 2VNCA 1BVLA 1V3LA 1I8KB 3MPCA 4L4VE 3DVIA 3KPTA 4OZIE 2PNDA 2IH1A 5J06A 1I75A 3T0DA 3WD5H 3Q5TA 3KYKH 3MV9A 4EN3D 1OVZA 1ZWIB 4J2XA 4I1NB 1CFTB 1XZ0B 4JDZB 5I73B 3FN0L 4LGRB 3ZHDA 3FB7A 5DR5L 5HDLA 3WFCH 3ARDB 4LLUA 3ZKND 1JUFA 2MNUA 5JZ7D 4L29A 4NZTL 1CYGA 2XFXB 4YHLL 5A2KH 1IGTA 1J86A 1W72L 3VFPB 3KJ6L 2IF7A 3HC0A 2FX8H 1EAJA 5MEQB 1BD2B 4PUBH 2X6MA 5JTWA 4UNUA 1MHPH 3M45A 1CK0L 4R90H 3HMXH 4JJHA 3WNLA 1K9TA 1WSST 5J1TC 1G9MC 1XF2B 1DQML 3O11B 1GGUA 1IGYA 2PXYB 1J11A 5LAXB 3WNMA 3BKCH 3HS0A 3L1OL 4JFZL 3FRPA 4GG6F 4X4XA 5JPMB 4P49A 1MJ7L 3VFMA 3DI2B 2CRYA 2XY1A 4PJ8C 1GXEA 2A6JB 3VXTB 4QRSA 4WTWA 4NUGH 2FATL 2QQQA 1IC4H 3KLHC 1HILB 2D31A 1IGCH 3EHBC 4U1IA 4NRYB 5FKPA 5GIRA 3T8XA 3BZDA 5CAYB 2E7HA 3VXNB 5CSZB 4P5TA 5C0NC 4XNQA 4F2MB 1UCTA 1T3FB 5DQJA 5E2VL 4R0LB 4Y4FD 5I1EH 4HUXA 3RWCB 3L9RB 3BISA 4KUCF 3IAPA 3MRHB 3BO8A 1A3RH 2ARJQ 3O9WB 3LKNB 1HHIB 3HKFA 3NTCH 3T3MF 4KK8C 3QCVL 4HSQA 4PJFE 5KSVA 3FB6A 3CFJB 4F7PA 1SVCP 1VCAA 2YUZA 4PJEB 5E1AB 1RZKC 4Y4HC 3ETBF 1XF5A 2B1HH 1NMAL 2VABB 3UBXI 4LHUD 4YHPA 1T21B 3KYNB 4KHXH 5FYJL 2V17H 5F7UA 1KYOJ 2FNBA 3QUYA 3VWJD 1YEKH 1TJIL 1QLFA 4ETQA 4G80A 3BGFB 1AJ7H 2J8UA 5F21B 5FGBA 4Q6IC 1QP1A 4L8DB 5HVGB 2WBJB 4FFYL 4RAVA 3TNMB 1OGTA 5I18L 4JZNB 2Z9TA 5J3HC 1IZKA 1RZ7L 2CKBH 3NGBC 5IW1A 1IAIH 3C6SA 3FOMA 4L3CB 5KZCD 3FOLB 3HZYB 4DGYH 4HGWA 3A6CH 1A4KB 1GL4B 1K8IB 3G5ZA 2RQ8A 3LIZH 2NY3C 4MA7H 4PJIA 2KKQA 3H9SB 3QCUH 2GTWA 4X6DE 1QBMH 3GSQB 3W0WA 2OR7A 3WEXA 1DP0A 3TA3A 1YEDB 2DQUL 5CFHA 3HG1B 3H3PL 4JQXA 4LVEA 5FCUH 1TLKA 3SCMB 4KPHH 4RA3A 2LFGA 2QLVB 4EOWL 1FYTA 5L2KA 5DJYB 3BW9A 1D9KA 4WFGD 1MCWW 3ZYZA 4Z7UA 5MHSE 1P53A 2F5BH 4LNVA 5EUKA 1BHGA 1G0DA 4IRJB 2EKJA 3WJLA 5A2FA 3WIFB 1AY1H 3BDYH 5DC0A 5DJZB 5I0DA 4PJFB 1ZHNA 4M7LL 4LIQE 1MAMH 1PFCA 5IFJA 3CPLB 2DQEH 3GNMH 2VZUA 3ZKQD 3BGMB 4PRNA 3NZHL 4BH8B 3C5SA 4JRYE 2VLRE 4PY7A 3VXME 1AR1C 4CMHC 1UWGL 3LH2L 1D5IL 3O8XD 5MI0C 2DLHA 4D9QE 3ZDYE 4CAGA 2IPTH 1PG7L 5L6YH 5IJKA 1A6PA 3V6OC 1CL7H 3SGDI 3BKYL 5C0GB 4I0CC 1Q1JH 4GO6B 4JFED 1E6OH 3L5HA 4UT6L 2LE9A 1G9NH 3H7BA 2DDQL 2FBJH 3MLVL 1AFVL 3KS0H 2OR8A 3QNZB 4NUJB 5JORB 1JPGA 2FCBA 2A77H 4NQCA 4O5LH 3V9FA 2W0LA 3IF1A 4GRLC 5JXED 5ALBH 3CVHB 3EUUA 3VFTB 1CGVA 2CR6A 4EUPG 4HC1H 2JK5A 1OT2A 5TE4L 3U6RA 5TQ0L 4PTUA 3PWVA 1A6VH 1GC1L 3DYPA 3O4OB 4CKVX 3PABA 2PYED 2NTFA 1YEIL 2BRRH 5IHBA 4TUJA 1FP5A 4NQXB 5HHOE 3O6FB 1C16B 5EU6D 4GH7B 2NW2B 1MHCA 4TSCL 4WFEE 4HUKB 3SOBH 3OAZK 1VFAB 3CNKA 4JFDE 3QRGL 2E27L 4ZOCA 1CGTA 4GAFB 5E99L 4P2CG 3N0PB 2BERA 4MYWB 2W07A 4DVRL 4Q74A 3HRPA 4WDIB 5EA0L 1UM5H 3MR9B 5C0AB 3RTQA 4KTDL 3EYUL 5I16B 2DQCL 4BKLB 1QSFA 4KJWD 3EYSL 3VFNA 3O3DA 1OTTD 1NFIA 2A9MH 1CDBA 2ORBL 2EDFA 3QXVA 3DO7B 2ILLA 4EDXA 1RHHA 5FYKD 5I76A 3FFDB 2DB8A 4L1DA 1C7SA 1LEIB 4LK4A 5I66B 1LK2B 4WUKH 1FL3B 1TZIB 1NCWH 3OQ3B 3PV6B 3GIVB 3MLWL 4MZ2A 4Z9KB 4NKDA 1NGWB 3I2CH 2HYMA 3DMMB 5JIHA 4CDGC 5L2JA 4LHJB 5ITFB 1LK3L 4N90E 5HHXH 3VD7A 2NYYD 3MYJB 3QNXA 4YK4C 3OXRB 4ORGB 1YMMA 4OZFB 5IFHL 3VD4A 4XBGB 4HULB 3FFCA 1MIMH 2PR4L 5DS8B 2ESVA 5CZKA 2AK1L 2EXYC 5C3TA 5I75B 4LCWA 4YFLF 3SDYL 1HDMA 3GRWH 4M7LT 1CFNA 4PG2C 5KTEH 5HYJE 1N0XH 5K93A 2ZUUA 3STBA 1MRFL 2LU7A 4PJDB 3MXVH 5D96B 1XCTA 2Y4SA 1CDHA 3OL2A 4MAYC 5ICZA 3RA7H 5LBSL 1F4YL 1RK0B 1AD0A 1EJ6A 2WIMA 3D3VA 1HYSD 1NFDB 3PWPB 1KB5L 5E6IB 2YXFA 3BQUD 3M8OH 4DAGL 1OW0C 1WWBX 4WI8A 5FAAA 3O3AB 2IH3B 4U1GC 1J0IA 4XVTL 5D1XC 3GI8H 2BXYA 4WGWB 2WWMD 3VU2A 3N1PC 3FQNA 1BGXL 3KWWB 3LKOA 5FDWB 2BVPB 1MI5E 5BO1H 1WGOA 1A7RL 2X4SA 4LLWA 1EEZA 1U9KA 1XEDA 2F53A 4NZUL 5C0IB 1XAUA 3QUKA 1FRGL 5SWZE 4CW1B 1T6WA 4U3HA 2BJML 2IGFL 5CBAB 3KS0J 4S0SD 3PGDA 1NLBH 2WWKT 3QHZH 1WBZA 4JR9H 5HTSA 4HJGB 5GS1C 4DFHA 5GJSL 3P4NA 3OX8B 1ED3B 1CFSB 2C3HA 3GMQA 2BNQE 5FKAB 1A02N 3V4PH 4XNZB 1ODAA 4NO5B 1DANT 2ZSVA 3GB7B 4Z76A 1AQDB 43CAB 1U41A 4OLEA 5A2LH 4K2UH 3O2DL 3M07A 4WI4A 1G6RH 1WITA 3V5KA 1TQCC 3FQUB 5E2TL 3PGCB 4GS7C 4ZAKD 4F15B 3EFDH 3BPCB 3ILQD 4JGJA 5F9WB 1HH6A 1J1OL 1VSCA 2EZ0C 4Q97A 2IANB 4HKXA 3PL6B 2FX8L 2Y36L 3QJFB 5FGCE 3FT3B 1T5WA 3KJ4C 1MNUH 4BH7A 1Q9KA 3LHPL 2I27N 5KSAC 2YKLH 4G3YH 2HP4A 2FJFB 1UCBL 5IMKA 5LGHH 1KPVA 3MUHL 4Y7MA 3JV4A 5T3XL 1MFCL 3AAZB 1KIPA 4G8IB 1LQSR 2ADFL 4FQXA 2ZCHH 5DRXA 3BKML 5DJDB 4MA1B 4P9MH 2QBWA 5TQ2L 4JKMA 5ICYA 4O02L 4X99A 4C4KT 5ID0B 4GBXA 3HRZB 5I1CL 4AL8L 3RPKA 1F4AA 2J1KA 5D2NE 2R2BB 4QHNB 3ULVD 2BRQA 2VLJA 1SJXA 3FQTB 2MQCA 5FGSA 5IKCA 4JQIL 1RJCA 1KCRH 1DVFC 2L7JA 4HEPG 4WHYG 1XCQB 5F7EH 4U49A 3E6FA 5HYQB 5FOJA 2R1WA 1KFAL 1BM3H 1S3KH 3ZKMC 2MQ0A 2Q6WB 4OLZL 1VACA 3VA6A 1GVIA 2B4CL 1I9RH 1PW3A 3ZHLA 4ODVH 1YPZB 1ES0B 4TSBL 4N0YH 4JCMA 3MRGA 4OM1H 3S98A 4WU7B 2HLAB 3IDIB 3NFSL 3MRDA 4K7FA 1TVHB 3NTCL 4KXZI 4X5WA 3BPLC 5IBTL 3PP4L 4U6VH 3PWLB 4XBEH 5I30H 5EN2A 5EC1A 2EDRA 3MNWA 4PRHD 4LARH 4A6YH 5HPMB 1KEGH 4MD0A 5DMYA 1MFBL 1X7QA 3QI9B 2X4NB 4I2XB 4GOSA 3RHWF 3GMNB 3RWIB 3TVMC 1KSRA 3DV6B 1SMAA 1C08B 4FQHA 1U2CA 5IW6A 3IYLW 3QP3A 1ONQB 1ZLUK 4NKOA 4M7JL 4R8WH 5F1IA 3HN3A 2G5BA 4AENB 1FO0H 4OLYH 3TJHC 3S4SA 3V7MA 1FNSL 4KHTL 4L4TD 4PJAE 3LKSA 3UTTA 4LVNC 1S7UA 2GUOB 2NLJB 5IF0A 2A73B 2A6IB 1KN4L 5CLWA 2J6EL 2BVOA 4BA8A 2Z35B 4RFNC 1Y0LA 2JKXA 1F13A 4KKLC 4OD2A 5EU4A 2OBGA 3IGAB 4JHAL 1MJ8L 4WFHE 4LOUC 1LO2H 3HE7C 2DM3A 2BOBB 4KJQD 1NQBA 2AJZB 4NDMA 3VWKB 1UKTA 4UU9A 2H32B 5JUEL 4G43B 3T1FA 3M17A 5CJXA 1RUPL 2DWEB 3HA0A 4ZOAA 5ENWA 3S96B 1J5OH 1IC1A 4UQ2B 2GSGA 4HFWB 4OF6A 4W68A 4RGND 2NY0C 5HD8C 1CDYA 2O5ZL 1CLOH 1DN0B 1U2HA 2AEWA 4OFYA 4RISH 1J0YA 3KPNB 3SEPA 5B22A 3HFML 5IB3A 5CIPB 4CUCA 1QQDB 2X4OB 2JLLA 3IT8D 4NC0B 4XH2B 3BWUC 2I24N 3SN6N 2D7TH 3TYGL 4X4MA 1T5XB 3TIEB 3SHSA 3VD5A 2FBJL 2UUDK 5DHVA 1A1MA 1AIFB 5H35B 4M3KB 1K2DA 2DAVA 3SQOL 2YMXH 5C2UB