5KGWA

Hiv1 catalytic core domain in complex with inhibitor: (2~{s})-2-[3-(3,4-dihydro-2~{h}-chromen-6-yl)-1-methyl-indol-2-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
153
structure length
134
Chain Sequence
b'CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Indole-based allosteric inhibitors of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 44
structure length 134
sequence length 153
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5kgwA00
3LP1A 2IGIA 3P83D 3I8DA 3S3MA 4ZTJA 1L3SA 1WSGA 1ZBIA 1HNIA 1ZBHA 3MEDA 3SUOA 3TARA 3RRGA 3OJSA 1WN7A 2G8KA 4FM0A 1UWBA 3VQ9A 3NFAA 2OPQA 4DTJA 1B92A 3MEGA 3MEEA 4DFPA 2OZSA 1HYSA 2EX3A 1EKEA 3RMDA 3AVNA 3ZT1A 4E89A 3LWLA 3EY1A 4HUFA 2Y1JA 3OYAA 2G8FA 4FM2A 1VRUA 1WAFA 3OVNA 1S1UA 2DFHA 4CGJA 3MXIA 4J2DA 2EHGA 4Q0BA 1NK5A 5T7BA 1LAWA 4CEFA 1NKCA 1ZBLA 4OLBA 3QINA 2FBYA 1RTDA 1BQNA 5J2QA 4JS5A 1CXQA 4B8CA 3ISNC 4OPJA 3QEVA 3U3YA 2BDPA 4KHYA 1HYZA 4RW9A 3U3GA 5JS2A 1C1BA 3IS9A 1Q8IA 1NJXA 3QIOA 3L2VA 3TWHA 3OYLA 4I7FA 4RW6A 3OYFA 4KI6A 2KFNA 1KVAA 3NF7A 4DTMA 3PO4A 4AHUA 3OYKA 3KKSA 3K5MA 4CFDA 5K14A 4CHPA 3O4NA 3MXMA 2HVHA 1BI4B 1NJWA 1DLOA 4IDKA 4E7IA 3C6UA 4HHTA 4RW8A 2HHWA 2Z1JA 1D5AA 4CIEA 1IKWA 5KTQA 3DRSA 4ELVA 1ASWA 1Z25A 3ZSYA 3LZIA 3V81A 2Z1GA 4GW6A 4B9MA 1A5VA 3ZSOA 1TAQA 1JL2A 4H4OA 3SYZA 4BDZA 3TAQA 4CEAA 4F4KA 1NK4A 4DSEA 1RILA 4G1QA 2JGUA 3ZT0A 3SV3A 1XWLA 2WONA 3ZSZA 2X6SA 1BHLA 1NKEA 5HLFA 3QEPA 1SKSA 1N5YA 4M42A 1VSEA 3AVLA 3OYJA 3OYEA 1KFDA 4DSLA 4J2AA 1VSFA 3AVGA 2F96A 4CGFA 3PX0A 3SPZA 3B6PA 1XHZA 1RDBA 4FJ5A 3AO5A 1GOAA 1RTJA 3S3NA 4DTRA 4CJQA 4M3ZA 4AHVA 4NCGA 4EP5A 1LV5A 5C24A 3CYMA 4M41A 1ITGA 4KO0A 1ZBFA 3TAEA 2DY4A 4HTUA 4DQSA 4FVMA 3WNEA 3SJJA 2Z1HA 3KD5E 4BE2A 4DS4A 1UOCA 4Z4GA 4CHQA 1N6QA 3DLKA 1VSIA 2GUIA 4DTSA 2O4IA 3L8BA 4CJWA 4FM1A 4KTZA 2LSNA 4CFCA 5HBMA 4CESA 3L3UA 3K58A 1RBRA 3LP0A 1S6QA 3K5NA 4CGDA 4CCHA 3VA0A 3RRHA 1DTQA 3K57A 5SWMA 4KV8A 4Z4CA 2X74A 3AVAA 3MECA 1VSMA 3SQ4A 5KRSA 2XY8A 5J2NA 3QEWA 1KCFA 2YKNA 3NCIA 1QSYA 3VQ4A 2G8WA 3LWMA 1VK0A 1XI1A 4KKOA 1TKZA 4NYFA 1TGOA 2KQ2A 3V9WA 3G0ZA 5KGXA 3QLHA 4DF8A 3CG7A 4M3XA 1RBVA 1Z26A 3AVJA 4Z0UA 4CJLA 1QSSA 3SQ2A 4CJEA 3LDSA 1KFSA 4W5NA 4JLHA 3TR8A 1T7PA 1DTTA 1QTMA 3HP6A 2PYJA 2B4JA 1RT5A 4O55A 2HNYA 2QKBA 3V1RA 3C6TA 1BISA 4C8NA 2KZZA 3QNOA 4DSIA 2HHSA 3P1GA 3DI6A 4KB1A 1JLFA 4DQPA 4FLZA 1ZYQA 4O5BA 5D3GA 1F21A 4KFBA 3IAYA 1QE1A 4Z4IA 1REVA 3L2QA 1TKDA 1WAJA 3HPHA 1BQMA 3IG1A 4B8AB 1RT6A 4N5SA 2GV9A 4FJMA 2VG7A 4FXDA 3PUFA 3MXJA 3V9UA 1L5UA 3L2UA 3QIPA 1O1WA 4CK1A 1BCOA 3O3FA 3RWUA 3HJFA 2IS3A 4PY5A 4QOZB 1NOZA 3AA3A 3M8RA 4CEOA 3VQ7A 3G10A 3IRXA 3PV8A 2RKIA 4CK2A 1KVBA 1HNVA 3OYGA 1EX4A 4CF8A 4LD0A 3NAEA 2DFFA 1C1CA 2ZD1A 1T03A 3ZSRA 5J2MA 1HMVA 4HUGA 1SL2A 3TAMA 5I3UA 1NOYA 3OS0A 1TK5A 4FJKA 1SKRA 4OVLA 2BE2A 3DOLA 3THVA 2VWKA 4ZHRA 4PWDA 4NCAA 2RN2A 1JLGA 1XHXA 3V9SA 3CM6A 4C8MA 4KHWA 4E7HA 3DM2A 3BDPA 1I39A 1RTHA 3PY8A 1LW2A 1QHTA 2ITGA 1BGXT 3QO9A 4AHCA 1QSLA 2X78A 1SKWA 4CJSA 2RF2A 5KI6A 3VQ5A 2P1JA 4CGIA 4Z4FA 3WNHA 2IDOA 3VQQA 4CJTA 3AVFA 3SNNA 5HRNA 4RG8A 3KTQA 4B9NA 4DU4A 3O3HA 4KHUA 4IFYA 3VQEA 4CJUA 2R7YA 4F2RA 3T1AA 5EU7A 3OY9A 1LW0A 2A1RA 1NJYA 4AH9A 4FJ7A 4DTOA 4FK4A 4R5PA 4W5QA 3ZSXA 4J2EA 4FZZA 1HJRA 1JKHA 1A5WA 4I9LA 4CF9A 4E7LA 3LP3A 3TI0A 4E7JA 1X9WA 5C25A 3KD1E 4CFAA 1FXXA 2Y1IA 2AJQA 3O3GA 1RT7A 1TK0A 3NGZA 1RDCA 3HO1A 4DFMA 2Q3SA 1KRPA 4LSNA 2BANA 3HL8A 4UQGA 2HHXA 2YV0X 1C0TA 2WOMA 4IBNA 2QK9A 3NF6A 1NK8A 3MAQA 4KTQA 4F3TA 2G8VA 3M8SA 3L2WA 4KB0A 5SZTA 4CEEA 4FJ9A 4DSFA 4DU3A 3OYBA 2VG5A 4DQQA 4N76A 3V1QA 2HHUA 4M3YA 1I3AA 4CHZA 3JYTA 3NDKA 2XHBA 5FDLA 4QAGA 3QERA 4EZ9A 1UA0A 4K8XA 2QXFA 4M3UA 3SCXA 1U49A 4FLYA 3EZ5A 4FLTA 3T3FA 3M8PA 4AHSA 1KLNA 2BGGA 4OLAA 3ALYA 1ZBUA 5CY4A 4HCCA 4DTUA 3K5OA 3VQCA 4DLEA 4FJHA 4FJGA 3LAMA 4E7KA 3V9XA 3A2FA 3SPYA 1YVUA 3S3OA 2QKKA 4PA1A 2FBVA 2E4LA 3M8QA 4FZYA 3V1OA 3RTVA 1TL1A 1BL3A 3DRRA 4CEZA 4CECA 5KGWA 3LAKA 5J2PA 4KAZA 3AA2A 4FYDA 1RTIA 1IH7A 4IG3A 1IKXA 2OPRA 4CJ5A 3NH0A 2KTQA 3SUNA 4DFKA 3RMAA 1JLAA 4M3WA 1SUQA 1JLCA 4FJLA 1HQUA 1VSDA 1J9AA 4N56A 1D8YA 3NE6A 4QCLA 3F9KA 2HMIA 1WSJA 3RMCA 1NKBA 2ZQBA 3TAPA 2P51A 1S1VA 3KKRA 1FKPA 1L3TA 3AVHA 4E1MA 1HQEA 4FLVA 2HB5A 4DFJA 5E41A 1JLEA 1CZ9A 3NGYA 4BE1A 3B6OA 2G8IA 5CZ2A 3NHGA 3S9HA 1U04A 2G8HA 4KHQA 4CJVA 3O4QA 5HRSA 1ASUA 4FK2A 4DG1A 3ZSVA 1KTQA 4DTPA 4CJPA 1U47A 1SL0A 1CZBA 5J1EA 3ZT2A 4ID5A 2OYQA 4F8RA 3HPOA 4LSLA 4FW1A 3KK2A 4KTWA 1UA1A 3ITHA 1L3UA 3U6FA 1IG9A 4FJIA 1TKTA 1W9HA 1RT3A 4BWMA 3AV9A 4IG0A 4CGGA 4DF4A 2HNZA 4OKKA 3TANA 1RT4A 3VQDA 3H08A 3C95A 3KLGA 3ZCMA 4YFUA 2E6MA 4H4MA 1HRHA 4M3TA 3CM5A 4KRFA 4CJRA 4O0JA 1C0MA 1LWEA 3CFPA 4LH5A 1G15A 4KREA 1WNSA 1NK9A 1J5OA 2XY6A 1FKOA 3UIQA 4F3OA 3CFRA 2PZSA 1YT3A 2ATQA 1VSKA 4BE0A 2HW3A 1S1WA 3RMBA 4FLXA 4N41A 1HYVA 3VQAA 4EP4A 3V9ZA 3OS2A 4E0DA 4CE9A 3V4IA 1D9DA 3RR8A 1BI4A 4I2PA 3QEIA 1T05A 2FBXA 4N47A 3VN5A 3RR7A 5CYQA 2XO7A 1U48A 1L3VA 4PQUA 4AHRA 4FW2A 1WLJA 3AVCA 3HPGA 4CHYA 3I0RA 1NK7A 4FLWA 1NK0A 3TAGA 4C8KA 4CIFA 2RPIA 2YNGA 4AILC 4RW4A 1QS4A 4E1NA 4XIUA 4OPKA 4DU1A 2P5OA 1LWCA 4OGCA 3I0SA 4ID1A 2O4GA 3JSMA 4I2QA 4CJKA 1X9SA 1GOCA 4O0IA 4W5OA 3VQ8A 2XY7A 5I42A 2KFZA 4GMJB 3SV4A 1IO2A 4C8LA 3D45A 3KJVA 1EETA 3K59A 1U4BA 4Y1DA 3DOKA 5DMRA 3C94A 4Z4HA 3HT3A 4ELUA 4BWJA 4HVJA 3ZSQA 3QEXA 1A5XA 4MQ3A 4DTNA 1Q9XA 1VRTA 3KK1A 2D0CA 4EZ6A 2F8TA 3AO2A 5CYMA 2B5JA 3LP2A 1Q9YA 3CFOA 2OZMA 1WSEA 4BACA 1VSHA 1J54A 2IOCA 4CEDA 4DSKA 3P5JA 3HK2A 4FLUA 1T8EA 3AA5X 2D0BA 4FJ8A 1TVRA 1VSJA 3DLHA 3AVIA 1TL3A 2ZE2A 1S6PA 2YNHA 5DK5A 1RBSA 3DYAA 2DFEA 1LWFA 3DMJA 3LZJA 3TAFA 1TV6A 4B3OA 1IKYA 3AVKA 5C42A 4CF0A 3VQ6A 5FRMA 4F2SA 3VQPA 1JLQA 4FZXC 4JRPA 4ZTFA 4KI4A 2D5RA 4NCBA 2ETJA 1B9DA 4CJ3A 3K5LA 1CXUA 1VSLA 4DWIA 4DLGA 3OYNA 1IKVA 1S9EA 3HVTA 2YNIA 2XRIA 1BCMA 3DLRA 4CJ4A 1S5JA 3HP9A 2NUBA 3AVBA 3WNGA 3OYIA 4BDPA 4K8ZA 1RDAA 2OPPA 2GBZA 4CFBA 3OYCA 3KK3A 3V6DA 1R0AA 4HCBA 1TAUA 4KPYA 4Z4EA 3DRPA 2G8UA 1WSHA 3ULDA 2KZMA 1S1TA 3HVRA 4L8RB 3QESA 1X9MA 4CJFA 3KLIA 4OKEA 3KLHA 4FK0A 3L3VA 1LAVA 1JL1A 1D9FA 1YTUA 4HUEA 4O4GA 3HXMA 3F73A 1U45A 4CHOA 3ZSWA 1S1XA 3KLEA 4B9SA 1KLMA 2HNDA 2OPSA 3AO3A 1B9FA 1S9GA 4M45A 1KVCA 2FC0A 4OKJA 4W5RA 4DTXA 1KSPA 3ZT3A 5FRNA 2HHQA 3DLEA 4FJJA 3KLFA 1JLBA 4Q5VA 3K2PA 4CHNA 4DS5A 1WSFA 4CEQA 1ASVA 2XY5A 3PO5A 3AVMA 1K6YA 4CEBA 3SUPA 1C0UA 4B9UA 3CQ8A 2P5GA 1GOBA 2D0AA 3DLGA 5HRRA 1RT1A 2Z1IA 2PY5A 3AO1A 1W0HA 5FROA 3OYDA 1YTAA 4CERA 3WNFA 1NJZA 4RW7A 3LALA 1TK8A 4B9VA 2B6AA 4CF2A 1UAXA 1NK6A 4DSJA 2FBTA 3OS1A 2DTUA 4AHTA 2YNFA 1RCHA 2OA8A 3OJUA 3SQ0A 2HHTA 3OYHA 4B08A 1SV5A 2A1SA 4TSXA 1RNHA 3EYZA 3QNNA 2VWJA 1C6VA 4E3SA 4B9TA 4FJXA 3NH2A 3SI6A 1EXQA 4I9QA 4BDYA 3E01A 2HVIA 1QQCA 3ASMA 1BIUA 1J53A 4OJRA 4H8KA 1FK9A 4W5TA 3LANA 4LY7A 4LH4A 2JLEA 3NF8A 1HPZA 3KIOA 3NH1A 2F8SA 5JS1A 1BIZA 5HRPA 3PX6A 1EP4A 1RBUA 1RDDA 4JRQA 1XC9A 3DLBA 4DQIA 4NYNA 4CF1A 2YHBA 4KHSA 1TKXA 3AA4A 3AO4A 4KHNA 5CZ1A 5HROA 3SQ1A 3HYFA 3HSTB 4M3RA 3SUQA 4O44A 1WSIA 1JXEA 1SL1A 2HHVA 4CGHA 4DMNA 2W42A 2YHAA 4YNQA 3VQBA 4CIGA 1Y97A 1RT2A 3PX4A 4FJNA 3TABA 1CLQA 1RBTA 4Y1CA 1JXBA 4IFVA 4OGEA 4E19A 4C8OA 3ZT4A 2X6NA 3VA3A 3OYMA 3NBPA 4WE1A 4CK3A 2VG6A 4J2BA 2YKMA 3NGIA 3NF9A 3T19A 4DQRA 1C1AA 4FCYA 4IKFA 2E6LA 4GVMA 2PYLA 2IC3A 3LPUA 4B9LA 4ELTA 5KRTA 3HM9A 2IAJA 3QETA 4PUOA 3LPTA 4ICLA 3FFIA 4MFBA 3L2RA 1X1PA 3D0PA 2KW4A 4JS4A 1MU2A 3SZ2A 3BGRA 5HP1A 2I5JA
chains in the Genus database with same CATH superfamily
3AAPA 3P83D 3VOVA 3I8DA 1HNIA 2QXLA 5ADXA 5AQZA 3RRGA 3OJSA 1UWBA 2OPQA 4DTJA 3FR0A 1EKEA 3RMDA 3ZT1A 3EY1A 4FM2A 4DQ8A 4J2DA 2EHGA 3ZX0A 1NK5A 2KKZA 3CMEN 1BQNA 1CXQA 4B8CA 3U3YA 3QEVA 3EKSA 2E20A 2BDPA 1HYZA 4RW9A 1NJXA 3VGLA 3AARA 2ASMA 4I7FA 4KI6A 2KFNA 4A5AA 1KVAA 3KKSA 3K5MA 1M90O 3G25A 1GLLO 2E1YA 2HVHA 1BI4B 4HHTA 4RW8A 4IO8A 1ZC6A 2Z1JA 3ZX2A 5EVZA 2VGNA 3O80A 3FZMA 1V4SA 4WQ4A 1KD1O 1Z25A 3O9RA 2O8BB 3SAGA 4B9MA 3QB0A 2O8DA 4H4OA 1NGIA 1NK4A 4B3MK 3SAFA 2GEMA 2QWNA 4ISGA 3ZSZA 3CJ9A 4BC2A 3Q7CA 3VEYA 3VEWA 4JKGB 1SKSA 1N5YA 4M42A 3OYEA 3ZX3A 4J2AA 1YIJN 4CGFA 3B6PA 3RVCA 4PHTX 2QA4N 4DTRA 4CJQA 3CYMA 4DV2K 1UOCA 5AQJA 5F2RA 1NLVA 1N6QA 2GUIA 4M63C 2LSNA 4CFCA 5HBMA 4CESA 3K58A 2QW9A 5SWMA 3TTDA 4KV8A 3IKMA 3MECA 1VSMA 5KRSA 2P9IB 1QSYA 3VQ4A 2QWOA 3E66A 1VQ6N 4NYFA 2KQ2A 3V9WA 1KFSA 1S72N 3TR8A 2GX9A 5AZJB 4O55A 2CH5A 1ATRA 1NGJA 4PL7A 3OA9A 2FXUA 3EN9A 3FLCO 3A5NC 1ZBSA 4NXNK 4FLZA 5D3GA 1F21A 4A2AA 1REVA 1TKDA 1WAJA 4NXMK 4N5SA 4LC9B 3L2UA 4DR1K 1O1WA 4KH4A 3RWUA 3HJFA 2IS3A 3AA3A 3PV8A 4BRFA 1KVBA 1YXQA 3OYGA 4LD0A 4CJ7A 3THXA 4HUGA 2D4WA 2BUPA 1NMDA 3ENOA 4FJKA 3J81O 1SKRA 1YJWN 2QM1A 3DOLA 3M3ZA 3EEQA 2HMPA 3SBTA 4JI3K 4AHCA 5BREA 1QSLA 2X78A 2RF2A 5KI6A 2A3ZA 3VQQA 4CZFA 5HRNA 3THYA 5BR9A 3VQEA 4F2RA 3ATVA 1LW0A 3CCRN 3C7NB 1HJRA 1JKHA 1K8KB 4E7LA 2FSNA 4E7JA 3CCEN 4CFAA 2Y1IA 3M5RA 2HSTA 3ZETA 1W2BM 3K0SA 1RT7A 3Q7BA 3NGZA 1RDCA 4MO5A 3HO1A 4WF9L 4LSNA 2NLXA 3D2EB 5HL7L 2G8VA 1NGDA 4XH1A 4CEEA 4FJ9A 4YOXA 3V1QA 3C6AA 4MDBA 4A5BA 1I3AA 2YHWA 3NDKA 4BRAA 3CF5L 2OANA 3P38A 3CCSN 4K8XA 4DB3A 4DV5K 4DTUA 3IDHA 1VQKN 3LAMA 3A2FA 3R1XA 3SPYA 2W6LA 1TYQA 5AQWA 3M8QA 3RTVA 1BL3A 4JKBA 2HBMA 4X66K 4C1NK 1NWKA 3A0IX 5LL6Z 1IH7A 2ZF5O 3WEEA 3TU5A 3SUNA 3O1BA 3RMAA 4JKFA 4M3WA 1SUQA 1HQUA 4N56A 1U2VB 4JN4A 4CZMA 3NE6A 3F9KA 3VGKA 1WSJA 3RMCA 2ZGZA 2ZQBA 3TAPA 2NRTA 1NBWA 4X65K 1EQYA 3KKRA 1FKPA 1J6ZA 3AVHA 1CZ9A 4BE1A 5HRSA 4CZJA 3ZT2A 1VQMN 4F8RA 4ILJA 4LSLA 3KK2A 1L3UA 3H1VX 4FJIA 4LF4K 4CGGA 1RDWX 3AV9A 2HNZA 2F7TA 4JHDB 3VQDA 3KLGA 3C95A 5AQKA 3ZCMA 4H4MA 1HRHA 3CM5A 1VQON 4O0JA 4HTLA 3CFPA 3E1YA 2QEXN 2F4VK 1WNSA 1YUWA 3UIQA 3CFRA 4N41A 2W40A 1HYVA 4MO4A 4EP4A 4E0DA 3U9ZA 4BRKA 4CE9A 1D9DA 3RR8A 3KWIA 2AA4A 3QEIA 2FBXA 4N47A 3VN5A 4FSVA 4FW2A 1WLJA 3HPGA 4CHYA 1NK7A 4FLWA 4C8KA 4CIFA 4JKEA 4XIUA 4DU1A 2Q36A 3WXKA 4AM7A 4W5OA 2XY7A 3TTFA 2UXBK 4GMJB 1IO2A 3W3DA 3D45A 5C10A 1EETA 2F9TA 5DMRA 3HT3A 1A5XA 4DTNA 4LF6K 1SAZA 3KK1A 5JLHA 4JK7A 5BRDA 1Q9YA 3CFOA 1VQNN 1IBLK 1VSHA 4O8UA 4BRIA 1T8EA 5AQLA 2O8EA 3SBGA 1RBSA 3DYAA 2EWSA 5TKWA 4LFBK 1TV6A 3SLCA 4CZIA 5C42A 4CF0A 3VQ6A 5FRMA 4FZXC 1JLQA 3I55N 1SQKA 1CXUA 1VSLA 4DWIA 3OYNA 4IXCA 3THXB 3N4QA 4DR4K 3HVTA 3CQYA 3AY9A 2XRIA 1BCMA 4DR5K 1JCGA 3OW2M 1TUUA 3BF3A 2QWLA 3OYCA 3QFUA 5BN8A 3DRPA 4Z4EA 1S1TA 2P9UB 4U7BA 4OKEA 4BY9C 4HUEA 5AR0A 4QS9A 3AO3A 4W5RA 1XHZA 3MCPA 4BR9A 2ZM6K 3DLEA 4FJJA 3C6HA 1JLBA 1QQMA 1WSFA 1ASVA 1W97L 3EL2A 4B9UA 4BC3A 1GOBA 5JMVA 2P5GA 4FVUA 1RT1A 3CCUN 3ZETB 3HI0A 3IUCA 3OYDA 4CERA 1Q7YO 1P90A 1SZ2A 3WUHA 4CF2A 1NK6A 2DTUA 4AHTA 3T69A 5M1QA 4E3SA 4BRNA 4FJXA 2HVIA 1FK9A 4W5TA 3LANA 4LY7A 2A42A 4JD2B 3NF8A 2DPNA 4H03B 4KHSA 2YHBA 5AQNA 3NVMA 1VQLN 1QVFM 3SQ1A 3SUQA 1NU0A 2KLAA 1Y97A 3U8XA 2HBJA 1CLQA 4WYBA 5EXWA 4E19A 2O8BA 1MWKA 3VA3A 1DEJA 4CK3A 2VG6A 3QICA 3T19A 4B1UB 1C1AA 4OX9K 4B9LA 3O1WA 5AQQA 4MFBA 1IV0A 3SZ2A 3LP1A 2IGIA 1ZBIA 4JKGA 3FZHA 4RWTA 1ZBHA 3VENA 3TARA 1WN7A 3E9LA 3NFAA 4O5FA 1KXPA 3MEGA 4CI6A 2OZSA 1HYSA 3T1YK 4H5TA 2Y1JA 3J7YP 4JI1K 4CGJA 4DUYK 4BC5A 4LF8K 1NKCA 4EHTA 4RTFD 3FGUA 4JS5A 3ISNC 4CW7B 1OH7A 4RW6A 5AFUH 3OYKA 2P9IA 4CHPA 4H5VA 3O9QA 1FJGK 4PL8A 1DLOA 4JK9A 4CIEA 1MA9B 4K43A 4ELVA 3LZIA 3E9OA 3V81A 4FWOA 5AZJA 1JL2A 3H46O 3TSUA 4K42A 2JGUA 3O4WA 3SV3A 1HKCA 1OKJA 4GKKK 5E26A 1VSEA 2HBLA 4FOEA 3PX0A 2QTDA 3ENBA 3R9PA 3AO5A 3S3NA 1ILYA 4WFBL 2NRZA 4M3ZA 3EKUA 2OCEA 4HTUA 2A5XA 1HKBA 3WNEA 4Z4GA 3KD5E 4CZLA 5AQHA 4CHQA 1YITN 3DLKA 3D7EO 4JI4K 3TSQA 1VQ8N 3L3UA 2ZJRL 1RBRA 4CCHA 3PSIA 3VA0A 3RRHA 4Z4CA 3FZKA 3QBWA 2XY8A 3QEWA 4JI5K 5AJ3K 4IO9L 3G0ZA 5KGXA 3DWLA 3CG7A 4M3XA 1RBVA 3U4LA 3SQ2A 1IBKK 4LFCK 4W5NA 4JLHA 3O5BA 2PYJA 3SAHA 2QKBA 3V1RA 3C6TA 3QMLA 4YORA 4DSIA 3C7NA 3DI6A 4KB1A 4DQPA 4A62A 3VF2A 1K8KA 2A40A 3L2QA 5LJWA 4FWMA 4FWPA 3CERA 2BTFA 5LJVA 5FPEA 3V9UA 1L5UA 1QVGM 4CK1A 4QOZB 4CEOA 3D2EA 2RKIA 1EX4A 4LF7K 3R8EA 4BROA 2DFFA 3ZSRA 1HKGA 1SL2A 3TAMA 5I3UA 3OS0A 1X9JA 5GINA 2VWKA 4ZHRA 4PWDA 3UB5A 1XMQK 4JI7K 1WOQA 2I7PA 4KHWA 4CZEA 1C0GA 1RTHA 1NGGA 4YDUC 2ITGA 4CJSA 1NGEA 2NRWA 3VQ5A 4CGIA 3WNHA 1QHAA 5B8HA 1IJJA 4RG8A 4A61A 4B9NA 4EAHD 3C65A 1EWRA 4IFYA 5H1SQ 2R7YA 3T1AA 1NGCA 3OY9A 1U2VA 3R6MA 2UUAK 4GVEA 3QDKA 4R5PA 4W5QA 3ZSXA 4I9LA 4H5NA 3M1FA 3GE1A 1FXXA 5EY4A 3M6GA 1DT9A 2HBKA 1TK0A 2Q3SA 3HL8A 1NG9A 2HHXA 1C0TA 1GLJO 2GUPA 2QK9A 3NF6A 3WXLA 3MAQA 1NK8A 4KTQA 1T44A 4DSFA 2ZWHA 4DU3A 4DQQA 3J8AA 3VEOA 4M3YA 2A41A 4CHZA 4JHDA 3SCXA 1U49A 4FLYA 3EZ5A 4FLTA 3T3FA 5CY4A 3HOTA 4DLEA 3V9XA 4BRDA 3S3OA 1KQSM 4ILHA 4A2BA 4GNIA 4H0OA 2E4LA 3CC4N 3V1OA 3DRRA 3B8AX 3LAKA 4FYDA 5IT9O 1RTIA 2FF6A 1IKXA 1RDUA 4RCHA 3G6EN 1VSDA 1GLBG 1G99A 5DM6L 3UKRB 4QCLA 2HMIA 3P31A 1NKBA 3EZWA 1S1VA 4H5WA 1L3TA 3S41A 4DV6K 2VQFK 3UKUB 1JLEA 4K41A 3B6OA 4BR0A 2G8HA 4KHQA 3O4QA 1ASUA 1Z6RA 4FK2A 4DG1A 4CJPA 1CZBA 2P9SB 4WCEL 3HPOA 1RFQA 4FW1A 5F0XA 4DHYA 2IVNA 3SMPA 4OKKA 1RT4A 4M7YA 1HX1A 4BRPA 4BVOA 3EE9A 1C0MA 1GLCG 2VGMA 4LH5A 4KREA 1NK9A 2XY6A 1N32K 1VSKA 1S1WA 4YOUA 3RMBA 3H45C 3HOSA 3A8YA 3VQAA 1WB9A 3V9ZA 3OS2A 1MWMA 5KQ8A 4I2PA 3L6QA 1U48A 2W6KA 1QZ5A 4FK0A 2YNGA 5LMNK 4AILC 2P5OA 1JCEA 4OGCA 2P9UA 4I2QA 4CJKA 3VQ8A 1V4TA 5I42A 2KFZA 3SV4A 3KJVA 5ELZA 4FWLA 4Y1DA 5AQFA 3C94A 2VYPA 4Z4HA 4BWJA 4HVJA 3ZSQA 3QEXA 3AO2A 1WSEA 4BACA 2IOCA 4BG9A 4BRCA 3HK2A 4FLUA 4MLHA 1TVRA 4QS8A 2UYTA 2ZE2A 5DK5A 3PSFA 2V7YA 3TAFA 4O8KA 1IKYA 1YAGA 3AVKA 1VQ5N 2D5RA 4B1ZA 4NCBA 4DR6K 4CJ3A 3K5LA 4XH4A 3VPZA 3VEXA 3NMUA 3DXMB 2YNIA 2WC9A 4CJ4A 3MCAB 3HP9A 3WT0A 3AVBA 5FPDA 1RDAA 3I8BA 2GBZA 4CFBA 4JKAA 1R0AA 3MN5A 4JD2A 1TAUA 1WSHA 3ULDA 1X9MA 2Q0RA 2JWKA 3KLHA 3MN9A 3HXMA 3F73A 3JAMO 1U45A 3LDLA 5JLFA 4YDUA 4JKDA 3KLEA 1S9GA 1KVCA 2FC0A 4ILGB 1VQ9N 3K2PA 5C12A 4DS5A 2Q2RA 3PO5A 3AVMA 3SUPA 3CQ8A 4F9OA 3VETA 4B3SK 3AO1A 5FROA 1NJZA 3LALA 1RGIA 4CZGA 2E8AA 1UAXA 1GLEG 1Q82O 2RE2A 2OA8A 5M1OA 2AP1A 3IFRA 4MDAA 1SV5A 1LCUA 2WFBA 2A1SA 3QNNA 3CJAA 4B9TA 3UE5A 2FLOA 1EXQA 3E01A 2V51B 3BY5A 1WBDA 4OJRA 3ID6A 1ATNA 4LH4A 4EIAA 3TSPA 3NH1A 3O6WA 4JRQA 1XC9A 4DQIA 4CF1A 4DR7K 1VHXA 1JXEA 2QWRA 3E9PA 2W42A 3P39A 1RT2A 4R79A 1E3MA 1JXBA 3T7ZA 5LMUK 2NNWA 3ZT4A 3OYMA 4WE1A 2WBNA 3OHRA 2NRXA 4FCYA 2E1ZA 4FWSA 4PUOA 3W0LA 3QETA 4EHUA 4ICLA 4AM6A 3FFIA 4L3QA 3L2RA 1HNXK 5J2QA 1D9FA 3OTOK 1M1KO 4ZTJA 5M1FA 1WSGA 1W7AA 4IEIA 4DCHA 3MX5A 4B1YB 3MEDA 3CHWA 4FOIA 1ATSA 3CI5A 5AQUA 2E2QA 5M1PA 2G8KA 4FM0A 3CCVN 1KAZA 4DFPA 2EX3A 3MK6A 1XQSC 4E89A 4H0YB 2G8FA 1WAFA 2DFHA 3LDPA 5T7BA 1ZBLA 4OLBA 3QINA 1RTDA 4KHYA 3C0BA 4OPJA 3VEZA 3T1HK 2P9PB 3QIOA 3L2VA 3TWHA 3OYFA 4OPHA 3PO4A 3NF7A 3ZEUA 4DTMA 4AHUA 4CFDA 2YJFA 3MWPA 3MXMA 1NGBA 4E7IA 3C6UA 2UUBK 5AZIA 4C1NI 5BPNA 1D5AA 4H0TB 1IKWA 5KTQA 3ZSYA 1YJNN 3GDQA 3F9MA 4GW6A 3ZSOA 1TAQA 5BR8K 4CEAA 1RILA 2YCHA 3ZT0A 1HJOA 5TKYA 5C2DA 1JJ2M 2P9NA 1NKEA 3CQXA 5HLFA 5AQVA 1T6CA 3QEPA 1KFDA 3QFPA 4DSLA 2P9LB 1Q86O 1GOAA 3FE1A 1JCFA 4AHVA 4NCGA 5C24A 4M41A 1ITGA 1ZBFA 2FSJA 3TAEA 4FVMA 4DS4A 5I9EB 4JI8K 3GL1A 4DTSA 4FM1A 4CJWA 2RHKA 1KAYA 5FPNA 3BUZB 3LP0A 1S6QA 4CGDA 3AVAA 3LDQA 3SQ4A 5J2NA 1KCFA 5GAEP 3NCIA 5C15A 4KKOA 4AQYK 4K25A 1TGOA 2VWBA 1J5EK 4DF8A 3AVJA 4CJLA 3LDSA 1T7PA 1QTMA 2V7ZA 2HNYA 4X62K 1IBMK 2PAVA 1BISA 4PKIA 4C8NA 3QNOA 4BQZA 2JWLA 3L0QA 1JLFA 2D0PA 3IAYA 4KFBA 1QE1A 5FLXO 1OH8A 4B8AB 1RT6A 4HWIA 3CPWM 1HR0K 2GWJA 3D6RA 5KPZA 3JXUA 3PUFA 3MXJA 1BCOA 3O3FA 4M7XA 5AQGA 1NOZA 3VQ7A 3G10A 4FWRA 1HUXA 4J8FA 4CF8A 5BPLA 5BN9A 4FPAA 1C1CA 2ZD1A 4H0PA 2UXDK 4JYAK 1NOYA 3H3NO 3CCJN 4NCAA 3GBTA 1EWQA 1XHXA 3CM6A 4E7HA 2GWKA 4WFAL 1QHTA 3F2KA 4QS7A 4YY3K 3HZ6A 4YHHK 1Q18A 2P1JA 2IDOA 4CJTA 1N34K 4X64K 4DU4A 4V19S 2HHHK 3PIPL 2UU9K 4H5RA 4CJUA 4FWNA 4PKGA 3VF4A 2A1RA 3UKRA 4AH9A 4FK4A 4JI6K 4J2EA 4FZZA 2ZGYA 3LP3A 1X9WA 5C25A 1U6ZA 4GKJK 3UKUA 1XC3A 2BANA 4CD1A 4LF5K 4YOTA 4IOCL 3VESA 2IVPA 4F3TA 3M8SA 2P9SA 4KB0A 5SZTA 3EO3A 3DXKB 3BEXA 2HHUA 1EO1A 1IG8A 5FDLA 4QAGA 4EZ9A 2QXFA 5BPMA 1KLNA 2BGGA 3M8PA 4AHSA 5C2FA 1SS6A 4KHPK 3K5OA 3VQCA 4FJGA 4E7KA 4BR5A 2HOEA 1T6DA 2QKKA 2CH6A 3O8MA 3THWB 4PA1A 5KGWA 5J2PA 3DJCA 5AFUA 1XMOK 4GV6A 4CJ5A 1BWFO 4BRQA 2YHYA 4FWQA 1JLAA 4FJLA 1JLCA 2J4RA 3ZEUB 1N36K 4NO7A 4EFHA 2P51A 3D2FA 5AZIB 5AQMA 4IZ9A 4IOXA 4FLVA 3U9DA 4DFJA 5E41A 4IEEA 5IWAK 4Z94A 4B3TK 1U04A 4CJVA 4DTPA 1SL0A 1KTQA 1U47A 3A5MC 5J1EA 1HNZK 4ID5A 2OYQA 4IJNA 2QI2A 2P9NB 3U6FA 1TKTA 1W9HA 4IG0A 3RSEB 3TANA 5KPRA 5LY3A 5ADXH 4YFUA 1BUPA 2E6MA 4KRFA 4CJRA 1K73O 2FSKA 1G15A 1FKOA 4F3OA 1VAZA 2PZSA 1NGFA 3G71N 2NRVA 4FLXA 1N8RO 3BF1A 3V4IA 4JNEA 3DXMA 1T05A 3RR7A 5CYQA 4PQUA 5GIOA 5M1NA 4ISFA 4OO1J 3P4IA 3I0RA 1NK0A 5A2QO 2RPIA 1BU6O 5EOYA 5AQSA 4E1NA 4BQLA 3KVGA 4OPKA 1LWCA 3I0SA 5BRFA 3JSMA 1X9SA 3AGKA 2YHXA 4C8LA 2ZJPL 3DOKA 3ULEB 4BG8A 5BRHA 1BDGA 1Q9XA 2D0CA 4EZ6A 3HBTA 1BA0A 3MX2A 2OZMA 3BZCA 4I6MA 1J54A 4DSKA 4CEDA 3P5JA 4LFAK 2D0BA 4BGAA 1VSJA 3ZYYX 1TL3A 2YNHA 4WQ5A 3WXIA 2DFEA 3DMJA 3LZJA 4FL9A 4IJAA 4KI4A 1BG3A 5M1KA 4JRPA 1K8AO 2I7NA 1GLFO 2ETJA 1B9DA 4YOYA 3GOIA 5AQRA 2P9KB 1IKVA 4G9ZA 1S9EA 1X3NA 3DLRA 2O8CA 1NGHA 3J7AP 2NUBA 3WNGA 3OYIA 4K8ZA 2OPPA 2OTJN 3K9KA 3JS6A 3KK3A 4HCBA 3H1QA 2H3GX 3DLLL 3MWTA 5FPMA 1BA1A 3QESA 5AQTA 4CJFA 4CBUA 1JL1A 1YTUA 4CHOA 1NM1A 3ZSWA 2O8FA 1I94K 1XNRK 4CIGA 2HNDA 4DTXA 4M45A 2VCPA 4OKJA 4C23A 2HHQA 5FRNA 3CJCA 4CEQA 2F9WA 2XY5A 3VGMA 2D0AA 5HRRA 5JICA 2Z1IA 1W0HA 1YHQN 3WNFA 2B6AA 2Q0UA 2FBTA 4BVPA 1RCHA 3CC7N 3SQ0A 1LOTB 3OYHA 4B08A 2HHTA 4TSXA 5KQDA 5GAHP 1C6VA 4NB4A 3NH2A 3SI6A 4BR2A 4BDYA 1QQCA 3ASMA 1BIUA 1E4GT 1J53A 3EE8A 4WFNL 3CPEA 2JLEA 2A6AA 5JS1A 5HRPA 1EP4A 1RBUA 1RDDA 2P9PA 4NYNA 2WTUA 1TKXA 3A5OC 4CBWA 5HROA 3A5LC 3HSTB 2ASOA 1SL1A 3J80O 4CGHA 4DMNA 3I56N 4YNQA 3PX4A 4FJNA 2VQEK 1QQOA 3TABA 1RBTA 4IFVA 1OVQA 4B9QA 1GLDG 3D2FB 3NGIA 3NF9A 4BRLA 4DQRA 4GVMA 2PYLA 2IC3A 3LPUA 4ELTA 5KRTA 2IAJA 3LPTA 2UXCK 3D0PA 1VQ4N 1X1PA 2V52B 3H6EA 4UY8O 5C0YA 4CZHA 1MU2A 3BGRA 5HOOA 2I5JA 4KH6A 3S3MA 1L3SA 3SJHA 5GIPA 3GG4A 1MDUB 3MN7A 1R59O 5JVGL 3SUOA 4JKCA 2P9LA 4FPBA 4XEIA 3CXCM 3HTVA 1T3VA 3VQ9A 1B92A 3MEEA 3AVNA 1D4XA 3LWLA 4HUFA 3OYAA 1VRUA 4OPAA 2UUCK 3OVNA 1S1UA 4MLEA 4B1WB 3MXIA 4Q0BA 3CIPA 1VQ7N 1LAWA 4CEFA 3F5TA 2FBYA 3QBXA 1WUAA 3U3GA 5JS2A 1C1BA 3IS9A 1Q8IA 5AQOA 2FF3B 3R3LA 3OYLA 5JVHL 5GADP 2NRHA 5K14A 3O4NA 1NJWA 2HHWA 4IDKA 1NJIO 3DRSA 2QWQA 1ASWA 5CHIA 2Z1GA 1DGKN 1A5VA 2Q31A 3SYZA 4BDZA 3TAQA 4F4KA 4DSEA 3HSCA 3TTCA 1XWLA 2WONA 2X6SA 1BHLA 1GLAG 3CCLN 3AVLA 3OYJA 3VTIA 1VSFA 3AVGA 2F96A 4B1VA 1HPMA 1RDBA 4FJ5A 1RTJA 2GELA 1LV5A 4EP5A 3WXMB 3TPQA 4I6MB 3VMFB 3J7ZO 4KO0A 3SMSA 2DY4A 4DQSA 3SJJA 2Z1HA 4GY2B 4BE2A 1X3MA 4DV7K 3L4QA 2ZJQL 1VSIA 2O4IA 3L8BA 4Y0WA 4KTZA 1BO5O 3K5NA 1E4FT 1DTQA 3K57A 3AAQA 4K0KK 2X74A 2YKNA 2G8WA 3LWMA 3O08A 1VK0A 1XI1A 4DV4K 2NRRA 4YOWA 2ASPA 1TKZA 4FO0A 4BGBA 2O8CB 3QLHA 1Z26A 2YJEA 4Z0UA 1QSSA 4CJEA 1DTTA 3HP6A 2D0OA 4PKHA 2O8DB 2B4JA 1RT5A 4DKWA 3KWGA 2KZZA 3FZLA 2HF3A 2HHSA 3P1GA 2O8FB 1ZYQA 4O5BA 4Z4IA 4GV3A 1ESVA 1OVYA 4IOAL 3HPHA 1BQMA 2YX6A 3IG1A 2GV9A 4FJMA 2VG7A 4FXDA 2ITMA 5DM7L 2CGLA 1QQNA 3QIPA 4PY5A 3LL3A 3M8RA 3IRXA 4CK2A 2HF4A 1HNVA 3NAEA 1KAXA 3DXKA 2E2PA 3DAWA 1T03A 5J2MA 1HMVA 3KK7A 1TK5A 4OVLA 2BE2A 3THVA 2RN2A 1JLGA 3FFKB 3FZFA 3V9SA 4C8MA 3BDPA 3DM2A 1S3XA 1I39A 3PY8A 1LW2A 3THWA 1BGXT 3QO9A 1SKWA 4Z4FA 3AGRA 1Y64A 3AVFA 1OH5A 3SNNA 3KTQA 1O13A 3O3HA 1HLUA 4KHUA 5EU7A 1NJYA 4FJ7A 4DTOA 5AQPA 1A5WA 4CF9A 3KD1E 2NZTA 3TI0A 1VQPN 2AJQA 4NLCA 3O3GA 4IFEA 2E2NA 3VEVA 4DFMA 1KRPA 4JAXA 4UQGA 4JK8A 2YV0X 4A59A 2WOMA 4IBNA 3LM9A 1N33K 1XNQK 3ZLJA 3L2WA 4DUZK 3CJ7A 3L4IA 3N4PA 3OYBA 2VG5A 4N76A 4AF1A 3RSEA 3JYTA 2XHBA 2D1KA 3QERA 1UA0A 4M3UA 3VF6A 4OLAA 1BOTO 1ZBUA 3ALYA 4HCCA 3WQUA 3CD6N 5AQIA 3CCQN 4FJHA 3HRGA 4ISEA 1YVUA 2FBVA 4FZYA 1TL1A 1OH6A 1P8ZA 3O9UA 4CECA 4CEZA 5KPTA 4KAZA 3AA2A 3O9SA 3IMXA 4IG3A 2OPRA 3NH0A 4DV1K 3THYB 2KTQA 3WXJA 4DFKA 1J9AA 1D8YA 4B3RK 5CR4A 4DR2K 1S22A 3MDQA 4E1MA 3LDNA 4A57A 1HQEA 2HB5A 3NGYA 2E5LK 3PLAA 2G8IA 5CZ2A 3NHGA 3S9HA 2E88A 3ULEA 3ZSVA 4BRHA 4E1JA 4CD3A 2BH1A 4KTWA 1UA1A 3ITHA 1IG9A 3SPZA 4KH5A 1RT3A 4BWMA 4DF4A 4WQ5C 3H08A 1Q81O 4GV9A 4DR3K 4M3TA 2IVOA 1YVNA 1LWEA 4BR7A 1TYQB 1J5OA 3OBYA 3ENHA 1YT3A 2ATQA 4BE0A 2W41A 3NVKA 2HW3A 3K9JA 3CJBA 4WQ4C 2P9KA 4BREA 3WEEB 5E84A 1BI4A 1CZAN 3LM2A 3OBWA 2XO7A 1L3VA 4AHRA 3AVCA 4XH5A 3TAGA 4RW4A 1QS4A 4JKHA 3G4SN 4ID1A 2O4GA 1GOCA 4O0IA 4NLBA 1Z05A 3K59A 1U4BA 4ELUA 3BZKA 4H0VB 5F1XA 1FW6A 4MQ3A 1XUPO 3SK3A 3CCMN 2GTDA 1VRTA 3PIOL 2F8TA 5CYMA 2B5JA 4U67L 1YF5L 3LP2A 2OTLN 5GAGP 4JI0K 1H1VA 3KZBA 3AA5X 2CGJA 1ZXOA 4FJ8A 3HM8A 3DLHA 2PFUA 3AVIA 1S6PA 1LWFA 5AQXA 4B3OA 4F2SA 3VQPA 4ZTFA 3CC2N 3CJ1A 2QWPA 3LDOA 4DLGA 4CVNE 3ATUA 5AQYA 5EX5A 4DV0K 1S5JA 4BDPA 4CBXA 3V6DA 1YJ9N 4BRMA 4KPYA 2G8UA 2KZMA 4BRGA 3HVRA 4L8RB 3KLIA 4JEPA 3L3VA 1LAVA 2CGKA 4YOVA 1DKGD 4O4GA 1S1XA 4B9SA 1KLMA 2OPSA 1B9FA 1KSPA 5MLCQ 3ZT3A 2WUSA 3KLFA 4Q5VA 1KC8O 2Q1NA 4CHNA 2Q97A 4CEBA 1K6YA 3VERA 1C0UA 2YI1A 3DLGA 2PY5A 5CE3A 4DV3K 2O8EB 1YTAA 1TK8A 4RW7A 4B9VA 2IIRA 2KHOA 4DSJA 3OS1A 2YNFA 1K9MO 4H0XB 3OJUA 3O9TA 4JI2K 3WQTA 1RNHA 3EYZA 2VWJA 4I9QA 1NMNA 1HNWK 1C0FA 4H8KA 2PBDA 3BP8A 3VTHA 2QWMA 4KBOA 1HPZA 3KIOA 2F8SA 1BIZA 3MN6A 3PX6A 3DLBA 3AA4A 3AO4A 3ID8A 5CZ1A 4KHNA 2E2OA 1QZ6A 4IWVA 3HYFA 4M3RA 4O44A 1WSIA 1NGAA 2HHVA 4IDHA 4FWKA 1TUYA 3I33A 3KHYA 4CZKA 2YHAA 3VQBA 3CMAN 1WBBA 4Y1CA 1NNEA 4OGEA 4C8OA 2X6NA 3NBPA 4BR4A 4JV5K 4J2BA 3MMVA 2YKMA 4IKFA 2E6LA 4BC4A 4B1XB 3HM9A 4LF9K 3CETA 2KW4A 4JS4A 1YI2N 3H3OB 5HP1A 4G1QA
chains in the Genus database with same CATH topology
3LP1A 2IGIA 3P83D 3I8DA 3S3MA 4ZTJA 1L3SA 1WSGA 1ZBIA 1HNIA 1ZBHA 3MEDA 3SUOA 3TARA 3RRGA 3OJSA 1WN7A 2G8KA 4FM0A 1UWBA 3VQ9A 3NFAA 2OPQA 4DTJA 1B92A 3MEGA 3MEEA 4DFPA 2OZSA 1HYSA 2EX3A 1EKEA 3RMDA 3AVNA 3ZT1A 4E89A 3LWLA 3EY1A 4HUFA 2Y1JA 3OYAA 2G8FA 4FM2A 1VRUA 1WAFA 3OVNA 1S1UA 2DFHA 4CGJA 3MXIA 4J2DA 2EHGA 4Q0BA 1NK5A 5T7BA 1LAWA 4CEFA 1NKCA 1ZBLA 4OLBA 3QINA 2FBYA 1RTDA 1BQNA 5J2QA 4JS5A 1CXQA 4B8CA 3ISNC 4OPJA 3QEVA 3U3YA 2BDPA 4KHYA 1HYZA 4RW9A 3U3GA 5JS2A 1C1BA 3IS9A 1Q8IA 1NJXA 3QIOA 3L2VA 3TWHA 3OYLA 4I7FA 4RW6A 3OYFA 4KI6A 2KFNA 1KVAA 3NF7A 4DTMA 3PO4A 4AHUA 3OYKA 3KKSA 3K5MA 4CFDA 5K14A 4CHPA 3O4NA 3MXMA 2HVHA 1BI4B 1NJWA 1DLOA 4IDKA 4E7IA 3C6UA 4HHTA 4RW8A 2HHWA 2Z1JA 1D5AA 4CIEA 1IKWA 5KTQA 3DRSA 4ELVA 1ASWA 1Z25A 3ZSYA 3LZIA 3V81A 2Z1GA 4GW6A 4B9MA 1A5VA 3ZSOA 1TAQA 1JL2A 4H4OA 3SYZA 4BDZA 3TAQA 4CEAA 4F4KA 1NK4A 4DSEA 1RILA 4G1QA 2JGUA 3ZT0A 3SV3A 1XWLA 2WONA 3ZSZA 2X6SA 1BHLA 1NKEA 5HLFA 3QEPA 1SKSA 1N5YA 4M42A 1VSEA 3AVLA 3OYJA 3OYEA 1KFDA 4DSLA 4J2AA 1VSFA 3AVGA 2F96A 4CGFA 3PX0A 3SPZA 3B6PA 1XHZA 1RDBA 4FJ5A 3AO5A 1GOAA 1RTJA 3S3NA 4DTRA 4CJQA 4M3ZA 4AHVA 4NCGA 4EP5A 1LV5A 5C24A 3CYMA 4M41A 1ITGA 4KO0A 1ZBFA 3TAEA 2DY4A 4HTUA 4DQSA 4FVMA 3WNEA 3SJJA 2Z1HA 3KD5E 4BE2A 4DS4A 1UOCA 4Z4GA 4CHQA 1N6QA 3DLKA 1VSIA 2GUIA 4DTSA 2O4IA 3L8BA 4CJWA 4FM1A 4KTZA 2LSNA 4CFCA 5HBMA 4CESA 3L3UA 3K58A 1RBRA 3LP0A 1S6QA 3K5NA 4CGDA 4CCHA 3VA0A 3RRHA 1DTQA 3K57A 5SWMA 4KV8A 4Z4CA 2X74A 3AVAA 3MECA 1VSMA 3SQ4A 5KRSA 2XY8A 5J2NA 3QEWA 1KCFA 2YKNA 3NCIA 1QSYA 3VQ4A 2G8WA 3LWMA 1VK0A 1XI1A 4KKOA 1TKZA 4NYFA 1TGOA 2KQ2A 3V9WA 3G0ZA 5KGXA 3QLHA 4DF8A 3CG7A 4M3XA 1RBVA 1Z26A 3AVJA 4Z0UA 4CJLA 1QSSA 3SQ2A 4CJEA 3LDSA 1KFSA 4W5NA 4JLHA 3TR8A 1T7PA 1DTTA 1QTMA 3HP6A 2PYJA 2B4JA 1RT5A 4O55A 2HNYA 2QKBA 3V1RA 3C6TA 1BISA 4C8NA 2KZZA 3QNOA 4DSIA 2HHSA 3P1GA 3DI6A 4KB1A 1JLFA 4DQPA 4FLZA 1ZYQA 4O5BA 5D3GA 1F21A 4KFBA 3IAYA 1QE1A 4Z4IA 1REVA 3L2QA 1TKDA 1WAJA 3HPHA 1BQMA 3IG1A 4B8AB 1RT6A 4N5SA 2GV9A 4FJMA 2VG7A 4FXDA 3PUFA 3MXJA 3V9UA 1L5UA 3L2UA 3QIPA 1O1WA 4CK1A 1BCOA 3O3FA 3RWUA 3HJFA 2IS3A 4PY5A 4QOZB 1NOZA 3AA3A 3M8RA 4CEOA 3VQ7A 3G10A 3IRXA 3PV8A 2RKIA 4CK2A 1KVBA 1HNVA 3OYGA 1EX4A 4CF8A 4LD0A 3NAEA 2DFFA 1C1CA 2ZD1A 1T03A 3ZSRA 5J2MA 1HMVA 4HUGA 1SL2A 3TAMA 5I3UA 1NOYA 3OS0A 1TK5A 4FJKA 1SKRA 4OVLA 2BE2A 3DOLA 3THVA 2VWKA 4ZHRA 4PWDA 4NCAA 2RN2A 1JLGA 1XHXA 3V9SA 3CM6A 4C8MA 4KHWA 4E7HA 3DM2A 3BDPA 1I39A 1RTHA 3PY8A 1LW2A 1QHTA 2ITGA 1BGXT 3QO9A 4AHCA 1QSLA 2X78A 1SKWA 4CJSA 2RF2A 5KI6A 3VQ5A 2P1JA 4CGIA 4Z4FA 3WNHA 2IDOA 3VQQA 4CJTA 3AVFA 3SNNA 5HRNA 4RG8A 3KTQA 4B9NA 4DU4A 3O3HA 4KHUA 4IFYA 3VQEA 4CJUA 2R7YA 4F2RA 3T1AA 5EU7A 3OY9A 1LW0A 2A1RA 1NJYA 4AH9A 4FJ7A 4DTOA 4FK4A 4R5PA 4W5QA 3ZSXA 4J2EA 4FZZA 1HJRA 1JKHA 1A5WA 4I9LA 4CF9A 4E7LA 3LP3A 3TI0A 4E7JA 1X9WA 5C25A 3KD1E 4CFAA 1FXXA 2Y1IA 2AJQA 3O3GA 1RT7A 1TK0A 3NGZA 1RDCA 3HO1A 4DFMA 2Q3SA 1KRPA 4LSNA 2BANA 3HL8A 4UQGA 2HHXA 2YV0X 1C0TA 2WOMA 4IBNA 2QK9A 3NF6A 1NK8A 3MAQA 4KTQA 4F3TA 2G8VA 3M8SA 3L2WA 4KB0A 5SZTA 4CEEA 4FJ9A 4DSFA 4DU3A 3OYBA 2VG5A 4DQQA 4N76A 3V1QA 2HHUA 4M3YA 1I3AA 4CHZA 3JYTA 3NDKA 2XHBA 5FDLA 4QAGA 3QERA 4EZ9A 1UA0A 4K8XA 2QXFA 4M3UA 3SCXA 1U49A 4FLYA 3EZ5A 4FLTA 3T3FA 3M8PA 4AHSA 1KLNA 2BGGA 4OLAA 3ALYA 1ZBUA 5CY4A 4HCCA 4DTUA 3K5OA 3VQCA 4DLEA 4FJHA 4FJGA 3LAMA 4E7KA 3V9XA 3A2FA 3SPYA 1YVUA 3S3OA 2QKKA 4PA1A 2FBVA 2E4LA 3M8QA 4FZYA 3V1OA 3RTVA 1TL1A 1BL3A 3DRRA 4CEZA 4CECA 5KGWA 3LAKA 5J2PA 4KAZA 3AA2A 4FYDA 1RTIA 1IH7A 4IG3A 1IKXA 2OPRA 4CJ5A 3NH0A 2KTQA 3SUNA 4DFKA 3RMAA 1JLAA 4M3WA 1SUQA 1JLCA 4FJLA 1HQUA 1VSDA 1J9AA 4N56A 1D8YA 3NE6A 4QCLA 3F9KA 2HMIA 1WSJA 3RMCA 1NKBA 2ZQBA 3TAPA 2P51A 1S1VA 3KKRA 1FKPA 1L3TA 3AVHA 4E1MA 1HQEA 4FLVA 2HB5A 4DFJA 5E41A 1JLEA 1CZ9A 3NGYA 4BE1A 3B6OA 2G8IA 5CZ2A 3NHGA 3S9HA 1U04A 2G8HA 4KHQA 4CJVA 3O4QA 5HRSA 1ASUA 4FK2A 4DG1A 3ZSVA 1KTQA 4DTPA 4CJPA 1U47A 1SL0A 1CZBA 5J1EA 3ZT2A 4ID5A 2OYQA 4F8RA 3HPOA 4LSLA 4FW1A 3KK2A 4KTWA 1UA1A 3ITHA 1L3UA 3U6FA 1IG9A 4FJIA 1TKTA 1W9HA 1RT3A 4BWMA 3AV9A 4IG0A 4CGGA 4DF4A 2HNZA 4OKKA 3TANA 1RT4A 3VQDA 3H08A 3C95A 3KLGA 3ZCMA 4YFUA 2E6MA 4H4MA 1HRHA 4M3TA 3CM5A 4KRFA 4CJRA 4O0JA 1C0MA 1LWEA 3CFPA 4LH5A 1G15A 4KREA 1WNSA 1NK9A 1J5OA 2XY6A 1FKOA 3UIQA 4F3OA 3CFRA 2PZSA 1YT3A 2ATQA 1VSKA 4BE0A 2HW3A 1S1WA 3RMBA 4FLXA 4N41A 1HYVA 3VQAA 4EP4A 3V9ZA 3OS2A 4E0DA 4CE9A 3V4IA 1D9DA 3RR8A 1BI4A 4I2PA 3QEIA 1T05A 2FBXA 4N47A 3VN5A 3RR7A 5CYQA 2XO7A 1U48A 1L3VA 4PQUA 4AHRA 4FW2A 1WLJA 3AVCA 3HPGA 4CHYA 3I0RA 1NK7A 4FLWA 1NK0A 3TAGA 4C8KA 4CIFA 2RPIA 2YNGA 4AILC 4RW4A 1QS4A 4E1NA 4XIUA 4OPKA 4DU1A 2P5OA 1LWCA 4OGCA 3I0SA 4ID1A 2O4GA 3JSMA 4I2QA 4CJKA 1X9SA 1GOCA 4O0IA 4W5OA 3VQ8A 2XY7A 5I42A 2KFZA 4GMJB 3SV4A 1IO2A 4C8LA 3D45A 3KJVA 1EETA 3K59A 1U4BA 4Y1DA 3DOKA 5DMRA 3C94A 4Z4HA 3HT3A 4ELUA 4BWJA 4HVJA 3ZSQA 3QEXA 1A5XA 4MQ3A 4DTNA 1Q9XA 1VRTA 3KK1A 2D0CA 4EZ6A 2F8TA 3AO2A 5CYMA 2B5JA 3LP2A 1Q9YA 3CFOA 2OZMA 1WSEA 4BACA 1VSHA 1J54A 2IOCA 4CEDA 4DSKA 3P5JA 3HK2A 4FLUA 1T8EA 3AA5X 2D0BA 4FJ8A 1TVRA 1VSJA 3DLHA 3AVIA 1TL3A 2ZE2A 1S6PA 2YNHA 5DK5A 1RBSA 3DYAA 2DFEA 1LWFA 3DMJA 3LZJA 3TAFA 1TV6A 4B3OA 1IKYA 3AVKA 5C42A 4CF0A 3VQ6A 5FRMA 4F2SA 3VQPA 1JLQA 4FZXC 4JRPA 4ZTFA 4KI4A 2D5RA 4NCBA 2ETJA 1B9DA 4CJ3A 3K5LA 1CXUA 1VSLA 4DWIA 4DLGA 3OYNA 1IKVA 1S9EA 3HVTA 2YNIA 2XRIA 1BCMA 3DLRA 4CJ4A 1S5JA 3HP9A 2NUBA 3AVBA 3WNGA 3OYIA 4BDPA 4K8ZA 1RDAA 2OPPA 2GBZA 4CFBA 3OYCA 3KK3A 3V6DA 1R0AA 4HCBA 1TAUA 4KPYA 4Z4EA 3DRPA 2G8UA 1WSHA 3ULDA 2KZMA 1S1TA 3HVRA 4L8RB 3QESA 1X9MA 4CJFA 3KLIA 4OKEA 3KLHA 4FK0A 3L3VA 1LAVA 1JL1A 1D9FA 1YTUA 4HUEA 4O4GA 3HXMA 3F73A 1U45A 4CHOA 3ZSWA 1S1XA 3KLEA 4B9SA 1KLMA 2HNDA 2OPSA 3AO3A 1B9FA 1S9GA 4M45A 1KVCA 2FC0A 4OKJA 4W5RA 4DTXA 1KSPA 3ZT3A 5FRNA 2HHQA 3DLEA 4FJJA 3KLFA 1JLBA 4Q5VA 3K2PA 4CHNA 4DS5A 1WSFA 4CEQA 1ASVA 2XY5A 3PO5A 3AVMA 1K6YA 4CEBA 3SUPA 1C0UA 4B9UA 3CQ8A 2P5GA 1GOBA 2D0AA 3DLGA 5HRRA 1RT1A 2Z1IA 2PY5A 3AO1A 1W0HA 5FROA 3OYDA 1YTAA 4CERA 3WNFA 1NJZA 4RW7A 3LALA 1TK8A 4B9VA 2B6AA 4CF2A 1UAXA 1NK6A 4DSJA 2FBTA 3OS1A 2DTUA 4AHTA 2YNFA 1RCHA 2OA8A 3OJUA 3SQ0A 2HHTA 3OYHA 4B08A 1SV5A 2A1SA 4TSXA 1RNHA 3EYZA 3QNNA 2VWJA 1C6VA 4E3SA 4B9TA 4FJXA 3NH2A 3SI6A 1EXQA 4I9QA 4BDYA 3E01A 2HVIA 1QQCA 3ASMA 1BIUA 1J53A 4OJRA 4H8KA 1FK9A 4W5TA 3LANA 4LY7A 4LH4A 2JLEA 3NF8A 1HPZA 3KIOA 3NH1A 2F8SA 5JS1A 1BIZA 5HRPA 3PX6A 1EP4A 1RBUA 1RDDA 4JRQA 1XC9A 3DLBA 4DQIA 4NYNA 4CF1A 2YHBA 4KHSA 1TKXA 3AA4A 3AO4A 4KHNA 5CZ1A 5HROA 3SQ1A 3HYFA 3HSTB 4M3RA 3SUQA 4O44A 1WSIA 1JXEA 1SL1A 2HHVA 4CGHA 4DMNA 2W42A 2YHAA 4YNQA 3VQBA 4CIGA 1Y97A 1RT2A 3PX4A 4FJNA 3TABA 1CLQA 1RBTA 4Y1CA 1JXBA 4IFVA 4OGEA 4E19A 4C8OA 3ZT4A 2X6NA 3VA3A 3OYMA 3NBPA 4WE1A 4CK3A 2VG6A 4J2BA 2YKMA 3NGIA 3NF9A 3T19A 4DQRA 1C1AA 4FCYA 4IKFA 2E6LA 4GVMA 2PYLA 2IC3A 3LPUA 4B9LA 4ELTA 5KRTA 3HM9A 2IAJA 3QETA 4PUOA 3LPTA 4ICLA 3FFIA 4MFBA 3L2RA 1X1PA 3D0PA 2KW4A 4JS4A 1MU2A 3SZ2A 3BGRA 5HP1A 2I5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LP1 A;  2IGI A;  3P83 D;  3I8D A;  3S3M A;  4ZTJ A;  1L3S A;  1WSG A;  1ZBI A;  1HNI A;  1ZBH A;  3MED A;  3SUO A;  3TAR A;  3RRG A;  3OJS A;  1WN7 A;  2G8K A;  4FM0 A;  1UWB A;  3VQ9 A;  3NFA A;  2OPQ A;  4DTJ A;  1B92 A;  3MEG A;  3MEE A;  4DFP A;  2OZS A;  1HYS A;  2EX3 A;  1EKE A;  3RMD A;  3AVN A;  3ZT1 A;  4E89 A;  3LWL A;  3EY1 A;  4HUF A;  2Y1J A;  3OYA A;  2G8F A;  4FM2 A;  1VRU A;  1WAF A;  3OVN A;  1S1U A;  2DFH A;  4CGJ A;  3MXI A;  4J2D A;  2EHG A;  4Q0B A;  1NK5 A;  5T7B A;  1LAW A;  4CEF A;  1NKC A;  1ZBL A;  4OLB A;  3QIN A;  2FBY A;  1RTD A;  1BQN A;  5J2Q A;  4JS5 A;  1CXQ A;  4B8C A;  3ISN C;  4OPJ A;  3QEV A;  3U3Y A;  2BDP A;  4KHY A;  1HYZ A;  4RW9 A;  3U3G A;  5JS2 A;  1C1B A;  3IS9 A;  1Q8I A;  1NJX A;  3QIO A;  3L2V A;  3TWH A;  3OYL A;  4I7F A;  4RW6 A;  3OYF A;  4KI6 A;  2KFN A;  1KVA A;  3NF7 A;  4DTM A;  3PO4 A;  4AHU A;  3OYK A;  3KKS A;  3K5M A;  4CFD A;  5K14 A;  4CHP A;  3O4N A;  3MXM A;  2HVH A;  1BI4 B;  1NJW A;  1DLO A;  4IDK A;  4E7I A;  3C6U A;  4HHT A;  4RW8 A;  2HHW A;  2Z1J A;  1D5A A;  4CIE A;  1IKW A;  5KTQ A;  3DRS A;  4ELV A;  1ASW A;  1Z25 A;  3ZSY A;  3LZI A;  3V81 A;  2Z1G A;  4GW6 A;  4B9M A;  1A5V A;  3ZSO A;  1TAQ A;  1JL2 A;  4H4O A;  3SYZ A;  4BDZ A;  3TAQ A;  4CEA A;  4F4K A;  1NK4 A;  4DSE A;  1RIL A;  4G1Q A;  2JGU A;  3ZT0 A;  3SV3 A;  1XWL A;  2WON A;  3ZSZ A;  2X6S A;  1BHL A;  1NKE A;  5HLF A;  3QEP A;  1SKS A;  1N5Y A;  4M42 A;  1VSE A;  3AVL A;  3OYJ A;  3OYE A;  1KFD A;  4DSL A;  4J2A A;  1VSF A;  3AVG A;  2F96 A;  4CGF A;  3PX0 A;  3SPZ A;  3B6P A;  1XHZ A;  1RDB A;  4FJ5 A;  3AO5 A;  1GOA A;  1RTJ A;  3S3N A;  4DTR A;  4CJQ A;  4M3Z A;  4AHV A;  4NCG A;  4EP5 A;  1LV5 A;  5C24 A;  3CYM A;  4M41 A;  1ITG A;  4KO0 A;  1ZBF A;  3TAE A;  2DY4 A;  4HTU A;  4DQS A;  4FVM A;  3WNE A;  3SJJ A;  2Z1H A;  3KD5 E;  4BE2 A;  4DS4 A;  1UOC A;  4Z4G A;  4CHQ A;  1N6Q A;  3DLK A;  1VSI A;  2GUI A;  4DTS A;  2O4I A;  3L8B A;  4CJW A;  4FM1 A;  4KTZ A;  2LSN A;  4CFC A;  5HBM A;  4CES A;  3L3U A;  3K58 A;  1RBR A;  3LP0 A;  1S6Q A;  3K5N A;  4CGD A;  4CCH A;  3VA0 A;  3RRH A;  1DTQ A;  3K57 A;  5SWM A;  4KV8 A;  4Z4C A;  2X74 A;  3AVA A;  3MEC A;  1VSM A;  3SQ4 A;  5KRS A;  2XY8 A;  5J2N A;  3QEW A;  1KCF A;  2YKN A;  3NCI A;  1QSY A;  3VQ4 A;  2G8W A;  3LWM A;  1VK0 A;  1XI1 A;  4KKO A;  1TKZ A;  4NYF A;  1TGO A;  2KQ2 A;  3V9W A;  3G0Z A;  5KGX A;  3QLH A;  4DF8 A;  3CG7 A;  4M3X A;  1RBV A;  1Z26 A;  3AVJ A;  4Z0U A;  4CJL A;  1QSS A;  3SQ2 A;  4CJE A;  3LDS A;  1KFS A;  4W5N A;  4JLH A;  3TR8 A;  1T7P A;  1DTT A;  1QTM A;  3HP6 A;  2PYJ A;  2B4J A;  1RT5 A;  4O55 A;  2HNY A;  2QKB A;  3V1R A;  3C6T A;  1BIS A;  4C8N A;  2KZZ A;  3QNO A;  4DSI A;  2HHS A;  3P1G A;  3DI6 A;  4KB1 A;  1JLF A;  4DQP A;  4FLZ A;  1ZYQ A;  4O5B A;  5D3G A;  1F21 A;  4KFB A;  3IAY A;  1QE1 A;  4Z4I A;  1REV A;  3L2Q A;  1TKD A;  1WAJ A;  3HPH A;  1BQM A;  3IG1 A;  4B8A B;  1RT6 A;  4N5S A;  2GV9 A;  4FJM A;  2VG7 A;  4FXD A;  3PUF A;  3MXJ A;  3V9U A;  1L5U A;  3L2U A;  3QIP A;  1O1W A;  4CK1 A;  1BCO A;  3O3F A;  3RWU A;  3HJF A;  2IS3 A;  4PY5 A;  4QOZ B;  1NOZ A;  3AA3 A;  3M8R A;  4CEO A;  3VQ7 A;  3G10 A;  3IRX A;  3PV8 A;  2RKI A;  4CK2 A;  1KVB A;  1HNV A;  3OYG A;  1EX4 A;  4CF8 A;  4LD0 A;  3NAE A;  2DFF A;  1C1C A;  2ZD1 A;  1T03 A;  3ZSR A;  5J2M A;  1HMV A;  4HUG A;  1SL2 A;  3TAM A;  5I3U A;  1NOY A;  3OS0 A;  1TK5 A;  4FJK A;  1SKR A;  4OVL A;  2BE2 A;  3DOL A;  3THV A;  2VWK A;  4ZHR A;  4PWD A;  4NCA A;  2RN2 A;  1JLG A;  1XHX A;  3V9S A;  3CM6 A;  4C8M A;  4KHW A;  4E7H A;  3DM2 A;  3BDP A;  1I39 A;  1RTH A;  3PY8 A;  1LW2 A;  1QHT A;  2ITG A;  1BGX T;  3QO9 A;  4AHC A;  1QSL A;  2X78 A;  1SKW A;  4CJS A;  2RF2 A;  5KI6 A;  3VQ5 A;  2P1J A;  4CGI A;  4Z4F A;  3WNH A;  2IDO A;  3VQQ A;  4CJT A;  3AVF A;  3SNN A;  5HRN A;  4RG8 A;  3KTQ A;  4B9N A;  4DU4 A;  3O3H A;  4KHU A;  4IFY A;  3VQE A;  4CJU A;  2R7Y A;  4F2R A;  3T1A A;  5EU7 A;  3OY9 A;  1LW0 A;  2A1R A;  1NJY A;  4AH9 A;  4FJ7 A;  4DTO A;  4FK4 A;  4R5P A;  4W5Q A;  3ZSX A;  4J2E A;  4FZZ A;  1HJR A;  1JKH A;  1A5W A;  4I9L A;  4CF9 A;  4E7L A;  3LP3 A;  3TI0 A;  4E7J A;  1X9W A;  5C25 A;  3KD1 E;  4CFA A;  1FXX A;  2Y1I A;  2AJQ A;  3O3G A;  1RT7 A;  1TK0 A;  3NGZ A;  1RDC A;  3HO1 A;  4DFM A;  2Q3S A;  1KRP A;  4LSN A;  2BAN A;  3HL8 A;  4UQG A;  2HHX A;  2YV0 X;  1C0T A;  2WOM A;  4IBN A;  2QK9 A;  3NF6 A;  1NK8 A;  3MAQ A;  4KTQ A;  4F3T A;  2G8V A;  3M8S A;  3L2W A;  4KB0 A;  5SZT A;  4CEE A;  4FJ9 A;  4DSF A;  4DU3 A;  3OYB A;  2VG5 A;  4DQQ A;  4N76 A;  3V1Q A;  2HHU A;  4M3Y A;  1I3A A;  4CHZ A;  3JYT A;  3NDK A;  2XHB A;  5FDL A;  4QAG A;  3QER A;  4EZ9 A;  1UA0 A;  4K8X A;  2QXF A;  4M3U A;  3SCX A;  1U49 A;  4FLY A;  3EZ5 A;  4FLT A;  3T3F A;  3M8P A;  4AHS A;  1KLN A;  2BGG A;  4OLA A;  3ALY A;  1ZBU A;  5CY4 A;  4HCC A;  4DTU A;  3K5O A;  3VQC A;  4DLE A;  4FJH A;  4FJG A;  3LAM A;  4E7K A;  3V9X A;  3A2F A;  3SPY A;  1YVU A;  3S3O A;  2QKK A;  4PA1 A;  2FBV A;  2E4L A;  3M8Q A;  4FZY A;  3V1O A;  3RTV A;  1TL1 A;  1BL3 A;  3DRR A;  4CEZ A;  4CEC A;  5KGW A;  3LAK A;  5J2P A;  4KAZ A;  3AA2 A;  4FYD A;  1RTI A;  1IH7 A;  4IG3 A;  1IKX A;  2OPR A;  4CJ5 A;  3NH0 A;  2KTQ A;  3SUN A;  4DFK A;  3RMA A;  1JLA A;  4M3W A;  1SUQ A;  1JLC A;  4FJL A;  1HQU A;  1VSD A;  1J9A A;  4N56 A;  1D8Y A;  3NE6 A;  4QCL A;  3F9K A;  2HMI A;  1WSJ A;  3RMC A;  1NKB A;  2ZQB A;  3TAP A;  2P51 A;  1S1V A;  3KKR A;  1FKP A;  1L3T A;  3AVH A;  4E1M A;  1HQE A;  4FLV A;  2HB5 A;  4DFJ A;  5E41 A;  1JLE A;  1CZ9 A;  3NGY A;  4BE1 A;  3B6O A;  2G8I A;  5CZ2 A;  3NHG A;  3S9H A;  1U04 A;  2G8H A;  4KHQ A;  4CJV A;  3O4Q A;  5HRS A;  1ASU A;  4FK2 A;  4DG1 A;  3ZSV A;  1KTQ A;  4DTP A;  4CJP A;  1U47 A;  1SL0 A;  1CZB A;  5J1E A;  3ZT2 A;  4ID5 A;  2OYQ A;  4F8R A;  3HPO A;  4LSL A;  4FW1 A;  3KK2 A;  4KTW A;  1UA1 A;  3ITH A;  1L3U A;  3U6F A;  1IG9 A;  4FJI A;  1TKT A;  1W9H A;  1RT3 A;  4BWM A;  3AV9 A;  4IG0 A;  4CGG A;  4DF4 A;  2HNZ A;  4OKK A;  3TAN A;  1RT4 A;  3VQD A;  3H08 A;  3C95 A;  3KLG A;  3ZCM A;  4YFU A;  2E6M A;  4H4M A;  1HRH A;  4M3T A;  3CM5 A;  4KRF A;  4CJR A;  4O0J A;  1C0M A;  1LWE A;  3CFP A;  4LH5 A;  1G15 A;  4KRE A;  1WNS A;  1NK9 A;  1J5O A;  2XY6 A;  1FKO A;  3UIQ A;  4F3O A;  3CFR A;  2PZS A;  1YT3 A;  2ATQ A;  1VSK A;  4BE0 A;  2HW3 A;  1S1W A;  3RMB A;  4FLX A;  4N41 A;  1HYV A;  3VQA A;  4EP4 A;  3V9Z A;  3OS2 A;  4E0D A;  4CE9 A;  3V4I A;  1D9D A;  3RR8 A;  1BI4 A;  4I2P A;  3QEI A;  1T05 A;  2FBX A;  4N47 A;  3VN5 A;  3RR7 A;  5CYQ A;  2XO7 A;  1U48 A;  1L3V A;  4PQU A;  4AHR A;  4FW2 A;  1WLJ A;  3AVC A;  3HPG A;  4CHY A;  3I0R A;  1NK7 A;  4FLW A;  1NK0 A;  3TAG A;  4C8K A;  4CIF A;  2RPI A;  2YNG A;  4AIL C;  4RW4 A;  1QS4 A;  4E1N A;  4XIU A;  4OPK A;  4DU1 A;  2P5O A;  1LWC A;  4OGC A;  3I0S A;  4ID1 A;  2O4G A;  3JSM A;  4I2Q A;  4CJK A;  1X9S A;  1GOC A;  4O0I A;  4W5O A;  3VQ8 A;  2XY7 A;  5I42 A;  2KFZ A;  4GMJ B;  3SV4 A;  1IO2 A;  4C8L A;  3D45 A;  3KJV A;  1EET A;  3K59 A;  1U4B A;  4Y1D A;  3DOK A;  5DMR A;  3C94 A;  4Z4H A;  3HT3 A;  4ELU A;  4BWJ A;  4HVJ A;  3ZSQ A;  3QEX A;  1A5X A;  4MQ3 A;  4DTN A;  1Q9X A;  1VRT A;  3KK1 A;  2D0C A;  4EZ6 A;  2F8T A;  3AO2 A;  5CYM A;  2B5J A;  3LP2 A;  1Q9Y A;  3CFO A;  2OZM A;  1WSE A;  4BAC A;  1VSH A;  1J54 A;  2IOC A;  4CED A;  4DSK A;  3P5J A;  3HK2 A;  4FLU A;  1T8E A;  3AA5 X;  2D0B A;  4FJ8 A;  1TVR A;  1VSJ A;  3DLH A;  3AVI A;  1TL3 A;  2ZE2 A;  1S6P A;  2YNH A;  5DK5 A;  1RBS A;  3DYA A;  2DFE A;  1LWF A;  3DMJ A;  3LZJ A;  3TAF A;  1TV6 A;  4B3O A;  1IKY A;  3AVK A;  5C42 A;  4CF0 A;  3VQ6 A;  5FRM A;  4F2S A;  3VQP A;  1JLQ A;  4FZX C;  4JRP A;  4ZTF A;  4KI4 A;  2D5R A;  4NCB A;  2ETJ A;  1B9D A;  4CJ3 A;  3K5L A;  1CXU A;  1VSL A;  4DWI A;  4DLG A;  3OYN A;  1IKV A;  1S9E A;  3HVT A;  2YNI A;  2XRI A;  1BCM A;  3DLR A;  4CJ4 A;  1S5J A;  3HP9 A;  2NUB A;  3AVB A;  3WNG A;  3OYI A;  4BDP A;  4K8Z A;  1RDA A;  2OPP A;  2GBZ A;  4CFB A;  3OYC A;  3KK3 A;  3V6D A;  1R0A A;  4HCB A;  1TAU A;  4KPY A;  4Z4E A;  3DRP A;  2G8U A;  1WSH A;  3ULD A;  2KZM A;  1S1T A;  3HVR A;  4L8R B;  3QES A;  1X9M A;  4CJF A;  3KLI A;  4OKE A;  3KLH A;  4FK0 A;  3L3V A;  1LAV A;  1JL1 A;  1D9F A;  1YTU A;  4HUE A;  4O4G A;  3HXM A;  3F73 A;  1U45 A;  4CHO A;  3ZSW A;  1S1X A;  3KLE A;  4B9S A;  1KLM A;  2HND A;  2OPS A;  3AO3 A;  1B9F A;  1S9G A;  4M45 A;  1KVC A;  2FC0 A;  4OKJ A;  4W5R A;  4DTX A;  1KSP A;  3ZT3 A;  5FRN A;  2HHQ A;  3DLE A;  4FJJ A;  3KLF A;  1JLB A;  4Q5V A;  3K2P A;  4CHN A;  4DS5 A;  1WSF A;  4CEQ A;  1ASV A;  2XY5 A;  3PO5 A;  3AVM A;  1K6Y A;  4CEB A;  3SUP A;  1C0U A;  4B9U A;  3CQ8 A;  2P5G A;  1GOB A;  2D0A A;  3DLG A;  5HRR A;  1RT1 A;  2Z1I A;  2PY5 A;  3AO1 A;  1W0H A;  5FRO A;  3OYD A;  1YTA A;  4CER A;  3WNF A;  1NJZ A;  4RW7 A;  3LAL A;  1TK8 A;  4B9V A;  2B6A A;  4CF2 A;  1UAX A;  1NK6 A;  4DSJ A;  2FBT A;  3OS1 A;  2DTU A;  4AHT A;  2YNF A;  1RCH A;  2OA8 A;  3OJU A;  3SQ0 A;  2HHT A;  3OYH A;  4B08 A;  1SV5 A;  2A1S A;  4TSX A;  1RNH A;  3EYZ A;  3QNN A;  2VWJ A;  1C6V A;  4E3S A;  4B9T A;  4FJX A;  3NH2 A;  3SI6 A;  1EXQ A;  4I9Q A;  4BDY A;  3E01 A;  2HVI A;  1QQC A;  3ASM A;  1BIU A;  1J53 A;  4OJR A;  4H8K A;  1FK9 A;  4W5T A;  3LAN A;  4LY7 A;  4LH4 A;  2JLE A;  3NF8 A;  1HPZ A;  3KIO A;  3NH1 A;  2F8S A;  5JS1 A;  1BIZ A;  5HRP A;  3PX6 A;  1EP4 A;  1RBU A;  1RDD A;  4JRQ A;  1XC9 A;  3DLB A;  4DQI A;  4NYN A;  4CF1 A;  2YHB A;  4KHS A;  1TKX A;  3AA4 A;  3AO4 A;  4KHN A;  5CZ1 A;  5HRO A;  3SQ1 A;  3HYF A;  3HST B;  4M3R A;  3SUQ A;  4O44 A;  1WSI A;  1JXE A;  1SL1 A;  2HHV A;  4CGH A;  4DMN A;  2W42 A;  2YHA A;  4YNQ A;  3VQB A;  4CIG A;  1Y97 A;  1RT2 A;  3PX4 A;  4FJN A;  3TAB A;  1CLQ A;  1RBT A;  4Y1C A;  1JXB A;  4IFV A;  4OGE A;  4E19 A;  4C8O A;  3ZT4 A;  2X6N A;  3VA3 A;  3OYM A;  3NBP A;  4WE1 A;  4CK3 A;  2VG6 A;  4J2B A;  2YKM A;  3NGI A;  3NF9 A;  3T19 A;  4DQR A;  1C1A A;  4FCY A;  4IKF A;  2E6L A;  4GVM A;  2PYL A;  2IC3 A;  3LPU A;  4B9L A;  4ELT A;  5KRT A;  3HM9 A;  2IAJ A;  3QET A;  4PUO A;  3LPT A;  4ICL A;  3FFI A;  4MFB A;  3L2R A;  1X1P A;  3D0P A;  2KW4 A;  4JS4 A;  1MU2 A;  3SZ2 A;  3BGR A;  5HP1 A;  2I5J A; 
#chains in the Genus database with same CATH topology
 3AAP A;  3P83 D;  3VOV A;  3I8D A;  1HNI A;  2QXL A;  5ADX A;  5AQZ A;  3RRG A;  3OJS A;  1UWB A;  2OPQ A;  4DTJ A;  3FR0 A;  1EKE A;  3RMD A;  3ZT1 A;  3EY1 A;  4FM2 A;  4DQ8 A;  4J2D A;  2EHG A;  3ZX0 A;  1NK5 A;  2KKZ A;  3CME N;  1BQN A;  1CXQ A;  4B8C A;  3U3Y A;  3QEV A;  3EKS A;  2E20 A;  2BDP A;  1HYZ A;  4RW9 A;  1NJX A;  3VGL A;  3AAR A;  2ASM A;  4I7F A;  4KI6 A;  2KFN A;  4A5A A;  1KVA A;  3KKS A;  3K5M A;  1M90 O;  3G25 A;  1GLL O;  2E1Y A;  2HVH A;  1BI4 B;  4HHT A;  4RW8 A;  4IO8 A;  1ZC6 A;  2Z1J A;  3ZX2 A;  5EVZ A;  2VGN A;  3O80 A;  3FZM A;  1V4S A;  4WQ4 A;  1KD1 O;  1Z25 A;  3O9R A;  2O8B B;  3SAG A;  4B9M A;  3QB0 A;  2O8D A;  4H4O A;  1NGI A;  1NK4 A;  4B3M K;  3SAF A;  2GEM A;  2QWN A;  4ISG A;  3ZSZ A;  3CJ9 A;  4BC2 A;  3Q7C A;  3VEY A;  3VEW A;  4JKG B;  1SKS A;  1N5Y A;  4M42 A;  3OYE A;  3ZX3 A;  4J2A A;  1YIJ N;  4CGF A;  3B6P A;  3RVC A;  4PHT X;  2QA4 N;  4DTR A;  4CJQ A;  3CYM A;  4DV2 K;  1UOC A;  5AQJ A;  5F2R A;  1NLV A;  1N6Q A;  2GUI A;  4M63 C;  2LSN A;  4CFC A;  5HBM A;  4CES A;  3K58 A;  2QW9 A;  5SWM A;  3TTD A;  4KV8 A;  3IKM A;  3MEC A;  1VSM A;  5KRS A;  2P9I B;  1QSY A;  3VQ4 A;  2QWO A;  3E66 A;  1VQ6 N;  4NYF A;  2KQ2 A;  3V9W A;  1KFS A;  1S72 N;  3TR8 A;  2GX9 A;  5AZJ B;  4O55 A;  2CH5 A;  1ATR A;  1NGJ A;  4PL7 A;  3OA9 A;  2FXU A;  3EN9 A;  3FLC O;  3A5N C;  1ZBS A;  4NXN K;  4FLZ A;  5D3G A;  1F21 A;  4A2A A;  1REV A;  1TKD A;  1WAJ A;  4NXM K;  4N5S A;  4LC9 B;  3L2U A;  4DR1 K;  1O1W A;  4KH4 A;  3RWU A;  3HJF A;  2IS3 A;  3AA3 A;  3PV8 A;  4BRF A;  1KVB A;  1YXQ A;  3OYG A;  4LD0 A;  4CJ7 A;  3THX A;  4HUG A;  2D4W A;  2BUP A;  1NMD A;  3ENO A;  4FJK A;  3J81 O;  1SKR A;  1YJW N;  2QM1 A;  3DOL A;  3M3Z A;  3EEQ A;  2HMP A;  3SBT A;  4JI3 K;  4AHC A;  5BRE A;  1QSL A;  2X78 A;  2RF2 A;  5KI6 A;  2A3Z A;  3VQQ A;  4CZF A;  5HRN A;  3THY A;  5BR9 A;  3VQE A;  4F2R A;  3ATV A;  1LW0 A;  3CCR N;  3C7N B;  1HJR A;  1JKH A;  1K8K B;  4E7L A;  2FSN A;  4E7J A;  3CCE N;  4CFA A;  2Y1I A;  3M5R A;  2HST A;  3ZET A;  1W2B M;  3K0S A;  1RT7 A;  3Q7B A;  3NGZ A;  1RDC A;  4MO5 A;  3HO1 A;  4WF9 L;  4LSN A;  2NLX A;  3D2E B;  5HL7 L;  2G8V A;  1NGD A;  4XH1 A;  4CEE A;  4FJ9 A;  4YOX A;  3V1Q A;  3C6A A;  4MDB A;  4A5B A;  1I3A A;  2YHW A;  3NDK A;  4BRA A;  3CF5 L;  2OAN A;  3P38 A;  3CCS N;  4K8X A;  4DB3 A;  4DV5 K;  4DTU A;  3IDH A;  1VQK N;  3LAM A;  3A2F A;  3R1X A;  3SPY A;  2W6L A;  1TYQ A;  5AQW A;  3M8Q A;  3RTV A;  1BL3 A;  4JKB A;  2HBM A;  4X66 K;  4C1N K;  1NWK A;  3A0I X;  5LL6 Z;  1IH7 A;  2ZF5 O;  3WEE A;  3TU5 A;  3SUN A;  3O1B A;  3RMA A;  4JKF A;  4M3W A;  1SUQ A;  1HQU A;  4N56 A;  1U2V B;  4JN4 A;  4CZM A;  3NE6 A;  3F9K A;  3VGK A;  1WSJ A;  3RMC A;  2ZGZ A;  2ZQB A;  3TAP A;  2NRT A;  1NBW A;  4X65 K;  1EQY A;  3KKR A;  1FKP A;  1J6Z A;  3AVH A;  1CZ9 A;  4BE1 A;  5HRS A;  4CZJ A;  3ZT2 A;  1VQM N;  4F8R A;  4ILJ A;  4LSL A;  3KK2 A;  1L3U A;  3H1V X;  4FJI A;  4LF4 K;  4CGG A;  1RDW X;  3AV9 A;  2HNZ A;  2F7T A;  4JHD B;  3VQD A;  3KLG A;  3C95 A;  5AQK A;  3ZCM A;  4H4M A;  1HRH A;  3CM5 A;  1VQO N;  4O0J A;  4HTL A;  3CFP A;  3E1Y A;  2QEX N;  2F4V K;  1WNS A;  1YUW A;  3UIQ A;  3CFR A;  4N41 A;  2W40 A;  1HYV A;  4MO4 A;  4EP4 A;  4E0D A;  3U9Z A;  4BRK A;  4CE9 A;  1D9D A;  3RR8 A;  3KWI A;  2AA4 A;  3QEI A;  2FBX A;  4N47 A;  3VN5 A;  4FSV A;  4FW2 A;  1WLJ A;  3HPG A;  4CHY A;  1NK7 A;  4FLW A;  4C8K A;  4CIF A;  4JKE A;  4XIU A;  4DU1 A;  2Q36 A;  3WXK A;  4AM7 A;  4W5O A;  2XY7 A;  3TTF A;  2UXB K;  4GMJ B;  1IO2 A;  3W3D A;  3D45 A;  5C10 A;  1EET A;  2F9T A;  5DMR A;  3HT3 A;  1A5X A;  4DTN A;  4LF6 K;  1SAZ A;  3KK1 A;  5JLH A;  4JK7 A;  5BRD A;  1Q9Y A;  3CFO A;  1VQN N;  1IBL K;  1VSH A;  4O8U A;  4BRI A;  1T8E A;  5AQL A;  2O8E A;  3SBG A;  1RBS A;  3DYA A;  2EWS A;  5TKW A;  4LFB K;  1TV6 A;  3SLC A;  4CZI A;  5C42 A;  4CF0 A;  3VQ6 A;  5FRM A;  4FZX C;  1JLQ A;  3I55 N;  1SQK A;  1CXU A;  1VSL A;  4DWI A;  3OYN A;  4IXC A;  3THX B;  3N4Q A;  4DR4 K;  3HVT A;  3CQY A;  3AY9 A;  2XRI A;  1BCM A;  4DR5 K;  1JCG A;  3OW2 M;  1TUU A;  3BF3 A;  2QWL A;  3OYC A;  3QFU A;  5BN8 A;  3DRP A;  4Z4E A;  1S1T A;  2P9U B;  4U7B A;  4OKE A;  4BY9 C;  4HUE A;  5AR0 A;  4QS9 A;  3AO3 A;  4W5R A;  1XHZ A;  3MCP A;  4BR9 A;  2ZM6 K;  3DLE A;  4FJJ A;  3C6H A;  1JLB A;  1QQM A;  1WSF A;  1ASV A;  1W97 L;  3EL2 A;  4B9U A;  4BC3 A;  1GOB A;  5JMV A;  2P5G A;  4FVU A;  1RT1 A;  3CCU N;  3ZET B;  3HI0 A;  3IUC A;  3OYD A;  4CER A;  1Q7Y O;  1P90 A;  1SZ2 A;  3WUH A;  4CF2 A;  1NK6 A;  2DTU A;  4AHT A;  3T69 A;  5M1Q A;  4E3S A;  4BRN A;  4FJX A;  2HVI A;  1FK9 A;  4W5T A;  3LAN A;  4LY7 A;  2A42 A;  4JD2 B;  3NF8 A;  2DPN A;  4H03 B;  4KHS A;  2YHB A;  5AQN A;  3NVM A;  1VQL N;  1QVF M;  3SQ1 A;  3SUQ A;  1NU0 A;  2KLA A;  1Y97 A;  3U8X A;  2HBJ A;  1CLQ A;  4WYB A;  5EXW A;  4E19 A;  2O8B A;  1MWK A;  3VA3 A;  1DEJ A;  4CK3 A;  2VG6 A;  3QIC A;  3T19 A;  4B1U B;  1C1A A;  4OX9 K;  4B9L A;  3O1W A;  5AQQ A;  4MFB A;  1IV0 A;  3SZ2 A;  3LP1 A;  2IGI A;  1ZBI A;  4JKG A;  3FZH A;  4RWT A;  1ZBH A;  3VEN A;  3TAR A;  1WN7 A;  3E9L A;  3NFA A;  4O5F A;  1KXP A;  3MEG A;  4CI6 A;  2OZS A;  1HYS A;  3T1Y K;  4H5T A;  2Y1J A;  3J7Y P;  4JI1 K;  4CGJ A;  4DUY K;  4BC5 A;  4LF8 K;  1NKC A;  4EHT A;  4RTF D;  3FGU A;  4JS5 A;  3ISN C;  4CW7 B;  1OH7 A;  4RW6 A;  5AFU H;  3OYK A;  2P9I A;  4CHP A;  4H5V A;  3O9Q A;  1FJG K;  4PL8 A;  1DLO A;  4JK9 A;  4CIE A;  1MA9 B;  4K43 A;  4ELV A;  3LZI A;  3E9O A;  3V81 A;  4FWO A;  5AZJ A;  1JL2 A;  3H46 O;  3TSU A;  4K42 A;  2JGU A;  3O4W A;  3SV3 A;  1HKC A;  1OKJ A;  4GKK K;  5E26 A;  1VSE A;  2HBL A;  4FOE A;  3PX0 A;  2QTD A;  3ENB A;  3R9P A;  3AO5 A;  3S3N A;  1ILY A;  4WFB L;  2NRZ A;  4M3Z A;  3EKU A;  2OCE A;  4HTU A;  2A5X A;  1HKB A;  3WNE A;  4Z4G A;  3KD5 E;  4CZL A;  5AQH A;  4CHQ A;  1YIT N;  3DLK A;  3D7E O;  4JI4 K;  3TSQ A;  1VQ8 N;  3L3U A;  2ZJR L;  1RBR A;  4CCH A;  3PSI A;  3VA0 A;  3RRH A;  4Z4C A;  3FZK A;  3QBW A;  2XY8 A;  3QEW A;  4JI5 K;  5AJ3 K;  4IO9 L;  3G0Z A;  5KGX A;  3DWL A;  3CG7 A;  4M3X A;  1RBV A;  3U4L A;  3SQ2 A;  1IBK K;  4LFC K;  4W5N A;  4JLH A;  3O5B A;  2PYJ A;  3SAH A;  2QKB A;  3V1R A;  3C6T A;  3QML A;  4YOR A;  4DSI A;  3C7N A;  3DI6 A;  4KB1 A;  4DQP A;  4A62 A;  3VF2 A;  1K8K A;  2A40 A;  3L2Q A;  5LJW A;  4FWM A;  4FWP A;  3CER A;  2BTF A;  5LJV A;  5FPE A;  3V9U A;  1L5U A;  1QVG M;  4CK1 A;  4QOZ B;  4CEO A;  3D2E A;  2RKI A;  1EX4 A;  4LF7 K;  3R8E A;  4BRO A;  2DFF A;  3ZSR A;  1HKG A;  1SL2 A;  3TAM A;  5I3U A;  3OS0 A;  1X9J A;  5GIN A;  2VWK A;  4ZHR A;  4PWD A;  3UB5 A;  1XMQ K;  4JI7 K;  1WOQ A;  2I7P A;  4KHW A;  4CZE A;  1C0G A;  1RTH A;  1NGG A;  4YDU C;  2ITG A;  4CJS A;  1NGE A;  2NRW A;  3VQ5 A;  4CGI A;  3WNH A;  1QHA A;  5B8H A;  1IJJ A;  4RG8 A;  4A61 A;  4B9N A;  4EAH D;  3C65 A;  1EWR A;  4IFY A;  5H1S Q;  2R7Y A;  3T1A A;  1NGC A;  3OY9 A;  1U2V A;  3R6M A;  2UUA K;  4GVE A;  3QDK A;  4R5P A;  4W5Q A;  3ZSX A;  4I9L A;  4H5N A;  3M1F A;  3GE1 A;  1FXX A;  5EY4 A;  3M6G A;  1DT9 A;  2HBK A;  1TK0 A;  2Q3S A;  3HL8 A;  1NG9 A;  2HHX A;  1C0T A;  1GLJ O;  2GUP A;  2QK9 A;  3NF6 A;  3WXL A;  3MAQ A;  1NK8 A;  4KTQ A;  1T44 A;  4DSF A;  2ZWH A;  4DU3 A;  4DQQ A;  3J8A A;  3VEO A;  4M3Y A;  2A41 A;  4CHZ A;  4JHD A;  3SCX A;  1U49 A;  4FLY A;  3EZ5 A;  4FLT A;  3T3F A;  5CY4 A;  3HOT A;  4DLE A;  3V9X A;  4BRD A;  3S3O A;  1KQS M;  4ILH A;  4A2B A;  4GNI A;  4H0O A;  2E4L A;  3CC4 N;  3V1O A;  3DRR A;  3B8A X;  3LAK A;  4FYD A;  5IT9 O;  1RTI A;  2FF6 A;  1IKX A;  1RDU A;  4RCH A;  3G6E N;  1VSD A;  1GLB G;  1G99 A;  5DM6 L;  3UKR B;  4QCL A;  2HMI A;  3P31 A;  1NKB A;  3EZW A;  1S1V A;  4H5W A;  1L3T A;  3S41 A;  4DV6 K;  2VQF K;  3UKU B;  1JLE A;  4K41 A;  3B6O A;  4BR0 A;  2G8H A;  4KHQ A;  3O4Q A;  1ASU A;  1Z6R A;  4FK2 A;  4DG1 A;  4CJP A;  1CZB A;  2P9S B;  4WCE L;  3HPO A;  1RFQ A;  4FW1 A;  5F0X A;  4DHY A;  2IVN A;  3SMP A;  4OKK A;  1RT4 A;  4M7Y A;  1HX1 A;  4BRP A;  4BVO A;  3EE9 A;  1C0M A;  1GLC G;  2VGM A;  4LH5 A;  4KRE A;  1NK9 A;  2XY6 A;  1N32 K;  1VSK A;  1S1W A;  4YOU A;  3RMB A;  3H45 C;  3HOS A;  3A8Y A;  3VQA A;  1WB9 A;  3V9Z A;  3OS2 A;  1MWM A;  5KQ8 A;  4I2P A;  3L6Q A;  1U48 A;  2W6K A;  1QZ5 A;  4FK0 A;  2YNG A;  5LMN K;  4AIL C;  2P5O A;  1JCE A;  4OGC A;  2P9U A;  4I2Q A;  4CJK A;  3VQ8 A;  1V4T A;  5I42 A;  2KFZ A;  3SV4 A;  3KJV A;  5ELZ A;  4FWL A;  4Y1D A;  5AQF A;  3C94 A;  2VYP A;  4Z4H A;  4BWJ A;  4HVJ A;  3ZSQ A;  3QEX A;  3AO2 A;  1WSE A;  4BAC A;  2IOC A;  4BG9 A;  4BRC A;  3HK2 A;  4FLU A;  4MLH A;  1TVR A;  4QS8 A;  2UYT A;  2ZE2 A;  5DK5 A;  3PSF A;  2V7Y A;  3TAF A;  4O8K A;  1IKY A;  1YAG A;  3AVK A;  1VQ5 N;  2D5R A;  4B1Z A;  4NCB A;  4DR6 K;  4CJ3 A;  3K5L A;  4XH4 A;  3VPZ A;  3VEX A;  3NMU A;  3DXM B;  2YNI A;  2WC9 A;  4CJ4 A;  3MCA B;  3HP9 A;  3WT0 A;  3AVB A;  5FPD A;  1RDA A;  3I8B A;  2GBZ A;  4CFB A;  4JKA A;  1R0A A;  3MN5 A;  4JD2 A;  1TAU A;  1WSH A;  3ULD A;  1X9M A;  2Q0R A;  2JWK A;  3KLH A;  3MN9 A;  3HXM A;  3F73 A;  3JAM O;  1U45 A;  3LDL A;  5JLF A;  4YDU A;  4JKD A;  3KLE A;  1S9G A;  1KVC A;  2FC0 A;  4ILG B;  1VQ9 N;  3K2P A;  5C12 A;  4DS5 A;  2Q2R A;  3PO5 A;  3AVM A;  3SUP A;  3CQ8 A;  4F9O A;  3VET A;  4B3S K;  3AO1 A;  5FRO A;  1NJZ A;  3LAL A;  1RGI A;  4CZG A;  2E8A A;  1UAX A;  1GLE G;  1Q82 O;  2RE2 A;  2OA8 A;  5M1O A;  2AP1 A;  3IFR A;  4MDA A;  1SV5 A;  1LCU A;  2WFB A;  2A1S A;  3QNN A;  3CJA A;  4B9T A;  3UE5 A;  2FLO A;  1EXQ A;  3E01 A;  2V51 B;  3BY5 A;  1WBD A;  4OJR A;  3ID6 A;  1ATN A;  4LH4 A;  4EIA A;  3TSP A;  3NH1 A;  3O6W A;  4JRQ A;  1XC9 A;  4DQI A;  4CF1 A;  4DR7 K;  1VHX A;  1JXE A;  2QWR A;  3E9P A;  2W42 A;  3P39 A;  1RT2 A;  4R79 A;  1E3M A;  1JXB A;  3T7Z A;  5LMU K;  2NNW A;  3ZT4 A;  3OYM A;  4WE1 A;  2WBN A;  3OHR A;  2NRX A;  4FCY A;  2E1Z A;  4FWS A;  4PUO A;  3W0L A;  3QET A;  4EHU A;  4ICL A;  4AM6 A;  3FFI A;  4L3Q A;  3L2R A;  1HNX K;  5J2Q A;  1D9F A;  3OTO K;  1M1K O;  4ZTJ A;  5M1F A;  1WSG A;  1W7A A;  4IEI A;  4DCH A;  3MX5 A;  4B1Y B;  3MED A;  3CHW A;  4FOI A;  1ATS A;  3CI5 A;  5AQU A;  2E2Q A;  5M1P A;  2G8K A;  4FM0 A;  3CCV N;  1KAZ A;  4DFP A;  2EX3 A;  3MK6 A;  1XQS C;  4E89 A;  4H0Y B;  2G8F A;  1WAF A;  2DFH A;  3LDP A;  5T7B A;  1ZBL A;  4OLB A;  3QIN A;  1RTD A;  4KHY A;  3C0B A;  4OPJ A;  3VEZ A;  3T1H K;  2P9P B;  3QIO A;  3L2V A;  3TWH A;  3OYF A;  4OPH A;  3PO4 A;  3NF7 A;  3ZEU A;  4DTM A;  4AHU A;  4CFD A;  2YJF A;  3MWP A;  3MXM A;  1NGB A;  4E7I A;  3C6U A;  2UUB K;  5AZI A;  4C1N I;  5BPN A;  1D5A A;  4H0T B;  1IKW A;  5KTQ A;  3ZSY A;  1YJN N;  3GDQ A;  3F9M A;  4GW6 A;  3ZSO A;  1TAQ A;  5BR8 K;  4CEA A;  1RIL A;  2YCH A;  3ZT0 A;  1HJO A;  5TKY A;  5C2D A;  1JJ2 M;  2P9N A;  1NKE A;  3CQX A;  5HLF A;  5AQV A;  1T6C A;  3QEP A;  1KFD A;  3QFP A;  4DSL A;  2P9L B;  1Q86 O;  1GOA A;  3FE1 A;  1JCF A;  4AHV A;  4NCG A;  5C24 A;  4M41 A;  1ITG A;  1ZBF A;  2FSJ A;  3TAE A;  4FVM A;  4DS4 A;  5I9E B;  4JI8 K;  3GL1 A;  4DTS A;  4FM1 A;  4CJW A;  2RHK A;  1KAY A;  5FPN A;  3BUZ B;  3LP0 A;  1S6Q A;  4CGD A;  3AVA A;  3LDQ A;  3SQ4 A;  5J2N A;  1KCF A;  5GAE P;  3NCI A;  5C15 A;  4KKO A;  4AQY K;  4K25 A;  1TGO A;  2VWB A;  1J5E K;  4DF8 A;  3AVJ A;  4CJL A;  3LDS A;  1T7P A;  1QTM A;  2V7Z A;  2HNY A;  4X62 K;  1IBM K;  2PAV A;  1BIS A;  4PKI A;  4C8N A;  3QNO A;  4BQZ A;  2JWL A;  3L0Q A;  1JLF A;  2D0P A;  3IAY A;  4KFB A;  1QE1 A;  5FLX O;  1OH8 A;  4B8A B;  1RT6 A;  4HWI A;  3CPW M;  1HR0 K;  2GWJ A;  3D6R A;  5KPZ A;  3JXU A;  3PUF A;  3MXJ A;  1BCO A;  3O3F A;  4M7X A;  5AQG A;  1NOZ A;  3VQ7 A;  3G10 A;  4FWR A;  1HUX A;  4J8F A;  4CF8 A;  5BPL A;  5BN9 A;  4FPA A;  1C1C A;  2ZD1 A;  4H0P A;  2UXD K;  4JYA K;  1NOY A;  3H3N O;  3CCJ N;  4NCA A;  3GBT A;  1EWQ A;  1XHX A;  3CM6 A;  4E7H A;  2GWK A;  4WFA L;  1QHT A;  3F2K A;  4QS7 A;  4YY3 K;  3HZ6 A;  4YHH K;  1Q18 A;  2P1J A;  2IDO A;  4CJT A;  1N34 K;  4X64 K;  4DU4 A;  4V19 S;  2HHH K;  3PIP L;  2UU9 K;  4H5R A;  4CJU A;  4FWN A;  4PKG A;  3VF4 A;  2A1R A;  3UKR A;  4AH9 A;  4FK4 A;  4JI6 K;  4J2E A;  4FZZ A;  2ZGY A;  3LP3 A;  1X9W A;  5C25 A;  1U6Z A;  4GKJ K;  3UKU A;  1XC3 A;  2BAN A;  4CD1 A;  4LF5 K;  4YOT A;  4IOC L;  3VES A;  2IVP A;  4F3T A;  3M8S A;  2P9S A;  4KB0 A;  5SZT A;  3EO3 A;  3DXK B;  3BEX A;  2HHU A;  1EO1 A;  1IG8 A;  5FDL A;  4QAG A;  4EZ9 A;  2QXF A;  5BPM A;  1KLN A;  2BGG A;  3M8P A;  4AHS A;  5C2F A;  1SS6 A;  4KHP K;  3K5O A;  3VQC A;  4FJG A;  4E7K A;  4BR5 A;  2HOE A;  1T6D A;  2QKK A;  2CH6 A;  3O8M A;  3THW B;  4PA1 A;  5KGW A;  5J2P A;  3DJC A;  5AFU A;  1XMO K;  4GV6 A;  4CJ5 A;  1BWF O;  4BRQ A;  2YHY A;  4FWQ A;  1JLA A;  4FJL A;  1JLC A;  2J4R A;  3ZEU B;  1N36 K;  4NO7 A;  4EFH A;  2P51 A;  3D2F A;  5AZI B;  5AQM A;  4IZ9 A;  4IOX A;  4FLV A;  3U9D A;  4DFJ A;  5E41 A;  4IEE A;  5IWA K;  4Z94 A;  4B3T K;  1U04 A;  4CJV A;  4DTP A;  1SL0 A;  1KTQ A;  1U47 A;  3A5M C;  5J1E A;  1HNZ K;  4ID5 A;  2OYQ A;  4IJN A;  2QI2 A;  2P9N B;  3U6F A;  1TKT A;  1W9H A;  4IG0 A;  3RSE B;  3TAN A;  5KPR A;  5LY3 A;  5ADX H;  4YFU A;  1BUP A;  2E6M A;  4KRF A;  4CJR A;  1K73 O;  2FSK A;  1G15 A;  1FKO A;  4F3O A;  1VAZ A;  2PZS A;  1NGF A;  3G71 N;  2NRV A;  4FLX A;  1N8R O;  3BF1 A;  3V4I A;  4JNE A;  3DXM A;  1T05 A;  3RR7 A;  5CYQ A;  4PQU A;  5GIO A;  5M1N A;  4ISF A;  4OO1 J;  3P4I A;  3I0R A;  1NK0 A;  5A2Q O;  2RPI A;  1BU6 O;  5EOY A;  5AQS A;  4E1N A;  4BQL A;  3KVG A;  4OPK A;  1LWC A;  3I0S A;  5BRF A;  3JSM A;  1X9S A;  3AGK A;  2YHX A;  4C8L A;  2ZJP L;  3DOK A;  3ULE B;  4BG8 A;  5BRH A;  1BDG A;  1Q9X A;  2D0C A;  4EZ6 A;  3HBT A;  1BA0 A;  3MX2 A;  2OZM A;  3BZC A;  4I6M A;  1J54 A;  4DSK A;  4CED A;  3P5J A;  4LFA K;  2D0B A;  4BGA A;  1VSJ A;  3ZYY X;  1TL3 A;  2YNH A;  4WQ5 A;  3WXI A;  2DFE A;  3DMJ A;  3LZJ A;  4FL9 A;  4IJA A;  4KI4 A;  1BG3 A;  5M1K A;  4JRP A;  1K8A O;  2I7N A;  1GLF O;  2ETJ A;  1B9D A;  4YOY A;  3GOI A;  5AQR A;  2P9K B;  1IKV A;  4G9Z A;  1S9E A;  1X3N A;  3DLR A;  2O8C A;  1NGH A;  3J7A P;  2NUB A;  3WNG A;  3OYI A;  4K8Z A;  2OPP A;  2OTJ N;  3K9K A;  3JS6 A;  3KK3 A;  4HCB A;  3H1Q A;  2H3G X;  3DLL L;  3MWT A;  5FPM A;  1BA1 A;  3QES A;  5AQT A;  4CJF A;  4CBU A;  1JL1 A;  1YTU A;  4CHO A;  1NM1 A;  3ZSW A;  2O8F A;  1I94 K;  1XNR K;  4CIG A;  2HND A;  4DTX A;  4M45 A;  2VCP A;  4OKJ A;  4C23 A;  2HHQ A;  5FRN A;  3CJC A;  4CEQ A;  2F9W A;  2XY5 A;  3VGM A;  2D0A A;  5HRR A;  5JIC A;  2Z1I A;  1W0H A;  1YHQ N;  3WNF A;  2B6A A;  2Q0U A;  2FBT A;  4BVP A;  1RCH A;  3CC7 N;  3SQ0 A;  1LOT B;  3OYH A;  4B08 A;  2HHT A;  4TSX A;  5KQD A;  5GAH P;  1C6V A;  4NB4 A;  3NH2 A;  3SI6 A;  4BR2 A;  4BDY A;  1QQC A;  3ASM A;  1BIU A;  1E4G T;  1J53 A;  3EE8 A;  4WFN L;  3CPE A;  2JLE A;  2A6A A;  5JS1 A;  5HRP A;  1EP4 A;  1RBU A;  1RDD A;  2P9P A;  4NYN A;  2WTU A;  1TKX A;  3A5O C;  4CBW A;  5HRO A;  3A5L C;  3HST B;  2ASO A;  1SL1 A;  3J80 O;  4CGH A;  4DMN A;  3I56 N;  4YNQ A;  3PX4 A;  4FJN A;  2VQE K;  1QQO A;  3TAB A;  1RBT A;  4IFV A;  1OVQ A;  4B9Q A;  1GLD G;  3D2F B;  3NGI A;  3NF9 A;  4BRL A;  4DQR A;  4GVM A;  2PYL A;  2IC3 A;  3LPU A;  4ELT A;  5KRT A;  2IAJ A;  3LPT A;  2UXC K;  3D0P A;  1VQ4 N;  1X1P A;  2V52 B;  3H6E A;  4UY8 O;  5C0Y A;  4CZH A;  1MU2 A;  3BGR A;  5HOO A;  2I5J A;  4KH6 A;  3S3M A;  1L3S A;  3SJH A;  5GIP A;  3GG4 A;  1MDU B;  3MN7 A;  1R59 O;  5JVG L;  3SUO A;  4JKC A;  2P9L A;  4FPB A;  4XEI A;  3CXC M;  3HTV A;  1T3V A;  3VQ9 A;  1B92 A;  3MEE A;  3AVN A;  1D4X A;  3LWL A;  4HUF A;  3OYA A;  1VRU A;  4OPA A;  2UUC K;  3OVN A;  1S1U A;  4MLE A;  4B1W B;  3MXI A;  4Q0B A;  3CIP A;  1VQ7 N;  1LAW A;  4CEF A;  3F5T A;  2FBY A;  3QBX A;  1WUA A;  3U3G A;  5JS2 A;  1C1B A;  3IS9 A;  1Q8I A;  5AQO A;  2FF3 B;  3R3L A;  3OYL A;  5JVH L;  5GAD P;  2NRH A;  5K14 A;  3O4N A;  1NJW A;  2HHW A;  4IDK A;  1NJI O;  3DRS A;  2QWQ A;  1ASW A;  5CHI A;  2Z1G A;  1DGK N;  1A5V A;  2Q31 A;  3SYZ A;  4BDZ A;  3TAQ A;  4F4K A;  4DSE A;  3HSC A;  3TTC A;  1XWL A;  2WON A;  2X6S A;  1BHL A;  1GLA G;  3CCL N;  3AVL A;  3OYJ A;  3VTI A;  1VSF A;  3AVG A;  2F96 A;  4B1V A;  1HPM A;  1RDB A;  4FJ5 A;  1RTJ A;  2GEL A;  1LV5 A;  4EP5 A;  3WXM B;  3TPQ A;  4I6M B;  3VMF B;  3J7Z O;  4KO0 A;  3SMS A;  2DY4 A;  4DQS A;  3SJJ A;  2Z1H A;  4GY2 B;  4BE2 A;  1X3M A;  4DV7 K;  3L4Q A;  2ZJQ L;  1VSI A;  2O4I A;  3L8B A;  4Y0W A;  4KTZ A;  1BO5 O;  3K5N A;  1E4F T;  1DTQ A;  3K57 A;  3AAQ A;  4K0K K;  2X74 A;  2YKN A;  2G8W A;  3LWM A;  3O08 A;  1VK0 A;  1XI1 A;  4DV4 K;  2NRR A;  4YOW A;  2ASP A;  1TKZ A;  4FO0 A;  4BGB A;  2O8C B;  3QLH A;  1Z26 A;  2YJE A;  4Z0U A;  1QSS A;  4CJE A;  1DTT A;  3HP6 A;  2D0O A;  4PKH A;  2O8D B;  2B4J A;  1RT5 A;  4DKW A;  3KWG A;  2KZZ A;  3FZL A;  2HF3 A;  2HHS A;  3P1G A;  2O8F B;  1ZYQ A;  4O5B A;  4Z4I A;  4GV3 A;  1ESV A;  1OVY A;  4IOA L;  3HPH A;  1BQM A;  2YX6 A;  3IG1 A;  2GV9 A;  4FJM A;  2VG7 A;  4FXD A;  2ITM A;  5DM7 L;  2CGL A;  1QQN A;  3QIP A;  4PY5 A;  3LL3 A;  3M8R A;  3IRX A;  4CK2 A;  2HF4 A;  1HNV A;  3NAE A;  1KAX A;  3DXK A;  2E2P A;  3DAW A;  1T03 A;  5J2M A;  1HMV A;  3KK7 A;  1TK5 A;  4OVL A;  2BE2 A;  3THV A;  2RN2 A;  1JLG A;  3FFK B;  3FZF A;  3V9S A;  4C8M A;  3BDP A;  3DM2 A;  1S3X A;  1I39 A;  3PY8 A;  1LW2 A;  3THW A;  1BGX T;  3QO9 A;  1SKW A;  4Z4F A;  3AGR A;  1Y64 A;  3AVF A;  1OH5 A;  3SNN A;  3KTQ A;  1O13 A;  3O3H A;  1HLU A;  4KHU A;  5EU7 A;  1NJY A;  4FJ7 A;  4DTO A;  5AQP A;  1A5W A;  4CF9 A;  3KD1 E;  2NZT A;  3TI0 A;  1VQP N;  2AJQ A;  4NLC A;  3O3G A;  4IFE A;  2E2N A;  3VEV A;  4DFM A;  1KRP A;  4JAX A;  4UQG A;  4JK8 A;  2YV0 X;  4A59 A;  2WOM A;  4IBN A;  3LM9 A;  1N33 K;  1XNQ K;  3ZLJ A;  3L2W A;  4DUZ K;  3CJ7 A;  3L4I A;  3N4P A;  3OYB A;  2VG5 A;  4N76 A;  4AF1 A;  3RSE A;  3JYT A;  2XHB A;  2D1K A;  3QER A;  1UA0 A;  4M3U A;  3VF6 A;  4OLA A;  1BOT O;  1ZBU A;  3ALY A;  4HCC A;  3WQU A;  3CD6 N;  5AQI A;  3CCQ N;  4FJH A;  3HRG A;  4ISE A;  1YVU A;  2FBV A;  4FZY A;  1TL1 A;  1OH6 A;  1P8Z A;  3O9U A;  4CEC A;  4CEZ A;  5KPT A;  4KAZ A;  3AA2 A;  3O9S A;  3IMX A;  4IG3 A;  2OPR A;  3NH0 A;  4DV1 K;  3THY B;  2KTQ A;  3WXJ A;  4DFK A;  1J9A A;  1D8Y A;  4B3R K;  5CR4 A;  4DR2 K;  1S22 A;  3MDQ A;  4E1M A;  3LDN A;  4A57 A;  1HQE A;  2HB5 A;  3NGY A;  2E5L K;  3PLA A;  2G8I A;  5CZ2 A;  3NHG A;  3S9H A;  2E88 A;  3ULE A;  3ZSV A;  4BRH A;  4E1J A;  4CD3 A;  2BH1 A;  4KTW A;  1UA1 A;  3ITH A;  1IG9 A;  3SPZ A;  4KH5 A;  1RT3 A;  4BWM A;  4DF4 A;  4WQ5 C;  3H08 A;  1Q81 O;  4GV9 A;  4DR3 K;  4M3T A;  2IVO A;  1YVN A;  1LWE A;  4BR7 A;  1TYQ B;  1J5O A;  3OBY A;  3ENH A;  1YT3 A;  2ATQ A;  4BE0 A;  2W41 A;  3NVK A;  2HW3 A;  3K9J A;  3CJB A;  4WQ4 C;  2P9K A;  4BRE A;  3WEE B;  5E84 A;  1BI4 A;  1CZA N;  3LM2 A;  3OBW A;  2XO7 A;  1L3V A;  4AHR A;  3AVC A;  4XH5 A;  3TAG A;  4RW4 A;  1QS4 A;  4JKH A;  3G4S N;  4ID1 A;  2O4G A;  1GOC A;  4O0I A;  4NLB A;  1Z05 A;  3K59 A;  1U4B A;  4ELU A;  3BZK A;  4H0V B;  5F1X A;  1FW6 A;  4MQ3 A;  1XUP O;  3SK3 A;  3CCM N;  2GTD A;  1VRT A;  3PIO L;  2F8T A;  5CYM A;  2B5J A;  4U67 L;  1YF5 L;  3LP2 A;  2OTL N;  5GAG P;  4JI0 K;  1H1V A;  3KZB A;  3AA5 X;  2CGJ A;  1ZXO A;  4FJ8 A;  3HM8 A;  3DLH A;  2PFU A;  3AVI A;  1S6P A;  1LWF A;  5AQX A;  4B3O A;  4F2S A;  3VQP A;  4ZTF A;  3CC2 N;  3CJ1 A;  2QWP A;  3LDO A;  4DLG A;  4CVN E;  3ATU A;  5AQY A;  5EX5 A;  4DV0 K;  1S5J A;  4BDP A;  4CBX A;  3V6D A;  1YJ9 N;  4BRM A;  4KPY A;  2G8U A;  2KZM A;  4BRG A;  3HVR A;  4L8R B;  3KLI A;  4JEP A;  3L3V A;  1LAV A;  2CGK A;  4YOV A;  1DKG D;  4O4G A;  1S1X A;  4B9S A;  1KLM A;  2OPS A;  1B9F A;  1KSP A;  5MLC Q;  3ZT3 A;  2WUS A;  3KLF A;  4Q5V A;  1KC8 O;  2Q1N A;  4CHN A;  2Q97 A;  4CEB A;  1K6Y A;  3VER A;  1C0U A;  2YI1 A;  3DLG A;  2PY5 A;  5CE3 A;  4DV3 K;  2O8E B;  1YTA A;  1TK8 A;  4RW7 A;  4B9V A;  2IIR A;  2KHO A;  4DSJ A;  3OS1 A;  2YNF A;  1K9M O;  4H0X B;  3OJU A;  3O9T A;  4JI2 K;  3WQT A;  1RNH A;  3EYZ A;  2VWJ A;  4I9Q A;  1NMN A;  1HNW K;  1C0F A;  4H8K A;  2PBD A;  3BP8 A;  3VTH A;  2QWM A;  4KBO A;  1HPZ A;  3KIO A;  2F8S A;  1BIZ A;  3MN6 A;  3PX6 A;  3DLB A;  3AA4 A;  3AO4 A;  3ID8 A;  5CZ1 A;  4KHN A;  2E2O A;  1QZ6 A;  4IWV A;  3HYF A;  4M3R A;  4O44 A;  1WSI A;  1NGA A;  2HHV A;  4IDH A;  4FWK A;  1TUY A;  3I33 A;  3KHY A;  4CZK A;  2YHA A;  3VQB A;  3CMA N;  1WBB A;  4Y1C A;  1NNE A;  4OGE A;  4C8O A;  2X6N A;  3NBP A;  4BR4 A;  4JV5 K;  4J2B A;  3MMV A;  2YKM A;  4IKF A;  2E6L A;  4BC4 A;  4B1X B;  3HM9 A;  4LF9 K;  3CET A;  2KW4 A;  4JS4 A;  1YI2 N;  3H3O B;  5HP1 A;  4G1Q A; 
#chains in the Genus database with same CATH homology
 3LP1 A;  2IGI A;  3P83 D;  3I8D A;  3S3M A;  4ZTJ A;  1L3S A;  1WSG A;  1ZBI A;  1HNI A;  1ZBH A;  3MED A;  3SUO A;  3TAR A;  3RRG A;  3OJS A;  1WN7 A;  2G8K A;  4FM0 A;  1UWB A;  3VQ9 A;  3NFA A;  2OPQ A;  4DTJ A;  1B92 A;  3MEG A;  3MEE A;  4DFP A;  2OZS A;  1HYS A;  2EX3 A;  1EKE A;  3RMD A;  3AVN A;  3ZT1 A;  4E89 A;  3LWL A;  3EY1 A;  4HUF A;  2Y1J A;  3OYA A;  2G8F A;  4FM2 A;  1VRU A;  1WAF A;  3OVN A;  1S1U A;  2DFH A;  4CGJ A;  3MXI A;  4J2D A;  2EHG A;  4Q0B A;  1NK5 A;  5T7B A;  1LAW A;  4CEF A;  1NKC A;  1ZBL A;  4OLB A;  3QIN A;  2FBY A;  1RTD A;  1BQN A;  5J2Q A;  4JS5 A;  1CXQ A;  4B8C A;  3ISN C;  4OPJ A;  3QEV A;  3U3Y A;  2BDP A;  4KHY A;  1HYZ A;  4RW9 A;  3U3G A;  5JS2 A;  1C1B A;  3IS9 A;  1Q8I A;  1NJX A;  3QIO A;  3L2V A;  3TWH A;  3OYL A;  4I7F A;  4RW6 A;  3OYF A;  4KI6 A;  2KFN A;  1KVA A;  3NF7 A;  4DTM A;  3PO4 A;  4AHU A;  3OYK A;  3KKS A;  3K5M A;  4CFD A;  5K14 A;  4CHP A;  3O4N A;  3MXM A;  2HVH A;  1BI4 B;  1NJW A;  1DLO A;  4IDK A;  4E7I A;  3C6U A;  4HHT A;  4RW8 A;  2HHW A;  2Z1J A;  1D5A A;  4CIE A;  1IKW A;  5KTQ A;  3DRS A;  4ELV A;  1ASW A;  1Z25 A;  3ZSY A;  3LZI A;  3V81 A;  2Z1G A;  4GW6 A;  4B9M A;  1A5V A;  3ZSO A;  1TAQ A;  1JL2 A;  4H4O A;  3SYZ A;  4BDZ A;  3TAQ A;  4CEA A;  4F4K A;  1NK4 A;  4DSE A;  1RIL A;  4G1Q A;  2JGU A;  3ZT0 A;  3SV3 A;  1XWL A;  2WON A;  3ZSZ A;  2X6S A;  1BHL A;  1NKE A;  5HLF A;  3QEP A;  1SKS A;  1N5Y A;  4M42 A;  1VSE A;  3AVL A;  3OYJ A;  3OYE A;  1KFD A;  4DSL A;  4J2A A;  1VSF A;  3AVG A;  2F96 A;  4CGF A;  3PX0 A;  3SPZ A;  3B6P A;  1XHZ A;  1RDB A;  4FJ5 A;  3AO5 A;  1GOA A;  1RTJ A;  3S3N A;  4DTR A;  4CJQ A;  4M3Z A;  4AHV A;  4NCG A;  4EP5 A;  1LV5 A;  5C24 A;  3CYM A;  4M41 A;  1ITG A;  4KO0 A;  1ZBF A;  3TAE A;  2DY4 A;  4HTU A;  4DQS A;  4FVM A;  3WNE A;  3SJJ A;  2Z1H A;  3KD5 E;  4BE2 A;  4DS4 A;  1UOC A;  4Z4G A;  4CHQ A;  1N6Q A;  3DLK A;  1VSI A;  2GUI A;  4DTS A;  2O4I A;  3L8B A;  4CJW A;  4FM1 A;  4KTZ A;  2LSN A;  4CFC A;  5HBM A;  4CES A;  3L3U A;  3K58 A;  1RBR A;  3LP0 A;  1S6Q A;  3K5N A;  4CGD A;  4CCH A;  3VA0 A;  3RRH A;  1DTQ A;  3K57 A;  5SWM A;  4KV8 A;  4Z4C A;  2X74 A;  3AVA A;  3MEC A;  1VSM A;  3SQ4 A;  5KRS A;  2XY8 A;  5J2N A;  3QEW A;  1KCF A;  2YKN A;  3NCI A;  1QSY A;  3VQ4 A;  2G8W A;  3LWM A;  1VK0 A;  1XI1 A;  4KKO A;  1TKZ A;  4NYF A;  1TGO A;  2KQ2 A;  3V9W A;  3G0Z A;  5KGX A;  3QLH A;  4DF8 A;  3CG7 A;  4M3X A;  1RBV A;  1Z26 A;  3AVJ A;  4Z0U A;  4CJL A;  1QSS A;  3SQ2 A;  4CJE A;  3LDS A;  1KFS A;  4W5N A;  4JLH A;  3TR8 A;  1T7P A;  1DTT A;  1QTM A;  3HP6 A;  2PYJ A;  2B4J A;  1RT5 A;  4O55 A;  2HNY A;  2QKB A;  3V1R A;  3C6T A;  1BIS A;  4C8N A;  2KZZ A;  3QNO A;  4DSI A;  2HHS A;  3P1G A;  3DI6 A;  4KB1 A;  1JLF A;  4DQP A;  4FLZ A;  1ZYQ A;  4O5B A;  5D3G A;  1F21 A;  4KFB A;  3IAY A;  1QE1 A;  4Z4I A;  1REV A;  3L2Q A;  1TKD A;  1WAJ A;  3HPH A;  1BQM A;  3IG1 A;  4B8A B;  1RT6 A;  4N5S A;  2GV9 A;  4FJM A;  2VG7 A;  4FXD A;  3PUF A;  3MXJ A;  3V9U A;  1L5U A;  3L2U A;  3QIP A;  1O1W A;  4CK1 A;  1BCO A;  3O3F A;  3RWU A;  3HJF A;  2IS3 A;  4PY5 A;  4QOZ B;  1NOZ A;  3AA3 A;  3M8R A;  4CEO A;  3VQ7 A;  3G10 A;  3IRX A;  3PV8 A;  2RKI A;  4CK2 A;  1KVB A;  1HNV A;  3OYG A;  1EX4 A;  4CF8 A;  4LD0 A;  3NAE A;  2DFF A;  1C1C A;  2ZD1 A;  1T03 A;  3ZSR A;  5J2M A;  1HMV A;  4HUG A;  1SL2 A;  3TAM A;  5I3U A;  1NOY A;  3OS0 A;  1TK5 A;  4FJK A;  1SKR A;  4OVL A;  2BE2 A;  3DOL A;  3THV A;  2VWK A;  4ZHR A;  4PWD A;  4NCA A;  2RN2 A;  1JLG A;  1XHX A;  3V9S A;  3CM6 A;  4C8M A;  4KHW A;  4E7H A;  3DM2 A;  3BDP A;  1I39 A;  1RTH A;  3PY8 A;  1LW2 A;  1QHT A;  2ITG A;  1BGX T;  3QO9 A;  4AHC A;  1QSL A;  2X78 A;  1SKW A;  4CJS A;  2RF2 A;  5KI6 A;  3VQ5 A;  2P1J A;  4CGI A;  4Z4F A;  3WNH A;  2IDO A;  3VQQ A;  4CJT A;  3AVF A;  3SNN A;  5HRN A;  4RG8 A;  3KTQ A;  4B9N A;  4DU4 A;  3O3H A;  4KHU A;  4IFY A;  3VQE A;  4CJU A;  2R7Y A;  4F2R A;  3T1A A;  5EU7 A;  3OY9 A;  1LW0 A;  2A1R A;  1NJY A;  4AH9 A;  4FJ7 A;  4DTO A;  4FK4 A;  4R5P A;  4W5Q A;  3ZSX A;  4J2E A;  4FZZ A;  1HJR A;  1JKH A;  1A5W A;  4I9L A;  4CF9 A;  4E7L A;  3LP3 A;  3TI0 A;  4E7J A;  1X9W A;  5C25 A;  3KD1 E;  4CFA A;  1FXX A;  2Y1I A;  2AJQ A;  3O3G A;  1RT7 A;  1TK0 A;  3NGZ A;  1RDC A;  3HO1 A;  4DFM A;  2Q3S A;  1KRP A;  4LSN A;  2BAN A;  3HL8 A;  4UQG A;  2HHX A;  2YV0 X;  1C0T A;  2WOM A;  4IBN A;  2QK9 A;  3NF6 A;  1NK8 A;  3MAQ A;  4KTQ A;  4F3T A;  2G8V A;  3M8S A;  3L2W A;  4KB0 A;  5SZT A;  4CEE A;  4FJ9 A;  4DSF A;  4DU3 A;  3OYB A;  2VG5 A;  4DQQ A;  4N76 A;  3V1Q A;  2HHU A;  4M3Y A;  1I3A A;  4CHZ A;  3JYT A;  3NDK A;  2XHB A;  5FDL A;  4QAG A;  3QER A;  4EZ9 A;  1UA0 A;  4K8X A;  2QXF A;  4M3U A;  3SCX A;  1U49 A;  4FLY A;  3EZ5 A;  4FLT A;  3T3F A;  3M8P A;  4AHS A;  1KLN A;  2BGG A;  4OLA A;  3ALY A;  1ZBU A;  5CY4 A;  4HCC A;  4DTU A;  3K5O A;  3VQC A;  4DLE A;  4FJH A;  4FJG A;  3LAM A;  4E7K A;  3V9X A;  3A2F A;  3SPY A;  1YVU A;  3S3O A;  2QKK A;  4PA1 A;  2FBV A;  2E4L A;  3M8Q A;  4FZY A;  3V1O A;  3RTV A;  1TL1 A;  1BL3 A;  3DRR A;  4CEZ A;  4CEC A;  5KGW A;  3LAK A;  5J2P A;  4KAZ A;  3AA2 A;  4FYD A;  1RTI A;  1IH7 A;  4IG3 A;  1IKX A;  2OPR A;  4CJ5 A;  3NH0 A;  2KTQ A;  3SUN A;  4DFK A;  3RMA A;  1JLA A;  4M3W A;  1SUQ A;  1JLC A;  4FJL A;  1HQU A;  1VSD A;  1J9A A;  4N56 A;  1D8Y A;  3NE6 A;  4QCL A;  3F9K A;  2HMI A;  1WSJ A;  3RMC A;  1NKB A;  2ZQB A;  3TAP A;  2P51 A;  1S1V A;  3KKR A;  1FKP A;  1L3T A;  3AVH A;  4E1M A;  1HQE A;  4FLV A;  2HB5 A;  4DFJ A;  5E41 A;  1JLE A;  1CZ9 A;  3NGY A;  4BE1 A;  3B6O A;  2G8I A;  5CZ2 A;  3NHG A;  3S9H A;  1U04 A;  2G8H A;  4KHQ A;  4CJV A;  3O4Q A;  5HRS A;  1ASU A;  4FK2 A;  4DG1 A;  3ZSV A;  1KTQ A;  4DTP A;  4CJP A;  1U47 A;  1SL0 A;  1CZB A;  5J1E A;  3ZT2 A;  4ID5 A;  2OYQ A;  4F8R A;  3HPO A;  4LSL A;  4FW1 A;  3KK2 A;  4KTW A;  1UA1 A;  3ITH A;  1L3U A;  3U6F A;  1IG9 A;  4FJI A;  1TKT A;  1W9H A;  1RT3 A;  4BWM A;  3AV9 A;  4IG0 A;  4CGG A;  4DF4 A;  2HNZ A;  4OKK A;  3TAN A;  1RT4 A;  3VQD A;  3H08 A;  3C95 A;  3KLG A;  3ZCM A;  4YFU A;  2E6M A;  4H4M A;  1HRH A;  4M3T A;  3CM5 A;  4KRF A;  4CJR A;  4O0J A;  1C0M A;  1LWE A;  3CFP A;  4LH5 A;  1G15 A;  4KRE A;  1WNS A;  1NK9 A;  1J5O A;  2XY6 A;  1FKO A;  3UIQ A;  4F3O A;  3CFR A;  2PZS A;  1YT3 A;  2ATQ A;  1VSK A;  4BE0 A;  2HW3 A;  1S1W A;  3RMB A;  4FLX A;  4N41 A;  1HYV A;  3VQA A;  4EP4 A;  3V9Z A;  3OS2 A;  4E0D A;  4CE9 A;  3V4I A;  1D9D A;  3RR8 A;  1BI4 A;  4I2P A;  3QEI A;  1T05 A;  2FBX A;  4N47 A;  3VN5 A;  3RR7 A;  5CYQ A;  2XO7 A;  1U48 A;  1L3V A;  4PQU A;  4AHR A;  4FW2 A;  1WLJ A;  3AVC A;  3HPG A;  4CHY A;  3I0R A;  1NK7 A;  4FLW A;  1NK0 A;  3TAG A;  4C8K A;  4CIF A;  2RPI A;  2YNG A;  4AIL C;  4RW4 A;  1QS4 A;  4E1N A;  4XIU A;  4OPK A;  4DU1 A;  2P5O A;  1LWC A;  4OGC A;  3I0S A;  4ID1 A;  2O4G A;  3JSM A;  4I2Q A;  4CJK A;  1X9S A;  1GOC A;  4O0I A;  4W5O A;  3VQ8 A;  2XY7 A;  5I42 A;  2KFZ A;  4GMJ B;  3SV4 A;  1IO2 A;  4C8L A;  3D45 A;  3KJV A;  1EET A;  3K59 A;  1U4B A;  4Y1D A;  3DOK A;  5DMR A;  3C94 A;  4Z4H A;  3HT3 A;  4ELU A;  4BWJ A;  4HVJ A;  3ZSQ A;  3QEX A;  1A5X A;  4MQ3 A;  4DTN A;  1Q9X A;  1VRT A;  3KK1 A;  2D0C A;  4EZ6 A;  2F8T A;  3AO2 A;  5CYM A;  2B5J A;  3LP2 A;  1Q9Y A;  3CFO A;  2OZM A;  1WSE A;  4BAC A;  1VSH A;  1J54 A;  2IOC A;  4CED A;  4DSK A;  3P5J A;  3HK2 A;  4FLU A;  1T8E A;  3AA5 X;  2D0B A;  4FJ8 A;  1TVR A;  1VSJ A;  3DLH A;  3AVI A;  1TL3 A;  2ZE2 A;  1S6P A;  2YNH A;  5DK5 A;  1RBS A;  3DYA A;  2DFE A;  1LWF A;  3DMJ A;  3LZJ A;  3TAF A;  1TV6 A;  4B3O A;  1IKY A;  3AVK A;  5C42 A;  4CF0 A;  3VQ6 A;  5FRM A;  4F2S A;  3VQP A;  1JLQ A;  4FZX C;  4JRP A;  4ZTF A;  4KI4 A;  2D5R A;  4NCB A;  2ETJ A;  1B9D A;  4CJ3 A;  3K5L A;  1CXU A;  1VSL A;  4DWI A;  4DLG A;  3OYN A;  1IKV A;  1S9E A;  3HVT A;  2YNI A;  2XRI A;  1BCM A;  3DLR A;  4CJ4 A;  1S5J A;  3HP9 A;  2NUB A;  3AVB A;  3WNG A;  3OYI A;  4BDP A;  4K8Z A;  1RDA A;  2OPP A;  2GBZ A;  4CFB A;  3OYC A;  3KK3 A;  3V6D A;  1R0A A;  4HCB A;  1TAU A;  4KPY A;  4Z4E A;  3DRP A;  2G8U A;  1WSH A;  3ULD A;  2KZM A;  1S1T A;  3HVR A;  4L8R B;  3QES A;  1X9M A;  4CJF A;  3KLI A;  4OKE A;  3KLH A;  4FK0 A;  3L3V A;  1LAV A;  1JL1 A;  1D9F A;  1YTU A;  4HUE A;  4O4G A;  3HXM A;  3F73 A;  1U45 A;  4CHO A;  3ZSW A;  1S1X A;  3KLE A;  4B9S A;  1KLM A;  2HND A;  2OPS A;  3AO3 A;  1B9F A;  1S9G A;  4M45 A;  1KVC A;  2FC0 A;  4OKJ A;  4W5R A;  4DTX A;  1KSP A;  3ZT3 A;  5FRN A;  2HHQ A;  3DLE A;  4FJJ A;  3KLF A;  1JLB A;  4Q5V A;  3K2P A;  4CHN A;  4DS5 A;  1WSF A;  4CEQ A;  1ASV A;  2XY5 A;  3PO5 A;  3AVM A;  1K6Y A;  4CEB A;  3SUP A;  1C0U A;  4B9U A;  3CQ8 A;  2P5G A;  1GOB A;  2D0A A;  3DLG A;  5HRR A;  1RT1 A;  2Z1I A;  2PY5 A;  3AO1 A;  1W0H A;  5FRO A;  3OYD A;  1YTA A;  4CER A;  3WNF A;  1NJZ A;  4RW7 A;  3LAL A;  1TK8 A;  4B9V A;  2B6A A;  4CF2 A;  1UAX A;  1NK6 A;  4DSJ A;  2FBT A;  3OS1 A;  2DTU A;  4AHT A;  2YNF A;  1RCH A;  2OA8 A;  3OJU A;  3SQ0 A;  2HHT A;  3OYH A;  4B08 A;  1SV5 A;  2A1S A;  4TSX A;  1RNH A;  3EYZ A;  3QNN A;  2VWJ A;  1C6V A;  4E3S A;  4B9T A;  4FJX A;  3NH2 A;  3SI6 A;  1EXQ A;  4I9Q A;  4BDY A;  3E01 A;  2HVI A;  1QQC A;  3ASM A;  1BIU A;  1J53 A;  4OJR A;  4H8K A;  1FK9 A;  4W5T A;  3LAN A;  4LY7 A;  4LH4 A;  2JLE A;  3NF8 A;  1HPZ A;  3KIO A;  3NH1 A;  2F8S A;  5JS1 A;  1BIZ A;  5HRP A;  3PX6 A;  1EP4 A;  1RBU A;  1RDD A;  4JRQ A;  1XC9 A;  3DLB A;  4DQI A;  4NYN A;  4CF1 A;  2YHB A;  4KHS A;  1TKX A;  3AA4 A;  3AO4 A;  4KHN A;  5CZ1 A;  5HRO A;  3SQ1 A;  3HYF A;  3HST B;  4M3R A;  3SUQ A;  4O44 A;  1WSI A;  1JXE A;  1SL1 A;  2HHV A;  4CGH A;  4DMN A;  2W42 A;  2YHA A;  4YNQ A;  3VQB A;  4CIG A;  1Y97 A;  1RT2 A;  3PX4 A;  4FJN A;  3TAB A;  1CLQ A;  1RBT A;  4Y1C A;  1JXB A;  4IFV A;  4OGE A;  4E19 A;  4C8O A;  3ZT4 A;  2X6N A;  3VA3 A;  3OYM A;  3NBP A;  4WE1 A;  4CK3 A;  2VG6 A;  4J2B A;  2YKM A;  3NGI A;  3NF9 A;  3T19 A;  4DQR A;  1C1A A;  4FCY A;  4IKF A;  2E6L A;  4GVM A;  2PYL A;  2IC3 A;  3LPU A;  4B9L A;  4ELT A;  5KRT A;  3HM9 A;  2IAJ A;  3QET A;  4PUO A;  3LPT A;  4ICL A;  3FFI A;  4MFB A;  3L2R A;  1X1P A;  3D0P A;  2KW4 A;  4JS4 A;  1MU2 A;  3SZ2 A;  3BGR A;  5HP1 A;  2I5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...