5KGWA

Hiv1 catalytic core domain in complex with inhibitor: (2~{s})-2-[3-(3,4-dihydro-2~{h}-chromen-6-yl)-1-methyl-indol-2-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
153
structure length
134
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title Indole-based allosteric inhibitors of HIV-1 integrase.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 44
structure length 134
sequence length 153
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5kgwA00
4IDKA 1RILA 2DFHA 3DYAA 2BANA 1VSKA 2GUIA 2P51A 3O3HA 1RT1A 2EHGA 3LP2A 2I5JA 4FZYA 1I3AA 1VSDA 4CJTA 4DSIA 3ZT1A 4M3UA 3OY9A 1ZBIA 4KAZA 3K57A 4W5RA 4PWDA 1D9DA 4FJ9A 5C25A 1A5VA 2KW4A 3PX4A 4Z4EA 5FRNA 2ZD1A 4I2PA 1UWBA 3KTQA 3U3GA 1SL1A 1RTDA 4CF9A 3TAGA 1WAFA 3CFOA 1NK6A 2BE2A 1JLQA 3LP1A 4EP4A 3NHGA 3OYMA 4H4MA 4JS5A 3DLHA 2HVHA 4GMJB 1NK5A 5CZ1A 2RF2A 1JL1A 3HPGA 2KZMA 1LV5A 3L3VA 3T19A 1J53A 4Z4CA 3QESA 1VK0A 3MECA 4CEBA 4CHZA 5T7BA 3RMCA 1C1CA 4FLZA 4B08A 1BCMA 3THVA 3LAKA 3LP0A 3QIOA 4CGIA 3IS9A 2YNHA 1WSGA 3V9ZA 4RW7A 1XWLA 2NUBA 4KI4A 3D0PA 1UAXA 2RPIA 2Z1HA 4BDYA 1U48A 3S3OA 2HMIA 4DQIA 4E0DA 1Z25A 4F4KA 4LSNA 2XY8A 3AVFA 4ID5A 1UA1A 3SV3A 1RTJA 4FVMA 4H4OA 5J2PA 4FJXA 2E4LA 3ASMA 3OJUA 1XC9A 2F8TA 2YKNA 1Q8IA 2QXFA 3AVNA 1A5XA 1C6VA 2HW3A 3D45A 4Y1DA 2OPQA 4Q5VA 3LANA 4KTZA 4JRQA 3TAQA 2HB5A 2B4JA 3SQ1A 1XHZA 4CJUA 1Y97A 4CCHA 4W5QA 4FJ5A 1D5AA 4HUGA 4CHNA 1JXEA 4C8OA 4OLAA 4DTOA 2OPPA 3KLHA 4EZ6A 3MXMA 4OLBA 3QO9A 4UQGA 1WAJA 3DRSA 4CJEA 3WNHA 4DWIA 4M42A 2DTUA 4YNQA 5CY4A 3VQ5A 3QNOA 3VQ7A 3VQBA 3KK2A 4M3RA 3PX6A 2P1JA 1NOYA 4NCAA 4FZZA 3OS2A 1NKCA 1D8YA 1NOZA 3DLGA 4ID1A 1VRUA 4O0JA 4DS4A 4HUEA 2JGUA 2X6NA 4ZTJA 1S9GA 1HQUA 3VN5A 3HT3A 1Q9XA 4DFKA 4MQ3A 1EETA 2ZE2A 2Y1JA 3EYZA 1K6YA 1NJXA 1X1PA 4KV8A 4W5TA 4OGEA 3RMBA 1TL3A 2D0CA 3AVLA 3HVRA 3KLEA 2PYLA 4RW6A 3AA2A 4FM2A 3AVCA 1SKWA 3NBPA 2OYQA 1RT7A 4KHQA 4NYFA 2D5RA 4I2QA 3ZT2A 4BE1A 2XY6A 3BDPA 3DRPA 4KRFA 3TAPA 3PO4A 4C8LA 1JL2A 4B3OA 3QERA 4KI6A 4Z4GA 5E41A 4CFCA 1WSIA 2D0AA 2XY7A 1B92A 3CM6A 3NCIA 4F8RA 4DFPA 4FJJA 3NF8A 4CGFA 3LPTA 4DTNA 3OYAA 4FLUA 2RKIA 3VA3A 1L3TA 4F3OA 4FJLA 4CJRA 3ZSQA 3ZT4A 3CG7A 3NH1A 3AO3A 4DS5A 4CIEA 1L3SA 5SWMA 1VSHA 2YNIA 3M8RA 5HRNA 3JYTA 3DM2A 3KKSA 3VQPA 1S6QA 1C1BA 4NCGA 5SZTA 1ASWA 3VQQA 4B8AB 2JLEA 4DQRA 1VSIA 1IKXA 4H8KA 2Y1IA 1NK7A 2QK9A 1WSEA 1FKPA 4CEFA 4KHNA 3RRHA 2Q3SA 4FLWA 1BIZA 4TSXA 3SUOA 3AO1A 1C1AA 4FJHA 2W42A 3V6DA 1NK8A 4CJ4A 3ZSOA 1U04A 1HYVA 2ITGA 4CJWA 1RBRA 5DK5A 3LWLA 3NE6A 4DTUA 2YV0X 3HPOA 4Y1CA 3SPZA 3TANA 3RRGA 3L2RA 3EZ5A 2FBVA 4FK4A 4PY5A 2YHBA 3I0SA 4BWJA 5HLFA 3DLBA 3UIQA 1J54A 4CEZA 3HM9A 2OZSA 2HHXA 1G15A 4FJ7A 5FROA 3B6OA 3HP9A 2DFFA 5KRTA 4FLYA 4DF4A 1TK5A 3PO5A 1S1XA 4G1QA 4O0IA 5J2MA 3U3YA 1RT5A 4FM0A 4HHTA 2Z1JA 1B9FA 3ZSZA 1TK0A 3AVMA 1ZBLA 1KFDA 3NGYA 1RDAA 1KLNA 4L8RB 1NK0A 3HJFA 1LAWA 3OYEA 1DLOA 3O3GA 4KPYA 2XRIA 3NFAA 5HBMA 4LSLA 3TWHA 4BE0A 5HP1A 1IKVA 4F3TA 1S1UA 4AHTA 4FLXA 2F8SA 3L3UA 3PUFA 4M45A 3OS0A 1KVCA 5DMRA 4FLTA 1NK4A 4E7HA 4CJLA 3OYKA 1S1WA 3KLGA 1IG9A 4DFJA 2O4GA 1LW0A 3MXIA 3NGZA 1KLMA 1SKSA 1TKZA 4KREA 3OYNA 1QSYA 4Z4FA 4JS4A 2OZMA 2DFEA 3B6PA 3OS1A 1LWCA 3ZT3A 3HK2A 3BGRA 4MFBA 1UA0A 2YNFA 1QE1A 2FBYA 4LH5A 5KTQA 4YFUA 4CGDA 3HSTB 1FKOA 4CJKA 3RWUA 1QHTA 1RT6A 1S1TA 3RTVA 2HHSA 3K5NA 1Q9YA 1JKHA 1NJYA 2HHWA 2OPRA 1DTQA 5J2NA 1S9EA 1VSLA 3VQCA 2XO7A 3SJJA 1IO2A 3VQ9A 1NKEA 2ZQBA 4KKOA 3C94A 1ZBFA 3L2WA 5CZ2A 1N5YA 1VSMA 3O3FA 3TR8A 3PV8A 2G8WA 4DSKA 2HNYA 4HCCA 2RN2A 4I9QA 3TARA 3WNEA 3TAFA 4FW2A 4PQUA 3NAEA 2HVIA 4DTXA 1KRPA 3AO5A 4AHVA 3K5MA 3L8BA 4DU4A 4CEDA 1HNIA 1CXQA 4E7JA 3V9SA 3KKRA 3QEPA 4DLGA 4CJ3A 4E3SA 4AH9A 3VQAA 4KHYA 1RBUA 2R7YA 3VQ4A 3QLHA 4CGJA 3SZ2A 4FW1A 4CJFA 4CF0A 4CEOA 4CK3A 1ZYQA 1MU2A 3QNNA 4IBNA 2ETJA 3DI6A 3KLIA 5HROA 1U45A 2VG6A 1RDCA 1VSJA 4M41A 4FLVA 3MEDA 4PUOA 3FFIA 3K5OA 2HNZA 1CXUA 1ASVA 2XY5A 1NKBA 4ELTA 1BHLA 3TABA 2OPSA 3AVAA 3SPYA 1XI1A 2G8FA 3S3MA 1WLJA 2FBXA 4E7KA 4E1NA 4CESA 2B5JA 3AA5X 2XHBA 4CF1A 1TKDA 4DSJA 1S5JA 4KB0A 4CECA 1W9HA 3QEWA 4B9LA 3K2PA 1RTHA 4BACA 5I42A 2KZZA 1TAQA 1NJWA 3OYJA 4RW8A 4B9UA 1KCFA 3KK1A 1A5WA 2G8HA 3O4NA 3MEEA 4I9LA 4OJRA 1XHXA 4Z0UA 3LDSA 2G8KA 2PYJA 4CFBA 1C0MA 1RBSA 3HYFA 5HRPA 3EY1A 2X74A 5KGWA 4AHUA 4CHOA 4CHYA 4DSLA 1CLQA 2YNGA 2KFNA 1KSPA 1JXBA 2LSNA 1LWEA 4OKJA 4QAGA 1KTQA 5FDLA 3ZCMA 4CEAA 4W5OA 3QEVA 1HJRA 1HNVA 1VSEA 3LAMA 1R0AA 1BISA 4C8MA 3ZT0A 3DLEA 4CK1A 4CE9A 2IDOA 4FYDA 3DRRA 3NGIA 1F21A 4LH4A 3IAYA 4EP5A 1JLBA 3ALYA 3M8SA 1RDDA 5KGXA 3HO1A 1J5OA 4DTSA 2FBTA 3SUPA 2A1RA 3LALA 3OYLA 4FJGA 4DMNA 4N76A 4O4GA 3V4IA 3V1RA 1HYSA 4BDPA 4FCYA 3NF6A 2G8UA 1SV5A 3L2UA 1X9WA 3MEGA 4GW6A 4B8CA 4CJ5A 2KQ2A 1S6PA 3SV4A 1UOCA 3G10A 3AA3A 3T1AA 1IKWA 2X6SA 4IG3A 4J2BA 1WSJA 4ZHRA 1WNSA 2VG7A 4IG0A 1C0UA 4FXDA 2IGIA 4FJ8A 4M3TA 3S3NA 2OA8A 4CIGA 3C6TA 4FK2A 4M3XA 1BCOA 3SYZA 4E1MA 3O4QA 2IC3A 1HPZA 3G0ZA 1U47A 4M3YA 4F2RA 4IFYA 4QCLA 4CHQA 3CFRA 4FZXC 1WSHA 3QEIA 2KFZA 4PA1A 1I39A 3LP3A 4CEEA 3OYIA 4KHSA 3ISNC 4RG8A 4E89A 3OYGA 1D9FA 3SI6A 3VQ8A 1T03A 3V1QA 1BI4A 3KIOA 3DMJA 4BE2A 1N6QA 5CYMA 3ZSXA 2WONA 3WNFA 4C8KA 2P5GA 1GOCA 4CF8A 4DSFA 2D0BA 4FJKA 2GV9A 4FJIA 3LZIA 3CM5A 2PZSA 1VRTA 4J2DA 4CFAA 1RBTA 5C42A 4OKKA 5J2QA 1LW2A 5C24A 2PY5A 3DOLA 2BDPA 4GVMA 1SL0A 1GOBA 4NYNA 5KRSA 3QETA 3KLFA 4HCBA 3AA4A 2O4IA 3HVTA 1T7PA 4CFDA 1TKXA 1EP4A 2VWKA 3VQDA 3SQ0A 3QINA 3KK3A 4OKEA 3AVIA 4O5BA 2DY4A 4KTQA 4ZTFA 1ZBUA 4KO0A 3M8PA 2IOCA 4B9SA 4N56A 1HQEA 4BDZA 4J2EA 1LAVA 4Z4IA 4DFMA 1Z26A 3E01A 4KTWA 3VA0A 4CERA 3SUQA 4EZ9A 2HHQA 4DLEA 1TK8A 1BI4B 4IKFA 4J2AA 3P1GA 3L2QA 3K5LA 3CQ8A 1LWFA 1QTMA 4IFVA 4FK0A 3HL8A 2Z1GA 5JS1A 1WSFA 3SQ4A 4K8XA 2F96A 4DF8A 5D3GA 2KTQA 5JS2A 4DQQA 3ZSVA 3AO2A 3QIPA 3RMAA 4DQSA 3QEXA 1ASUA 1VSFA 4K8ZA 3OYFA 1T8EA 3RR8A 4FJNA 3LPUA 4FJMA 4KB1A 1HYZA 1JLFA 3H08A 1O1WA 1W0HA 1SUQA 2VG5A 4M3ZA 1REVA 2QKBA 5J1EA 3LZJA 3CYMA 1DTTA 2IS3A 3P83D 4Z4HA 3OYBA 1HMVA 1RT3A 4LY7A 3V9UA 4ELUA 2HHTA 4CJPA 4DU3A 1BQNA 2QKKA 3DLKA 4RW4A 3LWMA 3L2VA 3SNNA 4B9MA 4KHUA 2A1SA 2B6AA 3NF9A 3C95A 4OVLA 4AHSA 3HXMA 3HP6A 1FK9A 3IRXA 1JLAA 5HRRA 5CYQA 3V1OA 3AO4A 4DTRA 1BGXT 1T05A 4B9NA 1TL1A 4AHRA 4AILC 1ITGA 3K59A 2E6LA 1KVBA 5HRSA 3T3FA 3OYCA 3S9HA 3A2FA 4N41A 2FC0A 3NH2A 4CGGA 1ZBHA 1RCHA 4CK2A 2YKMA 2P5OA 2X78A 2YHAA 1QQCA 3F9KA 3MXJA 4OPJA 5I3UA 1J9AA 3AV9A 3CFPA 1KFSA 3KJVA 4OPKA 3ZSYA 4BWMA 4ELVA 4CJSA 4DTMA 1JLEA 1EX4A 1IKYA 3TAEA 4KHWA 3DLRA 3ZSWA 1KVAA 4E7IA 3OYDA 3OYHA 1CZ9A 3AVHA 4XIUA 3SQ2A 1GOAA 1NJZA 1TGOA 1EKEA 2GBZA 4N5SA 4KFBA 4HTUA 4W5NA 3AVKA 1SKRA 4CEQA 1L3VA 3VQ6A 1RTIA 1RNHA 1U49A 3VQEA 4LD0A 4HVJA 3ULDA 2HHVA 3DOKA 4DU1A 4E7LA 3V9WA 4C8NA 4F2SA 1HRHA 4I7FA 3NF7A 4HUFA 1CZBA 3WNGA 3NDKA 3I8DA 1S1VA 1QS4A 3KD5E 3P5JA 4ICLA 1RBVA 1NK9A 4AHCA 3V81A 4RW9A 4CJQA 1RDBA 3NH0A 4DTJA 3U6FA 1YT3A 2G8IA 4WE1A 3MAQA 3OVNA 4JLHA 1BL3A 3RMDA 1BIUA 4R5PA 1L3UA 4B9TA 2BGGA 4N47A 4QOZB 3OJSA 3RR7A 3JSMA 1JLGA 3K58A 3I0RA 4O44A 4DG1A 4B9VA 1QSLA 2VWJA 4CIFA 1YVUA 1RT4A 4JRPA 3SUNA 2EX3A 1YTAA 3AVGA 4NCBA 3AVBA 1TV6A 4CHPA 4E19A 3M8QA 4DSEA 5K14A 1YTUA 3ITHA 1EXQA 1TAUA 2IAJA 2HNDA 3C6UA 3HPHA 3ZSRA 4CGHA 3PY8A 1JLCA 4OGCA 2G8VA 1C0TA 2WOMA 4O55A 2HHUA 5FRMA 1B9DA 3IG1A 4CF2A 4M3WA 2ATQA 4CJVA 1L5UA 3KD1E 3PX0A 3TI0A 3TAMA 1RT2A 1TVRA 4FM1A 2Z1IA 1U4BA 5KI6A 5EU7A 1X9SA 2AJQA 1TKTA 1WN7A 1X9MA 1SL2A 3F73A 1BQMA 4DQPA 4Q0BA 2E6MA 3V9XA 1FXXA 1IH7A 3SCXA 4DTPA 3AVJA 1QSSA
chains in the Genus database with same CATH superfamily
3AAPA 3THYA 2BANA 2WFBA 1RT1A 3CF5L 2ZGZA 3LP2A 1I3AA 3I8BA 3OY9A 2IVOA 4KAZA 4PWDA 3VETA 1A5VA 1RGIA 4I2PA 3U3GA 1RTDA 5JICA 1BG3A 3CFOA 2BE2A 3DLHA 4JS5A 4H4MA 3O9SA 1HNXK 3LL3A 2RF2A 3HPGA 2Q36A 3T19A 1J53A 4Z4CA 3MECA 3DXKB 5T7BA 2KKZA 4FLZA 5GINA 3THVA 1GLCG 4CGIA 2YNHA 4A62A 4F4KA 4WQ5C 1ESVA 3THYB 3S3OA 2E2NA 4FWPA 4FOEA 3SJHA 1FW6A 3PSIA 4LC9B 1IV0A 3J8AA 3ASMA 2F8TA 5FPNA 5A2QO 1HNZK 1ATSA 1N32K 5F1XA 4Y1DA 4K43A 3KK7A 3P31A 1Y97A 4W5QA 1D5AA 2W40A 1JXEA 1YJNN 4C8OA 4OLAA 2OPPA 3HI0A 2OANA 3MXMA 2NRRA 4CJEA 4FL9A 3ZEUA 1ZXOA 3VQ7A 3VQBA 3KK2A 4FZZA 2P1JA 5DM6L 3MWTA 3DLGA 4ID1A 1VRUA 4FWQA 5KPRA 2X6NA 4DFKA 5KPTA 4MQ3A 2UUAK 3O1BA 4W5TA 4OGEA 3RMBA 3HVRA 4JK9A 4RW6A 3I56N 3ZX2A 1NJIO 1YF5L 1D4XA 4WFBL 1JL2A 4FWMA 4KI6A 1WSIA 4JI7K 1B92A 2E8AA 5FPDA 3NCIA 4DFPA 4FJJA 3LPTA 2ZF5O 3OYAA 4CJRA 4K42A 3NH1A 3AO3A 4CIEA 5SWMA 1S6QA 5SZTA 3QB0A 4B8AB 4DQRA 4H8KA 4YHHK 1WSEA 1FKPA 1NGBA 3AO1A 1HKBA 4BGAA 4FJHA 2P9PA 1NK8A 3ZSOA 3EZWA 2G8WA 1Z05A 1Q86O 1VQ8N 4Z94A 3L2RA 2FBVA 4FK4A 4JI0K 5AQFA 3B6OA 3W3DA 3CCRN 2Z1JA 1B9FA 1ZBLA 1NK0A 3OYEA 4CW7B 1BA0A 1DLOA 3WXMB 3O3GA 4KPYA 4BE0A 3J81O 4F3TA 4JV5K 4NXMK 4FLTA 1NK4A 4LF6K 5E26A 4NLBA 4DFJA 3W0LA 3MXIA 1KLMA 2NRHA 3T69A 4CZGA 2HHHK 4JS4A 3B6PA 3BGRA 4LH5A 1QE1A 5KTQA 5GIPA 1QHTA 1RT6A 1S1TA 3LDOA 1Q9YA 3SAFA 2OPRA 3PLAA 1DTQA 4DR7K 3C94A 3L2WA 1QQNA 4A61A 1VSMA 3PV8A 2HNYA 4FO0A 4PQUA 3VF2A 3VMFB 3CCJN 3O5BA 4H5NA 1HPMA 2P9KA 1CXQA 4E7JA 3KKRA 4CJ3A 1YIJN 3VQAA 2YHYA 2OCEA 3JXUA 3VQ4A 2V7YA 3QLHA 5AQTA 3SZ2A 4CJFA 3LDPA 4H5WA 3CJCA 4JK8A 5LMUK 1YAGA 3TSQA 3K0SA 1N8RO 3K9KA 1XNQK 5HROA 3VOVA 4FLVA 3U4LA 1YUWA 2XY5A 1NKBA 1BHLA 4EHUA 1XI1A 2G8FA 3O4WA 2B5JA 2XHBA 4DSJA 1W9HA 4B9LA 1NGCA 2KZZA 1TAQA 4YOUA 3SBTA 3D2FB 4B9UA 4RW8A 3KK1A 4I9LA 1BU6O 2VCPA 2PYJA 3HTVA 2P9UA 1RBSA 4BRGA 3EY1A 5KGWA 4CHYA 1IG8A 2YNGA 2KFNA 1KTQA 4CEAA 1HJRA 1VSEA 4H5RA 4LF9K 3JAMO 4JK7A 3ZT0A 1VHXA 2ZJPL 3FFKB 4CZIA 1F21A 3VGMA 4EP5A 1JLBA 2O8EA 4BROA 1RDDA 3HO1A 2IIRA 4DTSA 2FBTA 2A1RA 4N76A 3LALA 4JI5K 2W41A 1W2BM 1UOCA 2A3ZA 4U7BA 4IG3A 3SK3A 4J2BA 2VG7A 4IG0A 4PL8A 2P9LB 4DV6K 3TTCA 3VTIA 1T44A 3S3NA 4M3XA 5EX5A 3SYZA 3O4QA 2IC3A 1WBBA 5CHIA 5AFUA 1E3MA 3CFRA 3QEIA 4A57A 4RG8A 4NXNK 2HSTA 3MN7A 4BE2A 3ZSXA 2P9IB 2WONA 4FVUA 4YOWA 4EIAA 4JKGA 4B3RK 2PZSA 2WC9A 4J2DA 2BDPA 2CGKA 4YOVA 4GVMA 4NYNA 5KRSA 3KLFA 2HOEA 4DUZK 1U2VA 1TKXA 3KK3A 1EQYA 5TKWA 5AQRA 3C6AA 4ZTFA 3GOIA 3M8PA 4IOCL 4B9SA 1BOTO 1HQEA 2HF3A 1LAVA 4J2EA 3E01A 4KTWA 3VA0A 4CERA 1OVQA 1HJOA 4IKFA 5AQLA 4JKGB 2PAVA 5JS2A 4DQQA 4FPAA 1T8EA 5AQNA 3QICA 3THWB 3E9PA 4M3ZA 2QKBA 3LZJA 3V9UA 4DQ8A 1HMVA 4LY7A 2RHKA 4PKIA 5H1SQ 2HHTA 4H5VA 1OH8A 2QKKA 3DLKA 4RW4A 4MO4A 2A1SA 3C95A 3HP6A 4DTRA 4B9NA 1TL1A 4JI2K 3K59A 5HRSA 3T3FA 3OA9A 3A2FA 2FC0A 4BRDA 2YHAA 4FWKA 1KQSM 4DV4K 1KAZA 3CFPA 3D2EB 4IEEA 3EO3A 1VQLN 4ELVA 4CJSA 5GADP 3OYHA 1CZ9A 3SQ2A 4HTUA 4W5NA 1L3VA 4BG8A 1GLBG 4B1YB 5M1FA 4XH5A 4I7FA 5KQDA 4HUFA 3BUZB 1QS4A 3CMAN 3P5JA 3FZLA 4ICLA 4BRKA 3BZKA 1VQON 4RW9A 2FF3B 4DTJA 1YT3A 2IVPA 2GEMA 3OVNA 1L3UA 2BGGA 4B1UB 2NRTA 1IJJA 2E2OA 3AVGA 3AVBA 1TV6A 1M1KO 1IBMK 3ITHA 1EXQA 3HPHA 1RDWX 1WBDA 3H1VX 1JLCA 5JLFA 4OGCA 2HHUA 1W97L 1NGJA 2YI1A 1L5UA 1K73O 2W6KA 4IJNA 4DV3K 4FPBA 5EU7A 4JKFA 2AJQA 4B1VA 4JKCA 3CIPA 3ZSVA 4GNIA 2KHOA 3DYAA 1VSKA 3EE8A 2EHGA 2I5JA 4FZYA 4K0KK 1VSDA 5CR4A 1JCFA 1JCGA 3K57A 4W5RA 1D9DA 4FJ9A 3ZX3A 2KW4A 4DV2K 3PX4A 4Z4EA 5FRNA 3VEZA 1XC3A 5BPNA 4EP4A 1JL1A 3VGKA 3BF1A 4NO7A 4CHZA 4MLEA 1C1CA 4FWLA 3H45C 4B08A 4BY9C 3LP0A 4RW7A 4KI4A 1Y64A 3D0PA 4BRLA 1UAXA 2RPIA 4DR2K 2HMIA 1U48A 4DQIA 1Z25A 2XY8A 2GTDA 3SV3A 1RTJA 4H4OA 3OJUA 3S41A 5LMNK 1EWQA 4YDUC 3AVNA 2UXBK 4Q5VA 3LDLA 5C0YA 4JRQA 3TAQA 3CJ9A 2HB5A 4CCHA 4FJ5A 3ENBA 3VF4A 4JEPA 4EAHD 3QO9A 4UQGA 4M42A 5EXWA 4H0YB 3QNOA 4DB3A 5AQWA 5FLXO 3ULEA 1D8YA 4HUEA 1QQOA 1S9GA 3E66A 2QEXN 3HT3A 2D1KA 3EYZA 1K6YA 1NJXA 2H3GX 4O5FA 3CCMN 2YHXA 3AVCA 5ADXA 4ISFA 3T1YK 1RT7A 4KHQA 2D5RA 4BE1A 2XY6A 4C8LA 4CBWA 4EHTA 1BA1A 2XY7A 3CM6A 2HBJA 1L3TA 3PIPL 3VEWA 1HLUA 3ULEB 3JYTA 3DM2A 4KH5A 1ASWA 3VQQA 1J5EK 2JLEA 1IKXA 1XUPO 2QWMA 4CZMA 4AF1A 2Q3SA 3RRHA 1KAYA 4H0OA 3DJCA 3V6DA 4O8UA 5AQVA 3ZYYX 1U04A 3B8AX 1RBRA 4K41A 4DTUA 3HPOA 4CZJA 5ELZA 2NNWA 4BWJA 5HLFA 3DLBA 3UIQA 3EEQA 3DXKA 3GDQA 2OZSA 1G15A 5AQYA 4Y0WA 3HP9A 3CJAA 1TK5A 1NMNA 3E9LA 1XQSC 1S1XA 5LJVA 4G1QA 1WUAA 1BUPA 4FM0A 3FE1A 4A5BA 1KFDA 1RDAA 1X3NA 3IFRA 4B1ZA 3U9DA 2XRIA 3O9QA 2Q97A 4AHTA 5BR9A 2F8SA 4M45A 1KVCA 5DMRA 3MN9A 4E7HA 1S1WA 3KLGA 1IG9A 1LW0A 2O8CB 3NGZA 1SKSA 4BVPA 1VQ7N 3MK6A 4Z4FA 3A8YA 3C7NB 1LWCA 4GV3A 4DHYA 2CGLA 5EOYA 1YJWN 4XH4A 4CJ7A 3VPZA 3AARA 3RTVA 4H0PA 4CI6A 4LFBK 1S9EA 1VSLA 3KWIA 1IO2A 5M1KA 1ATRA 1VAZA 3K9JA 2QI2A 4HCCA 3TARA 1X3MA 3TAFA 4FW2A 1HUXA 5M1PA 2HVIA 1BWFO 4DTXA 1KRPA 4AHVA 5AZIA 3P4IA 4DU4A 1HNIA 2FSNA 2I7NA 5AQMA 2NLXA 4AH9A 3VGLA 3OTOK 4FW1A 1ZYQA 2QTDA 4IBNA 2VG6A 2O8FB 2YJFA 4M41A 1XMQK 1CXUA 3TABA 2OPSA 4E1NA 1R59O 3AA5X 1TKDA 1BDGA 4AQYK 1Q18A 1NGEA 1VQ4N 1KCFA 5AZIB 4GKJK 3O4NA 4Z0UA 1S72N 1XHXA 3L4QA 3VF6A 1OH5A 1C0MA 4J8FA 1NGGA 2WBNA 2X74A 5HRPA 4AHUA 2F7TA 4DR6K 1IBKK 4RTFD 1KSPA 1LWEA 4OKJA 4QAGA 1G99A 2IVNA 3QEVA 4B3OA 1R0AA 1HNVA 5TKYA 1YITN 1BISA 4C8MA 4DR1K 4AM6A 4CE9A 3UKUB 1MWMA 3M8SA 1HR0K 1J5OA 4JKEA 4FJGA 3HOSA 3R8EA 3OYLA 2DPNA 5DM7L 1HYSA 3IKMA 1ZBSA 4BR0A 3C0BA 3L2UA 1X9WA 3G25A 2KQ2A 3H3NO 3T1AA 4IOAL 3L6QA 1WSJA 2HBKA 3F9MA 1C0UA 2IGIA 4QS8A 5M1QA 3CHWA 4CD3A 2QW9A 1BCOA 3PSFA 3T7ZA 3D7EO 4F2RA 3G6EN 3CCLN 4CHQA 4OPAA 2KFZA 1I39A 3LP3A 4CEEA 4BRHA 3OYIA 1DKGD 1T03A 4I6MA 1N6QA 3WNFA 4DSFA 4FJKA 2D0BA 1TYQA 4C1NK 1NMDA 3LZIA 5JVGL 4CFAA 4RCHA 5J2QA 5C24A 3MDQA 3THXB 2O4IA 4ILJA 2E20A 3VQDA 4OKEA 5M1NA 5BN9A 2E1YA 4EFHA 4N56A 4DFMA 1Z26A 4NB4A 1HKGA 3D2FA 4I6MB 4WQ4A 3P1GA 5CE3A 5HL7L 1KXPA 3K5LA 3FGUA 4M63C 1TYQB 3OBWA 4DF8A 5D3GA 3AO2A 3OYFA 3RR8A 4WFAL 1VQKN 5B8HA 3M5RA 1JLFA 4PKHA 3DLLL 1O1WA 1W0HA 3CCQN 1REVA 3ZETB 1DTTA 4ELUA 3P83D 3TSUA 3CCUN 5JMVA 4DU3A 3LWMA 3L2VA 1S3XA 4B9MA 4KHUA 2NRWA 4OVLA 2BUPA 3U9ZA 5HRRA 3TTFA 1FK9A 1BGXT 1T05A 4IO9L 1ITGA 4FWSA 3I55N 3NH2A 4CBUA 1ZBHA 1RCHA 4CK2A 2YKMA 3JS6A 3MXJA 2P9LA 5I3UA 2HBLA 1T6CA 3GL1A 4BWMA 3ZSYA 2YX6A 4BRFA 3G71N 4DTMA 3N4QA 2A42A 2O8BB 4JI1K 1KVAA 4E7IA 2HF4A 4DCHA 5IT9O 4XIUA 3QDKA 1SKRA 4CEQA 3VQ6A 3AGRA 1RTIA 2F9WA 5LY3A 2HHVA 4V19S 3H6EA 1VQ5N 1OH7A 4OPHA 4F2SA 2P9IA 3NF7A 1NK9A 4AHCA 5MLCQ 4FSVA 4WE1A 3MAQA 1BL3A 1BIUA 4DV1K 4N47A 4QOZB 3OJSA 1NGFA 2P9NA 4B9VA 1TUUA 3BZCA 4NCBA 3FZKA 4IO8A 3M8QA 4DSEA 5K14A 1QZ5A 2IAJA 5GAHP 4DV0K 4LF4K 2G8VA 1C0TA 4O55A 5AQPA 5FRMA 2ITMA 4DR3K 3KD1E 3PX0A 3TI0A 1E4GT 3TAMA 1RT2A 4FM1A 4JKDA 1NU0A 1SL2A 3F73A 3M6GA 4DQPA 4Q0BA 1FXXA 4GV9A 5BRFA 3QESA 4IDKA 4LFAK 1KC8O 3TU5A 2P51A 2GUIA 4B3MK 2E5LK 3THWA 2P9NB 4CJTA 4G9ZA 3MMVA 1M90O 4M3UA 2E2QA 4WQ5A 1ZBIA 4JKAA 2V51B 2ZD1A 3KTQA 1SL1A 3WT0A 2VGMA 1GLLO 1JLQA 4L3QA 4A5AA 3NHGA 2HVHA 4GMJB 2QA4N 2KZMA 2VGNA 1VK0A 4CEBA 3RMCA 1BCMA 2HMPA 3KHYA 3IS9A 1WSGA 3V9ZA 3ZLJA 1XWLA 2NUBA 3D2EA 4BRQA 4E0DA 3WXKA 4QS9A 3AVFA 3IUCA 4ISEA 3MCPA 2YKNA 4BG9A 5BN8A 2FSJA 1RFQA 3MX2A 3SAGA 5KPZA 3D45A 3R6MA 2OPQA 3LANA 4KTZA 1XHZA 4CHNA 3KLHA 4OLBA 4H5TA 1WAJA 3DRSA 4DWIA 3WNHA 2DTUA 4YNQA 3VQ5A 4NCAA 3PX6A 4BR7A 3OS2A 1NKCA 1NOZA 2BH1A 2Q0UA 3F5TA 1Q9XA 1EETA 2BTFA 2ZE2A 4KV8A 3SMSA 1TL3A 3F2KA 5AQXA 2OTJN 2D0CA 3AVLA 2PYLA 3KLEA 1SKWA 3ZT2A 3KWGA 4KRFA 3TAPA 4CVNE 3PO4A 4F9OA 3QERA 4Z4GA 5AR0A 5E41A 5F0XA 4F8RA 3O8MA 3Q7CA 4FLUA 3VA3A 2RKIA 4FJLA 2VWBA 3ZSQA 3CG7A 1VSHA 3HRGA 2YNIA 5HRNA 3KKSA 4NCGA 1LCUA 1VSIA 1NK7A 4CEFA 3SUOA 2Q0RA 3NVMA 4CJ4A 1OH6A 4CJWA 1NBWA 5DK5A 3SPZA 2YV0X 3TANA 4PY5A 4DV5K 3I0SA 1T3VA 2UYTA 3VEOA 1J54A 4CEZA 3HM9A 2HHXA 4FJ7A 5FROA 1OKJA 5KRTA 2ASPA 3PO5A 1RT5A 1S22A 4HHTA 1WOQA 1TK0A 2P9SA 4BR2A 1KLNA 4L8RB 4B1XB 2QWLA 5KQ8A 4BR9A 2W6LA 3NFAA 4LSLA 3TWHA 1IKVA 4FLXA 4CZKA 4MDAA 3PUFA 3CCVN 3J7ZO 3VENA 4CZHA 3MX5A 4CJLA 3MWPA 4KREA 1TKZA 3OYNA 1QSYA 2FLOA 4BRNA 2OZMA 4R79A 3OS1A 4H03B 4MFBA 1NGAA 2YNFA 4YFUA 3CMEN 4CGDA 3HSTB 4JI8K 3RWUA 3J80O 1JKHA 1NJYA 1YXQA 5C15A 2HHWA 4IXCA 3SJJA 1NKEA 3VQ9A 2P9SB 3WEEB 4KKOA 2EWSA 3DAWA 3L4IA 5CZ2A 4XH1A 3TR8A 4I9QA 1RDUA 3O6WA 3WNEA 5AQHA 3CETA 3H46O 3AO5A 3CPWM 5BPLA 4CEDA 3ENOA 3V9SA 3QEPA 3LDNA 4MLHA 2R7YA 4IJAA 4CGJA 2FSKA 4CK3A 1KD1O 5EY4A 1XMOK 1MU2A 4DUYK 3QNNA 3IMXA 1V4SA 4HTLA 2ETJA 3KLIA 3LDQA 1NM1A 1VSJA 1WB9A 1VQ6N 3K5OA 1ASVA 3CERA 3N4PA 2E1ZA 5AFUH 4E7KA 4WQ4C 4LF7K 4CESA 4CF1A 1C0FA 4KB0A 5M1OA 1FJGK 3LM9A 4BACA 5I42A 3FR0A 1HKCA 3OYJA 3MEEA 2QM1A 1C0GA 3BF3A 4CFBA 1CLQA 3CPEA 1OVYA 3LM2A 5FDLA 4W5OA 4M7XA 4CK1A 4FYDA 3DRRA 3NGIA 3CQXA 3IAYA 3FZFA 1Q7YO 5KGXA 3VEYA 3SUPA 2WUSA 3V1RA 4WCEL 4FCYA 4BDPA 1SV5A 3C65A 3MEGA 4BRIA 1S6PA 3SV4A 4BGBA 3ID6A 3AA3A 2O8CA 3GE1A 3ATUA 4ZHRA 1WNSA 1J6ZA 3C7NA 4BC4A 4FJ8A 2OA8A 1P90A 1VQNN 4FK2A 3A5NC 4FOIA 4JHDB 5EVZA 1DEJA 3G0ZA 1U47A 1T6DA 4M3YA 4QCLA 4K25A 1QQMA 4BREA 1SZ2A 4E89A 1N34K 3OYGA 1CZAN 5AQOA 2NRZA 1BI4A 3KIOA 3DMJA 4C8KA 2P5GA 1GOCA 2VQEK 3FZHA 4FJIA 3ID8A 3VEVA 3CM5A 3CJBA 1VRTA 1RBTA 3CXCM 2PY5A 3DOLA 4JKHA 3VTHA 4CZEA 1SL0A 1JJ2M 4HCBA 3AA4A 3HVTA 3TTDA 1GLFO 2UU9K 5AZJA 2O8FA 3I33A 4O5BA 4BQLA 1XNRK 4KTQA 3O80A 1NGHA 4BC3A 1YJ9N 1ZBUA 4KO0A 4GKKK 1Z6RA 2WTUA 2D0PA 4FWNA 4H0VB 4BDZA 5AQUA 2A41A 2HHQA 3SUQA 3SAHA 1BI4B 1Q81O 4KH4A 3RSEB 4J2AA 3SMPA 3L2QA 3CQ8A 1QTMA 3D6RA 5JS1A 1WSFA 2NRXA 2KTQA 3WXLA 1EO1A 3QIPA 1ASUA 2GUPA 1SAZA 4K8ZA 4FJNA 1DT9A 2VG5A 1SUQA 1BO5O 2E88A 4WF9L 5J1EA 3CYMA 4Z4HA 5AZJB 1RT3A 3UKUA 4U67L 4CJPA 1BQNA 2B6AA 4AHSA 3V1OA 3IRXA 4KB1A 2QWNA 2QWPA 3AO4A 4AHRA 4AILC 2E6LA 3O9TA 1H1VA 2AA4A 3TPQA 2V52B 2P5OA 2X78A 3F9KA 4OPJA 3AV9A 3KJVA 4OPKA 5AQGA 4NLCA 5C12A 1JCEA 1NGDA 1JLEA 1EX4A 4KHWA 3OYDA 3AVHA 1NJZA 1TGOA 1EKEA 2GBZA 4N5SA 4KFBA 3AVKA 3ATVA 4WFNL 3VQEA 4LD0A 4HVJA 3DWLA 3ULDA 3DOKA 3E9OA 3WQTA 3V9WA 4E7LA 1HRHA 3T1HK 3FLCO 1CZBA 3WNGA 3KD5E 1S1VA 3HBTA 2Q1NA 3QFPA 3UB5A 1RDBA 3U6FA 3P38A 3ZEUB 3CJ1A 4C23A 2V7ZA 2I7PA 3THXA 3RR7A 3JSMA 1JLGA 3I0RA 4DG1A 4C1NI 1K8AO 5IWAK 1YI2N 2VWJA 4PL7A 1RT4A 3L0QA 2ZJRL 2EX3A 4JNEA 4CZLA 2ZJQL 4RWTA 4BC2A 3VESA 2YCHA 2ZWHA 5AQZA 1YTUA 3CCSN 4AM7A 3O08A 2WOMA 1B9DA 2ATQA 5AQIA 4CJVA 2D0OA 5KI6A 1X9SA 1X9MA 4IOXA 4LFCK 1EP4A 1IH7A 3SCXA 4DTPA 3AVJA 4CZFA 1RILA 2DFHA 3WXJA 3O3HA 3HZ6A 4E1JA 3ZETA 3CJ7A 4DSIA 3ZT1A 4DR5K 4M7YA 4GVEA 4JI6K 5C25A 5GIOA 1UWBA 1U6ZA 4BRPA 4CF9A 3TAGA 1WAFA 1NK6A 2P9PB 3LP1A 3OYMA 5ADXH 4OX9K 4YDUA 3SLCA 4A2AA 1NK5A 4LF8K 5CZ1A 2FXUA 3L3VA 1LV5A 4BVOA 1K9MO 3A5MC 5LJWA 1E4FT 4ISGA 3LAKA 3QIOA 4X64K 2ASMA 2Z1HA 4BDYA 1MWKA 3A5OC 4LSNA 2O8BA 2J4RA 1NLVA 2RE2A 4ID5A 1UA1A 2YJEA 4FVMA 5J2PA 4FJXA 2E4LA 1XC9A 1Q8IA 2QXFA 3VEXA 1A5XA 1C6VA 2HW3A 2ZM6K 1ZC6A 3MN5A 4UY8O 3UE5A 4YOTA 3CD6N 2NRVA 3SQ1A 2B4JA 4IFEA 4CJUA 1QVGM 4HUGA 4DTOA 4EZ6A 3KZBA 3Q7BA 1MA9B 5CY4A 1YHQN 4GV6A 4M3RA 1NOYA 1V4TA 4B1WB 4O0JA 4DS4A 2JGUA 4ZTJA 1HQUA 2VYPA 3VN5A 2PFUA 2Y1JA 1X1PA 4ILHA 3AA2A 4FM2A 3EN9A 5BREA 2P9KB 3NBPA 2OYQA 2HBMA 3HSCA 5GAGP 4NYFA 4I2QA 3BDPA 3DRPA 5BRDA 4H0TB 4CFCA 2D0AA 2JWKA 3NF8A 4CGFA 3RVCA 4DTNA 4F3OA 1QZ6A 3ZT4A 4DS5A 3AY9A 1L3SA 3M8RA 1ATNA 3VQPA 1C1BA 4IZ9A 2Y1IA 2QK9A 4KHNA 4FLWA 1BIZA 2NZTA 4TSXA 3WXIA 1C1AA 2W42A 2GELA 3U8XA 4BR4A 4DV7K 1HYVA 2ITGA 4XEIA 3LWLA 4PHTX 3NE6A 1HX1A 3RRGA 4Y1CA 5FPEA 3EZ5A 2YHBA 2P9UB 3QFUA 3J7YP 1VQ9N 4KH6A 2QWOA 4MO5A 2DFFA 4FLYA 4DF4A 5AJ3K 2YHWA 4O0IA 5J2MA 3U3YA 3HOTA 3ZSZA 2CGJA 3AVMA 3ENHA 3NGYA 3HJFA 3OW2M 1LAWA 2FF6A 2O8EB 3FZMA 3QMLA 5HBMA 5HP1A 1S1UA 2Q31A 3L3UA 4FWRA 3OS0A 1X9JA 4X62K 3DXMA 3OYKA 2D4WA 2O4GA 3R1XA 2DFEA 3HK2A 3ZT3A 1YVNA 1TUYA 1UA0A 2FBYA 5C2FA 4X65K 1FKOA 4CJKA 3GG4A 2HHSA 1P8ZA 3K5NA 4CD1A 5J2NA 3VQCA 2XO7A 2ZQBA 1ZBFA 1N5YA 4JD2A 4A59A 3O3FA 4DSKA 2QXLA 3BP8A 2RN2A 1VQPN 3NAEA 3MCAB 2OTLN 5BR8K 2UUBK 3ZX0A 3K5MA 3L8BA 3G4SN 4JI4K 3DXMB 4DLGA 4E3SA 2UUCK 4B3SK 4KHYA 1RBUA 4DKWA 1MDUB 4CBXA 4CF0A 5E84A 4CEOA 3QBXA 3HM8A 5I9EB 3CC4N 5AQSA 3R3LA 4A2BA 1U2VB 3DI6A 1U45A 1RDCA 3AAQA 3MEDA 4PUOA 3FFIA 2HNZA 4ELTA 4KHSA 3AVAA 3SPYA 1K8KA 2A5XA 4BC5A 1WLJA 2FBXA 3S3MA 3BY5A 4JD2B 4IDHA 3CC2N 4YORA 1S5JA 3C6HA 3CC7N 4CECA 3QEWA 1HNWK 3K2PA 1RTHA 1NG9A 2GWJA 3EKUA 1NJWA 5LL6Z 2G8HA 1A5WA 4OJRA 3LDSA 2G8KA 3CQYA 2VQFK 3HYFA 4DSLA 4CHOA 5AQJA 1JXBA 2LSNA 3ZCMA 3LAMA 3QBWA 5BRHA 3DLEA 2IDOA 4LH4A 3ALYA 3SBGA 2QWRA 1K8KB 4O8KA 4DMNA 4O4GA 3V4IA 3NF6A 2G8UA 1Q82O 2GX9A 3A5LC 3NMUA 4GW6A 4B8CA 4CJ5A 3G10A 1IKWA 2X6SA 5FPMA 4MDBA 2UXDK 4FXDA 4FWOA 1EWRA 4M3TA 4CIGA 3C6TA 5JVHL 2CH6A 4IWVA 4E1MA 2PBDA 1HPZA 4IFYA 4X66K 4YY3K 4FZXC 1WSHA 3WEEA 4PA1A 3MN6A 3ISNC 1GLJO 1D9FA 3SI6A 1KAXA 3VQ8A 3V1QA 2CH5A 4OO1J 5CYMA 4CF8A 4PKGA 2GV9A 3P39A 3TSPA 2E2PA 5C42A 1GLEG 4OKKA 1LW2A 3M1FA 2QWQA 2A40A 1GOBA 4B9QA 3QETA 3WQUA 5JLHA 1T7PA 4CFDA 3NVKA 3IDHA 2VWKA 3SQ0A 2JWLA 3QINA 1IBLK 3AVIA 4LF5K 2DY4A 1QHAA 1N36K 4JN4A 3H3OB 2ZGYA 2IOCA 1SQKA 4BRMA 3A0IX 3O9RA 2A6AA 4YOYA 4Z4IA 2F4VK 2ASOA 4EZ9A 1W7AA 4KBOA 4DLEA 1TK8A 2O8DA 1LWFA 1O13A 3OHRA 4IFVA 4FK0A 3HL8A 2Z1GA 5C10A 3SQ4A 4K8XA 2F96A 3BEXA 3PIOL 4DQSA 3QEXA 1VSFA 3R9PA 3RMAA 5C2DA 3LPUA 4FJMA 1HYZA 3J7AP 3H08A 3UKRA 2IS3A 4WYBA 3OYBA 3M3ZA 1GLAG 4BRAA 4QS7A 3SNNA 4ILGB 3NF9A 5AQKA 3HXMA 5AQQA 1JLAA 5CYQA 4JKBA 5BPMA 3KVGA 1VQMN 2F9TA 4DR4K 4BR5A 5F2RA 1KVBA 1SS6A 1N33K 2O8DB 3OYCA 3S9HA 3O9UA 2UXCK 4N41A 4CGGA 1QQCA 1J9AA 1KFSA 5HOOA 3OBYA 4JHDA 1IKYA 4GY2B 3TAEA 3UKRB 3DLRA 3ZSWA 3EL2A 1ILYA 4KHPK 1GOAA 5GAEP 3CCEN 4HWIA 1RNHA 1U49A 4DU1A 4C8NA 1DGKN 1NWKA 3EE9A 3NDKA 3I8DA 4YOXA 1RBVA 3CI5A 3V81A 4CJQA 4BQZA 3H1QA 3NH0A 2G8IA 3O1WA 4JLHA 2KLAA 3RMDA 4B9TA 4R5PA 1QVFM 3K58A 4O44A 1QSLA 4CIFA 1YVUA 4JRPA 3SUNA 4JYAK 1YTAA 3WUHA 4B3TK 4CHPA 4JI3K 4E19A 2GWKA 4H0XB 1TAUA 2HNDA 3C6UA 3ZSRA 4CGHA 3PY8A 3EKSA 3IG1A 2Q2RA 4CF2A 3GBTA 4M3WA 1GLDG 1NNEA 4IEIA 4BRCA 3RSEA 1NGIA 1TVRA 2Z1IA 1U4BA 3E1YA 4JAXA 1WN7A 1TKTA 3VERA 1BQMA 3AGKA 1LOTB 2E6MA 3V9XA 2AP1A 1I94K 1QSSA
chains in the Genus database with same CATH topology
4IDKA 1RILA 2DFHA 3DYAA 2BANA 1VSKA 2GUIA 2P51A 3O3HA 1RT1A 2EHGA 3LP2A 2I5JA 4FZYA 1I3AA 1VSDA 4CJTA 4DSIA 3ZT1A 4M3UA 3OY9A 1ZBIA 4KAZA 3K57A 4W5RA 4PWDA 1D9DA 4FJ9A 5C25A 1A5VA 2KW4A 3PX4A 4Z4EA 5FRNA 2ZD1A 4I2PA 1UWBA 3KTQA 3U3GA 1SL1A 1RTDA 4CF9A 3TAGA 1WAFA 3CFOA 1NK6A 2BE2A 1JLQA 3LP1A 4EP4A 3NHGA 3OYMA 4H4MA 4JS5A 3DLHA 2HVHA 4GMJB 1NK5A 5CZ1A 2RF2A 1JL1A 3HPGA 2KZMA 1LV5A 3L3VA 3T19A 1J53A 4Z4CA 3QESA 1VK0A 3MECA 4CEBA 4CHZA 5T7BA 3RMCA 1C1CA 4FLZA 4B08A 1BCMA 3THVA 3LAKA 3LP0A 3QIOA 4CGIA 3IS9A 2YNHA 1WSGA 3V9ZA 4RW7A 1XWLA 2NUBA 4KI4A 3D0PA 1UAXA 2RPIA 2Z1HA 4BDYA 1U48A 3S3OA 2HMIA 4DQIA 4E0DA 1Z25A 4F4KA 4LSNA 2XY8A 3AVFA 4ID5A 1UA1A 3SV3A 1RTJA 4FVMA 4H4OA 5J2PA 4FJXA 2E4LA 3ASMA 3OJUA 1XC9A 2F8TA 2YKNA 1Q8IA 2QXFA 3AVNA 1A5XA 1C6VA 2HW3A 3D45A 4Y1DA 2OPQA 4Q5VA 3LANA 4KTZA 4JRQA 3TAQA 2HB5A 2B4JA 3SQ1A 1XHZA 4CJUA 1Y97A 4CCHA 4W5QA 4FJ5A 1D5AA 4HUGA 4CHNA 1JXEA 4C8OA 4OLAA 4DTOA 2OPPA 3KLHA 4EZ6A 3MXMA 4OLBA 3QO9A 4UQGA 1WAJA 3DRSA 4CJEA 3WNHA 4DWIA 4M42A 2DTUA 4YNQA 5CY4A 3VQ5A 3QNOA 3VQ7A 3VQBA 3KK2A 4M3RA 3PX6A 2P1JA 1NOYA 4NCAA 4FZZA 3OS2A 1NKCA 1D8YA 1NOZA 3DLGA 4ID1A 1VRUA 4O0JA 4DS4A 4HUEA 2JGUA 2X6NA 4ZTJA 1S9GA 1HQUA 3VN5A 3HT3A 1Q9XA 4DFKA 4MQ3A 1EETA 2ZE2A 2Y1JA 3EYZA 1K6YA 1NJXA 1X1PA 4KV8A 4W5TA 4OGEA 3RMBA 1TL3A 2D0CA 3AVLA 3HVRA 3KLEA 2PYLA 4RW6A 3AA2A 4FM2A 3AVCA 1SKWA 3NBPA 2OYQA 1RT7A 4KHQA 4NYFA 2D5RA 4I2QA 3ZT2A 4BE1A 2XY6A 3BDPA 3DRPA 4KRFA 3TAPA 3PO4A 4C8LA 1JL2A 4B3OA 3QERA 4KI6A 4Z4GA 5E41A 4CFCA 1WSIA 2D0AA 2XY7A 1B92A 3CM6A 3NCIA 4F8RA 4DFPA 4FJJA 3NF8A 4CGFA 3LPTA 4DTNA 3OYAA 4FLUA 2RKIA 3VA3A 1L3TA 4F3OA 4FJLA 4CJRA 3ZSQA 3ZT4A 3CG7A 3NH1A 3AO3A 4DS5A 4CIEA 1L3SA 5SWMA 1VSHA 2YNIA 3M8RA 5HRNA 3JYTA 3DM2A 3KKSA 3VQPA 1S6QA 1C1BA 4NCGA 5SZTA 1ASWA 3VQQA 4B8AB 2JLEA 4DQRA 1VSIA 1IKXA 4H8KA 2Y1IA 1NK7A 2QK9A 1WSEA 1FKPA 4CEFA 4KHNA 3RRHA 2Q3SA 4FLWA 1BIZA 4TSXA 3SUOA 3AO1A 1C1AA 4FJHA 2W42A 3V6DA 1NK8A 4CJ4A 3ZSOA 1U04A 1HYVA 2ITGA 4CJWA 1RBRA 5DK5A 3LWLA 3NE6A 4DTUA 2YV0X 3HPOA 4Y1CA 3SPZA 3TANA 3RRGA 3L2RA 3EZ5A 2FBVA 4FK4A 4PY5A 2YHBA 3I0SA 4BWJA 5HLFA 3DLBA 3UIQA 1J54A 4CEZA 3HM9A 2OZSA 2HHXA 1G15A 4FJ7A 5FROA 3B6OA 3HP9A 2DFFA 5KRTA 4FLYA 4DF4A 1TK5A 3PO5A 1S1XA 4G1QA 4O0IA 5J2MA 3U3YA 1RT5A 4FM0A 4HHTA 2Z1JA 1B9FA 3ZSZA 1TK0A 3AVMA 1ZBLA 1KFDA 3NGYA 1RDAA 1KLNA 4L8RB 1NK0A 3HJFA 1LAWA 3OYEA 1DLOA 3O3GA 4KPYA 2XRIA 3NFAA 5HBMA 4LSLA 3TWHA 4BE0A 5HP1A 1IKVA 4F3TA 1S1UA 4AHTA 4FLXA 2F8SA 3L3UA 3PUFA 4M45A 3OS0A 1KVCA 5DMRA 4FLTA 1NK4A 4E7HA 4CJLA 3OYKA 1S1WA 3KLGA 1IG9A 4DFJA 2O4GA 1LW0A 3MXIA 3NGZA 1KLMA 1SKSA 1TKZA 4KREA 3OYNA 1QSYA 4Z4FA 4JS4A 2OZMA 2DFEA 3B6PA 3OS1A 1LWCA 3ZT3A 3HK2A 3BGRA 4MFBA 1UA0A 2YNFA 1QE1A 2FBYA 4LH5A 5KTQA 4YFUA 4CGDA 3HSTB 1FKOA 4CJKA 3RWUA 1QHTA 1RT6A 1S1TA 3RTVA 2HHSA 3K5NA 1Q9YA 1JKHA 1NJYA 2HHWA 2OPRA 1DTQA 5J2NA 1S9EA 1VSLA 3VQCA 2XO7A 3SJJA 1IO2A 3VQ9A 1NKEA 2ZQBA 4KKOA 3C94A 1ZBFA 3L2WA 5CZ2A 1N5YA 1VSMA 3O3FA 3TR8A 3PV8A 2G8WA 4DSKA 2HNYA 4HCCA 2RN2A 4I9QA 3TARA 3WNEA 3TAFA 4FW2A 4PQUA 3NAEA 2HVIA 4DTXA 1KRPA 3AO5A 4AHVA 3K5MA 3L8BA 4DU4A 4CEDA 1HNIA 1CXQA 4E7JA 3V9SA 3KKRA 3QEPA 4DLGA 4CJ3A 4E3SA 4AH9A 3VQAA 4KHYA 1RBUA 2R7YA 3VQ4A 3QLHA 4CGJA 3SZ2A 4FW1A 4CJFA 4CF0A 4CEOA 4CK3A 1ZYQA 1MU2A 3QNNA 4IBNA 2ETJA 3DI6A 3KLIA 5HROA 1U45A 2VG6A 1RDCA 1VSJA 4M41A 4FLVA 3MEDA 4PUOA 3FFIA 3K5OA 2HNZA 1CXUA 1ASVA 2XY5A 1NKBA 4ELTA 1BHLA 3TABA 2OPSA 3AVAA 3SPYA 1XI1A 2G8FA 3S3MA 1WLJA 2FBXA 4E7KA 4E1NA 4CESA 2B5JA 3AA5X 2XHBA 4CF1A 1TKDA 4DSJA 1S5JA 4KB0A 4CECA 1W9HA 3QEWA 4B9LA 3K2PA 1RTHA 4BACA 5I42A 2KZZA 1TAQA 1NJWA 3OYJA 4RW8A 4B9UA 1KCFA 3KK1A 1A5WA 2G8HA 3O4NA 3MEEA 4I9LA 4OJRA 1XHXA 4Z0UA 3LDSA 2G8KA 2PYJA 4CFBA 1C0MA 1RBSA 3HYFA 5HRPA 3EY1A 2X74A 5KGWA 4AHUA 4CHOA 4CHYA 4DSLA 1CLQA 2YNGA 2KFNA 1KSPA 1JXBA 2LSNA 1LWEA 4OKJA 4QAGA 1KTQA 5FDLA 3ZCMA 4CEAA 4W5OA 3QEVA 1HJRA 1HNVA 1VSEA 3LAMA 1R0AA 1BISA 4C8MA 3ZT0A 3DLEA 4CK1A 4CE9A 2IDOA 4FYDA 3DRRA 3NGIA 1F21A 4LH4A 3IAYA 4EP5A 1JLBA 3ALYA 3M8SA 1RDDA 5KGXA 3HO1A 1J5OA 4DTSA 2FBTA 3SUPA 2A1RA 3LALA 3OYLA 4FJGA 4DMNA 4N76A 4O4GA 3V4IA 3V1RA 1HYSA 4BDPA 4FCYA 3NF6A 2G8UA 1SV5A 3L2UA 1X9WA 3MEGA 4GW6A 4B8CA 4CJ5A 2KQ2A 1S6PA 3SV4A 1UOCA 3G10A 3AA3A 3T1AA 1IKWA 2X6SA 4IG3A 4J2BA 1WSJA 4ZHRA 1WNSA 2VG7A 4IG0A 1C0UA 4FXDA 2IGIA 4FJ8A 4M3TA 3S3NA 2OA8A 4CIGA 3C6TA 4FK2A 4M3XA 1BCOA 3SYZA 4E1MA 3O4QA 2IC3A 1HPZA 3G0ZA 1U47A 4M3YA 4F2RA 4IFYA 4QCLA 4CHQA 3CFRA 4FZXC 1WSHA 3QEIA 2KFZA 4PA1A 1I39A 3LP3A 4CEEA 3OYIA 4KHSA 3ISNC 4RG8A 4E89A 3OYGA 1D9FA 3SI6A 3VQ8A 1T03A 3V1QA 1BI4A 3KIOA 3DMJA 4BE2A 1N6QA 5CYMA 3ZSXA 2WONA 3WNFA 4C8KA 2P5GA 1GOCA 4CF8A 4DSFA 2D0BA 4FJKA 2GV9A 4FJIA 3LZIA 3CM5A 2PZSA 1VRTA 4J2DA 4CFAA 1RBTA 5C42A 4OKKA 5J2QA 1LW2A 5C24A 2PY5A 3DOLA 2BDPA 4GVMA 1SL0A 1GOBA 4NYNA 5KRSA 3QETA 3KLFA 4HCBA 3AA4A 2O4IA 3HVTA 1T7PA 4CFDA 1TKXA 1EP4A 2VWKA 3VQDA 3SQ0A 3QINA 3KK3A 4OKEA 3AVIA 4O5BA 2DY4A 4KTQA 4ZTFA 1ZBUA 4KO0A 3M8PA 2IOCA 4B9SA 4N56A 1HQEA 4BDZA 4J2EA 1LAVA 4Z4IA 4DFMA 1Z26A 3E01A 4KTWA 3VA0A 4CERA 3SUQA 4EZ9A 2HHQA 4DLEA 1TK8A 1BI4B 4IKFA 4J2AA 3P1GA 3L2QA 3K5LA 3CQ8A 1LWFA 1QTMA 4IFVA 4FK0A 3HL8A 2Z1GA 5JS1A 1WSFA 3SQ4A 4K8XA 2F96A 4DF8A 5D3GA 2KTQA 5JS2A 4DQQA 3ZSVA 3AO2A 3QIPA 3RMAA 4DQSA 3QEXA 1ASUA 1VSFA 4K8ZA 3OYFA 1T8EA 3RR8A 4FJNA 3LPUA 4FJMA 4KB1A 1HYZA 1JLFA 3H08A 1O1WA 1W0HA 1SUQA 2VG5A 4M3ZA 1REVA 2QKBA 5J1EA 3LZJA 3CYMA 1DTTA 2IS3A 3P83D 4Z4HA 3OYBA 1HMVA 1RT3A 4LY7A 3V9UA 4ELUA 2HHTA 4CJPA 4DU3A 1BQNA 2QKKA 3DLKA 4RW4A 3LWMA 3L2VA 3SNNA 4B9MA 4KHUA 2A1SA 2B6AA 3NF9A 3C95A 4OVLA 4AHSA 3HXMA 3HP6A 1FK9A 3IRXA 1JLAA 5HRRA 5CYQA 3V1OA 3AO4A 4DTRA 1BGXT 1T05A 4B9NA 1TL1A 4AHRA 4AILC 1ITGA 3K59A 2E6LA 1KVBA 5HRSA 3T3FA 3OYCA 3S9HA 3A2FA 4N41A 2FC0A 3NH2A 4CGGA 1ZBHA 1RCHA 4CK2A 2YKMA 2P5OA 2X78A 2YHAA 1QQCA 3F9KA 3MXJA 4OPJA 5I3UA 1J9AA 3AV9A 3CFPA 1KFSA 3KJVA 4OPKA 3ZSYA 4BWMA 4ELVA 4CJSA 4DTMA 1JLEA 1EX4A 1IKYA 3TAEA 4KHWA 3DLRA 3ZSWA 1KVAA 4E7IA 3OYDA 3OYHA 1CZ9A 3AVHA 4XIUA 3SQ2A 1GOAA 1NJZA 1TGOA 1EKEA 2GBZA 4N5SA 4KFBA 4HTUA 4W5NA 3AVKA 1SKRA 4CEQA 1L3VA 3VQ6A 1RTIA 1RNHA 1U49A 3VQEA 4LD0A 4HVJA 3ULDA 2HHVA 3DOKA 4DU1A 4E7LA 3V9WA 4C8NA 4F2SA 1HRHA 4I7FA 3NF7A 4HUFA 1CZBA 3WNGA 3NDKA 3I8DA 1S1VA 1QS4A 3KD5E 3P5JA 4ICLA 1RBVA 1NK9A 4AHCA 3V81A 4RW9A 4CJQA 1RDBA 3NH0A 4DTJA 3U6FA 1YT3A 2G8IA 4WE1A 3MAQA 3OVNA 4JLHA 1BL3A 3RMDA 1BIUA 4R5PA 1L3UA 4B9TA 2BGGA 4N47A 4QOZB 3OJSA 3RR7A 3JSMA 1JLGA 3K58A 3I0RA 4O44A 4DG1A 4B9VA 1QSLA 2VWJA 4CIFA 1YVUA 1RT4A 4JRPA 3SUNA 2EX3A 1YTAA 3AVGA 4NCBA 3AVBA 1TV6A 4CHPA 4E19A 3M8QA 4DSEA 5K14A 1YTUA 3ITHA 1EXQA 1TAUA 2IAJA 2HNDA 3C6UA 3HPHA 3ZSRA 4CGHA 3PY8A 1JLCA 4OGCA 2G8VA 1C0TA 2WOMA 4O55A 2HHUA 5FRMA 1B9DA 3IG1A 4CF2A 4M3WA 2ATQA 4CJVA 1L5UA 3KD1E 3PX0A 3TI0A 3TAMA 1RT2A 1TVRA 4FM1A 2Z1IA 1U4BA 5KI6A 5EU7A 1X9SA 2AJQA 1TKTA 1WN7A 1X9MA 1SL2A 3F73A 1BQMA 4DQPA 4Q0BA 2E6MA 3V9XA 1FXXA 1IH7A 3SCXA 4DTPA 3AVJA 1QSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDK A;  1RIL A;  2DFH A;  3DYA A;  2BAN A;  1VSK A;  2GUI A;  2P51 A;  3O3H A;  1RT1 A;  2EHG A;  3LP2 A;  2I5J A;  4FZY A;  1I3A A;  1VSD A;  4CJT A;  4DSI A;  3ZT1 A;  4M3U A;  3OY9 A;  1ZBI A;  4KAZ A;  3K57 A;  4W5R A;  4PWD A;  1D9D A;  4FJ9 A;  5C25 A;  1A5V A;  2KW4 A;  3PX4 A;  4Z4E A;  5FRN A;  2ZD1 A;  4I2P A;  1UWB A;  3KTQ A;  3U3G A;  1SL1 A;  1RTD A;  4CF9 A;  3TAG A;  1WAF A;  3CFO A;  1NK6 A;  2BE2 A;  1JLQ A;  3LP1 A;  4EP4 A;  3NHG A;  3OYM A;  4H4M A;  4JS5 A;  3DLH A;  2HVH A;  4GMJ B;  1NK5 A;  5CZ1 A;  2RF2 A;  1JL1 A;  3HPG A;  2KZM A;  1LV5 A;  3L3V A;  3T19 A;  1J53 A;  4Z4C A;  3QES A;  1VK0 A;  3MEC A;  4CEB A;  4CHZ A;  5T7B A;  3RMC A;  1C1C A;  4FLZ A;  4B08 A;  1BCM A;  3THV A;  3LAK A;  3LP0 A;  3QIO A;  4CGI A;  3IS9 A;  2YNH A;  1WSG A;  3V9Z A;  4RW7 A;  1XWL A;  2NUB A;  4KI4 A;  3D0P A;  1UAX A;  2RPI A;  2Z1H A;  4BDY A;  1U48 A;  3S3O A;  2HMI A;  4DQI A;  4E0D A;  1Z25 A;  4F4K A;  4LSN A;  2XY8 A;  3AVF A;  4ID5 A;  1UA1 A;  3SV3 A;  1RTJ A;  4FVM A;  4H4O A;  5J2P A;  4FJX A;  2E4L A;  3ASM A;  3OJU A;  1XC9 A;  2F8T A;  2YKN A;  1Q8I A;  2QXF A;  3AVN A;  1A5X A;  1C6V A;  2HW3 A;  3D45 A;  4Y1D A;  2OPQ A;  4Q5V A;  3LAN A;  4KTZ A;  4JRQ A;  3TAQ A;  2HB5 A;  2B4J A;  3SQ1 A;  1XHZ A;  4CJU A;  1Y97 A;  4CCH A;  4W5Q A;  4FJ5 A;  1D5A A;  4HUG A;  4CHN A;  1JXE A;  4C8O A;  4OLA A;  4DTO A;  2OPP A;  3KLH A;  4EZ6 A;  3MXM A;  4OLB A;  3QO9 A;  4UQG A;  1WAJ A;  3DRS A;  4CJE A;  3WNH A;  4DWI A;  4M42 A;  2DTU A;  4YNQ A;  5CY4 A;  3VQ5 A;  3QNO A;  3VQ7 A;  3VQB A;  3KK2 A;  4M3R A;  3PX6 A;  2P1J A;  1NOY A;  4NCA A;  4FZZ A;  3OS2 A;  1NKC A;  1D8Y A;  1NOZ A;  3DLG A;  4ID1 A;  1VRU A;  4O0J A;  4DS4 A;  4HUE A;  2JGU A;  2X6N A;  4ZTJ A;  1S9G A;  1HQU A;  3VN5 A;  3HT3 A;  1Q9X A;  4DFK A;  4MQ3 A;  1EET A;  2ZE2 A;  2Y1J A;  3EYZ A;  1K6Y A;  1NJX A;  1X1P A;  4KV8 A;  4W5T A;  4OGE A;  3RMB A;  1TL3 A;  2D0C A;  3AVL A;  3HVR A;  3KLE A;  2PYL A;  4RW6 A;  3AA2 A;  4FM2 A;  3AVC A;  1SKW A;  3NBP A;  2OYQ A;  1RT7 A;  4KHQ A;  4NYF A;  2D5R A;  4I2Q A;  3ZT2 A;  4BE1 A;  2XY6 A;  3BDP A;  3DRP A;  4KRF A;  3TAP A;  3PO4 A;  4C8L A;  1JL2 A;  4B3O A;  3QER A;  4KI6 A;  4Z4G A;  5E41 A;  4CFC A;  1WSI A;  2D0A A;  2XY7 A;  1B92 A;  3CM6 A;  3NCI A;  4F8R A;  4DFP A;  4FJJ A;  3NF8 A;  4CGF A;  3LPT A;  4DTN A;  3OYA A;  4FLU A;  2RKI A;  3VA3 A;  1L3T A;  4F3O A;  4FJL A;  4CJR A;  3ZSQ A;  3ZT4 A;  3CG7 A;  3NH1 A;  3AO3 A;  4DS5 A;  4CIE A;  1L3S A;  5SWM A;  1VSH A;  2YNI A;  3M8R A;  5HRN A;  3JYT A;  3DM2 A;  3KKS A;  3VQP A;  1S6Q A;  1C1B A;  4NCG A;  5SZT A;  1ASW A;  3VQQ A;  4B8A B;  2JLE A;  4DQR A;  1VSI A;  1IKX A;  4H8K A;  2Y1I A;  1NK7 A;  2QK9 A;  1WSE A;  1FKP A;  4CEF A;  4KHN A;  3RRH A;  2Q3S A;  4FLW A;  1BIZ A;  4TSX A;  3SUO A;  3AO1 A;  1C1A A;  4FJH A;  2W42 A;  3V6D A;  1NK8 A;  4CJ4 A;  3ZSO A;  1U04 A;  1HYV A;  2ITG A;  4CJW A;  1RBR A;  5DK5 A;  3LWL A;  3NE6 A;  4DTU A;  2YV0 X;  3HPO A;  4Y1C A;  3SPZ A;  3TAN A;  3RRG A;  3L2R A;  3EZ5 A;  2FBV A;  4FK4 A;  4PY5 A;  2YHB A;  3I0S A;  4BWJ A;  5HLF A;  3DLB A;  3UIQ A;  1J54 A;  4CEZ A;  3HM9 A;  2OZS A;  2HHX A;  1G15 A;  4FJ7 A;  5FRO A;  3B6O A;  3HP9 A;  2DFF A;  5KRT A;  4FLY A;  4DF4 A;  1TK5 A;  3PO5 A;  1S1X A;  4G1Q A;  4O0I A;  5J2M A;  3U3Y A;  1RT5 A;  4FM0 A;  4HHT A;  2Z1J A;  1B9F A;  3ZSZ A;  1TK0 A;  3AVM A;  1ZBL A;  1KFD A;  3NGY A;  1RDA A;  1KLN A;  4L8R B;  1NK0 A;  3HJF A;  1LAW A;  3OYE A;  1DLO A;  3O3G A;  4KPY A;  2XRI A;  3NFA A;  5HBM A;  4LSL A;  3TWH A;  4BE0 A;  5HP1 A;  1IKV A;  4F3T A;  1S1U A;  4AHT A;  4FLX A;  2F8S A;  3L3U A;  3PUF A;  4M45 A;  3OS0 A;  1KVC A;  5DMR A;  4FLT A;  1NK4 A;  4E7H A;  4CJL A;  3OYK A;  1S1W A;  3KLG A;  1IG9 A;  4DFJ A;  2O4G A;  1LW0 A;  3MXI A;  3NGZ A;  1KLM A;  1SKS A;  1TKZ A;  4KRE A;  3OYN A;  1QSY A;  4Z4F A;  4JS4 A;  2OZM A;  2DFE A;  3B6P A;  3OS1 A;  1LWC A;  3ZT3 A;  3HK2 A;  3BGR A;  4MFB A;  1UA0 A;  2YNF A;  1QE1 A;  2FBY A;  4LH5 A;  5KTQ A;  4YFU A;  4CGD A;  3HST B;  1FKO A;  4CJK A;  3RWU A;  1QHT A;  1RT6 A;  1S1T A;  3RTV A;  2HHS A;  3K5N A;  1Q9Y A;  1JKH A;  1NJY A;  2HHW A;  2OPR A;  1DTQ A;  5J2N A;  1S9E A;  1VSL A;  3VQC A;  2XO7 A;  3SJJ A;  1IO2 A;  3VQ9 A;  1NKE A;  2ZQB A;  4KKO A;  3C94 A;  1ZBF A;  3L2W A;  5CZ2 A;  1N5Y A;  1VSM A;  3O3F A;  3TR8 A;  3PV8 A;  2G8W A;  4DSK A;  2HNY A;  4HCC A;  2RN2 A;  4I9Q A;  3TAR A;  3WNE A;  3TAF A;  4FW2 A;  4PQU A;  3NAE A;  2HVI A;  4DTX A;  1KRP A;  3AO5 A;  4AHV A;  3K5M A;  3L8B A;  4DU4 A;  4CED A;  1HNI A;  1CXQ A;  4E7J A;  3V9S A;  3KKR A;  3QEP A;  4DLG A;  4CJ3 A;  4E3S A;  4AH9 A;  3VQA A;  4KHY A;  1RBU A;  2R7Y A;  3VQ4 A;  3QLH A;  4CGJ A;  3SZ2 A;  4FW1 A;  4CJF A;  4CF0 A;  4CEO A;  4CK3 A;  1ZYQ A;  1MU2 A;  3QNN A;  4IBN A;  2ETJ A;  3DI6 A;  3KLI A;  5HRO A;  1U45 A;  2VG6 A;  1RDC A;  1VSJ A;  4M41 A;  4FLV A;  3MED A;  4PUO A;  3FFI A;  3K5O A;  2HNZ A;  1CXU A;  1ASV A;  2XY5 A;  1NKB A;  4ELT A;  1BHL A;  3TAB A;  2OPS A;  3AVA A;  3SPY A;  1XI1 A;  2G8F A;  3S3M A;  1WLJ A;  2FBX A;  4E7K A;  4E1N A;  4CES A;  2B5J A;  3AA5 X;  2XHB A;  4CF1 A;  1TKD A;  4DSJ A;  1S5J A;  4KB0 A;  4CEC A;  1W9H A;  3QEW A;  4B9L A;  3K2P A;  1RTH A;  4BAC A;  5I42 A;  2KZZ A;  1TAQ A;  1NJW A;  3OYJ A;  4RW8 A;  4B9U A;  1KCF A;  3KK1 A;  1A5W A;  2G8H A;  3O4N A;  3MEE A;  4I9L A;  4OJR A;  1XHX A;  4Z0U A;  3LDS A;  2G8K A;  2PYJ A;  4CFB A;  1C0M A;  1RBS A;  3HYF A;  5HRP A;  3EY1 A;  2X74 A;  5KGW A;  4AHU A;  4CHO A;  4CHY A;  4DSL A;  1CLQ A;  2YNG A;  2KFN A;  1KSP A;  1JXB A;  2LSN A;  1LWE A;  4OKJ A;  4QAG A;  1KTQ A;  5FDL A;  3ZCM A;  4CEA A;  4W5O A;  3QEV A;  1HJR A;  1HNV A;  1VSE A;  3LAM A;  1R0A A;  1BIS A;  4C8M A;  3ZT0 A;  3DLE A;  4CK1 A;  4CE9 A;  2IDO A;  4FYD A;  3DRR A;  3NGI A;  1F21 A;  4LH4 A;  3IAY A;  4EP5 A;  1JLB A;  3ALY A;  3M8S A;  1RDD A;  5KGX A;  3HO1 A;  1J5O A;  4DTS A;  2FBT A;  3SUP A;  2A1R A;  3LAL A;  3OYL A;  4FJG A;  4DMN A;  4N76 A;  4O4G A;  3V4I A;  3V1R A;  1HYS A;  4BDP A;  4FCY A;  3NF6 A;  2G8U A;  1SV5 A;  3L2U A;  1X9W A;  3MEG A;  4GW6 A;  4B8C A;  4CJ5 A;  2KQ2 A;  1S6P A;  3SV4 A;  1UOC A;  3G10 A;  3AA3 A;  3T1A A;  1IKW A;  2X6S A;  4IG3 A;  4J2B A;  1WSJ A;  4ZHR A;  1WNS A;  2VG7 A;  4IG0 A;  1C0U A;  4FXD A;  2IGI A;  4FJ8 A;  4M3T A;  3S3N A;  2OA8 A;  4CIG A;  3C6T A;  4FK2 A;  4M3X A;  1BCO A;  3SYZ A;  4E1M A;  3O4Q A;  2IC3 A;  1HPZ A;  3G0Z A;  1U47 A;  4M3Y A;  4F2R A;  4IFY A;  4QCL A;  4CHQ A;  3CFR A;  4FZX C;  1WSH A;  3QEI A;  2KFZ A;  4PA1 A;  1I39 A;  3LP3 A;  4CEE A;  3OYI A;  4KHS A;  3ISN C;  4RG8 A;  4E89 A;  3OYG A;  1D9F A;  3SI6 A;  3VQ8 A;  1T03 A;  3V1Q A;  1BI4 A;  3KIO A;  3DMJ A;  4BE2 A;  1N6Q A;  5CYM A;  3ZSX A;  2WON A;  3WNF A;  4C8K A;  2P5G A;  1GOC A;  4CF8 A;  4DSF A;  2D0B A;  4FJK A;  2GV9 A;  4FJI A;  3LZI A;  3CM5 A;  2PZS A;  1VRT A;  4J2D A;  4CFA A;  1RBT A;  5C42 A;  4OKK A;  5J2Q A;  1LW2 A;  5C24 A;  2PY5 A;  3DOL A;  2BDP A;  4GVM A;  1SL0 A;  1GOB A;  4NYN A;  5KRS A;  3QET A;  3KLF A;  4HCB A;  3AA4 A;  2O4I A;  3HVT A;  1T7P A;  4CFD A;  1TKX A;  1EP4 A;  2VWK A;  3VQD A;  3SQ0 A;  3QIN A;  3KK3 A;  4OKE A;  3AVI A;  4O5B A;  2DY4 A;  4KTQ A;  4ZTF A;  1ZBU A;  4KO0 A;  3M8P A;  2IOC A;  4B9S A;  4N56 A;  1HQE A;  4BDZ A;  4J2E A;  1LAV A;  4Z4I A;  4DFM A;  1Z26 A;  3E01 A;  4KTW A;  3VA0 A;  4CER A;  3SUQ A;  4EZ9 A;  2HHQ A;  4DLE A;  1TK8 A;  1BI4 B;  4IKF A;  4J2A A;  3P1G A;  3L2Q A;  3K5L A;  3CQ8 A;  1LWF A;  1QTM A;  4IFV A;  4FK0 A;  3HL8 A;  2Z1G A;  5JS1 A;  1WSF A;  3SQ4 A;  4K8X A;  2F96 A;  4DF8 A;  5D3G A;  2KTQ A;  5JS2 A;  4DQQ A;  3ZSV A;  3AO2 A;  3QIP A;  3RMA A;  4DQS A;  3QEX A;  1ASU A;  1VSF A;  4K8Z A;  3OYF A;  1T8E A;  3RR8 A;  4FJN A;  3LPU A;  4FJM A;  4KB1 A;  1HYZ A;  1JLF A;  3H08 A;  1O1W A;  1W0H A;  1SUQ A;  2VG5 A;  4M3Z A;  1REV A;  2QKB A;  5J1E A;  3LZJ A;  3CYM A;  1DTT A;  2IS3 A;  3P83 D;  4Z4H A;  3OYB A;  1HMV A;  1RT3 A;  4LY7 A;  3V9U A;  4ELU A;  2HHT A;  4CJP A;  4DU3 A;  1BQN A;  2QKK A;  3DLK A;  4RW4 A;  3LWM A;  3L2V A;  3SNN A;  4B9M A;  4KHU A;  2A1S A;  2B6A A;  3NF9 A;  3C95 A;  4OVL A;  4AHS A;  3HXM A;  3HP6 A;  1FK9 A;  3IRX A;  1JLA A;  5HRR A;  5CYQ A;  3V1O A;  3AO4 A;  4DTR A;  1BGX T;  1T05 A;  4B9N A;  1TL1 A;  4AHR A;  4AIL C;  1ITG A;  3K59 A;  2E6L A;  1KVB A;  5HRS A;  3T3F A;  3OYC A;  3S9H A;  3A2F A;  4N41 A;  2FC0 A;  3NH2 A;  4CGG A;  1ZBH A;  1RCH A;  4CK2 A;  2YKM A;  2P5O A;  2X78 A;  2YHA A;  1QQC A;  3F9K A;  3MXJ A;  4OPJ A;  5I3U A;  1J9A A;  3AV9 A;  3CFP A;  1KFS A;  3KJV A;  4OPK A;  3ZSY A;  4BWM A;  4ELV A;  4CJS A;  4DTM A;  1JLE A;  1EX4 A;  1IKY A;  3TAE A;  4KHW A;  3DLR A;  3ZSW A;  1KVA A;  4E7I A;  3OYD A;  3OYH A;  1CZ9 A;  3AVH A;  4XIU A;  3SQ2 A;  1GOA A;  1NJZ A;  1TGO A;  1EKE A;  2GBZ A;  4N5S A;  4KFB A;  4HTU A;  4W5N A;  3AVK A;  1SKR A;  4CEQ A;  1L3V A;  3VQ6 A;  1RTI A;  1RNH A;  1U49 A;  3VQE A;  4LD0 A;  4HVJ A;  3ULD A;  2HHV A;  3DOK A;  4DU1 A;  4E7L A;  3V9W A;  4C8N A;  4F2S A;  1HRH A;  4I7F A;  3NF7 A;  4HUF A;  1CZB A;  3WNG A;  3NDK A;  3I8D A;  1S1V A;  1QS4 A;  3KD5 E;  3P5J A;  4ICL A;  1RBV A;  1NK9 A;  4AHC A;  3V81 A;  4RW9 A;  4CJQ A;  1RDB A;  3NH0 A;  4DTJ A;  3U6F A;  1YT3 A;  2G8I A;  4WE1 A;  3MAQ A;  3OVN A;  4JLH A;  1BL3 A;  3RMD A;  1BIU A;  4R5P A;  1L3U A;  4B9T A;  2BGG A;  4N47 A;  4QOZ B;  3OJS A;  3RR7 A;  3JSM A;  1JLG A;  3K58 A;  3I0R A;  4O44 A;  4DG1 A;  4B9V A;  1QSL A;  2VWJ A;  4CIF A;  1YVU A;  1RT4 A;  4JRP A;  3SUN A;  2EX3 A;  1YTA A;  3AVG A;  4NCB A;  3AVB A;  1TV6 A;  4CHP A;  4E19 A;  3M8Q A;  4DSE A;  5K14 A;  1YTU A;  3ITH A;  1EXQ A;  1TAU A;  2IAJ A;  2HND A;  3C6U A;  3HPH A;  3ZSR A;  4CGH A;  3PY8 A;  1JLC A;  4OGC A;  2G8V A;  1C0T A;  2WOM A;  4O55 A;  2HHU A;  5FRM A;  1B9D A;  3IG1 A;  4CF2 A;  4M3W A;  2ATQ A;  4CJV A;  1L5U A;  3KD1 E;  3PX0 A;  3TI0 A;  3TAM A;  1RT2 A;  1TVR A;  4FM1 A;  2Z1I A;  1U4B A;  5KI6 A;  5EU7 A;  1X9S A;  2AJQ A;  1TKT A;  1WN7 A;  1X9M A;  1SL2 A;  3F73 A;  1BQM A;  4DQP A;  4Q0B A;  2E6M A;  3V9X A;  1FXX A;  1IH7 A;  3SCX A;  4DTP A;  3AVJ A;  1QSS A; 
#chains in the Genus database with same CATH topology
 3AAP A;  3THY A;  2BAN A;  2WFB A;  1RT1 A;  3CF5 L;  2ZGZ A;  3LP2 A;  1I3A A;  3I8B A;  3OY9 A;  2IVO A;  4KAZ A;  4PWD A;  3VET A;  1A5V A;  1RGI A;  4I2P A;  3U3G A;  1RTD A;  5JIC A;  1BG3 A;  3CFO A;  2BE2 A;  3DLH A;  4JS5 A;  4H4M A;  3O9S A;  1HNX K;  3LL3 A;  2RF2 A;  3HPG A;  2Q36 A;  3T19 A;  1J53 A;  4Z4C A;  3MEC A;  3DXK B;  5T7B A;  2KKZ A;  4FLZ A;  5GIN A;  3THV A;  1GLC G;  4CGI A;  2YNH A;  4A62 A;  4F4K A;  4WQ5 C;  1ESV A;  3THY B;  3S3O A;  2E2N A;  4FWP A;  4FOE A;  3SJH A;  1FW6 A;  3PSI A;  4LC9 B;  1IV0 A;  3J8A A;  3ASM A;  2F8T A;  5FPN A;  5A2Q O;  1HNZ K;  1ATS A;  1N32 K;  5F1X A;  4Y1D A;  4K43 A;  3KK7 A;  3P31 A;  1Y97 A;  4W5Q A;  1D5A A;  2W40 A;  1JXE A;  1YJN N;  4C8O A;  4OLA A;  2OPP A;  3HI0 A;  2OAN A;  3MXM A;  2NRR A;  4CJE A;  4FL9 A;  3ZEU A;  1ZXO A;  3VQ7 A;  3VQB A;  3KK2 A;  4FZZ A;  2P1J A;  5DM6 L;  3MWT A;  3DLG A;  4ID1 A;  1VRU A;  4FWQ A;  5KPR A;  2X6N A;  4DFK A;  5KPT A;  4MQ3 A;  2UUA K;  3O1B A;  4W5T A;  4OGE A;  3RMB A;  3HVR A;  4JK9 A;  4RW6 A;  3I56 N;  3ZX2 A;  1NJI O;  1YF5 L;  1D4X A;  4WFB L;  1JL2 A;  4FWM A;  4KI6 A;  1WSI A;  4JI7 K;  1B92 A;  2E8A A;  5FPD A;  3NCI A;  4DFP A;  4FJJ A;  3LPT A;  2ZF5 O;  3OYA A;  4CJR A;  4K42 A;  3NH1 A;  3AO3 A;  4CIE A;  5SWM A;  1S6Q A;  5SZT A;  3QB0 A;  4B8A B;  4DQR A;  4H8K A;  4YHH K;  1WSE A;  1FKP A;  1NGB A;  3AO1 A;  1HKB A;  4BGA A;  4FJH A;  2P9P A;  1NK8 A;  3ZSO A;  3EZW A;  2G8W A;  1Z05 A;  1Q86 O;  1VQ8 N;  4Z94 A;  3L2R A;  2FBV A;  4FK4 A;  4JI0 K;  5AQF A;  3B6O A;  3W3D A;  3CCR N;  2Z1J A;  1B9F A;  1ZBL A;  1NK0 A;  3OYE A;  4CW7 B;  1BA0 A;  1DLO A;  3WXM B;  3O3G A;  4KPY A;  4BE0 A;  3J81 O;  4F3T A;  4JV5 K;  4NXM K;  4FLT A;  1NK4 A;  4LF6 K;  5E26 A;  4NLB A;  4DFJ A;  3W0L A;  3MXI A;  1KLM A;  2NRH A;  3T69 A;  4CZG A;  2HHH K;  4JS4 A;  3B6P A;  3BGR A;  4LH5 A;  1QE1 A;  5KTQ A;  5GIP A;  1QHT A;  1RT6 A;  1S1T A;  3LDO A;  1Q9Y A;  3SAF A;  2OPR A;  3PLA A;  1DTQ A;  4DR7 K;  3C94 A;  3L2W A;  1QQN A;  4A61 A;  1VSM A;  3PV8 A;  2HNY A;  4FO0 A;  4PQU A;  3VF2 A;  3VMF B;  3CCJ N;  3O5B A;  4H5N A;  1HPM A;  2P9K A;  1CXQ A;  4E7J A;  3KKR A;  4CJ3 A;  1YIJ N;  3VQA A;  2YHY A;  2OCE A;  3JXU A;  3VQ4 A;  2V7Y A;  3QLH A;  5AQT A;  3SZ2 A;  4CJF A;  3LDP A;  4H5W A;  3CJC A;  4JK8 A;  5LMU K;  1YAG A;  3TSQ A;  3K0S A;  1N8R O;  3K9K A;  1XNQ K;  5HRO A;  3VOV A;  4FLV A;  3U4L A;  1YUW A;  2XY5 A;  1NKB A;  1BHL A;  4EHU A;  1XI1 A;  2G8F A;  3O4W A;  2B5J A;  2XHB A;  4DSJ A;  1W9H A;  4B9L A;  1NGC A;  2KZZ A;  1TAQ A;  4YOU A;  3SBT A;  3D2F B;  4B9U A;  4RW8 A;  3KK1 A;  4I9L A;  1BU6 O;  2VCP A;  2PYJ A;  3HTV A;  2P9U A;  1RBS A;  4BRG A;  3EY1 A;  5KGW A;  4CHY A;  1IG8 A;  2YNG A;  2KFN A;  1KTQ A;  4CEA A;  1HJR A;  1VSE A;  4H5R A;  4LF9 K;  3JAM O;  4JK7 A;  3ZT0 A;  1VHX A;  2ZJP L;  3FFK B;  4CZI A;  1F21 A;  3VGM A;  4EP5 A;  1JLB A;  2O8E A;  4BRO A;  1RDD A;  3HO1 A;  2IIR A;  4DTS A;  2FBT A;  2A1R A;  4N76 A;  3LAL A;  4JI5 K;  2W41 A;  1W2B M;  1UOC A;  2A3Z A;  4U7B A;  4IG3 A;  3SK3 A;  4J2B A;  2VG7 A;  4IG0 A;  4PL8 A;  2P9L B;  4DV6 K;  3TTC A;  3VTI A;  1T44 A;  3S3N A;  4M3X A;  5EX5 A;  3SYZ A;  3O4Q A;  2IC3 A;  1WBB A;  5CHI A;  5AFU A;  1E3M A;  3CFR A;  3QEI A;  4A57 A;  4RG8 A;  4NXN K;  2HST A;  3MN7 A;  4BE2 A;  3ZSX A;  2P9I B;  2WON A;  4FVU A;  4YOW A;  4EIA A;  4JKG A;  4B3R K;  2PZS A;  2WC9 A;  4J2D A;  2BDP A;  2CGK A;  4YOV A;  4GVM A;  4NYN A;  5KRS A;  3KLF A;  2HOE A;  4DUZ K;  1U2V A;  1TKX A;  3KK3 A;  1EQY A;  5TKW A;  5AQR A;  3C6A A;  4ZTF A;  3GOI A;  3M8P A;  4IOC L;  4B9S A;  1BOT O;  1HQE A;  2HF3 A;  1LAV A;  4J2E A;  3E01 A;  4KTW A;  3VA0 A;  4CER A;  1OVQ A;  1HJO A;  4IKF A;  5AQL A;  4JKG B;  2PAV A;  5JS2 A;  4DQQ A;  4FPA A;  1T8E A;  5AQN A;  3QIC A;  3THW B;  3E9P A;  4M3Z A;  2QKB A;  3LZJ A;  3V9U A;  4DQ8 A;  1HMV A;  4LY7 A;  2RHK A;  4PKI A;  5H1S Q;  2HHT A;  4H5V A;  1OH8 A;  2QKK A;  3DLK A;  4RW4 A;  4MO4 A;  2A1S A;  3C95 A;  3HP6 A;  4DTR A;  4B9N A;  1TL1 A;  4JI2 K;  3K59 A;  5HRS A;  3T3F A;  3OA9 A;  3A2F A;  2FC0 A;  4BRD A;  2YHA A;  4FWK A;  1KQS M;  4DV4 K;  1KAZ A;  3CFP A;  3D2E B;  4IEE A;  3EO3 A;  1VQL N;  4ELV A;  4CJS A;  5GAD P;  3OYH A;  1CZ9 A;  3SQ2 A;  4HTU A;  4W5N A;  1L3V A;  4BG8 A;  1GLB G;  4B1Y B;  5M1F A;  4XH5 A;  4I7F A;  5KQD A;  4HUF A;  3BUZ B;  1QS4 A;  3CMA N;  3P5J A;  3FZL A;  4ICL A;  4BRK A;  3BZK A;  1VQO N;  4RW9 A;  2FF3 B;  4DTJ A;  1YT3 A;  2IVP A;  2GEM A;  3OVN A;  1L3U A;  2BGG A;  4B1U B;  2NRT A;  1IJJ A;  2E2O A;  3AVG A;  3AVB A;  1TV6 A;  1M1K O;  1IBM K;  3ITH A;  1EXQ A;  3HPH A;  1RDW X;  1WBD A;  3H1V X;  1JLC A;  5JLF A;  4OGC A;  2HHU A;  1W97 L;  1NGJ A;  2YI1 A;  1L5U A;  1K73 O;  2W6K A;  4IJN A;  4DV3 K;  4FPB A;  5EU7 A;  4JKF A;  2AJQ A;  4B1V A;  4JKC A;  3CIP A;  3ZSV A;  4GNI A;  2KHO A;  3DYA A;  1VSK A;  3EE8 A;  2EHG A;  2I5J A;  4FZY A;  4K0K K;  1VSD A;  5CR4 A;  1JCF A;  1JCG A;  3K57 A;  4W5R A;  1D9D A;  4FJ9 A;  3ZX3 A;  2KW4 A;  4DV2 K;  3PX4 A;  4Z4E A;  5FRN A;  3VEZ A;  1XC3 A;  5BPN A;  4EP4 A;  1JL1 A;  3VGK A;  3BF1 A;  4NO7 A;  4CHZ A;  4MLE A;  1C1C A;  4FWL A;  3H45 C;  4B08 A;  4BY9 C;  3LP0 A;  4RW7 A;  4KI4 A;  1Y64 A;  3D0P A;  4BRL A;  1UAX A;  2RPI A;  4DR2 K;  2HMI A;  1U48 A;  4DQI A;  1Z25 A;  2XY8 A;  2GTD A;  3SV3 A;  1RTJ A;  4H4O A;  3OJU A;  3S41 A;  5LMN K;  1EWQ A;  4YDU C;  3AVN A;  2UXB K;  4Q5V A;  3LDL A;  5C0Y A;  4JRQ A;  3TAQ A;  3CJ9 A;  2HB5 A;  4CCH A;  4FJ5 A;  3ENB A;  3VF4 A;  4JEP A;  4EAH D;  3QO9 A;  4UQG A;  4M42 A;  5EXW A;  4H0Y B;  3QNO A;  4DB3 A;  5AQW A;  5FLX O;  3ULE A;  1D8Y A;  4HUE A;  1QQO A;  1S9G A;  3E66 A;  2QEX N;  3HT3 A;  2D1K A;  3EYZ A;  1K6Y A;  1NJX A;  2H3G X;  4O5F A;  3CCM N;  2YHX A;  3AVC A;  5ADX A;  4ISF A;  3T1Y K;  1RT7 A;  4KHQ A;  2D5R A;  4BE1 A;  2XY6 A;  4C8L A;  4CBW A;  4EHT A;  1BA1 A;  2XY7 A;  3CM6 A;  2HBJ A;  1L3T A;  3PIP L;  3VEW A;  1HLU A;  3ULE B;  3JYT A;  3DM2 A;  4KH5 A;  1ASW A;  3VQQ A;  1J5E K;  2JLE A;  1IKX A;  1XUP O;  2QWM A;  4CZM A;  4AF1 A;  2Q3S A;  3RRH A;  1KAY A;  4H0O A;  3DJC A;  3V6D A;  4O8U A;  5AQV A;  3ZYY X;  1U04 A;  3B8A X;  1RBR A;  4K41 A;  4DTU A;  3HPO A;  4CZJ A;  5ELZ A;  2NNW A;  4BWJ A;  5HLF A;  3DLB A;  3UIQ A;  3EEQ A;  3DXK A;  3GDQ A;  2OZS A;  1G15 A;  5AQY A;  4Y0W A;  3HP9 A;  3CJA A;  1TK5 A;  1NMN A;  3E9L A;  1XQS C;  1S1X A;  5LJV A;  4G1Q A;  1WUA A;  1BUP A;  4FM0 A;  3FE1 A;  4A5B A;  1KFD A;  1RDA A;  1X3N A;  3IFR A;  4B1Z A;  3U9D A;  2XRI A;  3O9Q A;  2Q97 A;  4AHT A;  5BR9 A;  2F8S A;  4M45 A;  1KVC A;  5DMR A;  3MN9 A;  4E7H A;  1S1W A;  3KLG A;  1IG9 A;  1LW0 A;  2O8C B;  3NGZ A;  1SKS A;  4BVP A;  1VQ7 N;  3MK6 A;  4Z4F A;  3A8Y A;  3C7N B;  1LWC A;  4GV3 A;  4DHY A;  2CGL A;  5EOY A;  1YJW N;  4XH4 A;  4CJ7 A;  3VPZ A;  3AAR A;  3RTV A;  4H0P A;  4CI6 A;  4LFB K;  1S9E A;  1VSL A;  3KWI A;  1IO2 A;  5M1K A;  1ATR A;  1VAZ A;  3K9J A;  2QI2 A;  4HCC A;  3TAR A;  1X3M A;  3TAF A;  4FW2 A;  1HUX A;  5M1P A;  2HVI A;  1BWF O;  4DTX A;  1KRP A;  4AHV A;  5AZI A;  3P4I A;  4DU4 A;  1HNI A;  2FSN A;  2I7N A;  5AQM A;  2NLX A;  4AH9 A;  3VGL A;  3OTO K;  4FW1 A;  1ZYQ A;  2QTD A;  4IBN A;  2VG6 A;  2O8F B;  2YJF A;  4M41 A;  1XMQ K;  1CXU A;  3TAB A;  2OPS A;  4E1N A;  1R59 O;  3AA5 X;  1TKD A;  1BDG A;  4AQY K;  1Q18 A;  1NGE A;  1VQ4 N;  1KCF A;  5AZI B;  4GKJ K;  3O4N A;  4Z0U A;  1S72 N;  1XHX A;  3L4Q A;  3VF6 A;  1OH5 A;  1C0M A;  4J8F A;  1NGG A;  2WBN A;  2X74 A;  5HRP A;  4AHU A;  2F7T A;  4DR6 K;  1IBK K;  4RTF D;  1KSP A;  1LWE A;  4OKJ A;  4QAG A;  1G99 A;  2IVN A;  3QEV A;  4B3O A;  1R0A A;  1HNV A;  5TKY A;  1YIT N;  1BIS A;  4C8M A;  4DR1 K;  4AM6 A;  4CE9 A;  3UKU B;  1MWM A;  3M8S A;  1HR0 K;  1J5O A;  4JKE A;  4FJG A;  3HOS A;  3R8E A;  3OYL A;  2DPN A;  5DM7 L;  1HYS A;  3IKM A;  1ZBS A;  4BR0 A;  3C0B A;  3L2U A;  1X9W A;  3G25 A;  2KQ2 A;  3H3N O;  3T1A A;  4IOA L;  3L6Q A;  1WSJ A;  2HBK A;  3F9M A;  1C0U A;  2IGI A;  4QS8 A;  5M1Q A;  3CHW A;  4CD3 A;  2QW9 A;  1BCO A;  3PSF A;  3T7Z A;  3D7E O;  4F2R A;  3G6E N;  3CCL N;  4CHQ A;  4OPA A;  2KFZ A;  1I39 A;  3LP3 A;  4CEE A;  4BRH A;  3OYI A;  1DKG D;  1T03 A;  4I6M A;  1N6Q A;  3WNF A;  4DSF A;  4FJK A;  2D0B A;  1TYQ A;  4C1N K;  1NMD A;  3LZI A;  5JVG L;  4CFA A;  4RCH A;  5J2Q A;  5C24 A;  3MDQ A;  3THX B;  2O4I A;  4ILJ A;  2E20 A;  3VQD A;  4OKE A;  5M1N A;  5BN9 A;  2E1Y A;  4EFH A;  4N56 A;  4DFM A;  1Z26 A;  4NB4 A;  1HKG A;  3D2F A;  4I6M B;  4WQ4 A;  3P1G A;  5CE3 A;  5HL7 L;  1KXP A;  3K5L A;  3FGU A;  4M63 C;  1TYQ B;  3OBW A;  4DF8 A;  5D3G A;  3AO2 A;  3OYF A;  3RR8 A;  4WFA L;  1VQK N;  5B8H A;  3M5R A;  1JLF A;  4PKH A;  3DLL L;  1O1W A;  1W0H A;  3CCQ N;  1REV A;  3ZET B;  1DTT A;  4ELU A;  3P83 D;  3TSU A;  3CCU N;  5JMV A;  4DU3 A;  3LWM A;  3L2V A;  1S3X A;  4B9M A;  4KHU A;  2NRW A;  4OVL A;  2BUP A;  3U9Z A;  5HRR A;  3TTF A;  1FK9 A;  1BGX T;  1T05 A;  4IO9 L;  1ITG A;  4FWS A;  3I55 N;  3NH2 A;  4CBU A;  1ZBH A;  1RCH A;  4CK2 A;  2YKM A;  3JS6 A;  3MXJ A;  2P9L A;  5I3U A;  2HBL A;  1T6C A;  3GL1 A;  4BWM A;  3ZSY A;  2YX6 A;  4BRF A;  3G71 N;  4DTM A;  3N4Q A;  2A42 A;  2O8B B;  4JI1 K;  1KVA A;  4E7I A;  2HF4 A;  4DCH A;  5IT9 O;  4XIU A;  3QDK A;  1SKR A;  4CEQ A;  3VQ6 A;  3AGR A;  1RTI A;  2F9W A;  5LY3 A;  2HHV A;  4V19 S;  3H6E A;  1VQ5 N;  1OH7 A;  4OPH A;  4F2S A;  2P9I A;  3NF7 A;  1NK9 A;  4AHC A;  5MLC Q;  4FSV A;  4WE1 A;  3MAQ A;  1BL3 A;  1BIU A;  4DV1 K;  4N47 A;  4QOZ B;  3OJS A;  1NGF A;  2P9N A;  4B9V A;  1TUU A;  3BZC A;  4NCB A;  3FZK A;  4IO8 A;  3M8Q A;  4DSE A;  5K14 A;  1QZ5 A;  2IAJ A;  5GAH P;  4DV0 K;  4LF4 K;  2G8V A;  1C0T A;  4O55 A;  5AQP A;  5FRM A;  2ITM A;  4DR3 K;  3KD1 E;  3PX0 A;  3TI0 A;  1E4G T;  3TAM A;  1RT2 A;  4FM1 A;  4JKD A;  1NU0 A;  1SL2 A;  3F73 A;  3M6G A;  4DQP A;  4Q0B A;  1FXX A;  4GV9 A;  5BRF A;  3QES A;  4IDK A;  4LFA K;  1KC8 O;  3TU5 A;  2P51 A;  2GUI A;  4B3M K;  2E5L K;  3THW A;  2P9N B;  4CJT A;  4G9Z A;  3MMV A;  1M90 O;  4M3U A;  2E2Q A;  4WQ5 A;  1ZBI A;  4JKA A;  2V51 B;  2ZD1 A;  3KTQ A;  1SL1 A;  3WT0 A;  2VGM A;  1GLL O;  1JLQ A;  4L3Q A;  4A5A A;  3NHG A;  2HVH A;  4GMJ B;  2QA4 N;  2KZM A;  2VGN A;  1VK0 A;  4CEB A;  3RMC A;  1BCM A;  2HMP A;  3KHY A;  3IS9 A;  1WSG A;  3V9Z A;  3ZLJ A;  1XWL A;  2NUB A;  3D2E A;  4BRQ A;  4E0D A;  3WXK A;  4QS9 A;  3AVF A;  3IUC A;  4ISE A;  3MCP A;  2YKN A;  4BG9 A;  5BN8 A;  2FSJ A;  1RFQ A;  3MX2 A;  3SAG A;  5KPZ A;  3D45 A;  3R6M A;  2OPQ A;  3LAN A;  4KTZ A;  1XHZ A;  4CHN A;  3KLH A;  4OLB A;  4H5T A;  1WAJ A;  3DRS A;  4DWI A;  3WNH A;  2DTU A;  4YNQ A;  3VQ5 A;  4NCA A;  3PX6 A;  4BR7 A;  3OS2 A;  1NKC A;  1NOZ A;  2BH1 A;  2Q0U A;  3F5T A;  1Q9X A;  1EET A;  2BTF A;  2ZE2 A;  4KV8 A;  3SMS A;  1TL3 A;  3F2K A;  5AQX A;  2OTJ N;  2D0C A;  3AVL A;  2PYL A;  3KLE A;  1SKW A;  3ZT2 A;  3KWG A;  4KRF A;  3TAP A;  4CVN E;  3PO4 A;  4F9O A;  3QER A;  4Z4G A;  5AR0 A;  5E41 A;  5F0X A;  4F8R A;  3O8M A;  3Q7C A;  4FLU A;  3VA3 A;  2RKI A;  4FJL A;  2VWB A;  3ZSQ A;  3CG7 A;  1VSH A;  3HRG A;  2YNI A;  5HRN A;  3KKS A;  4NCG A;  1LCU A;  1VSI A;  1NK7 A;  4CEF A;  3SUO A;  2Q0R A;  3NVM A;  4CJ4 A;  1OH6 A;  4CJW A;  1NBW A;  5DK5 A;  3SPZ A;  2YV0 X;  3TAN A;  4PY5 A;  4DV5 K;  3I0S A;  1T3V A;  2UYT A;  3VEO A;  1J54 A;  4CEZ A;  3HM9 A;  2HHX A;  4FJ7 A;  5FRO A;  1OKJ A;  5KRT A;  2ASP A;  3PO5 A;  1RT5 A;  1S22 A;  4HHT A;  1WOQ A;  1TK0 A;  2P9S A;  4BR2 A;  1KLN A;  4L8R B;  4B1X B;  2QWL A;  5KQ8 A;  4BR9 A;  2W6L A;  3NFA A;  4LSL A;  3TWH A;  1IKV A;  4FLX A;  4CZK A;  4MDA A;  3PUF A;  3CCV N;  3J7Z O;  3VEN A;  4CZH A;  3MX5 A;  4CJL A;  3MWP A;  4KRE A;  1TKZ A;  3OYN A;  1QSY A;  2FLO A;  4BRN A;  2OZM A;  4R79 A;  3OS1 A;  4H03 B;  4MFB A;  1NGA A;  2YNF A;  4YFU A;  3CME N;  4CGD A;  3HST B;  4JI8 K;  3RWU A;  3J80 O;  1JKH A;  1NJY A;  1YXQ A;  5C15 A;  2HHW A;  4IXC A;  3SJJ A;  1NKE A;  3VQ9 A;  2P9S B;  3WEE B;  4KKO A;  2EWS A;  3DAW A;  3L4I A;  5CZ2 A;  4XH1 A;  3TR8 A;  4I9Q A;  1RDU A;  3O6W A;  3WNE A;  5AQH A;  3CET A;  3H46 O;  3AO5 A;  3CPW M;  5BPL A;  4CED A;  3ENO A;  3V9S A;  3QEP A;  3LDN A;  4MLH A;  2R7Y A;  4IJA A;  4CGJ A;  2FSK A;  4CK3 A;  1KD1 O;  5EY4 A;  1XMO K;  1MU2 A;  4DUY K;  3QNN A;  3IMX A;  1V4S A;  4HTL A;  2ETJ A;  3KLI A;  3LDQ A;  1NM1 A;  1VSJ A;  1WB9 A;  1VQ6 N;  3K5O A;  1ASV A;  3CER A;  3N4P A;  2E1Z A;  5AFU H;  4E7K A;  4WQ4 C;  4LF7 K;  4CES A;  4CF1 A;  1C0F A;  4KB0 A;  5M1O A;  1FJG K;  3LM9 A;  4BAC A;  5I42 A;  3FR0 A;  1HKC A;  3OYJ A;  3MEE A;  2QM1 A;  1C0G A;  3BF3 A;  4CFB A;  1CLQ A;  3CPE A;  1OVY A;  3LM2 A;  5FDL A;  4W5O A;  4M7X A;  4CK1 A;  4FYD A;  3DRR A;  3NGI A;  3CQX A;  3IAY A;  3FZF A;  1Q7Y O;  5KGX A;  3VEY A;  3SUP A;  2WUS A;  3V1R A;  4WCE L;  4FCY A;  4BDP A;  1SV5 A;  3C65 A;  3MEG A;  4BRI A;  1S6P A;  3SV4 A;  4BGB A;  3ID6 A;  3AA3 A;  2O8C A;  3GE1 A;  3ATU A;  4ZHR A;  1WNS A;  1J6Z A;  3C7N A;  4BC4 A;  4FJ8 A;  2OA8 A;  1P90 A;  1VQN N;  4FK2 A;  3A5N C;  4FOI A;  4JHD B;  5EVZ A;  1DEJ A;  3G0Z A;  1U47 A;  1T6D A;  4M3Y A;  4QCL A;  4K25 A;  1QQM A;  4BRE A;  1SZ2 A;  4E89 A;  1N34 K;  3OYG A;  1CZA N;  5AQO A;  2NRZ A;  1BI4 A;  3KIO A;  3DMJ A;  4C8K A;  2P5G A;  1GOC A;  2VQE K;  3FZH A;  4FJI A;  3ID8 A;  3VEV A;  3CM5 A;  3CJB A;  1VRT A;  1RBT A;  3CXC M;  2PY5 A;  3DOL A;  4JKH A;  3VTH A;  4CZE A;  1SL0 A;  1JJ2 M;  4HCB A;  3AA4 A;  3HVT A;  3TTD A;  1GLF O;  2UU9 K;  5AZJ A;  2O8F A;  3I33 A;  4O5B A;  4BQL A;  1XNR K;  4KTQ A;  3O80 A;  1NGH A;  4BC3 A;  1YJ9 N;  1ZBU A;  4KO0 A;  4GKK K;  1Z6R A;  2WTU A;  2D0P A;  4FWN A;  4H0V B;  4BDZ A;  5AQU A;  2A41 A;  2HHQ A;  3SUQ A;  3SAH A;  1BI4 B;  1Q81 O;  4KH4 A;  3RSE B;  4J2A A;  3SMP A;  3L2Q A;  3CQ8 A;  1QTM A;  3D6R A;  5JS1 A;  1WSF A;  2NRX A;  2KTQ A;  3WXL A;  1EO1 A;  3QIP A;  1ASU A;  2GUP A;  1SAZ A;  4K8Z A;  4FJN A;  1DT9 A;  2VG5 A;  1SUQ A;  1BO5 O;  2E88 A;  4WF9 L;  5J1E A;  3CYM A;  4Z4H A;  5AZJ B;  1RT3 A;  3UKU A;  4U67 L;  4CJP A;  1BQN A;  2B6A A;  4AHS A;  3V1O A;  3IRX A;  4KB1 A;  2QWN A;  2QWP A;  3AO4 A;  4AHR A;  4AIL C;  2E6L A;  3O9T A;  1H1V A;  2AA4 A;  3TPQ A;  2V52 B;  2P5O A;  2X78 A;  3F9K A;  4OPJ A;  3AV9 A;  3KJV A;  4OPK A;  5AQG A;  4NLC A;  5C12 A;  1JCE A;  1NGD A;  1JLE A;  1EX4 A;  4KHW A;  3OYD A;  3AVH A;  1NJZ A;  1TGO A;  1EKE A;  2GBZ A;  4N5S A;  4KFB A;  3AVK A;  3ATV A;  4WFN L;  3VQE A;  4LD0 A;  4HVJ A;  3DWL A;  3ULD A;  3DOK A;  3E9O A;  3WQT A;  3V9W A;  4E7L A;  1HRH A;  3T1H K;  3FLC O;  1CZB A;  3WNG A;  3KD5 E;  1S1V A;  3HBT A;  2Q1N A;  3QFP A;  3UB5 A;  1RDB A;  3U6F A;  3P38 A;  3ZEU B;  3CJ1 A;  4C23 A;  2V7Z A;  2I7P A;  3THX A;  3RR7 A;  3JSM A;  1JLG A;  3I0R A;  4DG1 A;  4C1N I;  1K8A O;  5IWA K;  1YI2 N;  2VWJ A;  4PL7 A;  1RT4 A;  3L0Q A;  2ZJR L;  2EX3 A;  4JNE A;  4CZL A;  2ZJQ L;  4RWT A;  4BC2 A;  3VES A;  2YCH A;  2ZWH A;  5AQZ A;  1YTU A;  3CCS N;  4AM7 A;  3O08 A;  2WOM A;  1B9D A;  2ATQ A;  5AQI A;  4CJV A;  2D0O A;  5KI6 A;  1X9S A;  1X9M A;  4IOX A;  4LFC K;  1EP4 A;  1IH7 A;  3SCX A;  4DTP A;  3AVJ A;  4CZF A;  1RIL A;  2DFH A;  3WXJ A;  3O3H A;  3HZ6 A;  4E1J A;  3ZET A;  3CJ7 A;  4DSI A;  3ZT1 A;  4DR5 K;  4M7Y A;  4GVE A;  4JI6 K;  5C25 A;  5GIO A;  1UWB A;  1U6Z A;  4BRP A;  4CF9 A;  3TAG A;  1WAF A;  1NK6 A;  2P9P B;  3LP1 A;  3OYM A;  5ADX H;  4OX9 K;  4YDU A;  3SLC A;  4A2A A;  1NK5 A;  4LF8 K;  5CZ1 A;  2FXU A;  3L3V A;  1LV5 A;  4BVO A;  1K9M O;  3A5M C;  5LJW A;  1E4F T;  4ISG A;  3LAK A;  3QIO A;  4X64 K;  2ASM A;  2Z1H A;  4BDY A;  1MWK A;  3A5O C;  4LSN A;  2O8B A;  2J4R A;  1NLV A;  2RE2 A;  4ID5 A;  1UA1 A;  2YJE A;  4FVM A;  5J2P A;  4FJX A;  2E4L A;  1XC9 A;  1Q8I A;  2QXF A;  3VEX A;  1A5X A;  1C6V A;  2HW3 A;  2ZM6 K;  1ZC6 A;  3MN5 A;  4UY8 O;  3UE5 A;  4YOT A;  3CD6 N;  2NRV A;  3SQ1 A;  2B4J A;  4IFE A;  4CJU A;  1QVG M;  4HUG A;  4DTO A;  4EZ6 A;  3KZB A;  3Q7B A;  1MA9 B;  5CY4 A;  1YHQ N;  4GV6 A;  4M3R A;  1NOY A;  1V4T A;  4B1W B;  4O0J A;  4DS4 A;  2JGU A;  4ZTJ A;  1HQU A;  2VYP A;  3VN5 A;  2PFU A;  2Y1J A;  1X1P A;  4ILH A;  3AA2 A;  4FM2 A;  3EN9 A;  5BRE A;  2P9K B;  3NBP A;  2OYQ A;  2HBM A;  3HSC A;  5GAG P;  4NYF A;  4I2Q A;  3BDP A;  3DRP A;  5BRD A;  4H0T B;  4CFC A;  2D0A A;  2JWK A;  3NF8 A;  4CGF A;  3RVC A;  4DTN A;  4F3O A;  1QZ6 A;  3ZT4 A;  4DS5 A;  3AY9 A;  1L3S A;  3M8R A;  1ATN A;  3VQP A;  1C1B A;  4IZ9 A;  2Y1I A;  2QK9 A;  4KHN A;  4FLW A;  1BIZ A;  2NZT A;  4TSX A;  3WXI A;  1C1A A;  2W42 A;  2GEL A;  3U8X A;  4BR4 A;  4DV7 K;  1HYV A;  2ITG A;  4XEI A;  3LWL A;  4PHT X;  3NE6 A;  1HX1 A;  3RRG A;  4Y1C A;  5FPE A;  3EZ5 A;  2YHB A;  2P9U B;  3QFU A;  3J7Y P;  1VQ9 N;  4KH6 A;  2QWO A;  4MO5 A;  2DFF A;  4FLY A;  4DF4 A;  5AJ3 K;  2YHW A;  4O0I A;  5J2M A;  3U3Y A;  3HOT A;  3ZSZ A;  2CGJ A;  3AVM A;  3ENH A;  3NGY A;  3HJF A;  3OW2 M;  1LAW A;  2FF6 A;  2O8E B;  3FZM A;  3QML A;  5HBM A;  5HP1 A;  1S1U A;  2Q31 A;  3L3U A;  4FWR A;  3OS0 A;  1X9J A;  4X62 K;  3DXM A;  3OYK A;  2D4W A;  2O4G A;  3R1X A;  2DFE A;  3HK2 A;  3ZT3 A;  1YVN A;  1TUY A;  1UA0 A;  2FBY A;  5C2F A;  4X65 K;  1FKO A;  4CJK A;  3GG4 A;  2HHS A;  1P8Z A;  3K5N A;  4CD1 A;  5J2N A;  3VQC A;  2XO7 A;  2ZQB A;  1ZBF A;  1N5Y A;  4JD2 A;  4A59 A;  3O3F A;  4DSK A;  2QXL A;  3BP8 A;  2RN2 A;  1VQP N;  3NAE A;  3MCA B;  2OTL N;  5BR8 K;  2UUB K;  3ZX0 A;  3K5M A;  3L8B A;  3G4S N;  4JI4 K;  3DXM B;  4DLG A;  4E3S A;  2UUC K;  4B3S K;  4KHY A;  1RBU A;  4DKW A;  1MDU B;  4CBX A;  4CF0 A;  5E84 A;  4CEO A;  3QBX A;  3HM8 A;  5I9E B;  3CC4 N;  5AQS A;  3R3L A;  4A2B A;  1U2V B;  3DI6 A;  1U45 A;  1RDC A;  3AAQ A;  3MED A;  4PUO A;  3FFI A;  2HNZ A;  4ELT A;  4KHS A;  3AVA A;  3SPY A;  1K8K A;  2A5X A;  4BC5 A;  1WLJ A;  2FBX A;  3S3M A;  3BY5 A;  4JD2 B;  4IDH A;  3CC2 N;  4YOR A;  1S5J A;  3C6H A;  3CC7 N;  4CEC A;  3QEW A;  1HNW K;  3K2P A;  1RTH A;  1NG9 A;  2GWJ A;  3EKU A;  1NJW A;  5LL6 Z;  2G8H A;  1A5W A;  4OJR A;  3LDS A;  2G8K A;  3CQY A;  2VQF K;  3HYF A;  4DSL A;  4CHO A;  5AQJ A;  1JXB A;  2LSN A;  3ZCM A;  3LAM A;  3QBW A;  5BRH A;  3DLE A;  2IDO A;  4LH4 A;  3ALY A;  3SBG A;  2QWR A;  1K8K B;  4O8K A;  4DMN A;  4O4G A;  3V4I A;  3NF6 A;  2G8U A;  1Q82 O;  2GX9 A;  3A5L C;  3NMU A;  4GW6 A;  4B8C A;  4CJ5 A;  3G10 A;  1IKW A;  2X6S A;  5FPM A;  4MDB A;  2UXD K;  4FXD A;  4FWO A;  1EWR A;  4M3T A;  4CIG A;  3C6T A;  5JVH L;  2CH6 A;  4IWV A;  4E1M A;  2PBD A;  1HPZ A;  4IFY A;  4X66 K;  4YY3 K;  4FZX C;  1WSH A;  3WEE A;  4PA1 A;  3MN6 A;  3ISN C;  1GLJ O;  1D9F A;  3SI6 A;  1KAX A;  3VQ8 A;  3V1Q A;  2CH5 A;  4OO1 J;  5CYM A;  4CF8 A;  4PKG A;  2GV9 A;  3P39 A;  3TSP A;  2E2P A;  5C42 A;  1GLE G;  4OKK A;  1LW2 A;  3M1F A;  2QWQ A;  2A40 A;  1GOB A;  4B9Q A;  3QET A;  3WQU A;  5JLH A;  1T7P A;  4CFD A;  3NVK A;  3IDH A;  2VWK A;  3SQ0 A;  2JWL A;  3QIN A;  1IBL K;  3AVI A;  4LF5 K;  2DY4 A;  1QHA A;  1N36 K;  4JN4 A;  3H3O B;  2ZGY A;  2IOC A;  1SQK A;  4BRM A;  3A0I X;  3O9R A;  2A6A A;  4YOY A;  4Z4I A;  2F4V K;  2ASO A;  4EZ9 A;  1W7A A;  4KBO A;  4DLE A;  1TK8 A;  2O8D A;  1LWF A;  1O13 A;  3OHR A;  4IFV A;  4FK0 A;  3HL8 A;  2Z1G A;  5C10 A;  3SQ4 A;  4K8X A;  2F96 A;  3BEX A;  3PIO L;  4DQS A;  3QEX A;  1VSF A;  3R9P A;  3RMA A;  5C2D A;  3LPU A;  4FJM A;  1HYZ A;  3J7A P;  3H08 A;  3UKR A;  2IS3 A;  4WYB A;  3OYB A;  3M3Z A;  1GLA G;  4BRA A;  4QS7 A;  3SNN A;  4ILG B;  3NF9 A;  5AQK A;  3HXM A;  5AQQ A;  1JLA A;  5CYQ A;  4JKB A;  5BPM A;  3KVG A;  1VQM N;  2F9T A;  4DR4 K;  4BR5 A;  5F2R A;  1KVB A;  1SS6 A;  1N33 K;  2O8D B;  3OYC A;  3S9H A;  3O9U A;  2UXC K;  4N41 A;  4CGG A;  1QQC A;  1J9A A;  1KFS A;  5HOO A;  3OBY A;  4JHD A;  1IKY A;  4GY2 B;  3TAE A;  3UKR B;  3DLR A;  3ZSW A;  3EL2 A;  1ILY A;  4KHP K;  1GOA A;  5GAE P;  3CCE N;  4HWI A;  1RNH A;  1U49 A;  4DU1 A;  4C8N A;  1DGK N;  1NWK A;  3EE9 A;  3NDK A;  3I8D A;  4YOX A;  1RBV A;  3CI5 A;  3V81 A;  4CJQ A;  4BQZ A;  3H1Q A;  3NH0 A;  2G8I A;  3O1W A;  4JLH A;  2KLA A;  3RMD A;  4B9T A;  4R5P A;  1QVF M;  3K58 A;  4O44 A;  1QSL A;  4CIF A;  1YVU A;  4JRP A;  3SUN A;  4JYA K;  1YTA A;  3WUH A;  4B3T K;  4CHP A;  4JI3 K;  4E19 A;  2GWK A;  4H0X B;  1TAU A;  2HND A;  3C6U A;  3ZSR A;  4CGH A;  3PY8 A;  3EKS A;  3IG1 A;  2Q2R A;  4CF2 A;  3GBT A;  4M3W A;  1GLD G;  1NNE A;  4IEI A;  4BRC A;  3RSE A;  1NGI A;  1TVR A;  2Z1I A;  1U4B A;  3E1Y A;  4JAX A;  1WN7 A;  1TKT A;  3VER A;  1BQM A;  3AGK A;  1LOT B;  2E6M A;  3V9X A;  2AP1 A;  1I94 K;  1QSS A; 
#chains in the Genus database with same CATH homology
 4IDK A;  1RIL A;  2DFH A;  3DYA A;  2BAN A;  1VSK A;  2GUI A;  2P51 A;  3O3H A;  1RT1 A;  2EHG A;  3LP2 A;  2I5J A;  4FZY A;  1I3A A;  1VSD A;  4CJT A;  4DSI A;  3ZT1 A;  4M3U A;  3OY9 A;  1ZBI A;  4KAZ A;  3K57 A;  4W5R A;  4PWD A;  1D9D A;  4FJ9 A;  5C25 A;  1A5V A;  2KW4 A;  3PX4 A;  4Z4E A;  5FRN A;  2ZD1 A;  4I2P A;  1UWB A;  3KTQ A;  3U3G A;  1SL1 A;  1RTD A;  4CF9 A;  3TAG A;  1WAF A;  3CFO A;  1NK6 A;  2BE2 A;  1JLQ A;  3LP1 A;  4EP4 A;  3NHG A;  3OYM A;  4H4M A;  4JS5 A;  3DLH A;  2HVH A;  4GMJ B;  1NK5 A;  5CZ1 A;  2RF2 A;  1JL1 A;  3HPG A;  2KZM A;  1LV5 A;  3L3V A;  3T19 A;  1J53 A;  4Z4C A;  3QES A;  1VK0 A;  3MEC A;  4CEB A;  4CHZ A;  5T7B A;  3RMC A;  1C1C A;  4FLZ A;  4B08 A;  1BCM A;  3THV A;  3LAK A;  3LP0 A;  3QIO A;  4CGI A;  3IS9 A;  2YNH A;  1WSG A;  3V9Z A;  4RW7 A;  1XWL A;  2NUB A;  4KI4 A;  3D0P A;  1UAX A;  2RPI A;  2Z1H A;  4BDY A;  1U48 A;  3S3O A;  2HMI A;  4DQI A;  4E0D A;  1Z25 A;  4F4K A;  4LSN A;  2XY8 A;  3AVF A;  4ID5 A;  1UA1 A;  3SV3 A;  1RTJ A;  4FVM A;  4H4O A;  5J2P A;  4FJX A;  2E4L A;  3ASM A;  3OJU A;  1XC9 A;  2F8T A;  2YKN A;  1Q8I A;  2QXF A;  3AVN A;  1A5X A;  1C6V A;  2HW3 A;  3D45 A;  4Y1D A;  2OPQ A;  4Q5V A;  3LAN A;  4KTZ A;  4JRQ A;  3TAQ A;  2HB5 A;  2B4J A;  3SQ1 A;  1XHZ A;  4CJU A;  1Y97 A;  4CCH A;  4W5Q A;  4FJ5 A;  1D5A A;  4HUG A;  4CHN A;  1JXE A;  4C8O A;  4OLA A;  4DTO A;  2OPP A;  3KLH A;  4EZ6 A;  3MXM A;  4OLB A;  3QO9 A;  4UQG A;  1WAJ A;  3DRS A;  4CJE A;  3WNH A;  4DWI A;  4M42 A;  2DTU A;  4YNQ A;  5CY4 A;  3VQ5 A;  3QNO A;  3VQ7 A;  3VQB A;  3KK2 A;  4M3R A;  3PX6 A;  2P1J A;  1NOY A;  4NCA A;  4FZZ A;  3OS2 A;  1NKC A;  1D8Y A;  1NOZ A;  3DLG A;  4ID1 A;  1VRU A;  4O0J A;  4DS4 A;  4HUE A;  2JGU A;  2X6N A;  4ZTJ A;  1S9G A;  1HQU A;  3VN5 A;  3HT3 A;  1Q9X A;  4DFK A;  4MQ3 A;  1EET A;  2ZE2 A;  2Y1J A;  3EYZ A;  1K6Y A;  1NJX A;  1X1P A;  4KV8 A;  4W5T A;  4OGE A;  3RMB A;  1TL3 A;  2D0C A;  3AVL A;  3HVR A;  3KLE A;  2PYL A;  4RW6 A;  3AA2 A;  4FM2 A;  3AVC A;  1SKW A;  3NBP A;  2OYQ A;  1RT7 A;  4KHQ A;  4NYF A;  2D5R A;  4I2Q A;  3ZT2 A;  4BE1 A;  2XY6 A;  3BDP A;  3DRP A;  4KRF A;  3TAP A;  3PO4 A;  4C8L A;  1JL2 A;  4B3O A;  3QER A;  4KI6 A;  4Z4G A;  5E41 A;  4CFC A;  1WSI A;  2D0A A;  2XY7 A;  1B92 A;  3CM6 A;  3NCI A;  4F8R A;  4DFP A;  4FJJ A;  3NF8 A;  4CGF A;  3LPT A;  4DTN A;  3OYA A;  4FLU A;  2RKI A;  3VA3 A;  1L3T A;  4F3O A;  4FJL A;  4CJR A;  3ZSQ A;  3ZT4 A;  3CG7 A;  3NH1 A;  3AO3 A;  4DS5 A;  4CIE A;  1L3S A;  5SWM A;  1VSH A;  2YNI A;  3M8R A;  5HRN A;  3JYT A;  3DM2 A;  3KKS A;  3VQP A;  1S6Q A;  1C1B A;  4NCG A;  5SZT A;  1ASW A;  3VQQ A;  4B8A B;  2JLE A;  4DQR A;  1VSI A;  1IKX A;  4H8K A;  2Y1I A;  1NK7 A;  2QK9 A;  1WSE A;  1FKP A;  4CEF A;  4KHN A;  3RRH A;  2Q3S A;  4FLW A;  1BIZ A;  4TSX A;  3SUO A;  3AO1 A;  1C1A A;  4FJH A;  2W42 A;  3V6D A;  1NK8 A;  4CJ4 A;  3ZSO A;  1U04 A;  1HYV A;  2ITG A;  4CJW A;  1RBR A;  5DK5 A;  3LWL A;  3NE6 A;  4DTU A;  2YV0 X;  3HPO A;  4Y1C A;  3SPZ A;  3TAN A;  3RRG A;  3L2R A;  3EZ5 A;  2FBV A;  4FK4 A;  4PY5 A;  2YHB A;  3I0S A;  4BWJ A;  5HLF A;  3DLB A;  3UIQ A;  1J54 A;  4CEZ A;  3HM9 A;  2OZS A;  2HHX A;  1G15 A;  4FJ7 A;  5FRO A;  3B6O A;  3HP9 A;  2DFF A;  5KRT A;  4FLY A;  4DF4 A;  1TK5 A;  3PO5 A;  1S1X A;  4G1Q A;  4O0I A;  5J2M A;  3U3Y A;  1RT5 A;  4FM0 A;  4HHT A;  2Z1J A;  1B9F A;  3ZSZ A;  1TK0 A;  3AVM A;  1ZBL A;  1KFD A;  3NGY A;  1RDA A;  1KLN A;  4L8R B;  1NK0 A;  3HJF A;  1LAW A;  3OYE A;  1DLO A;  3O3G A;  4KPY A;  2XRI A;  3NFA A;  5HBM A;  4LSL A;  3TWH A;  4BE0 A;  5HP1 A;  1IKV A;  4F3T A;  1S1U A;  4AHT A;  4FLX A;  2F8S A;  3L3U A;  3PUF A;  4M45 A;  3OS0 A;  1KVC A;  5DMR A;  4FLT A;  1NK4 A;  4E7H A;  4CJL A;  3OYK A;  1S1W A;  3KLG A;  1IG9 A;  4DFJ A;  2O4G A;  1LW0 A;  3MXI A;  3NGZ A;  1KLM A;  1SKS A;  1TKZ A;  4KRE A;  3OYN A;  1QSY A;  4Z4F A;  4JS4 A;  2OZM A;  2DFE A;  3B6P A;  3OS1 A;  1LWC A;  3ZT3 A;  3HK2 A;  3BGR A;  4MFB A;  1UA0 A;  2YNF A;  1QE1 A;  2FBY A;  4LH5 A;  5KTQ A;  4YFU A;  4CGD A;  3HST B;  1FKO A;  4CJK A;  3RWU A;  1QHT A;  1RT6 A;  1S1T A;  3RTV A;  2HHS A;  3K5N A;  1Q9Y A;  1JKH A;  1NJY A;  2HHW A;  2OPR A;  1DTQ A;  5J2N A;  1S9E A;  1VSL A;  3VQC A;  2XO7 A;  3SJJ A;  1IO2 A;  3VQ9 A;  1NKE A;  2ZQB A;  4KKO A;  3C94 A;  1ZBF A;  3L2W A;  5CZ2 A;  1N5Y A;  1VSM A;  3O3F A;  3TR8 A;  3PV8 A;  2G8W A;  4DSK A;  2HNY A;  4HCC A;  2RN2 A;  4I9Q A;  3TAR A;  3WNE A;  3TAF A;  4FW2 A;  4PQU A;  3NAE A;  2HVI A;  4DTX A;  1KRP A;  3AO5 A;  4AHV A;  3K5M A;  3L8B A;  4DU4 A;  4CED A;  1HNI A;  1CXQ A;  4E7J A;  3V9S A;  3KKR A;  3QEP A;  4DLG A;  4CJ3 A;  4E3S A;  4AH9 A;  3VQA A;  4KHY A;  1RBU A;  2R7Y A;  3VQ4 A;  3QLH A;  4CGJ A;  3SZ2 A;  4FW1 A;  4CJF A;  4CF0 A;  4CEO A;  4CK3 A;  1ZYQ A;  1MU2 A;  3QNN A;  4IBN A;  2ETJ A;  3DI6 A;  3KLI A;  5HRO A;  1U45 A;  2VG6 A;  1RDC A;  1VSJ A;  4M41 A;  4FLV A;  3MED A;  4PUO A;  3FFI A;  3K5O A;  2HNZ A;  1CXU A;  1ASV A;  2XY5 A;  1NKB A;  4ELT A;  1BHL A;  3TAB A;  2OPS A;  3AVA A;  3SPY A;  1XI1 A;  2G8F A;  3S3M A;  1WLJ A;  2FBX A;  4E7K A;  4E1N A;  4CES A;  2B5J A;  3AA5 X;  2XHB A;  4CF1 A;  1TKD A;  4DSJ A;  1S5J A;  4KB0 A;  4CEC A;  1W9H A;  3QEW A;  4B9L A;  3K2P A;  1RTH A;  4BAC A;  5I42 A;  2KZZ A;  1TAQ A;  1NJW A;  3OYJ A;  4RW8 A;  4B9U A;  1KCF A;  3KK1 A;  1A5W A;  2G8H A;  3O4N A;  3MEE A;  4I9L A;  4OJR A;  1XHX A;  4Z0U A;  3LDS A;  2G8K A;  2PYJ A;  4CFB A;  1C0M A;  1RBS A;  3HYF A;  5HRP A;  3EY1 A;  2X74 A;  5KGW A;  4AHU A;  4CHO A;  4CHY A;  4DSL A;  1CLQ A;  2YNG A;  2KFN A;  1KSP A;  1JXB A;  2LSN A;  1LWE A;  4OKJ A;  4QAG A;  1KTQ A;  5FDL A;  3ZCM A;  4CEA A;  4W5O A;  3QEV A;  1HJR A;  1HNV A;  1VSE A;  3LAM A;  1R0A A;  1BIS A;  4C8M A;  3ZT0 A;  3DLE A;  4CK1 A;  4CE9 A;  2IDO A;  4FYD A;  3DRR A;  3NGI A;  1F21 A;  4LH4 A;  3IAY A;  4EP5 A;  1JLB A;  3ALY A;  3M8S A;  1RDD A;  5KGX A;  3HO1 A;  1J5O A;  4DTS A;  2FBT A;  3SUP A;  2A1R A;  3LAL A;  3OYL A;  4FJG A;  4DMN A;  4N76 A;  4O4G A;  3V4I A;  3V1R A;  1HYS A;  4BDP A;  4FCY A;  3NF6 A;  2G8U A;  1SV5 A;  3L2U A;  1X9W A;  3MEG A;  4GW6 A;  4B8C A;  4CJ5 A;  2KQ2 A;  1S6P A;  3SV4 A;  1UOC A;  3G10 A;  3AA3 A;  3T1A A;  1IKW A;  2X6S A;  4IG3 A;  4J2B A;  1WSJ A;  4ZHR A;  1WNS A;  2VG7 A;  4IG0 A;  1C0U A;  4FXD A;  2IGI A;  4FJ8 A;  4M3T A;  3S3N A;  2OA8 A;  4CIG A;  3C6T A;  4FK2 A;  4M3X A;  1BCO A;  3SYZ A;  4E1M A;  3O4Q A;  2IC3 A;  1HPZ A;  3G0Z A;  1U47 A;  4M3Y A;  4F2R A;  4IFY A;  4QCL A;  4CHQ A;  3CFR A;  4FZX C;  1WSH A;  3QEI A;  2KFZ A;  4PA1 A;  1I39 A;  3LP3 A;  4CEE A;  3OYI A;  4KHS A;  3ISN C;  4RG8 A;  4E89 A;  3OYG A;  1D9F A;  3SI6 A;  3VQ8 A;  1T03 A;  3V1Q A;  1BI4 A;  3KIO A;  3DMJ A;  4BE2 A;  1N6Q A;  5CYM A;  3ZSX A;  2WON A;  3WNF A;  4C8K A;  2P5G A;  1GOC A;  4CF8 A;  4DSF A;  2D0B A;  4FJK A;  2GV9 A;  4FJI A;  3LZI A;  3CM5 A;  2PZS A;  1VRT A;  4J2D A;  4CFA A;  1RBT A;  5C42 A;  4OKK A;  5J2Q A;  1LW2 A;  5C24 A;  2PY5 A;  3DOL A;  2BDP A;  4GVM A;  1SL0 A;  1GOB A;  4NYN A;  5KRS A;  3QET A;  3KLF A;  4HCB A;  3AA4 A;  2O4I A;  3HVT A;  1T7P A;  4CFD A;  1TKX A;  1EP4 A;  2VWK A;  3VQD A;  3SQ0 A;  3QIN A;  3KK3 A;  4OKE A;  3AVI A;  4O5B A;  2DY4 A;  4KTQ A;  4ZTF A;  1ZBU A;  4KO0 A;  3M8P A;  2IOC A;  4B9S A;  4N56 A;  1HQE A;  4BDZ A;  4J2E A;  1LAV A;  4Z4I A;  4DFM A;  1Z26 A;  3E01 A;  4KTW A;  3VA0 A;  4CER A;  3SUQ A;  4EZ9 A;  2HHQ A;  4DLE A;  1TK8 A;  1BI4 B;  4IKF A;  4J2A A;  3P1G A;  3L2Q A;  3K5L A;  3CQ8 A;  1LWF A;  1QTM A;  4IFV A;  4FK0 A;  3HL8 A;  2Z1G A;  5JS1 A;  1WSF A;  3SQ4 A;  4K8X A;  2F96 A;  4DF8 A;  5D3G A;  2KTQ A;  5JS2 A;  4DQQ A;  3ZSV A;  3AO2 A;  3QIP A;  3RMA A;  4DQS A;  3QEX A;  1ASU A;  1VSF A;  4K8Z A;  3OYF A;  1T8E A;  3RR8 A;  4FJN A;  3LPU A;  4FJM A;  4KB1 A;  1HYZ A;  1JLF A;  3H08 A;  1O1W A;  1W0H A;  1SUQ A;  2VG5 A;  4M3Z A;  1REV A;  2QKB A;  5J1E A;  3LZJ A;  3CYM A;  1DTT A;  2IS3 A;  3P83 D;  4Z4H A;  3OYB A;  1HMV A;  1RT3 A;  4LY7 A;  3V9U A;  4ELU A;  2HHT A;  4CJP A;  4DU3 A;  1BQN A;  2QKK A;  3DLK A;  4RW4 A;  3LWM A;  3L2V A;  3SNN A;  4B9M A;  4KHU A;  2A1S A;  2B6A A;  3NF9 A;  3C95 A;  4OVL A;  4AHS A;  3HXM A;  3HP6 A;  1FK9 A;  3IRX A;  1JLA A;  5HRR A;  5CYQ A;  3V1O A;  3AO4 A;  4DTR A;  1BGX T;  1T05 A;  4B9N A;  1TL1 A;  4AHR A;  4AIL C;  1ITG A;  3K59 A;  2E6L A;  1KVB A;  5HRS A;  3T3F A;  3OYC A;  3S9H A;  3A2F A;  4N41 A;  2FC0 A;  3NH2 A;  4CGG A;  1ZBH A;  1RCH A;  4CK2 A;  2YKM A;  2P5O A;  2X78 A;  2YHA A;  1QQC A;  3F9K A;  3MXJ A;  4OPJ A;  5I3U A;  1J9A A;  3AV9 A;  3CFP A;  1KFS A;  3KJV A;  4OPK A;  3ZSY A;  4BWM A;  4ELV A;  4CJS A;  4DTM A;  1JLE A;  1EX4 A;  1IKY A;  3TAE A;  4KHW A;  3DLR A;  3ZSW A;  1KVA A;  4E7I A;  3OYD A;  3OYH A;  1CZ9 A;  3AVH A;  4XIU A;  3SQ2 A;  1GOA A;  1NJZ A;  1TGO A;  1EKE A;  2GBZ A;  4N5S A;  4KFB A;  4HTU A;  4W5N A;  3AVK A;  1SKR A;  4CEQ A;  1L3V A;  3VQ6 A;  1RTI A;  1RNH A;  1U49 A;  3VQE A;  4LD0 A;  4HVJ A;  3ULD A;  2HHV A;  3DOK A;  4DU1 A;  4E7L A;  3V9W A;  4C8N A;  4F2S A;  1HRH A;  4I7F A;  3NF7 A;  4HUF A;  1CZB A;  3WNG A;  3NDK A;  3I8D A;  1S1V A;  1QS4 A;  3KD5 E;  3P5J A;  4ICL A;  1RBV A;  1NK9 A;  4AHC A;  3V81 A;  4RW9 A;  4CJQ A;  1RDB A;  3NH0 A;  4DTJ A;  3U6F A;  1YT3 A;  2G8I A;  4WE1 A;  3MAQ A;  3OVN A;  4JLH A;  1BL3 A;  3RMD A;  1BIU A;  4R5P A;  1L3U A;  4B9T A;  2BGG A;  4N47 A;  4QOZ B;  3OJS A;  3RR7 A;  3JSM A;  1JLG A;  3K58 A;  3I0R A;  4O44 A;  4DG1 A;  4B9V A;  1QSL A;  2VWJ A;  4CIF A;  1YVU A;  1RT4 A;  4JRP A;  3SUN A;  2EX3 A;  1YTA A;  3AVG A;  4NCB A;  3AVB A;  1TV6 A;  4CHP A;  4E19 A;  3M8Q A;  4DSE A;  5K14 A;  1YTU A;  3ITH A;  1EXQ A;  1TAU A;  2IAJ A;  2HND A;  3C6U A;  3HPH A;  3ZSR A;  4CGH A;  3PY8 A;  1JLC A;  4OGC A;  2G8V A;  1C0T A;  2WOM A;  4O55 A;  2HHU A;  5FRM A;  1B9D A;  3IG1 A;  4CF2 A;  4M3W A;  2ATQ A;  4CJV A;  1L5U A;  3KD1 E;  3PX0 A;  3TI0 A;  3TAM A;  1RT2 A;  1TVR A;  4FM1 A;  2Z1I A;  1U4B A;  5KI6 A;  5EU7 A;  1X9S A;  2AJQ A;  1TKT A;  1WN7 A;  1X9M A;  1SL2 A;  3F73 A;  1BQM A;  4DQP A;  4Q0B A;  2E6M A;  3V9X A;  1FXX A;  1IH7 A;  3SCX A;  4DTP A;  3AVJ A;  1QSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...