5KGWA

Hiv1 catalytic core domain in complex with inhibitor: (2~{s})-2-[3-(3,4-dihydro-2~{h}-chromen-6-yl)-1-methyl-indol-2-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
153
structure length
134
Chain Sequence
CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Indole-based allosteric inhibitors of HIV-1 integrase.
pubmed doi rcsb
molecule keywords Integrase
molecule tags Transferase/transferase inhibitor
source organism Human immunodeficiency virus 1
total genus 44
structure length 134
sequence length 153
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5kgwA00
4OJRA 3JSMA 1TAQA 1R0AA 1NKBA 2F8SA 4Z4FA 3QEXA 4HHTA 3SQ4A 5C24A 1RT5A 1VSHA 1UA0A 2OZMA 3EZ5A 2DFEA 2HHXA 3AA2A 3AO2A 3DRSA 3SV3A 1WSJA 3ZSXA 4IKFA 3HT3A 3VQ7A 4I2QA 5FDLA 3KJVA 4IFVA 1VSLA 1U47A 3BDPA 2BGGA 4CGJA 1A5XA 4FZZA 4AHCA 4KHUA 1HYZA 3KLGA 3HO1A 3TWHA 2ZD1A 4IG0A 1RNHA 3WNHA 3RMBA 4E7IA 3MAQA 3RMDA 3V9WA 3LP0A 1ZBLA 2PYJA 4KREA 3CG7A 2KTQA 4W5NA 2DTUA 1RT7A 4CK1A 4CGFA 5CY4A 1X1PA 1UWBA 1QSLA 3L3UA 2KW4A 2VWKA 3QEWA 4M3TA 2RN2A 3SQ0A 3D0PA 2PZSA 3EYZA 4CCHA 4CGIA 3S3NA 3OY9A 3OYNA 1N6QA 4CJWA 1Z26A 4KHWA 4EP5A 4DQPA 4KV8A 4CJQA 1U48A 4KTQA 3AA5X 4CEZA 3U3YA 3EY1A 4M3XA 2QXFA 4NCAA 3MEEA 2YV0X 3OS2A 2HHQA 1WNSA 3LP3A 3HP6A 1KRPA 4FZXC 3QESA 4F2SA 5KRTA 4CJSA 1TAUA 1CXUA 3V81A 5DK5A 1O1WA 4DLEA 2YKMA 1VK0A 1ASWA 3OYCA 1LWEA 3TAPA 3KD5E 1Y97A 3K5OA 3PUFA 3ZSWA 3F73A 1LW2A 1KLNA 3OYLA 1NK9A 4M42A 4KRFA 4EP4A 5KGXA 4H4OA 4C8NA 5K14A 3K57A 4JS5A 4DSKA 4CGHA 3PX6A 4BE1A 2RF2A 4CJRA 1NJZA 2Y1JA 1YT3A 4E0DA 4FJXA 1J9AA 3QIOA 4DTXA 1T8EA 1D5AA 2P51A 1RTJA 3KK3A 3CFOA 1LAWA 3HSTB 4PUOA 3NFAA 2X74A 3B6PA 4CK2A 4DSIA 2PY5A 4LSNA 3C95A 4J2BA 2B4JA 4N76A 2F96A 3OS1A 4CFBA 1TK8A 2ZE2A 2XHBA 3O4NA 1TVRA 3ISNC 4Z4CA 4C8KA 1IH7A 4FJ5A 3HJFA 3E01A 2P5OA 1S1TA 1HYVA 1MU2A 3AV9A 4FW2A 1ZBHA 4OPKA 3QEPA 1S9GA 1HNVA 4RG8A 3K5LA 4LD0A 1X9SA 2OPPA 1GOCA 1VRTA 4BACA 3DLEA 4DTRA 3S9HA 4FJLA 3QEVA 3QIPA 1IG9A 1GOAA 1D9FA 4FJKA 3AVAA 3NH1A 3RTVA 1W0HA 3V1OA 3C6TA 3WNFA 1S9EA 2Z1HA 5CYQA 1JLEA 5EU7A 1SL2A 4Z4GA 1KVCA 1QS4A 3AVBA 2E4LA 3BGRA 3VQ5A 5T7BA 1TKXA 4HVJA 4CHYA 1XI1A 4KAZA 4LH4A 4DS5A 3OYEA 4FLZA 1RT3A 1FKOA 1WSGA 4QAGA 4IDKA 4CGDA 3O3GA 5J2MA 5FRMA 4BWMA 2ZQBA 1C0UA 1BCMA 3NH2A 2OPRA 4C8MA 1U49A 4O55A 1CXQA 3K2PA 5JS2A 3NHGA 2YHBA 2VWJA 1VSEA 4ZTJA 1RTDA 1BL3A 3SZ2A 2DFFA 4Q5VA 5HRSA 3P1GA 2E6LA 1NKEA 3HYFA 2JLEA 3LAMA 3QEIA 4FK0A 3K5NA 4YNQA 3KLHA 3HPOA 3AO4A 1BQMA 3KD1E 1RDCA 3VQBA 2FC0A 2HHSA 3L2UA 3AVLA 1SKSA 1HQUA 3V1RA 4J2AA 1JXBA 1D9DA 3TAQA 1DTTA 4BDPA 4Z4EA 3HK2A 4DTMA 4KHYA 3MXJA 4LSLA 1FXXA 3F9KA 2PYLA 4FJJA 4QOZB 2HNYA 3DLRA 1WSEA 4FLVA 4FLUA 2B5JA 3G0ZA 2XRIA 1JL2A 3DOLA 4CHZA 3T1AA 3VA3A 1UAXA 4DTOA 1LW0A 1HNIA 1WSIA 3K59A 5I3UA 1LWCA 1QSSA 4WE1A 4B8CA 4CJVA 4DQIA 1B9DA 1YTAA 4CECA 3NGIA 4CJEA 3I0RA 4G1QA 4I2PA 4AHRA 1X9WA 1S6QA 4FZYA 5HRRA 4FLXA 3LP2A 3NE6A 4E7HA 2YKNA 3NGZA 4DSLA 3RMCA 3VQAA 4F2RA 1NK8A 4DTPA 1UOCA 4CHPA 5J2QA 1QSYA 2HW3A 1CZBA 1BCOA 5CZ1A 1L3TA 4Z4IA 4IG3A 1RILA 2LSNA 3AVIA 1ASVA 4AH9A 1HQEA 3ZSRA 1U45A 3O4QA 1CZ9A 4CFDA 1KTQA 1XHXA 3AO5A 3OYKA 3NH0A 4FM1A 3TARA 3L8BA 4PY5A 4N5SA 5CZ2A 4ZTFA 3SJJA 1J5OA 1B9FA 4CJTA 4OKJA 4E1MA 4AHTA 1KCFA 1WSHA 3G10A 3DMJA 1BQNA 4E7KA 1LWFA 5HRPA 3NGYA 3L2VA 4ICLA 1F21A 3LALA 4LH5A 4CEFA 4DFKA 4RW7A 4NYNA 2G8VA 1Q9YA 3QERA 1TKTA 3LZIA 4M41A 4PA1A 5KI6A 1WN7A 4CF1A 3JYTA 4B9LA 4FW1A 4DF8A 4Z0UA 3OYHA 4DF4A 1BISA 2QK9A 1TGOA 3HL8A 1J53A 2ITGA 3LWMA 1D8YA 3AVKA 3LPTA 1EP4A 3OYFA 4BDYA 1LV5A 2AJQA 1XWLA 3SUNA 2KZZA 3HPHA 1RT4A 4N41A 3V9ZA 1XHZA 2HVHA 3CM5A 2FBYA 3RRHA 4AILC 1U04A 3TAMA 4CF2A 1KVBA 4W5TA 4BWJA 1NK5A 1SKRA 3DYAA 4W5QA 1C1BA 1IO2A 1IKVA 4JRPA 2ETJA 3C94A 3HXMA 4L8RB 4GW6A 3QNNA 3VQ9A 3P5JA 4ID5A 3CQ8A 1I39A 4KKOA 1WLJA 4CJKA 3PO5A 3SQ2A 3SYZA 1DTQA 3T19A 4CF0A 4CESA 1HPZA 2HNDA 3OYIA 2XY7A 3ULDA 3TAEA 3DLBA 3HVRA 4MQ3A 2P1JA 4IBNA 1SUQA 2Z1GA 3MEDA 5DMRA 5KRSA 1RDBA 3AVHA 3MEGA 4JRQA 3RWUA 4KFBA 3AA4A 1JL1A 4DQRA 4AHVA 2G8WA 4I9LA 2HHVA 1JLGA 2YHAA 2YNFA 2FBTA 3AVMA 4B9SA 4DQQA 1KSPA 4NYFA 4DTSA 4M3UA 4ID1A 4FYDA 1KFDA 3PX4A 3SPYA 3DLHA 3TI0A 4FK4A 1X9MA 4CFCA 3S3OA 4OKKA 3U3GA 1S1UA 1BHLA 3PO4A 2HHWA 3QNOA 2Z1IA 2W42A 3KLEA 3K58A 4FJNA 1BGXT 1JLAA 2ATQA 3VQCA 4DTJA 1L3VA 4Y1CA 4HUGA 3THVA 3AVCA 3QINA 1QE1A 2OYQA 1IKXA 3DI6A 4HTUA 3NBPA 3IRXA 3ZT2A 2WONA 4YFUA 4FLTA 2OA8A 4H4MA 3KIOA 4Z4HA 1J54A 4EZ9A 2BANA 3AVJA 4CJPA 4DFMA 5HP1A 3TR8A 4FJHA 3OYMA 4DS4A 1BIZA 1BI4A 4OVLA 3SNNA 1XC9A 3A2FA 4XIUA 4M3WA 5J2PA 4CJ4A 1KLMA 4FJ7A 2IC3A 3HM9A 5KGWA 1L3UA 3SUQA 4B9MA 1RTIA 3KKRA 1WSFA 4AHUA 3RMAA 4H8KA 3MECA 2OPSA 4FXDA 3NF7A 4IFYA 2I5JA 1A5VA 3ZT4A 1T03A 1QQCA 3LPUA 1ZYQA 3V4IA 2OZSA 4KB1A 4C8OA 2IDOA 3RRGA 1S5JA 1NK0A 3TAFA 4RW6A 3PV8A 2HHTA 1ZBFA 5SZTA 4JS4A 3SI6A 2EX3A 2KQ2A 4E7JA 3L2QA 1KFSA 4HCCA 2G8HA 4KHQA 4CJUA 4CEQA 4ELUA 3PY8A 5SWMA 4BE0A 4E19A 4EZ6A 1GOBA 2G8FA 4CHOA 3PX0A 3OS0A 3UIQA 1NKCA 4DU3A 2VG5A 1WAJA 4CIGA 2EHGA 4E1NA 2KFZA 4B9VA 4E3SA 2Q3SA 4FJIA 2BE2A 1YVUA 2VG6A 1RDDA 4W5OA 5I42A 1VSMA 4MFBA 5FRNA 1YTUA 4CEEA 2RPIA 3V1QA 4FM2A 2Z1JA 3ZSZA 3NAEA 4FLWA 4DU1A 3MXMA 2G8KA 4DWIA 2A1RA 4HUEA 4KPYA 4CHNA 3IG1A 3O3FA 1EETA 4KI6A 1EXQA 3ALYA 1TK0A 4O44A 3OVNA 4RW4A 1SV5A 3ZCMA 3LZJA 3OYAA 1IKWA 4PQUA 2QKKA 5HLFA 1ASUA 4W5RA 4DLGA 3OYDA 4FK2A 3SQ1A 1FKPA 1BIUA 4O5BA 1S6PA 1C1AA 2XO7A 3L2WA 1JKHA 3TAGA 1TL3A 2NUBA 1NJYA 1CLQA 2YNHA 1EKEA 3V9SA 2GV9A 1SL1A 2GBZA 4HUFA 1I3AA 3HP9A 3I8DA 4F8RA 4F3TA 4B3OA 3VQ6A 4Y1DA 3CYMA 3DLKA 4O0IA 1Q8IA 1RTHA 1RBRA 4Q0BA 2VG7A 1ZBUA 4CJ3A 2E6MA 4DU4A 1NK7A 4DMNA 4OLBA 1RT1A 1U4BA 2D0AA 2O4GA 3NF8A 3OYJA 3QETA 4O0JA 4CERA 3QO9A 4DSFA 1RT6A 1K6YA 1JLBA 4OGEA 3OYBA 4FJMA 3V9UA 1VSKA 3DOKA 3U6FA 4BDZA 3ZT0A 3MXIA 5C42A 1VSDA 4B9TA 4HCBA 4N47A 3L3VA 1T7PA 4NCBA 5HRNA 2YNIA 1BI4B 1FK9A 1TV6A 3AA3A 1QHTA 4ZHRA 1L5UA 1VSFA 3P83D 4CFAA 4F3OA 4M45A 4J2EA 1S1VA 3DM2A 4B9NA 2XY5A 2BDPA 4CJ5A 3AO1A 3CFPA 5J2NA 4DFJA 1WAFA 3AO3A 1TKDA 4KHSA 1C0TA 3ZSVA 3KLIA 4FCYA 4OKEA 4TSXA 2IGIA 3WNEA 1NJXA 1RBVA 3SPZA 2DY4A 4ELTA 2D0CA 1G15A 1C1CA 4N56A 3M8RA 3T3FA 1JLCA 1JXEA 1ZBIA 2GUIA 3VQDA 5HROA 4F4KA 2KFNA 4LY7A 1TKZA 4O4GA 3ZSOA 4K8XA 4CF9A 3VA0A 3D45A 4DQSA 2P5GA 1S1XA 3VQEA 4CIFA 3OJUA 1KVAA 3AVFA 2X6NA 2Y1IA 1SL0A 5C25A 3KKSA 4GMJB 3M8PA 2D0BA 4AHSA 1NK4A 1NOZA 1T05A 2O4IA 2IAJA 1IKYA 2YNGA 4FJGA 3LWLA 4CEBA 3KTQA 4FVMA 2B6AA 1NK6A 1QTMA 3VQ4A 4DG1A 3ITHA 4KTWA 3KK2A 3SV4A 2D5RA 3SUPA 2DFHA 3LAKA 1W9HA 3M8SA 4UQGA 2HMIA 3IS9A 3KK1A 1A5WA 4R5PA 3NDKA 4QCLA 4CEAA 4CE9A 3WNGA 4E89A 3TANA 1UA1A 1HJRA 3DRRA 2HB5A 1JLFA 1RT2A 2RKIA 5HBMA 5FROA 1Z25A 3HPGA 4CK3A 3NCIA 3SUOA 1HYSA 4OGCA 1S1WA 3LDSA 4DFPA 1B92A 3VQQA 3IAYA 2A1SA 4GVMA 1VSJA 3VQPA 2FBVA 4CHQA 3AVGA 3ZSQA 4B08A 2R7YA 1REVA 4OPJA 4JLHA 4DTUA 1EX4A 3C6UA 3FFIA 4RW8A 4E7LA 3TABA 5D3GA 4DTNA 1JLQA 5KTQA 1C6VA 3LANA 1L3SA 4FJ9A 4FLYA 3I0SA 4RW9A 4CJFA 1ITGA 2FBXA 4I9QA 4KTZA 3CM6A 1VSIA 3LP1A 1NJWA 2WOMA 4CF8A 1VRUA 2X78A 4KO0A 5JS1A 4B9UA 3NF9A 4KI4A 1RBUA 4CEDA 3B6OA 4KHNA 2IOCA 3NF6A 4DSJA 2XY6A 1N5YA 2HNZA 2IS3A 3ASMA 4CJLA 3VN5A 3CFRA 3V6DA 1RBTA 3S3MA 3RR8A 5CYMA 4BE2A 3H08A 1DLOA 3AVNA 4B8AB 3RR7A 2QKBA 4M3ZA 3HVTA 4K8ZA 1RDAA 3ZSYA 1HMVA 3K5MA 5J1EA 5E41A 1TK5A 1C0MA 2JGUA 2F8TA 3L2RA 2XY8A 2HHUA 3O3HA 4I7FA 4M3RA 4CGGA 3OYGA 3OJSA 2G8UA 4DSEA 4CEOA 1RBSA 3QLHA 4M3YA 2HVIA 4KB0A 2KZMA 3DLGA 2X6SA 3ZT3A 3ZT1A 3V9XA 1NOYA 3M8QA 2G8IA 4NCGA 2OPQA 1TL1A 1RCHA 1HRHA 3VQ8A 3KLFA 4CIEA 1Q9XA 4ELVA 1LAVA 4FM0A 1SKWA 4J2DA 3SCXA 4PWDA 4OLAA 4C8LA 4FJ8A 3DRPA
chains in the Genus database with same CATH superfamily
4WFAL 1R0AA 1HX1A 3MWTA 4PKHA 1RDWX 1W97L 2CGJA 4HHTA 1UA0A 4EHUA 2HHXA 1DKGD 3ZSXA 4B1YB 2HOEA 3HT3A 4IKFA 3VQ7A 4DV0K 1Q7YO 1HKBA 4CGJA 2O8EA 3KLGA 3HO1A 2KTQA 4FWNA 2PYJA 4JKEA 1RT7A 4UY8O 3CD6N 5CY4A 3L3UA 2KW4A 3HSCA 4M3TA 5JLHA 1KXPA 3D0PA 2PZSA 3EYZA 3U9DA 4CGIA 2CGLA 5TKYA 2HBMA 3JS6A 2YHWA 2W6LA 3BY5A 4KTQA 2QWRA 3EY1A 3U3YA 2QXFA 4WYBA 1H1VA 2ZGYA 3MCAB 3HP6A 4FZXC 4F2SA 1TAUA 5KRTA 3FFKB 1CXUA 3WXLA 3PIPL 1O1WA 1NGIA 2YKMA 1GLJO 3OYCA 4QS7A 3AGKA 4DB3A 3K5OA 3ZSWA 1KLNA 3GL1A 4EP4A 3K57A 4DSKA 3PX6A 1HUXA 4H03B 2RF2A 4FWSA 1J9AA 1BA1A 3ATVA 2P51A 4BRQA 2D0OA 3CFOA 3HSTB 3TTCA 1VQNN 4GNIA 4J2BA 4LSNA 4BROA 3HM8A 4C8KA 2UYTA 2BH1A 2Q0UA 3THXB 3E01A 1MU2A 2P9IA 5C2DA 4RG8A 4XH1A 1VRTA 4FSVA 3RVCA 4LFAK 3J7AP 1GLCG 1IG9A 5C12A 1GOAA 3AVAA 3V1OA 3WNFA 4B1WB 4MLEA 4Z4GA 1SAZA 1TKXA 3ZX0A 3VOVA 4HVJA 1XI1A 4KAZA 3BF3A 4BQZA 4FLZA 1WSGA 4NB4A 4JKCA 3K2PA 1P90A 4FOIA 5JS2A 2YHBA 3DJCA 4JKDA 1KQSM 3MN6A 2O8EB 2JLEA 3LAMA 1Q81O 3EE9A 5AQZA 1M90O 3HPOA 1XMOK 3KD1E 1RDCA 3VQBA 3L2UA 3NVMA 4BREA 2O8CB 3V1RA 1KAXA 3W3DA 4Z4EA 1YHQN 4EIAA 5LY3A 5AQRA 4KHYA 4LSLA 2O8DA 3R9PA 3DLRA 1YXQA 3G0ZA 4DTOA 4B8CA 4CJVA 1B9DA 4CECA 3U4LA 3EO3A 1X9WA 1GLLO 5CR4A 5HRRA 3ENBA 4MDBA 3NGZA 4DSLA 1WUAA 1BUPA 1NK8A 5J2QA 3S41A 4BG8A 3PLAA 2ASMA 4CFDA 3OYKA 1ILYA 5M1QA 2NRTA 4AHTA 1BQNA 4E7KA 3L2VA 4A2BA 4ICLA 3DLLL 3ZYYX 4FW1A 3OHRA 2UXCK 3F5TA 2PAVA 1TGOA 3LWMA 3CMAN 3OYFA 2AJQA 3V9ZA 1ESVA 3RRHA 4AILC 2HF4A 3KWIA 4W5TA 4BWJA 3CJBA 3DYAA 1C1BA 1EWQA 3C94A 3RSEB 4BVPA 3CJ1A 3SQ2A 1DTQA 3ULDA 3HVRA 4Q0BA 1SUQA 3RWUA 4JAXA 3ATUA 4PKIA 1JLGA 4DR2K 1KD1O 4M3UA 3PX4A 1G99A 3LDPA 3TI0A 4BRCA 2O8DB 3S3OA 4DR1K 1S1UA 1ATSA 3QNOA 2W42A 4A2AA 4DTJA 1L3VA 3AVCA 4CZFA 4IFEA 3GOIA 2OYQA 3NBPA 1SQKA 3Q7BA 2BANA 4CVNE 4DS4A 1XC9A 4OVLA 1BI4A 2YJFA 3D6RA 3A2FA 3O1BA 1KLMA 3HM9A 3VGLA 4AHUA 4X66K 4H8KA 5KPZA 2OPSA 1S22A 4IFYA 2I5JA 1A5VA 5M1NA 1T03A 1QQCA 3LPUA 2OZSA 3V4IA 4KB1A 5JICA 1S5JA 1NK0A 3PV8A 2Q0RA 3VESA 3U8XA 4DQ8A 1ZXOA 4PHTX 3CIPA 1N36K 2QTDA 2QXLA 1GOBA 5EY4A 4EZ6A 2ZJPL 3OS0A 3T69A 5KPRA 4E1NA 3VETA 4B1XB 1MWMA 4FJIA 2ASPA 3HI0A 1YVUA 4YOYA 2ITMA 5FRNA 4BRIA 3A8YA 1NWKA 3EE8A 2YHYA 2Z1JA 3NAEA 4DU1A 4FLWA 4KPYA 2A1RA 4KI6A 4PL8A 3IFRA 3O3FA 1QQNA 3OVNA 3ZEUA 4RW4A 3ZCMA 5E84A 4PQUA 5BR8K 1GLBG 3TSUA 1FKPA 1BIUA 4O5BA 1S6PA 3TAGA 1NJYA 2NUBA 3D2EA 4FWLA 2ZM6K 3E1YA 1NU0A 3V9SA 2ZJQL 3I8DA 5JMVA 3DWLA 4B3OA 3DLKA 4O0IA 1Q8IA 1FJGK 4JKGA 4CD1A 4OLBA 2O4GA 4BRAA 3OYJA 3QETA 1OVQA 2JWLA 4BR9A 3ULEB 4WQ5C 3CC4N 4N47A 3PSFA 2YNIA 4BRHA 3AAQA 1BI4B 3FZHA 1VSFA 1RGIA 1S1VA 3VPZA 2WTUA 2XY5A 4B9NA 5J2NA 1WAFA 1QZ6A 1NGCA 3AY9A 3SPZA 4ELTA 4IEEA 3M8RA 3T3FA 1JLCA 1ZBIA 4LF5K 5HROA 5GINA 4A57A 4DQSA 5KQDA 2P5GA 1S1XA 5AQFA 3UKRA 1KVAA 2OCEA 2Q31A 4GMJB 1NK4A 2D0BA 1TUUA 2Q97A 4CEBA 3VEYA 2B6AA 4C23A 4OPAA 3ITHA 3SV4A 4MO4A 3SUPA 5M1FA 1OH7A 1NMNA 4WFBL 4C1NI 5EVZA 1A5WA 3KK1A 3KVGA 4IOAL 2F7TA 3NDKA 3MMVA 4E89A 5KPTA 3TANA 1HJRA 3HBTA 1RT2A 1VQ6N 5HBMA 4ISGA 3SUOA 2QM1A 4OGCA 4DFPA 2A1SA 4GVMA 1QHAA 4CHQA 2VWBA 3K9KA 4B08A 1REVA 4OPJA 4DTUA 3SK3A 3MX5A 1JLQA 4BC5A 3LANA 5KTQA 1L3SA 2WFBA 4CJFA 3H45C 1VSIA 3ZX3A 1VRUA 2X78A 4KO0A 4B9UA 3NF9A 1U6ZA 2KKZA 3MK6A 2FSNA 2XY6A 2IS3A 3VN5A 3V6DA 3RR8A 2A41A 5CYMA 1MWKA 4BC4A 3G6EN 3RR7A 2QKBA 4K8ZA 1RDAA 3K5MA 1C0MA 4JKHA 2F8TA 2HHUA 5EXWA 4DSEA 1YJNN 2IVNA 3QLHA 4M3YA 2A40A 3P38A 3ZT1A 5LMNK 1K8KA 1RCHA 1Q9XA 4KH5A 3H1VX 1JCEA 4FM0A 4J2DA 3SCXA 2V52B 1TAQA 3FZFA 3EKSA 3QEXA 3TTFA 5C24A 5TKWA 5AR0A 3DRSA 2OTLN 3SV3A 3TPQA 2A6AA 4I2QA 5FDLA 3KJVA 1RDUA 4IFVA 5FLXO 1MDUB 3CETA 4KHUA 1HYZA 3TWHA 1RNHA 4E7IA 1ZBLA 4W5NA 2F9WA 1X1PA 1UWBA 4KH4A 3SQ0A 4OO1J 1LCUA 2QW9A 3CCMN 2P9NA 4CJWA 1Z26A 4EP5A 4B9QA 3QBWA 3SBGA 3MWPA 4CZHA 3T1YK 1U48A 2QWMA 4WCEL 1Q86O 3MEEA 1WNSA 1KRPA 4CJSA 3V81A 3CQYA 5DK5A 1VK0A 4DCHA 2IVOA 1Z05A 1NK9A 3LDOA 5K14A 4CGHA 4CJRA 4B1ZA 1BA0A 1ZC6A 4DTXA 1D5AA 3GBTA 1RTJA 4CZMA 3KK3A 4FPAA 3NFAA 3B6PA 4CK2A 4DSIA 2PY5A 2B4JA 4CFBA 3O4NA 1TVRA 5HL7L 2P5OA 5C0YA 2P9LA 4OPKA 4O5FA 3T1HK 2OPPA 1GOCA 3DLEA 1J6ZA 3CPWM 4B3TK 3QEVA 1D9FA 1U2VB 3NH1A 3RTVA 4AF1A 2Z1HA 3CCQN 1K8KB 3EN9A 1KAYA 4DS5A 4RWTA 3MX2A 5J2MA 4BRKA 2KLAA 2OPRA 3M1FA 1CXQA 2VWJA 3SZ2A 5AQSA 1NKEA 2CH6A 1GLAG 1K73O 5GIOA 3G4SN 4L3QA 3K5NA 4YNQA 1BQMA 1QVGM 2HHSA 1DEJA 5AQIA 3ZETA 2E2QA 1DTTA 4BDPA 3MXJA 1I94K 5I9EB 2PYLA 4QOZB 4FJJA 4MDAA 1WSEA 4FLVA 1IBKK 2XRIA 2PFUA 3T1AA 3CCVN 1UAXA 3A0IX 1LW0A 1HNIA 5I3UA 4FWRA 3JXUA 4DQIA 4CI6A 3I0RA 4I2PA 3I8BA 1S6QA 4FZYA 3LP2A 2FSKA 3RMCA 3CCJN 3CXCM 3ZLJA 3K9JA 1QZ5A 4CHPA 2HW3A 3PSIA 3HOTA 1BCOA 5CZ1A 4IG3A 2AA4A 4YDUC 1HQEA 3DXKA 3O4QA 1KTQA 1XHXA 2PBDA 4FM1A 3NH0A 1KC8O 3E9PA 5CZ2A 3U9ZA 1KAZA 4WF9L 1WSHA 3DMJA 4A59A 5HRPA 3NGYA 1S3XA 1V4SA 1E3MA 1Y64A 4CEFA 1HLUA 4NXMK 2OTJN 4JK8A 1JJ2M 3LZIA 4B9LA 4YDUA 1HPMA 4Z0UA 3SAGA 3P31A 3OYHA 3HL8A 1J53A 3H1QA 1D8YA 3AVKA 3LPTA 1LV5A 4AM7A 1XWLA 4JI2K 3SUNA 3HPHA 4FWQA 4IZ9A 5AQKA 5AQWA 4JI5K 1U04A 4CF2A 4NXNK 1O13A 2NRWA 1SKRA 4W5QA 1IO2A 1IKVA 2ETJA 4L8RB 4ISFA 1VQ5N 3QNNA 2QWLA 5AQNA 3P5JA 4ID5A 4KKOA 4JI4K 3FZKA 4CF0A 4CESA 3SYZA 4KHNA 4K42A 2XY7A 3DLBA 2UXDK 4MQ3A 4DV6K 4IBNA 5KRSA 3AVHA 1VQ8N 3AA4A 2HHVA 2G8WA 3BZKA 2YHAA 3DXMA 2FBTA 2EWSA 2FF3B 4WQ4C 4DTSA 1YJ9N 3ZETB 3THYA 4FYDA 5C10A 4JHDA 3HZ6A 2Z1IA 2ATQA 2A42A 3QINA 3VENA 1QE1A 3IUCA 1IKXA 4R79A 3IRXA 4FLTA 4O8UA 3WQUA 1NGDA 4H4MA 4Z4HA 1J54A 4EZ9A 5HP1A 4FJHA 4WQ4A 5LL6Z 1BIZA 4CJ4A 1N34K 4DV5K 4FJ7A 5DM7L 2JWKA 1WSFA 3MECA 1HR0K 2ASOA 4FO0A 1ZYQA 4C8OA 4JYAK 4JD2A 2W40A 4CZGA 3SI6A 2KQ2A 1WBBA 4E7JA 3C6HA 4FOEA 2E2PA 5BREA 5AQVA 4ELUA 4H0VB 4E19A 5GAHP 2YX6A 3UB5A 3UIQA 1NKCA 4DU3A 3H6EA 2VG5A 4CIGA 2HBJA 3R1XA 3C0BA 2VG6A 3O6WA 5GAEP 4W5OA 1N8RO 3V1QA 4H5RA 3ZSZA 2G8KA 4HUEA 1HNWK 1EETA 1TK0A 4DR5K 3LZJA 3OYAA 1YITN 5HLFA 3OYDA 1C1AA 3L2WA 1TL3A 3VEXA 1LOTB 3DXMB 1EKEA 1XQSC 2V51B 3VEWA 3L0QA 5DM6L 1J5EK 2GBZA 1X9JA 1I3AA 3HP9A 4BRGA 3THYB 4Y1DA 2P9IB 1RTHA 5JVGL 1RBRA 3PIOL 4CJ3A 1NG9A 1RT1A 2D0AA 5AJ3K 4JI0K 3VMFB 1JLBA 5BR9A 1VSDA 3ENHA 4NCBA 4DR3K 1TV6A 4F3OA 3K0SA 4CFAA 4M45A 3CFPA 2P9PA 4DUYK 3AO3A 1TKDA 2HBKA 4KHSA 1YAGA 1C0TA 3ZSVA 3FLCO 3KLIA 2A5XA 2IGIA 3WNEA 3VTIA 5C15A 1RBVA 4DV4K 3E9LA 1G15A 4LF8K 2P9UA 4X65K 3VQDA 4ISEA 4O4GA 3ZSOA 4K8XA 3VA0A 2UUAK 1NBWA 1YI2N 3VQEA 3AVFA 2Y1IA 4X64K 5C25A 4Z94A 4AHSA 2O4IA 2V7YA 1K9MO 3LWLA 4FVMA 1NK6A 3VQ4A 4DG1A 3KK2A 1T6CA 1HKGA 3EL2A 2D1KA 4CZLA 4QCLA 4CEAA 4CE9A 3WNGA 2YHXA 3I33A 4K25A 5FROA 1JLFA 2RKIA 4CK3A 5FPDA 1Z25A 1HYSA 3KZBA 3H46O 1VSJA 3VQPA 3VERA 3ID8A 2R7YA 3TABA 4DTNA 4IJNA 5AQOA 4FJ9A 3E66A 3UE5A 4RW9A 4I9QA 2FBXA 3GE1A 3L6QA 1NJWA 4H0TB 2WOMA 3LDNA 5JS1A 4CEDA 2J4RA 3B6OA 4DSJA 3EEQA 3ASMA 4CJ7A 2I7PA 3H08A 1DLOA 3AVNA 4B8AB 4M3ZA 2E1YA 1HMVA 1TK5A 2JGUA 5LJVA 3L2RA 2XY8A 1X3MA 3O3HA 4M3RA 4CZKA 3SAFA 1BG3A 1RBSA 2KZMA 3L4QA 2I7NA 3V9XA 3M8QA 3VQ8A 4IOCL 4CIEA 4H0XB 2HF3A 1SKWA 3R8EA 4FJ8A 3DRPA 2F8SA 2H3GX 1VQPN 2E5LK 3EZ5A 3AA2A 3AO2A 1VQ4N 1WSJA 3KWGA 3LDLA 1ZBSA 1VSLA 1HNXK 4YOTA 4V19S 4YOXA 4FPBA 3D7EO 4AHCA 4EFHA 2ZD1A 4IG0A 4FVUA 5M1OA 3V9WA 3LP0A 4BR2A 4M63C 1GLEG 1VQ9N 4CGFA 2W41A 2VWKA 3HTVA 4CCHA 4G9ZA 3S3NA 1N6QA 4DR6K 4DQPA 4KV8A 4CJQA 3O80A 4JI1K 4LF7K 4CEZA 3OA9A 1TYQA 2YV0X 2HHQA 3LP3A 3QBXA 3TTDA 3QESA 2HMPA 3VF4A 4DLEA 3KD5E 3TAPA 1Y97A 3F73A 1NLVA 3PUFA 4DV1K 1LW2A 4M42A 4KRFA 1SS6A 4JS5A 4E0DA 3WXJA 3QIOA 3ZX2A 4ILGB 5C2FA 1T8EA 1OH5A 3VEOA 4PUOA 4YY3K 4B3SK 4N76A 3C95A 2F96A 5BN9A 2XHBA 4Z4CA 3HJFA 2QWNA 2NRXA 1NGAA 1S1TA 1HYVA 3MN5A 4FW2A 1ZBHA 2E2NA 2QI2A 1E4GT 1S9GA 1HNVA 4LD0A 4K43A 1X9SA 4DTRA 1SZ2A 4BACA 3S9HA 3O1WA 4FJKA 4BRPA 1D4XA 2DPNA 4JN4A 3ZEUB 1S9EA 5CYQA 5EU7A 3MCPA 1QS4A 2E4LA 3BGRA 1S72N 4IEIA 4NLBA 4LH4A 3UKUA 3OYEA 1NGFA 4DV3K 3D2EB 4KBOA 2GWKA 4IDKA 3O3GA 4DV2K 5B8HA 5FRMA 4BWMA 1C0UA 1IBLK 1BWFO 1YVNA 4C8MA 4CZEA 3NHGA 1U49A 4ZTJA 1VSEA 1RTDA 1N33K 1BL3A 4JKGB 1XMQK 3P1GA 2E6LA 3HYFA 4XH4A 4BRMA 3KLHA 3AO4A 2FC0A 3AVLA 1YJWN 3TSPA 1JXBA 4DTMA 3VEVA 4K0KK 1FXXA 3F9KA 2VGMA 3MDQA 4FLUA 2B5JA 1IJJA 1JL2A 4CHZA 3VA3A 4JKFA 1LWCA 5GIPA 1QSSA 1P8ZA 3QMLA 5AQUA 1YTAA 4IWVA 3NGIA 4CJEA 1TYQB 3C7NA 4AHRA 3THWA 4KH6A 5KQ8A 3CJCA 3WQTA 4E7HA 3M5RA 1VAZA 4F2RA 4DTPA 1T6DA 5AQGA 2KHOA 5BPLA 3UKRB 1L3TA 4Z4IA 1RILA 2LSNA 5AQQA 3AVIA 4AH9A 3ZSRA 4DHYA 1U45A 2E1ZA 3J80O 3AO5A 4PY5A 4N5SA 4ZTFA 4YHHK 4CJTA 1KCFA 3G10A 2O8BA 5AQPA 1LWFA 4DFKA 3LALA 1Q9YA 4B3RK 3QERA 3VTHA 4M41A 3A5LC 4NO7A 5KI6A 4ILHA 3OTOK 5HOOA 4N41A 2HVHA 2FBYA 3TAMA 3CERA 4JK7A 4IJAA 2RHKA 4JRPA 1HKCA 3HXMA 3P4IA 4GW6A 3VQ9A 3PO5A 1WLJA 4CJKA 2BUPA 3T19A 3OYIA 5M1KA 1X3NA 3WEEA 1OH6A 2P1JA 5DMRA 3MEGA 3ID6A 4JRQA 3QB0A 2YNFA 3AVMA 4B9SA 3LM2A 1KSPA 4NYFA 4CW7B 2WBNA 2IIRA 3SPYA 4BY9C 4FK4A 1X9MA 3IKMA 4CFCA 4BG9A 3U3GA 3PO4A 2HHWA 4FJNA 1JLAA 1MA9B 3THVA 4X62K 3CHWA 3LM9A 2WONA 4A5BA 5BN8A 2NRHA 3KIOA 3J8AA 3O9QA 4CJPA 4DFMA 4CBXA 2NNWA 2F9TA 3OYMA 3SNNA 4H5NA 2FXUA 4XIUA 1E4FT 5J2PA 3M6GA 1YF5L 2IVPA 3ENOA 5KGWA 1RTIA 1EQYA 5CHIA 3F2KA 3O8MA 1NGHA 4FXDA 3ZT4A 3VGKA 4H5VA 3O9SA 5SZTA 1EWRA 2EX3A 1ATNA 2E2OA 3L2QA 3BP8A 4CJUA 2P9NB 5SWMA 4BE0A 4BC2A 4YOWA 4IO9L 1WAJA 2KFZA 2EHGA 2W6KA 3N4PA 4E3SA 2Q3SA 3THXA 4MFBA 3HOSA 1W7AA 3MN7A 3VGMA 4CBUA 4JI7K 5EOYA 3H3NO 4DWIA 1WBDA 1Q18A 4CHNA 3OBWA 1BO5O 2BTFA 4GV3A 1SV5A 1IKWA 5FPMA 3A5OC 2QKKA 4BRLA 3EKUA 4FK2A 3SQ1A 4U7BA 2XO7A 4CBWA 1CLQA 2HSTA 2YNHA 3SBTA 1SL1A 3T7ZA 4HUFA 4F8RA 3CI5A 2P9LB 3CYMA 4MLHA 5F0XA 4FWKA 1ZBUA 4DU4A 1NK7A 3NF8A 2P9KA 4CERA 3QO9A 4DSFA 1K6YA 4FJMA 2RE2A 3E9OA 3V9UA 3CCEN 1VSKA 2O8CA 3U6FA 2OANA 3ZT0A 3FZLA 3MXIA 2CGKA 2UUCK 1T7PA 3L3VA 5HRNA 3AA3A 4ZHRA 1L5UA 4J2EA 4U67L 3DM2A 4H0YB 2BDPA 3D2FA 3EZWA 4DFJA 1QQOA 3CCRN 4JEPA 1R59O 3Q7CA 4BC3A 1K8AO 2VYPA 5AQXA 2D0CA 1C1CA 3BUZB 1JXEA 3LDQA 4F4KA 4PL7A 2KFNA 4LY7A 1TKZA 1VQKN 3OJUA 4LF4K 2X6NA 1SL0A 4BVOA 1OKJA 4GY2B 2ZGZA 5AZJA 1RFQA 4FJGA 1T44A 1DT9A 2QWOA 4KTWA 1NMDA 2D5RA 4BGAA 1W9HA 4R5PA 1YUWA 5CE3A 4JV5K 2GEMA 4QS8A 3SMPA 2HB5A 4H0PA 3CJ7A 3HPGA 1S1WA 3DXKB 5AFUA 1B92A 3VQQA 3BF1A 1OH8A 3NVKA 2FBVA 4BR0A 3AVGA 3ZSQA 1EX4A 4E7LA 1GLDG 2ZJRL 1C6VA 5JVHL 3RSEA 4FLYA 3I0SA 3CF5L 1NGBA 5BPMA 4JNEA 5IWAK 4F9OA 4KTZA 3CM6A 3LP1A 2E88A 4GKKK 4O8KA 4A62A 1RBUA 3G71N 1VQLN 2HNZA 3CJ9A 2P9KB 1RBTA 3S3MA 4B1VA 3HVTA 2NRRA 3ZSYA 5E41A 4CD3A 1TUYA 2G8UA 1XC3A 4IDHA 4CEOA 2HVIA 4KB0A 2X6SA 4DUZK 2AP1A 3ZT3A 3D2FB 4B1UB 2OPQA 1TL1A 3KLFA 4ILJA 3WXMB 4ELVA 1LAVA 4BQLA 4OLAA 4C8LA 5ELZA 4OJRA 3JSMA 1NKBA 3HRGA 4Z4FA 3SQ4A 1RT5A 1VSHA 2OZMA 3MN9A 2DFEA 4H5TA 3R3LA 3BDPA 1U47A 2BGGA 2WC9A 1A5XA 3J7YP 5FPNA 4FZZA 1IV0A 5E26A 4JHDB 2GUPA 1IG8A 5AZJB 4GVEA 3WNHA 3RMBA 4LFCK 3RMDA 3MAQA 4KREA 3CG7A 4CK1A 5BRHA 2UUBK 4JK9A 1QSLA 1M1KO 3QEWA 5GAGP 2RN2A 3QFUA 4XH5A 3OY9A 3OYNA 4KHWA 2UXBK 4H0OA 3AA5X 4CZJA 4M3XA 4NCAA 3OS2A 2GWJA 5AFUH 1EO1A 1NGEA 4JD2B 3BZCA 1ASWA 1LWEA 3FR0A 3OYLA 5KGXA 4H4OA 4C8NA 4BE1A 1BDGA 2YJEA 1NJZA 2Y1JA 1YT3A 4FJXA 5AQJA 3L4IA 3TU5A 1LAWA 4LF9K 2X74A 5A2QO 3OS1A 1TK8A 4MO5A 2ZE2A 4FWOA 3ISNC 4FJ5A 1IH7A 4GV6A 1QQMA 3VF6A 4JI3K 3AV9A 3I56N 3QEPA 3K5LA 5F1XA 4FJLA 1JCGA 3QFPA 3QIPA 1W0HA 3C6TA 1JLEA 3DAWA 1SL2A 2GTDA 1KVCA 3AVBA 5AQHA 2ZF5O 3O4WA 3VQ5A 5T7BA 4CHYA 3ULEA 5IT9O 1XNRK 5BRDA 1RT3A 1FKOA 4YOUA 4QAGA 2VQFK 4DR7K 4CGDA 5ADXA 3SMSA 2ZQBA 1DGKN 1BCMA 3NH2A 4A61A 4O55A 2VGNA 4BR7A 4M7XA 3WXKA 2DFFA 4Q5VA 5HRSA 3BEXA 1T3VA 3SJHA 2QEXN 3QEIA 3H3OB 4FK0A 3TSQA 1SKSA 1HQUA 4J2AA 1D9DA 3O9RA 3TAQA 3CMEN 3CCLN 3GDQA 2HNYA 4Y0WA 3DOLA 2HHTA 2P9PB 1WSIA 2FLOA 3K59A 4WE1A 4RCHA 3CCUN 2O8FA 3VEZA 2GX9A 5F2RA 4G1QA 5JLFA 4FLXA 3NE6A 2YKNA 2P9UB 2V7ZA 3VQAA 5AZIA 1UOCA 5MLCQ 1QSYA 4OPHA 1CZBA 1NJIO 2E8AA 1ASVA 1CZ9A 3TARA 3VF2A 3L8BA 3A5NC 2FSJA 3SJJA 1B9FA 1J5OA 4OKJA 4E1MA 2QWQA 4FL9A 4JKBA 1F21A 4FWMA 4LH5A 4RW7A 5GADP 4NLCA 2NLXA 4NYNA 2G8VA 1TKTA 4PA1A 4GV9A 5LJWA 1WN7A 4CF1A 3JYTA 1NNEA 2QA4N 4DF8A 1WB9A 4IO8A 4DF4A 1BISA 3IDHA 2QK9A 2ITGA 1EP4A 4BDYA 2KZZA 1RT4A 5H1SQ 1XHZA 2YI1A 3CM5A 1KVBA 4DKWA 1NK5A 5ADXH 3CQ8A 1I39A 1ATRA 5EX5A 3SLCA 1HPZA 2HNDA 3TAEA 5AQLA 2Q2RA 4BR5A 4A5AA 2Z1GA 2P9SA 3MEDA 1RDBA 5AQYA 5AQTA 4KFBA 1JL1A 1VQON 4DQRA 4AHVA 1XNQK 4I9LA 4PKGA 1C0FA 4DQQA 4WQ5A 4ID1A 3QICA 1KFDA 4BRNA 3DLHA 3O08A 4AM6A 4OKKA 3CJAA 1BHLA 3KLEA 3K58A 1JCFA 1BGXT 3VQCA 3P39A 4IXCA 2A3ZA 4Y1CA 4HUGA 3R6MA 3DI6A 4HTUA 4YFUA 3ZT2A 4J8FA 4CZIA 3CC2N 4LF6K 2OA8A 2O8FB 2VCPA 3B8AX 3AVJA 3WUHA 3TR8A 4FWPA 3AAPA 4M3WA 3FE1A 1VHXA 5AZIB 2IC3A 3KHYA 1L3UA 3SUQA 4B9MA 5FPEA 3KKRA 3RMAA 3NF7A 3G25A 3OW2M 3FZMA 3OBYA 2IDOA 3RRGA 3TAFA 4RW6A 1ZBFA 4JS4A 1KFSA 3NMUA 4HCCA 3LL3A 2G8HA 4KHQA 4BGBA 4CEQA 3PY8A 4QS9A 4B3MK 2G8FA 3JAMO 4CHOA 3PX0A 1QVFM 1NM1A 4WFNL 4I6MA 4HTLA 1C0GA 3GG4A 4B9VA 4DR4K 2BE2A 4KHPK 1RDDA 5I42A 4BRFA 1VSMA 3CCSN 1Q82O 1YTUA 4CEEA 1NGJA 2RPIA 3A5MC 4FM2A 3MXMA 3HK2A 3IG1A 1EXQA 3ALYA 1U2VA 3KK7A 4O44A 1FW6A 5AQMA 3CC7N 1ASUA 2P9SB 4W5RA 4DLGA 3F9MA 2HHHK 1OVYA 1JKHA 1HJOA 3J81O 2NZTA 2GV9A 2D4WA 4F3TA 3VQ6A 3CQXA 2VG7A 2GELA 2E6MA 4DMNA 1U4BA 4LFBK 4O0JA 3WT0A 1RT6A 4OGEA 3OYBA 4AQYK 1NGGA 3AGRA 3I55N 3DOKA 4YORA 4BDZA 1V4TA 1GLFO 3UKUB 5C42A 4B9TA 3IMXA 4HCBA 4EHTA 4RTFD 2NRVA 4XEIA 1VQMN 1FK9A 1QHTA 3P83D 1BOTO 4CJ5A 3AO1A 4C1NK 4FCYA 4OKEA 4TSXA 5LMUK 2ZWHA 1NJXA 2DY4A 5BPNA 2HBLA 4N56A 1HNZK 2GUIA 3N4QA 3C65A 4CF9A 3D45A 2CH5A 4CIFA 2QWPA 2NRZA 1IBMK 4JKAA 3KKSA 1T05A 3M8PA 5BRFA 1VQ7N 1NOZA 2Q1NA 2IAJA 1IKYA 2YNGA 3QDKA 3KTQA 3W0LA 4BR4A 1QTMA 4GKJK 4I6MB 2DFHA 3LAKA 2UU9K 2HMIA 3M8SA 3C7NB 4UQGA 3THWB 3IS9A 2FF6A 2E20A 4YOVA 4HWIA 2D0PA 1UA1A 3DRRA 3NCIA 1N32K 3O9UA 2Q36A 4K41A 5M1PA 3LDSA 3IAYA 2VQEK 3M3ZA 1CZAN 4DV7K 4JLHA 3O9TA 2O8BB 1XUPO 3C6UA 3FFIA 4RW8A 2F4VK 5D3GA 4JI8K 1YIJN 1ITGA 2WUSA 1W2BM 4BRDA 4H5WA 4LC9B 4CF8A 3WXIA 1BU6O 3CPEA 4KI4A 3SAHA 3O5BA 2IOCA 3NF6A 1N5YA 2DTUA 4CJLA 3CFRA 3AARA 4BE2A 2YCHA 4IOXA 5J1EA 4M7YA 3FGUA 4I7FA 4CGGA 3OYGA 3OJSA 4OX9K 4E1JA 3DLGA 1NOYA 3J7ZO 4JI6K 2G8IA 4EAHD 4NCGA 1Z6RA 1HRHA 1WOQA 3C6AA 3WEEB 4PWDA
chains in the Genus database with same CATH topology
4OJRA 3JSMA 1TAQA 1R0AA 1NKBA 2F8SA 4Z4FA 3QEXA 4HHTA 3SQ4A 5C24A 1RT5A 1VSHA 1UA0A 2OZMA 3EZ5A 2DFEA 2HHXA 3AA2A 3AO2A 3DRSA 3SV3A 1WSJA 3ZSXA 4IKFA 3HT3A 3VQ7A 4I2QA 5FDLA 3KJVA 4IFVA 1VSLA 1U47A 3BDPA 2BGGA 4CGJA 1A5XA 4FZZA 4AHCA 4KHUA 1HYZA 3KLGA 3HO1A 3TWHA 2ZD1A 4IG0A 1RNHA 3WNHA 3RMBA 4E7IA 3MAQA 3RMDA 3V9WA 3LP0A 1ZBLA 2PYJA 4KREA 3CG7A 2KTQA 4W5NA 2DTUA 1RT7A 4CK1A 4CGFA 5CY4A 1X1PA 1UWBA 1QSLA 3L3UA 2KW4A 2VWKA 3QEWA 4M3TA 2RN2A 3SQ0A 3D0PA 2PZSA 3EYZA 4CCHA 4CGIA 3S3NA 3OY9A 3OYNA 1N6QA 4CJWA 1Z26A 4KHWA 4EP5A 4DQPA 4KV8A 4CJQA 1U48A 4KTQA 3AA5X 4CEZA 3U3YA 3EY1A 4M3XA 2QXFA 4NCAA 3MEEA 2YV0X 3OS2A 2HHQA 1WNSA 3LP3A 3HP6A 1KRPA 4FZXC 3QESA 4F2SA 5KRTA 4CJSA 1TAUA 1CXUA 3V81A 5DK5A 1O1WA 4DLEA 2YKMA 1VK0A 1ASWA 3OYCA 1LWEA 3TAPA 3KD5E 1Y97A 3K5OA 3PUFA 3ZSWA 3F73A 1LW2A 1KLNA 3OYLA 1NK9A 4M42A 4KRFA 4EP4A 5KGXA 4H4OA 4C8NA 5K14A 3K57A 4JS5A 4DSKA 4CGHA 3PX6A 4BE1A 2RF2A 4CJRA 1NJZA 2Y1JA 1YT3A 4E0DA 4FJXA 1J9AA 3QIOA 4DTXA 1T8EA 1D5AA 2P51A 1RTJA 3KK3A 3CFOA 1LAWA 3HSTB 4PUOA 3NFAA 2X74A 3B6PA 4CK2A 4DSIA 2PY5A 4LSNA 3C95A 4J2BA 2B4JA 4N76A 2F96A 3OS1A 4CFBA 1TK8A 2ZE2A 2XHBA 3O4NA 1TVRA 3ISNC 4Z4CA 4C8KA 1IH7A 4FJ5A 3HJFA 3E01A 2P5OA 1S1TA 1HYVA 1MU2A 3AV9A 4FW2A 1ZBHA 4OPKA 3QEPA 1S9GA 1HNVA 4RG8A 3K5LA 4LD0A 1X9SA 2OPPA 1GOCA 1VRTA 4BACA 3DLEA 4DTRA 3S9HA 4FJLA 3QEVA 3QIPA 1IG9A 1GOAA 1D9FA 4FJKA 3AVAA 3NH1A 3RTVA 1W0HA 3V1OA 3C6TA 3WNFA 1S9EA 2Z1HA 5CYQA 1JLEA 5EU7A 1SL2A 4Z4GA 1KVCA 1QS4A 3AVBA 2E4LA 3BGRA 3VQ5A 5T7BA 1TKXA 4HVJA 4CHYA 1XI1A 4KAZA 4LH4A 4DS5A 3OYEA 4FLZA 1RT3A 1FKOA 1WSGA 4QAGA 4IDKA 4CGDA 3O3GA 5J2MA 5FRMA 4BWMA 2ZQBA 1C0UA 1BCMA 3NH2A 2OPRA 4C8MA 1U49A 4O55A 1CXQA 3K2PA 5JS2A 3NHGA 2YHBA 2VWJA 1VSEA 4ZTJA 1RTDA 1BL3A 3SZ2A 2DFFA 4Q5VA 5HRSA 3P1GA 2E6LA 1NKEA 3HYFA 2JLEA 3LAMA 3QEIA 4FK0A 3K5NA 4YNQA 3KLHA 3HPOA 3AO4A 1BQMA 3KD1E 1RDCA 3VQBA 2FC0A 2HHSA 3L2UA 3AVLA 1SKSA 1HQUA 3V1RA 4J2AA 1JXBA 1D9DA 3TAQA 1DTTA 4BDPA 4Z4EA 3HK2A 4DTMA 4KHYA 3MXJA 4LSLA 1FXXA 3F9KA 2PYLA 4FJJA 4QOZB 2HNYA 3DLRA 1WSEA 4FLVA 4FLUA 2B5JA 3G0ZA 2XRIA 1JL2A 3DOLA 4CHZA 3T1AA 3VA3A 1UAXA 4DTOA 1LW0A 1HNIA 1WSIA 3K59A 5I3UA 1LWCA 1QSSA 4WE1A 4B8CA 4CJVA 4DQIA 1B9DA 1YTAA 4CECA 3NGIA 4CJEA 3I0RA 4G1QA 4I2PA 4AHRA 1X9WA 1S6QA 4FZYA 5HRRA 4FLXA 3LP2A 3NE6A 4E7HA 2YKNA 3NGZA 4DSLA 3RMCA 3VQAA 4F2RA 1NK8A 4DTPA 1UOCA 4CHPA 5J2QA 1QSYA 2HW3A 1CZBA 1BCOA 5CZ1A 1L3TA 4Z4IA 4IG3A 1RILA 2LSNA 3AVIA 1ASVA 4AH9A 1HQEA 3ZSRA 1U45A 3O4QA 1CZ9A 4CFDA 1KTQA 1XHXA 3AO5A 3OYKA 3NH0A 4FM1A 3TARA 3L8BA 4PY5A 4N5SA 5CZ2A 4ZTFA 3SJJA 1J5OA 1B9FA 4CJTA 4OKJA 4E1MA 4AHTA 1KCFA 1WSHA 3G10A 3DMJA 1BQNA 4E7KA 1LWFA 5HRPA 3NGYA 3L2VA 4ICLA 1F21A 3LALA 4LH5A 4CEFA 4DFKA 4RW7A 4NYNA 2G8VA 1Q9YA 3QERA 1TKTA 3LZIA 4M41A 4PA1A 5KI6A 1WN7A 4CF1A 3JYTA 4B9LA 4FW1A 4DF8A 4Z0UA 3OYHA 4DF4A 1BISA 2QK9A 1TGOA 3HL8A 1J53A 2ITGA 3LWMA 1D8YA 3AVKA 3LPTA 1EP4A 3OYFA 4BDYA 1LV5A 2AJQA 1XWLA 3SUNA 2KZZA 3HPHA 1RT4A 4N41A 3V9ZA 1XHZA 2HVHA 3CM5A 2FBYA 3RRHA 4AILC 1U04A 3TAMA 4CF2A 1KVBA 4W5TA 4BWJA 1NK5A 1SKRA 3DYAA 4W5QA 1C1BA 1IO2A 1IKVA 4JRPA 2ETJA 3C94A 3HXMA 4L8RB 4GW6A 3QNNA 3VQ9A 3P5JA 4ID5A 3CQ8A 1I39A 4KKOA 1WLJA 4CJKA 3PO5A 3SQ2A 3SYZA 1DTQA 3T19A 4CF0A 4CESA 1HPZA 2HNDA 3OYIA 2XY7A 3ULDA 3TAEA 3DLBA 3HVRA 4MQ3A 2P1JA 4IBNA 1SUQA 2Z1GA 3MEDA 5DMRA 5KRSA 1RDBA 3AVHA 3MEGA 4JRQA 3RWUA 4KFBA 3AA4A 1JL1A 4DQRA 4AHVA 2G8WA 4I9LA 2HHVA 1JLGA 2YHAA 2YNFA 2FBTA 3AVMA 4B9SA 4DQQA 1KSPA 4NYFA 4DTSA 4M3UA 4ID1A 4FYDA 1KFDA 3PX4A 3SPYA 3DLHA 3TI0A 4FK4A 1X9MA 4CFCA 3S3OA 4OKKA 3U3GA 1S1UA 1BHLA 3PO4A 2HHWA 3QNOA 2Z1IA 2W42A 3KLEA 3K58A 4FJNA 1BGXT 1JLAA 2ATQA 3VQCA 4DTJA 1L3VA 4Y1CA 4HUGA 3THVA 3AVCA 3QINA 1QE1A 2OYQA 1IKXA 3DI6A 4HTUA 3NBPA 3IRXA 3ZT2A 2WONA 4YFUA 4FLTA 2OA8A 4H4MA 3KIOA 4Z4HA 1J54A 4EZ9A 2BANA 3AVJA 4CJPA 4DFMA 5HP1A 3TR8A 4FJHA 3OYMA 4DS4A 1BIZA 1BI4A 4OVLA 3SNNA 1XC9A 3A2FA 4XIUA 4M3WA 5J2PA 4CJ4A 1KLMA 4FJ7A 2IC3A 3HM9A 5KGWA 1L3UA 3SUQA 4B9MA 1RTIA 3KKRA 1WSFA 4AHUA 3RMAA 4H8KA 3MECA 2OPSA 4FXDA 3NF7A 4IFYA 2I5JA 1A5VA 3ZT4A 1T03A 1QQCA 3LPUA 1ZYQA 3V4IA 2OZSA 4KB1A 4C8OA 2IDOA 3RRGA 1S5JA 1NK0A 3TAFA 4RW6A 3PV8A 2HHTA 1ZBFA 5SZTA 4JS4A 3SI6A 2EX3A 2KQ2A 4E7JA 3L2QA 1KFSA 4HCCA 2G8HA 4KHQA 4CJUA 4CEQA 4ELUA 3PY8A 5SWMA 4BE0A 4E19A 4EZ6A 1GOBA 2G8FA 4CHOA 3PX0A 3OS0A 3UIQA 1NKCA 4DU3A 2VG5A 1WAJA 4CIGA 2EHGA 4E1NA 2KFZA 4B9VA 4E3SA 2Q3SA 4FJIA 2BE2A 1YVUA 2VG6A 1RDDA 4W5OA 5I42A 1VSMA 4MFBA 5FRNA 1YTUA 4CEEA 2RPIA 3V1QA 4FM2A 2Z1JA 3ZSZA 3NAEA 4FLWA 4DU1A 3MXMA 2G8KA 4DWIA 2A1RA 4HUEA 4KPYA 4CHNA 3IG1A 3O3FA 1EETA 4KI6A 1EXQA 3ALYA 1TK0A 4O44A 3OVNA 4RW4A 1SV5A 3ZCMA 3LZJA 3OYAA 1IKWA 4PQUA 2QKKA 5HLFA 1ASUA 4W5RA 4DLGA 3OYDA 4FK2A 3SQ1A 1FKPA 1BIUA 4O5BA 1S6PA 1C1AA 2XO7A 3L2WA 1JKHA 3TAGA 1TL3A 2NUBA 1NJYA 1CLQA 2YNHA 1EKEA 3V9SA 2GV9A 1SL1A 2GBZA 4HUFA 1I3AA 3HP9A 3I8DA 4F8RA 4F3TA 4B3OA 3VQ6A 4Y1DA 3CYMA 3DLKA 4O0IA 1Q8IA 1RTHA 1RBRA 4Q0BA 2VG7A 1ZBUA 4CJ3A 2E6MA 4DU4A 1NK7A 4DMNA 4OLBA 1RT1A 1U4BA 2D0AA 2O4GA 3NF8A 3OYJA 3QETA 4O0JA 4CERA 3QO9A 4DSFA 1RT6A 1K6YA 1JLBA 4OGEA 3OYBA 4FJMA 3V9UA 1VSKA 3DOKA 3U6FA 4BDZA 3ZT0A 3MXIA 5C42A 1VSDA 4B9TA 4HCBA 4N47A 3L3VA 1T7PA 4NCBA 5HRNA 2YNIA 1BI4B 1FK9A 1TV6A 3AA3A 1QHTA 4ZHRA 1L5UA 1VSFA 3P83D 4CFAA 4F3OA 4M45A 4J2EA 1S1VA 3DM2A 4B9NA 2XY5A 2BDPA 4CJ5A 3AO1A 3CFPA 5J2NA 4DFJA 1WAFA 3AO3A 1TKDA 4KHSA 1C0TA 3ZSVA 3KLIA 4FCYA 4OKEA 4TSXA 2IGIA 3WNEA 1NJXA 1RBVA 3SPZA 2DY4A 4ELTA 2D0CA 1G15A 1C1CA 4N56A 3M8RA 3T3FA 1JLCA 1JXEA 1ZBIA 2GUIA 3VQDA 5HROA 4F4KA 2KFNA 4LY7A 1TKZA 4O4GA 3ZSOA 4K8XA 4CF9A 3VA0A 3D45A 4DQSA 2P5GA 1S1XA 3VQEA 4CIFA 3OJUA 1KVAA 3AVFA 2X6NA 2Y1IA 1SL0A 5C25A 3KKSA 4GMJB 3M8PA 2D0BA 4AHSA 1NK4A 1NOZA 1T05A 2O4IA 2IAJA 1IKYA 2YNGA 4FJGA 3LWLA 4CEBA 3KTQA 4FVMA 2B6AA 1NK6A 1QTMA 3VQ4A 4DG1A 3ITHA 4KTWA 3KK2A 3SV4A 2D5RA 3SUPA 2DFHA 3LAKA 1W9HA 3M8SA 4UQGA 2HMIA 3IS9A 3KK1A 1A5WA 4R5PA 3NDKA 4QCLA 4CEAA 4CE9A 3WNGA 4E89A 3TANA 1UA1A 1HJRA 3DRRA 2HB5A 1JLFA 1RT2A 2RKIA 5HBMA 5FROA 1Z25A 3HPGA 4CK3A 3NCIA 3SUOA 1HYSA 4OGCA 1S1WA 3LDSA 4DFPA 1B92A 3VQQA 3IAYA 2A1SA 4GVMA 1VSJA 3VQPA 2FBVA 4CHQA 3AVGA 3ZSQA 4B08A 2R7YA 1REVA 4OPJA 4JLHA 4DTUA 1EX4A 3C6UA 3FFIA 4RW8A 4E7LA 3TABA 5D3GA 4DTNA 1JLQA 5KTQA 1C6VA 3LANA 1L3SA 4FJ9A 4FLYA 3I0SA 4RW9A 4CJFA 1ITGA 2FBXA 4I9QA 4KTZA 3CM6A 1VSIA 3LP1A 1NJWA 2WOMA 4CF8A 1VRUA 2X78A 4KO0A 5JS1A 4B9UA 3NF9A 4KI4A 1RBUA 4CEDA 3B6OA 4KHNA 2IOCA 3NF6A 4DSJA 2XY6A 1N5YA 2HNZA 2IS3A 3ASMA 4CJLA 3VN5A 3CFRA 3V6DA 1RBTA 3S3MA 3RR8A 5CYMA 4BE2A 3H08A 1DLOA 3AVNA 4B8AB 3RR7A 2QKBA 4M3ZA 3HVTA 4K8ZA 1RDAA 3ZSYA 1HMVA 3K5MA 5J1EA 5E41A 1TK5A 1C0MA 2JGUA 2F8TA 3L2RA 2XY8A 2HHUA 3O3HA 4I7FA 4M3RA 4CGGA 3OYGA 3OJSA 2G8UA 4DSEA 4CEOA 1RBSA 3QLHA 4M3YA 2HVIA 4KB0A 2KZMA 3DLGA 2X6SA 3ZT3A 3ZT1A 3V9XA 1NOYA 3M8QA 2G8IA 4NCGA 2OPQA 1TL1A 1RCHA 1HRHA 3VQ8A 3KLFA 4CIEA 1Q9XA 4ELVA 1LAVA 4FM0A 1SKWA 4J2DA 3SCXA 4PWDA 4OLAA 4C8LA 4FJ8A 3DRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OJR A;  3JSM A;  1TAQ A;  1R0A A;  1NKB A;  2F8S A;  4Z4F A;  3QEX A;  4HHT A;  3SQ4 A;  5C24 A;  1RT5 A;  1VSH A;  1UA0 A;  2OZM A;  3EZ5 A;  2DFE A;  2HHX A;  3AA2 A;  3AO2 A;  3DRS A;  3SV3 A;  1WSJ A;  3ZSX A;  4IKF A;  3HT3 A;  3VQ7 A;  4I2Q A;  5FDL A;  3KJV A;  4IFV A;  1VSL A;  1U47 A;  3BDP A;  2BGG A;  4CGJ A;  1A5X A;  4FZZ A;  4AHC A;  4KHU A;  1HYZ A;  3KLG A;  3HO1 A;  3TWH A;  2ZD1 A;  4IG0 A;  1RNH A;  3WNH A;  3RMB A;  4E7I A;  3MAQ A;  3RMD A;  3V9W A;  3LP0 A;  1ZBL A;  2PYJ A;  4KRE A;  3CG7 A;  2KTQ A;  4W5N A;  2DTU A;  1RT7 A;  4CK1 A;  4CGF A;  5CY4 A;  1X1P A;  1UWB A;  1QSL A;  3L3U A;  2KW4 A;  2VWK A;  3QEW A;  4M3T A;  2RN2 A;  3SQ0 A;  3D0P A;  2PZS A;  3EYZ A;  4CCH A;  4CGI A;  3S3N A;  3OY9 A;  3OYN A;  1N6Q A;  4CJW A;  1Z26 A;  4KHW A;  4EP5 A;  4DQP A;  4KV8 A;  4CJQ A;  1U48 A;  4KTQ A;  3AA5 X;  4CEZ A;  3U3Y A;  3EY1 A;  4M3X A;  2QXF A;  4NCA A;  3MEE A;  2YV0 X;  3OS2 A;  2HHQ A;  1WNS A;  3LP3 A;  3HP6 A;  1KRP A;  4FZX C;  3QES A;  4F2S A;  5KRT A;  4CJS A;  1TAU A;  1CXU A;  3V81 A;  5DK5 A;  1O1W A;  4DLE A;  2YKM A;  1VK0 A;  1ASW A;  3OYC A;  1LWE A;  3TAP A;  3KD5 E;  1Y97 A;  3K5O A;  3PUF A;  3ZSW A;  3F73 A;  1LW2 A;  1KLN A;  3OYL A;  1NK9 A;  4M42 A;  4KRF A;  4EP4 A;  5KGX A;  4H4O A;  4C8N A;  5K14 A;  3K57 A;  4JS5 A;  4DSK A;  4CGH A;  3PX6 A;  4BE1 A;  2RF2 A;  4CJR A;  1NJZ A;  2Y1J A;  1YT3 A;  4E0D A;  4FJX A;  1J9A A;  3QIO A;  4DTX A;  1T8E A;  1D5A A;  2P51 A;  1RTJ A;  3KK3 A;  3CFO A;  1LAW A;  3HST B;  4PUO A;  3NFA A;  2X74 A;  3B6P A;  4CK2 A;  4DSI A;  2PY5 A;  4LSN A;  3C95 A;  4J2B A;  2B4J A;  4N76 A;  2F96 A;  3OS1 A;  4CFB A;  1TK8 A;  2ZE2 A;  2XHB A;  3O4N A;  1TVR A;  3ISN C;  4Z4C A;  4C8K A;  1IH7 A;  4FJ5 A;  3HJF A;  3E01 A;  2P5O A;  1S1T A;  1HYV A;  1MU2 A;  3AV9 A;  4FW2 A;  1ZBH A;  4OPK A;  3QEP A;  1S9G A;  1HNV A;  4RG8 A;  3K5L A;  4LD0 A;  1X9S A;  2OPP A;  1GOC A;  1VRT A;  4BAC A;  3DLE A;  4DTR A;  3S9H A;  4FJL A;  3QEV A;  3QIP A;  1IG9 A;  1GOA A;  1D9F A;  4FJK A;  3AVA A;  3NH1 A;  3RTV A;  1W0H A;  3V1O A;  3C6T A;  3WNF A;  1S9E A;  2Z1H A;  5CYQ A;  1JLE A;  5EU7 A;  1SL2 A;  4Z4G A;  1KVC A;  1QS4 A;  3AVB A;  2E4L A;  3BGR A;  3VQ5 A;  5T7B A;  1TKX A;  4HVJ A;  4CHY A;  1XI1 A;  4KAZ A;  4LH4 A;  4DS5 A;  3OYE A;  4FLZ A;  1RT3 A;  1FKO A;  1WSG A;  4QAG A;  4IDK A;  4CGD A;  3O3G A;  5J2M A;  5FRM A;  4BWM A;  2ZQB A;  1C0U A;  1BCM A;  3NH2 A;  2OPR A;  4C8M A;  1U49 A;  4O55 A;  1CXQ A;  3K2P A;  5JS2 A;  3NHG A;  2YHB A;  2VWJ A;  1VSE A;  4ZTJ A;  1RTD A;  1BL3 A;  3SZ2 A;  2DFF A;  4Q5V A;  5HRS A;  3P1G A;  2E6L A;  1NKE A;  3HYF A;  2JLE A;  3LAM A;  3QEI A;  4FK0 A;  3K5N A;  4YNQ A;  3KLH A;  3HPO A;  3AO4 A;  1BQM A;  3KD1 E;  1RDC A;  3VQB A;  2FC0 A;  2HHS A;  3L2U A;  3AVL A;  1SKS A;  1HQU A;  3V1R A;  4J2A A;  1JXB A;  1D9D A;  3TAQ A;  1DTT A;  4BDP A;  4Z4E A;  3HK2 A;  4DTM A;  4KHY A;  3MXJ A;  4LSL A;  1FXX A;  3F9K A;  2PYL A;  4FJJ A;  4QOZ B;  2HNY A;  3DLR A;  1WSE A;  4FLV A;  4FLU A;  2B5J A;  3G0Z A;  2XRI A;  1JL2 A;  3DOL A;  4CHZ A;  3T1A A;  3VA3 A;  1UAX A;  4DTO A;  1LW0 A;  1HNI A;  1WSI A;  3K59 A;  5I3U A;  1LWC A;  1QSS A;  4WE1 A;  4B8C A;  4CJV A;  4DQI A;  1B9D A;  1YTA A;  4CEC A;  3NGI A;  4CJE A;  3I0R A;  4G1Q A;  4I2P A;  4AHR A;  1X9W A;  1S6Q A;  4FZY A;  5HRR A;  4FLX A;  3LP2 A;  3NE6 A;  4E7H A;  2YKN A;  3NGZ A;  4DSL A;  3RMC A;  3VQA A;  4F2R A;  1NK8 A;  4DTP A;  1UOC A;  4CHP A;  5J2Q A;  1QSY A;  2HW3 A;  1CZB A;  1BCO A;  5CZ1 A;  1L3T A;  4Z4I A;  4IG3 A;  1RIL A;  2LSN A;  3AVI A;  1ASV A;  4AH9 A;  1HQE A;  3ZSR A;  1U45 A;  3O4Q A;  1CZ9 A;  4CFD A;  1KTQ A;  1XHX A;  3AO5 A;  3OYK A;  3NH0 A;  4FM1 A;  3TAR A;  3L8B A;  4PY5 A;  4N5S A;  5CZ2 A;  4ZTF A;  3SJJ A;  1J5O A;  1B9F A;  4CJT A;  4OKJ A;  4E1M A;  4AHT A;  1KCF A;  1WSH A;  3G10 A;  3DMJ A;  1BQN A;  4E7K A;  1LWF A;  5HRP A;  3NGY A;  3L2V A;  4ICL A;  1F21 A;  3LAL A;  4LH5 A;  4CEF A;  4DFK A;  4RW7 A;  4NYN A;  2G8V A;  1Q9Y A;  3QER A;  1TKT A;  3LZI A;  4M41 A;  4PA1 A;  5KI6 A;  1WN7 A;  4CF1 A;  3JYT A;  4B9L A;  4FW1 A;  4DF8 A;  4Z0U A;  3OYH A;  4DF4 A;  1BIS A;  2QK9 A;  1TGO A;  3HL8 A;  1J53 A;  2ITG A;  3LWM A;  1D8Y A;  3AVK A;  3LPT A;  1EP4 A;  3OYF A;  4BDY A;  1LV5 A;  2AJQ A;  1XWL A;  3SUN A;  2KZZ A;  3HPH A;  1RT4 A;  4N41 A;  3V9Z A;  1XHZ A;  2HVH A;  3CM5 A;  2FBY A;  3RRH A;  4AIL C;  1U04 A;  3TAM A;  4CF2 A;  1KVB A;  4W5T A;  4BWJ A;  1NK5 A;  1SKR A;  3DYA A;  4W5Q A;  1C1B A;  1IO2 A;  1IKV A;  4JRP A;  2ETJ A;  3C94 A;  3HXM A;  4L8R B;  4GW6 A;  3QNN A;  3VQ9 A;  3P5J A;  4ID5 A;  3CQ8 A;  1I39 A;  4KKO A;  1WLJ A;  4CJK A;  3PO5 A;  3SQ2 A;  3SYZ A;  1DTQ A;  3T19 A;  4CF0 A;  4CES A;  1HPZ A;  2HND A;  3OYI A;  2XY7 A;  3ULD A;  3TAE A;  3DLB A;  3HVR A;  4MQ3 A;  2P1J A;  4IBN A;  1SUQ A;  2Z1G A;  3MED A;  5DMR A;  5KRS A;  1RDB A;  3AVH A;  3MEG A;  4JRQ A;  3RWU A;  4KFB A;  3AA4 A;  1JL1 A;  4DQR A;  4AHV A;  2G8W A;  4I9L A;  2HHV A;  1JLG A;  2YHA A;  2YNF A;  2FBT A;  3AVM A;  4B9S A;  4DQQ A;  1KSP A;  4NYF A;  4DTS A;  4M3U A;  4ID1 A;  4FYD A;  1KFD A;  3PX4 A;  3SPY A;  3DLH A;  3TI0 A;  4FK4 A;  1X9M A;  4CFC A;  3S3O A;  4OKK A;  3U3G A;  1S1U A;  1BHL A;  3PO4 A;  2HHW A;  3QNO A;  2Z1I A;  2W42 A;  3KLE A;  3K58 A;  4FJN A;  1BGX T;  1JLA A;  2ATQ A;  3VQC A;  4DTJ A;  1L3V A;  4Y1C A;  4HUG A;  3THV A;  3AVC A;  3QIN A;  1QE1 A;  2OYQ A;  1IKX A;  3DI6 A;  4HTU A;  3NBP A;  3IRX A;  3ZT2 A;  2WON A;  4YFU A;  4FLT A;  2OA8 A;  4H4M A;  3KIO A;  4Z4H A;  1J54 A;  4EZ9 A;  2BAN A;  3AVJ A;  4CJP A;  4DFM A;  5HP1 A;  3TR8 A;  4FJH A;  3OYM A;  4DS4 A;  1BIZ A;  1BI4 A;  4OVL A;  3SNN A;  1XC9 A;  3A2F A;  4XIU A;  4M3W A;  5J2P A;  4CJ4 A;  1KLM A;  4FJ7 A;  2IC3 A;  3HM9 A;  5KGW A;  1L3U A;  3SUQ A;  4B9M A;  1RTI A;  3KKR A;  1WSF A;  4AHU A;  3RMA A;  4H8K A;  3MEC A;  2OPS A;  4FXD A;  3NF7 A;  4IFY A;  2I5J A;  1A5V A;  3ZT4 A;  1T03 A;  1QQC A;  3LPU A;  1ZYQ A;  3V4I A;  2OZS A;  4KB1 A;  4C8O A;  2IDO A;  3RRG A;  1S5J A;  1NK0 A;  3TAF A;  4RW6 A;  3PV8 A;  2HHT A;  1ZBF A;  5SZT A;  4JS4 A;  3SI6 A;  2EX3 A;  2KQ2 A;  4E7J A;  3L2Q A;  1KFS A;  4HCC A;  2G8H A;  4KHQ A;  4CJU A;  4CEQ A;  4ELU A;  3PY8 A;  5SWM A;  4BE0 A;  4E19 A;  4EZ6 A;  1GOB A;  2G8F A;  4CHO A;  3PX0 A;  3OS0 A;  3UIQ A;  1NKC A;  4DU3 A;  2VG5 A;  1WAJ A;  4CIG A;  2EHG A;  4E1N A;  2KFZ A;  4B9V A;  4E3S A;  2Q3S A;  4FJI A;  2BE2 A;  1YVU A;  2VG6 A;  1RDD A;  4W5O A;  5I42 A;  1VSM A;  4MFB A;  5FRN A;  1YTU A;  4CEE A;  2RPI A;  3V1Q A;  4FM2 A;  2Z1J A;  3ZSZ A;  3NAE A;  4FLW A;  4DU1 A;  3MXM A;  2G8K A;  4DWI A;  2A1R A;  4HUE A;  4KPY A;  4CHN A;  3IG1 A;  3O3F A;  1EET A;  4KI6 A;  1EXQ A;  3ALY A;  1TK0 A;  4O44 A;  3OVN A;  4RW4 A;  1SV5 A;  3ZCM A;  3LZJ A;  3OYA A;  1IKW A;  4PQU A;  2QKK A;  5HLF A;  1ASU A;  4W5R A;  4DLG A;  3OYD A;  4FK2 A;  3SQ1 A;  1FKP A;  1BIU A;  4O5B A;  1S6P A;  1C1A A;  2XO7 A;  3L2W A;  1JKH A;  3TAG A;  1TL3 A;  2NUB A;  1NJY A;  1CLQ A;  2YNH A;  1EKE A;  3V9S A;  2GV9 A;  1SL1 A;  2GBZ A;  4HUF A;  1I3A A;  3HP9 A;  3I8D A;  4F8R A;  4F3T A;  4B3O A;  3VQ6 A;  4Y1D A;  3CYM A;  3DLK A;  4O0I A;  1Q8I A;  1RTH A;  1RBR A;  4Q0B A;  2VG7 A;  1ZBU A;  4CJ3 A;  2E6M A;  4DU4 A;  1NK7 A;  4DMN A;  4OLB A;  1RT1 A;  1U4B A;  2D0A A;  2O4G A;  3NF8 A;  3OYJ A;  3QET A;  4O0J A;  4CER A;  3QO9 A;  4DSF A;  1RT6 A;  1K6Y A;  1JLB A;  4OGE A;  3OYB A;  4FJM A;  3V9U A;  1VSK A;  3DOK A;  3U6F A;  4BDZ A;  3ZT0 A;  3MXI A;  5C42 A;  1VSD A;  4B9T A;  4HCB A;  4N47 A;  3L3V A;  1T7P A;  4NCB A;  5HRN A;  2YNI A;  1BI4 B;  1FK9 A;  1TV6 A;  3AA3 A;  1QHT A;  4ZHR A;  1L5U A;  1VSF A;  3P83 D;  4CFA A;  4F3O A;  4M45 A;  4J2E A;  1S1V A;  3DM2 A;  4B9N A;  2XY5 A;  2BDP A;  4CJ5 A;  3AO1 A;  3CFP A;  5J2N A;  4DFJ A;  1WAF A;  3AO3 A;  1TKD A;  4KHS A;  1C0T A;  3ZSV A;  3KLI A;  4FCY A;  4OKE A;  4TSX A;  2IGI A;  3WNE A;  1NJX A;  1RBV A;  3SPZ A;  2DY4 A;  4ELT A;  2D0C A;  1G15 A;  1C1C A;  4N56 A;  3M8R A;  3T3F A;  1JLC A;  1JXE A;  1ZBI A;  2GUI A;  3VQD A;  5HRO A;  4F4K A;  2KFN A;  4LY7 A;  1TKZ A;  4O4G A;  3ZSO A;  4K8X A;  4CF9 A;  3VA0 A;  3D45 A;  4DQS A;  2P5G A;  1S1X A;  3VQE A;  4CIF A;  3OJU A;  1KVA A;  3AVF A;  2X6N A;  2Y1I A;  1SL0 A;  5C25 A;  3KKS A;  4GMJ B;  3M8P A;  2D0B A;  4AHS A;  1NK4 A;  1NOZ A;  1T05 A;  2O4I A;  2IAJ A;  1IKY A;  2YNG A;  4FJG A;  3LWL A;  4CEB A;  3KTQ A;  4FVM A;  2B6A A;  1NK6 A;  1QTM A;  3VQ4 A;  4DG1 A;  3ITH A;  4KTW A;  3KK2 A;  3SV4 A;  2D5R A;  3SUP A;  2DFH A;  3LAK A;  1W9H A;  3M8S A;  4UQG A;  2HMI A;  3IS9 A;  3KK1 A;  1A5W A;  4R5P A;  3NDK A;  4QCL A;  4CEA A;  4CE9 A;  3WNG A;  4E89 A;  3TAN A;  1UA1 A;  1HJR A;  3DRR A;  2HB5 A;  1JLF A;  1RT2 A;  2RKI A;  5HBM A;  5FRO A;  1Z25 A;  3HPG A;  4CK3 A;  3NCI A;  3SUO A;  1HYS A;  4OGC A;  1S1W A;  3LDS A;  4DFP A;  1B92 A;  3VQQ A;  3IAY A;  2A1S A;  4GVM A;  1VSJ A;  3VQP A;  2FBV A;  4CHQ A;  3AVG A;  3ZSQ A;  4B08 A;  2R7Y A;  1REV A;  4OPJ A;  4JLH A;  4DTU A;  1EX4 A;  3C6U A;  3FFI A;  4RW8 A;  4E7L A;  3TAB A;  5D3G A;  4DTN A;  1JLQ A;  5KTQ A;  1C6V A;  3LAN A;  1L3S A;  4FJ9 A;  4FLY A;  3I0S A;  4RW9 A;  4CJF A;  1ITG A;  2FBX A;  4I9Q A;  4KTZ A;  3CM6 A;  1VSI A;  3LP1 A;  1NJW A;  2WOM A;  4CF8 A;  1VRU A;  2X78 A;  4KO0 A;  5JS1 A;  4B9U A;  3NF9 A;  4KI4 A;  1RBU A;  4CED A;  3B6O A;  4KHN A;  2IOC A;  3NF6 A;  4DSJ A;  2XY6 A;  1N5Y A;  2HNZ A;  2IS3 A;  3ASM A;  4CJL A;  3VN5 A;  3CFR A;  3V6D A;  1RBT A;  3S3M A;  3RR8 A;  5CYM A;  4BE2 A;  3H08 A;  1DLO A;  3AVN A;  4B8A B;  3RR7 A;  2QKB A;  4M3Z A;  3HVT A;  4K8Z A;  1RDA A;  3ZSY A;  1HMV A;  3K5M A;  5J1E A;  5E41 A;  1TK5 A;  1C0M A;  2JGU A;  2F8T A;  3L2R A;  2XY8 A;  2HHU A;  3O3H A;  4I7F A;  4M3R A;  4CGG A;  3OYG A;  3OJS A;  2G8U A;  4DSE A;  4CEO A;  1RBS A;  3QLH A;  4M3Y A;  2HVI A;  4KB0 A;  2KZM A;  3DLG A;  2X6S A;  3ZT3 A;  3ZT1 A;  3V9X A;  1NOY A;  3M8Q A;  2G8I A;  4NCG A;  2OPQ A;  1TL1 A;  1RCH A;  1HRH A;  3VQ8 A;  3KLF A;  4CIE A;  1Q9X A;  4ELV A;  1LAV A;  4FM0 A;  1SKW A;  4J2D A;  3SCX A;  4PWD A;  4OLA A;  4C8L A;  4FJ8 A;  3DRP A; 
#chains in the Genus database with same CATH topology
 4WFA L;  1R0A A;  1HX1 A;  3MWT A;  4PKH A;  1RDW X;  1W97 L;  2CGJ A;  4HHT A;  1UA0 A;  4EHU A;  2HHX A;  1DKG D;  3ZSX A;  4B1Y B;  2HOE A;  3HT3 A;  4IKF A;  3VQ7 A;  4DV0 K;  1Q7Y O;  1HKB A;  4CGJ A;  2O8E A;  3KLG A;  3HO1 A;  2KTQ A;  4FWN A;  2PYJ A;  4JKE A;  1RT7 A;  4UY8 O;  3CD6 N;  5CY4 A;  3L3U A;  2KW4 A;  3HSC A;  4M3T A;  5JLH A;  1KXP A;  3D0P A;  2PZS A;  3EYZ A;  3U9D A;  4CGI A;  2CGL A;  5TKY A;  2HBM A;  3JS6 A;  2YHW A;  2W6L A;  3BY5 A;  4KTQ A;  2QWR A;  3EY1 A;  3U3Y A;  2QXF A;  4WYB A;  1H1V A;  2ZGY A;  3MCA B;  3HP6 A;  4FZX C;  4F2S A;  1TAU A;  5KRT A;  3FFK B;  1CXU A;  3WXL A;  3PIP L;  1O1W A;  1NGI A;  2YKM A;  1GLJ O;  3OYC A;  4QS7 A;  3AGK A;  4DB3 A;  3K5O A;  3ZSW A;  1KLN A;  3GL1 A;  4EP4 A;  3K57 A;  4DSK A;  3PX6 A;  1HUX A;  4H03 B;  2RF2 A;  4FWS A;  1J9A A;  1BA1 A;  3ATV A;  2P51 A;  4BRQ A;  2D0O A;  3CFO A;  3HST B;  3TTC A;  1VQN N;  4GNI A;  4J2B A;  4LSN A;  4BRO A;  3HM8 A;  4C8K A;  2UYT A;  2BH1 A;  2Q0U A;  3THX B;  3E01 A;  1MU2 A;  2P9I A;  5C2D A;  4RG8 A;  4XH1 A;  1VRT A;  4FSV A;  3RVC A;  4LFA K;  3J7A P;  1GLC G;  1IG9 A;  5C12 A;  1GOA A;  3AVA A;  3V1O A;  3WNF A;  4B1W B;  4MLE A;  4Z4G A;  1SAZ A;  1TKX A;  3ZX0 A;  3VOV A;  4HVJ A;  1XI1 A;  4KAZ A;  3BF3 A;  4BQZ A;  4FLZ A;  1WSG A;  4NB4 A;  4JKC A;  3K2P A;  1P90 A;  4FOI A;  5JS2 A;  2YHB A;  3DJC A;  4JKD A;  1KQS M;  3MN6 A;  2O8E B;  2JLE A;  3LAM A;  1Q81 O;  3EE9 A;  5AQZ A;  1M90 O;  3HPO A;  1XMO K;  3KD1 E;  1RDC A;  3VQB A;  3L2U A;  3NVM A;  4BRE A;  2O8C B;  3V1R A;  1KAX A;  3W3D A;  4Z4E A;  1YHQ N;  4EIA A;  5LY3 A;  5AQR A;  4KHY A;  4LSL A;  2O8D A;  3R9P A;  3DLR A;  1YXQ A;  3G0Z A;  4DTO A;  4B8C A;  4CJV A;  1B9D A;  4CEC A;  3U4L A;  3EO3 A;  1X9W A;  1GLL O;  5CR4 A;  5HRR A;  3ENB A;  4MDB A;  3NGZ A;  4DSL A;  1WUA A;  1BUP A;  1NK8 A;  5J2Q A;  3S41 A;  4BG8 A;  3PLA A;  2ASM A;  4CFD A;  3OYK A;  1ILY A;  5M1Q A;  2NRT A;  4AHT A;  1BQN A;  4E7K A;  3L2V A;  4A2B A;  4ICL A;  3DLL L;  3ZYY X;  4FW1 A;  3OHR A;  2UXC K;  3F5T A;  2PAV A;  1TGO A;  3LWM A;  3CMA N;  3OYF A;  2AJQ A;  3V9Z A;  1ESV A;  3RRH A;  4AIL C;  2HF4 A;  3KWI A;  4W5T A;  4BWJ A;  3CJB A;  3DYA A;  1C1B A;  1EWQ A;  3C94 A;  3RSE B;  4BVP A;  3CJ1 A;  3SQ2 A;  1DTQ A;  3ULD A;  3HVR A;  4Q0B A;  1SUQ A;  3RWU A;  4JAX A;  3ATU A;  4PKI A;  1JLG A;  4DR2 K;  1KD1 O;  4M3U A;  3PX4 A;  1G99 A;  3LDP A;  3TI0 A;  4BRC A;  2O8D B;  3S3O A;  4DR1 K;  1S1U A;  1ATS A;  3QNO A;  2W42 A;  4A2A A;  4DTJ A;  1L3V A;  3AVC A;  4CZF A;  4IFE A;  3GOI A;  2OYQ A;  3NBP A;  1SQK A;  3Q7B A;  2BAN A;  4CVN E;  4DS4 A;  1XC9 A;  4OVL A;  1BI4 A;  2YJF A;  3D6R A;  3A2F A;  3O1B A;  1KLM A;  3HM9 A;  3VGL A;  4AHU A;  4X66 K;  4H8K A;  5KPZ A;  2OPS A;  1S22 A;  4IFY A;  2I5J A;  1A5V A;  5M1N A;  1T03 A;  1QQC A;  3LPU A;  2OZS A;  3V4I A;  4KB1 A;  5JIC A;  1S5J A;  1NK0 A;  3PV8 A;  2Q0R A;  3VES A;  3U8X A;  4DQ8 A;  1ZXO A;  4PHT X;  3CIP A;  1N36 K;  2QTD A;  2QXL A;  1GOB A;  5EY4 A;  4EZ6 A;  2ZJP L;  3OS0 A;  3T69 A;  5KPR A;  4E1N A;  3VET A;  4B1X B;  1MWM A;  4FJI A;  2ASP A;  3HI0 A;  1YVU A;  4YOY A;  2ITM A;  5FRN A;  4BRI A;  3A8Y A;  1NWK A;  3EE8 A;  2YHY A;  2Z1J A;  3NAE A;  4DU1 A;  4FLW A;  4KPY A;  2A1R A;  4KI6 A;  4PL8 A;  3IFR A;  3O3F A;  1QQN A;  3OVN A;  3ZEU A;  4RW4 A;  3ZCM A;  5E84 A;  4PQU A;  5BR8 K;  1GLB G;  3TSU A;  1FKP A;  1BIU A;  4O5B A;  1S6P A;  3TAG A;  1NJY A;  2NUB A;  3D2E A;  4FWL A;  2ZM6 K;  3E1Y A;  1NU0 A;  3V9S A;  2ZJQ L;  3I8D A;  5JMV A;  3DWL A;  4B3O A;  3DLK A;  4O0I A;  1Q8I A;  1FJG K;  4JKG A;  4CD1 A;  4OLB A;  2O4G A;  4BRA A;  3OYJ A;  3QET A;  1OVQ A;  2JWL A;  4BR9 A;  3ULE B;  4WQ5 C;  3CC4 N;  4N47 A;  3PSF A;  2YNI A;  4BRH A;  3AAQ A;  1BI4 B;  3FZH A;  1VSF A;  1RGI A;  1S1V A;  3VPZ A;  2WTU A;  2XY5 A;  4B9N A;  5J2N A;  1WAF A;  1QZ6 A;  1NGC A;  3AY9 A;  3SPZ A;  4ELT A;  4IEE A;  3M8R A;  3T3F A;  1JLC A;  1ZBI A;  4LF5 K;  5HRO A;  5GIN A;  4A57 A;  4DQS A;  5KQD A;  2P5G A;  1S1X A;  5AQF A;  3UKR A;  1KVA A;  2OCE A;  2Q31 A;  4GMJ B;  1NK4 A;  2D0B A;  1TUU A;  2Q97 A;  4CEB A;  3VEY A;  2B6A A;  4C23 A;  4OPA A;  3ITH A;  3SV4 A;  4MO4 A;  3SUP A;  5M1F A;  1OH7 A;  1NMN A;  4WFB L;  4C1N I;  5EVZ A;  1A5W A;  3KK1 A;  3KVG A;  4IOA L;  2F7T A;  3NDK A;  3MMV A;  4E89 A;  5KPT A;  3TAN A;  1HJR A;  3HBT A;  1RT2 A;  1VQ6 N;  5HBM A;  4ISG A;  3SUO A;  2QM1 A;  4OGC A;  4DFP A;  2A1S A;  4GVM A;  1QHA A;  4CHQ A;  2VWB A;  3K9K A;  4B08 A;  1REV A;  4OPJ A;  4DTU A;  3SK3 A;  3MX5 A;  1JLQ A;  4BC5 A;  3LAN A;  5KTQ A;  1L3S A;  2WFB A;  4CJF A;  3H45 C;  1VSI A;  3ZX3 A;  1VRU A;  2X78 A;  4KO0 A;  4B9U A;  3NF9 A;  1U6Z A;  2KKZ A;  3MK6 A;  2FSN A;  2XY6 A;  2IS3 A;  3VN5 A;  3V6D A;  3RR8 A;  2A41 A;  5CYM A;  1MWK A;  4BC4 A;  3G6E N;  3RR7 A;  2QKB A;  4K8Z A;  1RDA A;  3K5M A;  1C0M A;  4JKH A;  2F8T A;  2HHU A;  5EXW A;  4DSE A;  1YJN N;  2IVN A;  3QLH A;  4M3Y A;  2A40 A;  3P38 A;  3ZT1 A;  5LMN K;  1K8K A;  1RCH A;  1Q9X A;  4KH5 A;  3H1V X;  1JCE A;  4FM0 A;  4J2D A;  3SCX A;  2V52 B;  1TAQ A;  3FZF A;  3EKS A;  3QEX A;  3TTF A;  5C24 A;  5TKW A;  5AR0 A;  3DRS A;  2OTL N;  3SV3 A;  3TPQ A;  2A6A A;  4I2Q A;  5FDL A;  3KJV A;  1RDU A;  4IFV A;  5FLX O;  1MDU B;  3CET A;  4KHU A;  1HYZ A;  3TWH A;  1RNH A;  4E7I A;  1ZBL A;  4W5N A;  2F9W A;  1X1P A;  1UWB A;  4KH4 A;  3SQ0 A;  4OO1 J;  1LCU A;  2QW9 A;  3CCM N;  2P9N A;  4CJW A;  1Z26 A;  4EP5 A;  4B9Q A;  3QBW A;  3SBG A;  3MWP A;  4CZH A;  3T1Y K;  1U48 A;  2QWM A;  4WCE L;  1Q86 O;  3MEE A;  1WNS A;  1KRP A;  4CJS A;  3V81 A;  3CQY A;  5DK5 A;  1VK0 A;  4DCH A;  2IVO A;  1Z05 A;  1NK9 A;  3LDO A;  5K14 A;  4CGH A;  4CJR A;  4B1Z A;  1BA0 A;  1ZC6 A;  4DTX A;  1D5A A;  3GBT A;  1RTJ A;  4CZM A;  3KK3 A;  4FPA A;  3NFA A;  3B6P A;  4CK2 A;  4DSI A;  2PY5 A;  2B4J A;  4CFB A;  3O4N A;  1TVR A;  5HL7 L;  2P5O A;  5C0Y A;  2P9L A;  4OPK A;  4O5F A;  3T1H K;  2OPP A;  1GOC A;  3DLE A;  1J6Z A;  3CPW M;  4B3T K;  3QEV A;  1D9F A;  1U2V B;  3NH1 A;  3RTV A;  4AF1 A;  2Z1H A;  3CCQ N;  1K8K B;  3EN9 A;  1KAY A;  4DS5 A;  4RWT A;  3MX2 A;  5J2M A;  4BRK A;  2KLA A;  2OPR A;  3M1F A;  1CXQ A;  2VWJ A;  3SZ2 A;  5AQS A;  1NKE A;  2CH6 A;  1GLA G;  1K73 O;  5GIO A;  3G4S N;  4L3Q A;  3K5N A;  4YNQ A;  1BQM A;  1QVG M;  2HHS A;  1DEJ A;  5AQI A;  3ZET A;  2E2Q A;  1DTT A;  4BDP A;  3MXJ A;  1I94 K;  5I9E B;  2PYL A;  4QOZ B;  4FJJ A;  4MDA A;  1WSE A;  4FLV A;  1IBK K;  2XRI A;  2PFU A;  3T1A A;  3CCV N;  1UAX A;  3A0I X;  1LW0 A;  1HNI A;  5I3U A;  4FWR A;  3JXU A;  4DQI A;  4CI6 A;  3I0R A;  4I2P A;  3I8B A;  1S6Q A;  4FZY A;  3LP2 A;  2FSK A;  3RMC A;  3CCJ N;  3CXC M;  3ZLJ A;  3K9J A;  1QZ5 A;  4CHP A;  2HW3 A;  3PSI A;  3HOT A;  1BCO A;  5CZ1 A;  4IG3 A;  2AA4 A;  4YDU C;  1HQE A;  3DXK A;  3O4Q A;  1KTQ A;  1XHX A;  2PBD A;  4FM1 A;  3NH0 A;  1KC8 O;  3E9P A;  5CZ2 A;  3U9Z A;  1KAZ A;  4WF9 L;  1WSH A;  3DMJ A;  4A59 A;  5HRP A;  3NGY A;  1S3X A;  1V4S A;  1E3M A;  1Y64 A;  4CEF A;  1HLU A;  4NXM K;  2OTJ N;  4JK8 A;  1JJ2 M;  3LZI A;  4B9L A;  4YDU A;  1HPM A;  4Z0U A;  3SAG A;  3P31 A;  3OYH A;  3HL8 A;  1J53 A;  3H1Q A;  1D8Y A;  3AVK A;  3LPT A;  1LV5 A;  4AM7 A;  1XWL A;  4JI2 K;  3SUN A;  3HPH A;  4FWQ A;  4IZ9 A;  5AQK A;  5AQW A;  4JI5 K;  1U04 A;  4CF2 A;  4NXN K;  1O13 A;  2NRW A;  1SKR A;  4W5Q A;  1IO2 A;  1IKV A;  2ETJ A;  4L8R B;  4ISF A;  1VQ5 N;  3QNN A;  2QWL A;  5AQN A;  3P5J A;  4ID5 A;  4KKO A;  4JI4 K;  3FZK A;  4CF0 A;  4CES A;  3SYZ A;  4KHN A;  4K42 A;  2XY7 A;  3DLB A;  2UXD K;  4MQ3 A;  4DV6 K;  4IBN A;  5KRS A;  3AVH A;  1VQ8 N;  3AA4 A;  2HHV A;  2G8W A;  3BZK A;  2YHA A;  3DXM A;  2FBT A;  2EWS A;  2FF3 B;  4WQ4 C;  4DTS A;  1YJ9 N;  3ZET B;  3THY A;  4FYD A;  5C10 A;  4JHD A;  3HZ6 A;  2Z1I A;  2ATQ A;  2A42 A;  3QIN A;  3VEN A;  1QE1 A;  3IUC A;  1IKX A;  4R79 A;  3IRX A;  4FLT A;  4O8U A;  3WQU A;  1NGD A;  4H4M A;  4Z4H A;  1J54 A;  4EZ9 A;  5HP1 A;  4FJH A;  4WQ4 A;  5LL6 Z;  1BIZ A;  4CJ4 A;  1N34 K;  4DV5 K;  4FJ7 A;  5DM7 L;  2JWK A;  1WSF A;  3MEC A;  1HR0 K;  2ASO A;  4FO0 A;  1ZYQ A;  4C8O A;  4JYA K;  4JD2 A;  2W40 A;  4CZG A;  3SI6 A;  2KQ2 A;  1WBB A;  4E7J A;  3C6H A;  4FOE A;  2E2P A;  5BRE A;  5AQV A;  4ELU A;  4H0V B;  4E19 A;  5GAH P;  2YX6 A;  3UB5 A;  3UIQ A;  1NKC A;  4DU3 A;  3H6E A;  2VG5 A;  4CIG A;  2HBJ A;  3R1X A;  3C0B A;  2VG6 A;  3O6W A;  5GAE P;  4W5O A;  1N8R O;  3V1Q A;  4H5R A;  3ZSZ A;  2G8K A;  4HUE A;  1HNW K;  1EET A;  1TK0 A;  4DR5 K;  3LZJ A;  3OYA A;  1YIT N;  5HLF A;  3OYD A;  1C1A A;  3L2W A;  1TL3 A;  3VEX A;  1LOT B;  3DXM B;  1EKE A;  1XQS C;  2V51 B;  3VEW A;  3L0Q A;  5DM6 L;  1J5E K;  2GBZ A;  1X9J A;  1I3A A;  3HP9 A;  4BRG A;  3THY B;  4Y1D A;  2P9I B;  1RTH A;  5JVG L;  1RBR A;  3PIO L;  4CJ3 A;  1NG9 A;  1RT1 A;  2D0A A;  5AJ3 K;  4JI0 K;  3VMF B;  1JLB A;  5BR9 A;  1VSD A;  3ENH A;  4NCB A;  4DR3 K;  1TV6 A;  4F3O A;  3K0S A;  4CFA A;  4M45 A;  3CFP A;  2P9P A;  4DUY K;  3AO3 A;  1TKD A;  2HBK A;  4KHS A;  1YAG A;  1C0T A;  3ZSV A;  3FLC O;  3KLI A;  2A5X A;  2IGI A;  3WNE A;  3VTI A;  5C15 A;  1RBV A;  4DV4 K;  3E9L A;  1G15 A;  4LF8 K;  2P9U A;  4X65 K;  3VQD A;  4ISE A;  4O4G A;  3ZSO A;  4K8X A;  3VA0 A;  2UUA K;  1NBW A;  1YI2 N;  3VQE A;  3AVF A;  2Y1I A;  4X64 K;  5C25 A;  4Z94 A;  4AHS A;  2O4I A;  2V7Y A;  1K9M O;  3LWL A;  4FVM A;  1NK6 A;  3VQ4 A;  4DG1 A;  3KK2 A;  1T6C A;  1HKG A;  3EL2 A;  2D1K A;  4CZL A;  4QCL A;  4CEA A;  4CE9 A;  3WNG A;  2YHX A;  3I33 A;  4K25 A;  5FRO A;  1JLF A;  2RKI A;  4CK3 A;  5FPD A;  1Z25 A;  1HYS A;  3KZB A;  3H46 O;  1VSJ A;  3VQP A;  3VER A;  3ID8 A;  2R7Y A;  3TAB A;  4DTN A;  4IJN A;  5AQO A;  4FJ9 A;  3E66 A;  3UE5 A;  4RW9 A;  4I9Q A;  2FBX A;  3GE1 A;  3L6Q A;  1NJW A;  4H0T B;  2WOM A;  3LDN A;  5JS1 A;  4CED A;  2J4R A;  3B6O A;  4DSJ A;  3EEQ A;  3ASM A;  4CJ7 A;  2I7P A;  3H08 A;  1DLO A;  3AVN A;  4B8A B;  4M3Z A;  2E1Y A;  1HMV A;  1TK5 A;  2JGU A;  5LJV A;  3L2R A;  2XY8 A;  1X3M A;  3O3H A;  4M3R A;  4CZK A;  3SAF A;  1BG3 A;  1RBS A;  2KZM A;  3L4Q A;  2I7N A;  3V9X A;  3M8Q A;  3VQ8 A;  4IOC L;  4CIE A;  4H0X B;  2HF3 A;  1SKW A;  3R8E A;  4FJ8 A;  3DRP A;  2F8S A;  2H3G X;  1VQP N;  2E5L K;  3EZ5 A;  3AA2 A;  3AO2 A;  1VQ4 N;  1WSJ A;  3KWG A;  3LDL A;  1ZBS A;  1VSL A;  1HNX K;  4YOT A;  4V19 S;  4YOX A;  4FPB A;  3D7E O;  4AHC A;  4EFH A;  2ZD1 A;  4IG0 A;  4FVU A;  5M1O A;  3V9W A;  3LP0 A;  4BR2 A;  4M63 C;  1GLE G;  1VQ9 N;  4CGF A;  2W41 A;  2VWK A;  3HTV A;  4CCH A;  4G9Z A;  3S3N A;  1N6Q A;  4DR6 K;  4DQP A;  4KV8 A;  4CJQ A;  3O80 A;  4JI1 K;  4LF7 K;  4CEZ A;  3OA9 A;  1TYQ A;  2YV0 X;  2HHQ A;  3LP3 A;  3QBX A;  3TTD A;  3QES A;  2HMP A;  3VF4 A;  4DLE A;  3KD5 E;  3TAP A;  1Y97 A;  3F73 A;  1NLV A;  3PUF A;  4DV1 K;  1LW2 A;  4M42 A;  4KRF A;  1SS6 A;  4JS5 A;  4E0D A;  3WXJ A;  3QIO A;  3ZX2 A;  4ILG B;  5C2F A;  1T8E A;  1OH5 A;  3VEO A;  4PUO A;  4YY3 K;  4B3S K;  4N76 A;  3C95 A;  2F96 A;  5BN9 A;  2XHB A;  4Z4C A;  3HJF A;  2QWN A;  2NRX A;  1NGA A;  1S1T A;  1HYV A;  3MN5 A;  4FW2 A;  1ZBH A;  2E2N A;  2QI2 A;  1E4G T;  1S9G A;  1HNV A;  4LD0 A;  4K43 A;  1X9S A;  4DTR A;  1SZ2 A;  4BAC A;  3S9H A;  3O1W A;  4FJK A;  4BRP A;  1D4X A;  2DPN A;  4JN4 A;  3ZEU B;  1S9E A;  5CYQ A;  5EU7 A;  3MCP A;  1QS4 A;  2E4L A;  3BGR A;  1S72 N;  4IEI A;  4NLB A;  4LH4 A;  3UKU A;  3OYE A;  1NGF A;  4DV3 K;  3D2E B;  4KBO A;  2GWK A;  4IDK A;  3O3G A;  4DV2 K;  5B8H A;  5FRM A;  4BWM A;  1C0U A;  1IBL K;  1BWF O;  1YVN A;  4C8M A;  4CZE A;  3NHG A;  1U49 A;  4ZTJ A;  1VSE A;  1RTD A;  1N33 K;  1BL3 A;  4JKG B;  1XMQ K;  3P1G A;  2E6L A;  3HYF A;  4XH4 A;  4BRM A;  3KLH A;  3AO4 A;  2FC0 A;  3AVL A;  1YJW N;  3TSP A;  1JXB A;  4DTM A;  3VEV A;  4K0K K;  1FXX A;  3F9K A;  2VGM A;  3MDQ A;  4FLU A;  2B5J A;  1IJJ A;  1JL2 A;  4CHZ A;  3VA3 A;  4JKF A;  1LWC A;  5GIP A;  1QSS A;  1P8Z A;  3QML A;  5AQU A;  1YTA A;  4IWV A;  3NGI A;  4CJE A;  1TYQ B;  3C7N A;  4AHR A;  3THW A;  4KH6 A;  5KQ8 A;  3CJC A;  3WQT A;  4E7H A;  3M5R A;  1VAZ A;  4F2R A;  4DTP A;  1T6D A;  5AQG A;  2KHO A;  5BPL A;  3UKR B;  1L3T A;  4Z4I A;  1RIL A;  2LSN A;  5AQQ A;  3AVI A;  4AH9 A;  3ZSR A;  4DHY A;  1U45 A;  2E1Z A;  3J80 O;  3AO5 A;  4PY5 A;  4N5S A;  4ZTF A;  4YHH K;  4CJT A;  1KCF A;  3G10 A;  2O8B A;  5AQP A;  1LWF A;  4DFK A;  3LAL A;  1Q9Y A;  4B3R K;  3QER A;  3VTH A;  4M41 A;  3A5L C;  4NO7 A;  5KI6 A;  4ILH A;  3OTO K;  5HOO A;  4N41 A;  2HVH A;  2FBY A;  3TAM A;  3CER A;  4JK7 A;  4IJA A;  2RHK A;  4JRP A;  1HKC A;  3HXM A;  3P4I A;  4GW6 A;  3VQ9 A;  3PO5 A;  1WLJ A;  4CJK A;  2BUP A;  3T19 A;  3OYI A;  5M1K A;  1X3N A;  3WEE A;  1OH6 A;  2P1J A;  5DMR A;  3MEG A;  3ID6 A;  4JRQ A;  3QB0 A;  2YNF A;  3AVM A;  4B9S A;  3LM2 A;  1KSP A;  4NYF A;  4CW7 B;  2WBN A;  2IIR A;  3SPY A;  4BY9 C;  4FK4 A;  1X9M A;  3IKM A;  4CFC A;  4BG9 A;  3U3G A;  3PO4 A;  2HHW A;  4FJN A;  1JLA A;  1MA9 B;  3THV A;  4X62 K;  3CHW A;  3LM9 A;  2WON A;  4A5B A;  5BN8 A;  2NRH A;  3KIO A;  3J8A A;  3O9Q A;  4CJP A;  4DFM A;  4CBX A;  2NNW A;  2F9T A;  3OYM A;  3SNN A;  4H5N A;  2FXU A;  4XIU A;  1E4F T;  5J2P A;  3M6G A;  1YF5 L;  2IVP A;  3ENO A;  5KGW A;  1RTI A;  1EQY A;  5CHI A;  3F2K A;  3O8M A;  1NGH A;  4FXD A;  3ZT4 A;  3VGK A;  4H5V A;  3O9S A;  5SZT A;  1EWR A;  2EX3 A;  1ATN A;  2E2O A;  3L2Q A;  3BP8 A;  4CJU A;  2P9N B;  5SWM A;  4BE0 A;  4BC2 A;  4YOW A;  4IO9 L;  1WAJ A;  2KFZ A;  2EHG A;  2W6K A;  3N4P A;  4E3S A;  2Q3S A;  3THX A;  4MFB A;  3HOS A;  1W7A A;  3MN7 A;  3VGM A;  4CBU A;  4JI7 K;  5EOY A;  3H3N O;  4DWI A;  1WBD A;  1Q18 A;  4CHN A;  3OBW A;  1BO5 O;  2BTF A;  4GV3 A;  1SV5 A;  1IKW A;  5FPM A;  3A5O C;  2QKK A;  4BRL A;  3EKU A;  4FK2 A;  3SQ1 A;  4U7B A;  2XO7 A;  4CBW A;  1CLQ A;  2HST A;  2YNH A;  3SBT A;  1SL1 A;  3T7Z A;  4HUF A;  4F8R A;  3CI5 A;  2P9L B;  3CYM A;  4MLH A;  5F0X A;  4FWK A;  1ZBU A;  4DU4 A;  1NK7 A;  3NF8 A;  2P9K A;  4CER A;  3QO9 A;  4DSF A;  1K6Y A;  4FJM A;  2RE2 A;  3E9O A;  3V9U A;  3CCE N;  1VSK A;  2O8C A;  3U6F A;  2OAN A;  3ZT0 A;  3FZL A;  3MXI A;  2CGK A;  2UUC K;  1T7P A;  3L3V A;  5HRN A;  3AA3 A;  4ZHR A;  1L5U A;  4J2E A;  4U67 L;  3DM2 A;  4H0Y B;  2BDP A;  3D2F A;  3EZW A;  4DFJ A;  1QQO A;  3CCR N;  4JEP A;  1R59 O;  3Q7C A;  4BC3 A;  1K8A O;  2VYP A;  5AQX A;  2D0C A;  1C1C A;  3BUZ B;  1JXE A;  3LDQ A;  4F4K A;  4PL7 A;  2KFN A;  4LY7 A;  1TKZ A;  1VQK N;  3OJU A;  4LF4 K;  2X6N A;  1SL0 A;  4BVO A;  1OKJ A;  4GY2 B;  2ZGZ A;  5AZJ A;  1RFQ A;  4FJG A;  1T44 A;  1DT9 A;  2QWO A;  4KTW A;  1NMD A;  2D5R A;  4BGA A;  1W9H A;  4R5P A;  1YUW A;  5CE3 A;  4JV5 K;  2GEM A;  4QS8 A;  3SMP A;  2HB5 A;  4H0P A;  3CJ7 A;  3HPG A;  1S1W A;  3DXK B;  5AFU A;  1B92 A;  3VQQ A;  3BF1 A;  1OH8 A;  3NVK A;  2FBV A;  4BR0 A;  3AVG A;  3ZSQ A;  1EX4 A;  4E7L A;  1GLD G;  2ZJR L;  1C6V A;  5JVH L;  3RSE A;  4FLY A;  3I0S A;  3CF5 L;  1NGB A;  5BPM A;  4JNE A;  5IWA K;  4F9O A;  4KTZ A;  3CM6 A;  3LP1 A;  2E88 A;  4GKK K;  4O8K A;  4A62 A;  1RBU A;  3G71 N;  1VQL N;  2HNZ A;  3CJ9 A;  2P9K B;  1RBT A;  3S3M A;  4B1V A;  3HVT A;  2NRR A;  3ZSY A;  5E41 A;  4CD3 A;  1TUY A;  2G8U A;  1XC3 A;  4IDH A;  4CEO A;  2HVI A;  4KB0 A;  2X6S A;  4DUZ K;  2AP1 A;  3ZT3 A;  3D2F B;  4B1U B;  2OPQ A;  1TL1 A;  3KLF A;  4ILJ A;  3WXM B;  4ELV A;  1LAV A;  4BQL A;  4OLA A;  4C8L A;  5ELZ A;  4OJR A;  3JSM A;  1NKB A;  3HRG A;  4Z4F A;  3SQ4 A;  1RT5 A;  1VSH A;  2OZM A;  3MN9 A;  2DFE A;  4H5T A;  3R3L A;  3BDP A;  1U47 A;  2BGG A;  2WC9 A;  1A5X A;  3J7Y P;  5FPN A;  4FZZ A;  1IV0 A;  5E26 A;  4JHD B;  2GUP A;  1IG8 A;  5AZJ B;  4GVE A;  3WNH A;  3RMB A;  4LFC K;  3RMD A;  3MAQ A;  4KRE A;  3CG7 A;  4CK1 A;  5BRH A;  2UUB K;  4JK9 A;  1QSL A;  1M1K O;  3QEW A;  5GAG P;  2RN2 A;  3QFU A;  4XH5 A;  3OY9 A;  3OYN A;  4KHW A;  2UXB K;  4H0O A;  3AA5 X;  4CZJ A;  4M3X A;  4NCA A;  3OS2 A;  2GWJ A;  5AFU H;  1EO1 A;  1NGE A;  4JD2 B;  3BZC A;  1ASW A;  1LWE A;  3FR0 A;  3OYL A;  5KGX A;  4H4O A;  4C8N A;  4BE1 A;  1BDG A;  2YJE A;  1NJZ A;  2Y1J A;  1YT3 A;  4FJX A;  5AQJ A;  3L4I A;  3TU5 A;  1LAW A;  4LF9 K;  2X74 A;  5A2Q O;  3OS1 A;  1TK8 A;  4MO5 A;  2ZE2 A;  4FWO A;  3ISN C;  4FJ5 A;  1IH7 A;  4GV6 A;  1QQM A;  3VF6 A;  4JI3 K;  3AV9 A;  3I56 N;  3QEP A;  3K5L A;  5F1X A;  4FJL A;  1JCG A;  3QFP A;  3QIP A;  1W0H A;  3C6T A;  1JLE A;  3DAW A;  1SL2 A;  2GTD A;  1KVC A;  3AVB A;  5AQH A;  2ZF5 O;  3O4W A;  3VQ5 A;  5T7B A;  4CHY A;  3ULE A;  5IT9 O;  1XNR K;  5BRD A;  1RT3 A;  1FKO A;  4YOU A;  4QAG A;  2VQF K;  4DR7 K;  4CGD A;  5ADX A;  3SMS A;  2ZQB A;  1DGK N;  1BCM A;  3NH2 A;  4A61 A;  4O55 A;  2VGN A;  4BR7 A;  4M7X A;  3WXK A;  2DFF A;  4Q5V A;  5HRS A;  3BEX A;  1T3V A;  3SJH A;  2QEX N;  3QEI A;  3H3O B;  4FK0 A;  3TSQ A;  1SKS A;  1HQU A;  4J2A A;  1D9D A;  3O9R A;  3TAQ A;  3CME N;  3CCL N;  3GDQ A;  2HNY A;  4Y0W A;  3DOL A;  2HHT A;  2P9P B;  1WSI A;  2FLO A;  3K59 A;  4WE1 A;  4RCH A;  3CCU N;  2O8F A;  3VEZ A;  2GX9 A;  5F2R A;  4G1Q A;  5JLF A;  4FLX A;  3NE6 A;  2YKN A;  2P9U B;  2V7Z A;  3VQA A;  5AZI A;  1UOC A;  5MLC Q;  1QSY A;  4OPH A;  1CZB A;  1NJI O;  2E8A A;  1ASV A;  1CZ9 A;  3TAR A;  3VF2 A;  3L8B A;  3A5N C;  2FSJ A;  3SJJ A;  1B9F A;  1J5O A;  4OKJ A;  4E1M A;  2QWQ A;  4FL9 A;  4JKB A;  1F21 A;  4FWM A;  4LH5 A;  4RW7 A;  5GAD P;  4NLC A;  2NLX A;  4NYN A;  2G8V A;  1TKT A;  4PA1 A;  4GV9 A;  5LJW A;  1WN7 A;  4CF1 A;  3JYT A;  1NNE A;  2QA4 N;  4DF8 A;  1WB9 A;  4IO8 A;  4DF4 A;  1BIS A;  3IDH A;  2QK9 A;  2ITG A;  1EP4 A;  4BDY A;  2KZZ A;  1RT4 A;  5H1S Q;  1XHZ A;  2YI1 A;  3CM5 A;  1KVB A;  4DKW A;  1NK5 A;  5ADX H;  3CQ8 A;  1I39 A;  1ATR A;  5EX5 A;  3SLC A;  1HPZ A;  2HND A;  3TAE A;  5AQL A;  2Q2R A;  4BR5 A;  4A5A A;  2Z1G A;  2P9S A;  3MED A;  1RDB A;  5AQY A;  5AQT A;  4KFB A;  1JL1 A;  1VQO N;  4DQR A;  4AHV A;  1XNQ K;  4I9L A;  4PKG A;  1C0F A;  4DQQ A;  4WQ5 A;  4ID1 A;  3QIC A;  1KFD A;  4BRN A;  3DLH A;  3O08 A;  4AM6 A;  4OKK A;  3CJA A;  1BHL A;  3KLE A;  3K58 A;  1JCF A;  1BGX T;  3VQC A;  3P39 A;  4IXC A;  2A3Z A;  4Y1C A;  4HUG A;  3R6M A;  3DI6 A;  4HTU A;  4YFU A;  3ZT2 A;  4J8F A;  4CZI A;  3CC2 N;  4LF6 K;  2OA8 A;  2O8F B;  2VCP A;  3B8A X;  3AVJ A;  3WUH A;  3TR8 A;  4FWP A;  3AAP A;  4M3W A;  3FE1 A;  1VHX A;  5AZI B;  2IC3 A;  3KHY A;  1L3U A;  3SUQ A;  4B9M A;  5FPE A;  3KKR A;  3RMA A;  3NF7 A;  3G25 A;  3OW2 M;  3FZM A;  3OBY A;  2IDO A;  3RRG A;  3TAF A;  4RW6 A;  1ZBF A;  4JS4 A;  1KFS A;  3NMU A;  4HCC A;  3LL3 A;  2G8H A;  4KHQ A;  4BGB A;  4CEQ A;  3PY8 A;  4QS9 A;  4B3M K;  2G8F A;  3JAM O;  4CHO A;  3PX0 A;  1QVF M;  1NM1 A;  4WFN L;  4I6M A;  4HTL A;  1C0G A;  3GG4 A;  4B9V A;  4DR4 K;  2BE2 A;  4KHP K;  1RDD A;  5I42 A;  4BRF A;  1VSM A;  3CCS N;  1Q82 O;  1YTU A;  4CEE A;  1NGJ A;  2RPI A;  3A5M C;  4FM2 A;  3MXM A;  3HK2 A;  3IG1 A;  1EXQ A;  3ALY A;  1U2V A;  3KK7 A;  4O44 A;  1FW6 A;  5AQM A;  3CC7 N;  1ASU A;  2P9S B;  4W5R A;  4DLG A;  3F9M A;  2HHH K;  1OVY A;  1JKH A;  1HJO A;  3J81 O;  2NZT A;  2GV9 A;  2D4W A;  4F3T A;  3VQ6 A;  3CQX A;  2VG7 A;  2GEL A;  2E6M A;  4DMN A;  1U4B A;  4LFB K;  4O0J A;  3WT0 A;  1RT6 A;  4OGE A;  3OYB A;  4AQY K;  1NGG A;  3AGR A;  3I55 N;  3DOK A;  4YOR A;  4BDZ A;  1V4T A;  1GLF O;  3UKU B;  5C42 A;  4B9T A;  3IMX A;  4HCB A;  4EHT A;  4RTF D;  2NRV A;  4XEI A;  1VQM N;  1FK9 A;  1QHT A;  3P83 D;  1BOT O;  4CJ5 A;  3AO1 A;  4C1N K;  4FCY A;  4OKE A;  4TSX A;  5LMU K;  2ZWH A;  1NJX A;  2DY4 A;  5BPN A;  2HBL A;  4N56 A;  1HNZ K;  2GUI A;  3N4Q A;  3C65 A;  4CF9 A;  3D45 A;  2CH5 A;  4CIF A;  2QWP A;  2NRZ A;  1IBM K;  4JKA A;  3KKS A;  1T05 A;  3M8P A;  5BRF A;  1VQ7 N;  1NOZ A;  2Q1N A;  2IAJ A;  1IKY A;  2YNG A;  3QDK A;  3KTQ A;  3W0L A;  4BR4 A;  1QTM A;  4GKJ K;  4I6M B;  2DFH A;  3LAK A;  2UU9 K;  2HMI A;  3M8S A;  3C7N B;  4UQG A;  3THW B;  3IS9 A;  2FF6 A;  2E20 A;  4YOV A;  4HWI A;  2D0P A;  1UA1 A;  3DRR A;  3NCI A;  1N32 K;  3O9U A;  2Q36 A;  4K41 A;  5M1P A;  3LDS A;  3IAY A;  2VQE K;  3M3Z A;  1CZA N;  4DV7 K;  4JLH A;  3O9T A;  2O8B B;  1XUP O;  3C6U A;  3FFI A;  4RW8 A;  2F4V K;  5D3G A;  4JI8 K;  1YIJ N;  1ITG A;  2WUS A;  1W2B M;  4BRD A;  4H5W A;  4LC9 B;  4CF8 A;  3WXI A;  1BU6 O;  3CPE A;  4KI4 A;  3SAH A;  3O5B A;  2IOC A;  3NF6 A;  1N5Y A;  2DTU A;  4CJL A;  3CFR A;  3AAR A;  4BE2 A;  2YCH A;  4IOX A;  5J1E A;  4M7Y A;  3FGU A;  4I7F A;  4CGG A;  3OYG A;  3OJS A;  4OX9 K;  4E1J A;  3DLG A;  1NOY A;  3J7Z O;  4JI6 K;  2G8I A;  4EAH D;  4NCG A;  1Z6R A;  1HRH A;  1WOQ A;  3C6A A;  3WEE B;  4PWD A; 
#chains in the Genus database with same CATH homology
 4OJR A;  3JSM A;  1TAQ A;  1R0A A;  1NKB A;  2F8S A;  4Z4F A;  3QEX A;  4HHT A;  3SQ4 A;  5C24 A;  1RT5 A;  1VSH A;  1UA0 A;  2OZM A;  3EZ5 A;  2DFE A;  2HHX A;  3AA2 A;  3AO2 A;  3DRS A;  3SV3 A;  1WSJ A;  3ZSX A;  4IKF A;  3HT3 A;  3VQ7 A;  4I2Q A;  5FDL A;  3KJV A;  4IFV A;  1VSL A;  1U47 A;  3BDP A;  2BGG A;  4CGJ A;  1A5X A;  4FZZ A;  4AHC A;  4KHU A;  1HYZ A;  3KLG A;  3HO1 A;  3TWH A;  2ZD1 A;  4IG0 A;  1RNH A;  3WNH A;  3RMB A;  4E7I A;  3MAQ A;  3RMD A;  3V9W A;  3LP0 A;  1ZBL A;  2PYJ A;  4KRE A;  3CG7 A;  2KTQ A;  4W5N A;  2DTU A;  1RT7 A;  4CK1 A;  4CGF A;  5CY4 A;  1X1P A;  1UWB A;  1QSL A;  3L3U A;  2KW4 A;  2VWK A;  3QEW A;  4M3T A;  2RN2 A;  3SQ0 A;  3D0P A;  2PZS A;  3EYZ A;  4CCH A;  4CGI A;  3S3N A;  3OY9 A;  3OYN A;  1N6Q A;  4CJW A;  1Z26 A;  4KHW A;  4EP5 A;  4DQP A;  4KV8 A;  4CJQ A;  1U48 A;  4KTQ A;  3AA5 X;  4CEZ A;  3U3Y A;  3EY1 A;  4M3X A;  2QXF A;  4NCA A;  3MEE A;  2YV0 X;  3OS2 A;  2HHQ A;  1WNS A;  3LP3 A;  3HP6 A;  1KRP A;  4FZX C;  3QES A;  4F2S A;  5KRT A;  4CJS A;  1TAU A;  1CXU A;  3V81 A;  5DK5 A;  1O1W A;  4DLE A;  2YKM A;  1VK0 A;  1ASW A;  3OYC A;  1LWE A;  3TAP A;  3KD5 E;  1Y97 A;  3K5O A;  3PUF A;  3ZSW A;  3F73 A;  1LW2 A;  1KLN A;  3OYL A;  1NK9 A;  4M42 A;  4KRF A;  4EP4 A;  5KGX A;  4H4O A;  4C8N A;  5K14 A;  3K57 A;  4JS5 A;  4DSK A;  4CGH A;  3PX6 A;  4BE1 A;  2RF2 A;  4CJR A;  1NJZ A;  2Y1J A;  1YT3 A;  4E0D A;  4FJX A;  1J9A A;  3QIO A;  4DTX A;  1T8E A;  1D5A A;  2P51 A;  1RTJ A;  3KK3 A;  3CFO A;  1LAW A;  3HST B;  4PUO A;  3NFA A;  2X74 A;  3B6P A;  4CK2 A;  4DSI A;  2PY5 A;  4LSN A;  3C95 A;  4J2B A;  2B4J A;  4N76 A;  2F96 A;  3OS1 A;  4CFB A;  1TK8 A;  2ZE2 A;  2XHB A;  3O4N A;  1TVR A;  3ISN C;  4Z4C A;  4C8K A;  1IH7 A;  4FJ5 A;  3HJF A;  3E01 A;  2P5O A;  1S1T A;  1HYV A;  1MU2 A;  3AV9 A;  4FW2 A;  1ZBH A;  4OPK A;  3QEP A;  1S9G A;  1HNV A;  4RG8 A;  3K5L A;  4LD0 A;  1X9S A;  2OPP A;  1GOC A;  1VRT A;  4BAC A;  3DLE A;  4DTR A;  3S9H A;  4FJL A;  3QEV A;  3QIP A;  1IG9 A;  1GOA A;  1D9F A;  4FJK A;  3AVA A;  3NH1 A;  3RTV A;  1W0H A;  3V1O A;  3C6T A;  3WNF A;  1S9E A;  2Z1H A;  5CYQ A;  1JLE A;  5EU7 A;  1SL2 A;  4Z4G A;  1KVC A;  1QS4 A;  3AVB A;  2E4L A;  3BGR A;  3VQ5 A;  5T7B A;  1TKX A;  4HVJ A;  4CHY A;  1XI1 A;  4KAZ A;  4LH4 A;  4DS5 A;  3OYE A;  4FLZ A;  1RT3 A;  1FKO A;  1WSG A;  4QAG A;  4IDK A;  4CGD A;  3O3G A;  5J2M A;  5FRM A;  4BWM A;  2ZQB A;  1C0U A;  1BCM A;  3NH2 A;  2OPR A;  4C8M A;  1U49 A;  4O55 A;  1CXQ A;  3K2P A;  5JS2 A;  3NHG A;  2YHB A;  2VWJ A;  1VSE A;  4ZTJ A;  1RTD A;  1BL3 A;  3SZ2 A;  2DFF A;  4Q5V A;  5HRS A;  3P1G A;  2E6L A;  1NKE A;  3HYF A;  2JLE A;  3LAM A;  3QEI A;  4FK0 A;  3K5N A;  4YNQ A;  3KLH A;  3HPO A;  3AO4 A;  1BQM A;  3KD1 E;  1RDC A;  3VQB A;  2FC0 A;  2HHS A;  3L2U A;  3AVL A;  1SKS A;  1HQU A;  3V1R A;  4J2A A;  1JXB A;  1D9D A;  3TAQ A;  1DTT A;  4BDP A;  4Z4E A;  3HK2 A;  4DTM A;  4KHY A;  3MXJ A;  4LSL A;  1FXX A;  3F9K A;  2PYL A;  4FJJ A;  4QOZ B;  2HNY A;  3DLR A;  1WSE A;  4FLV A;  4FLU A;  2B5J A;  3G0Z A;  2XRI A;  1JL2 A;  3DOL A;  4CHZ A;  3T1A A;  3VA3 A;  1UAX A;  4DTO A;  1LW0 A;  1HNI A;  1WSI A;  3K59 A;  5I3U A;  1LWC A;  1QSS A;  4WE1 A;  4B8C A;  4CJV A;  4DQI A;  1B9D A;  1YTA A;  4CEC A;  3NGI A;  4CJE A;  3I0R A;  4G1Q A;  4I2P A;  4AHR A;  1X9W A;  1S6Q A;  4FZY A;  5HRR A;  4FLX A;  3LP2 A;  3NE6 A;  4E7H A;  2YKN A;  3NGZ A;  4DSL A;  3RMC A;  3VQA A;  4F2R A;  1NK8 A;  4DTP A;  1UOC A;  4CHP A;  5J2Q A;  1QSY A;  2HW3 A;  1CZB A;  1BCO A;  5CZ1 A;  1L3T A;  4Z4I A;  4IG3 A;  1RIL A;  2LSN A;  3AVI A;  1ASV A;  4AH9 A;  1HQE A;  3ZSR A;  1U45 A;  3O4Q A;  1CZ9 A;  4CFD A;  1KTQ A;  1XHX A;  3AO5 A;  3OYK A;  3NH0 A;  4FM1 A;  3TAR A;  3L8B A;  4PY5 A;  4N5S A;  5CZ2 A;  4ZTF A;  3SJJ A;  1J5O A;  1B9F A;  4CJT A;  4OKJ A;  4E1M A;  4AHT A;  1KCF A;  1WSH A;  3G10 A;  3DMJ A;  1BQN A;  4E7K A;  1LWF A;  5HRP A;  3NGY A;  3L2V A;  4ICL A;  1F21 A;  3LAL A;  4LH5 A;  4CEF A;  4DFK A;  4RW7 A;  4NYN A;  2G8V A;  1Q9Y A;  3QER A;  1TKT A;  3LZI A;  4M41 A;  4PA1 A;  5KI6 A;  1WN7 A;  4CF1 A;  3JYT A;  4B9L A;  4FW1 A;  4DF8 A;  4Z0U A;  3OYH A;  4DF4 A;  1BIS A;  2QK9 A;  1TGO A;  3HL8 A;  1J53 A;  2ITG A;  3LWM A;  1D8Y A;  3AVK A;  3LPT A;  1EP4 A;  3OYF A;  4BDY A;  1LV5 A;  2AJQ A;  1XWL A;  3SUN A;  2KZZ A;  3HPH A;  1RT4 A;  4N41 A;  3V9Z A;  1XHZ A;  2HVH A;  3CM5 A;  2FBY A;  3RRH A;  4AIL C;  1U04 A;  3TAM A;  4CF2 A;  1KVB A;  4W5T A;  4BWJ A;  1NK5 A;  1SKR A;  3DYA A;  4W5Q A;  1C1B A;  1IO2 A;  1IKV A;  4JRP A;  2ETJ A;  3C94 A;  3HXM A;  4L8R B;  4GW6 A;  3QNN A;  3VQ9 A;  3P5J A;  4ID5 A;  3CQ8 A;  1I39 A;  4KKO A;  1WLJ A;  4CJK A;  3PO5 A;  3SQ2 A;  3SYZ A;  1DTQ A;  3T19 A;  4CF0 A;  4CES A;  1HPZ A;  2HND A;  3OYI A;  2XY7 A;  3ULD A;  3TAE A;  3DLB A;  3HVR A;  4MQ3 A;  2P1J A;  4IBN A;  1SUQ A;  2Z1G A;  3MED A;  5DMR A;  5KRS A;  1RDB A;  3AVH A;  3MEG A;  4JRQ A;  3RWU A;  4KFB A;  3AA4 A;  1JL1 A;  4DQR A;  4AHV A;  2G8W A;  4I9L A;  2HHV A;  1JLG A;  2YHA A;  2YNF A;  2FBT A;  3AVM A;  4B9S A;  4DQQ A;  1KSP A;  4NYF A;  4DTS A;  4M3U A;  4ID1 A;  4FYD A;  1KFD A;  3PX4 A;  3SPY A;  3DLH A;  3TI0 A;  4FK4 A;  1X9M A;  4CFC A;  3S3O A;  4OKK A;  3U3G A;  1S1U A;  1BHL A;  3PO4 A;  2HHW A;  3QNO A;  2Z1I A;  2W42 A;  3KLE A;  3K58 A;  4FJN A;  1BGX T;  1JLA A;  2ATQ A;  3VQC A;  4DTJ A;  1L3V A;  4Y1C A;  4HUG A;  3THV A;  3AVC A;  3QIN A;  1QE1 A;  2OYQ A;  1IKX A;  3DI6 A;  4HTU A;  3NBP A;  3IRX A;  3ZT2 A;  2WON A;  4YFU A;  4FLT A;  2OA8 A;  4H4M A;  3KIO A;  4Z4H A;  1J54 A;  4EZ9 A;  2BAN A;  3AVJ A;  4CJP A;  4DFM A;  5HP1 A;  3TR8 A;  4FJH A;  3OYM A;  4DS4 A;  1BIZ A;  1BI4 A;  4OVL A;  3SNN A;  1XC9 A;  3A2F A;  4XIU A;  4M3W A;  5J2P A;  4CJ4 A;  1KLM A;  4FJ7 A;  2IC3 A;  3HM9 A;  5KGW A;  1L3U A;  3SUQ A;  4B9M A;  1RTI A;  3KKR A;  1WSF A;  4AHU A;  3RMA A;  4H8K A;  3MEC A;  2OPS A;  4FXD A;  3NF7 A;  4IFY A;  2I5J A;  1A5V A;  3ZT4 A;  1T03 A;  1QQC A;  3LPU A;  1ZYQ A;  3V4I A;  2OZS A;  4KB1 A;  4C8O A;  2IDO A;  3RRG A;  1S5J A;  1NK0 A;  3TAF A;  4RW6 A;  3PV8 A;  2HHT A;  1ZBF A;  5SZT A;  4JS4 A;  3SI6 A;  2EX3 A;  2KQ2 A;  4E7J A;  3L2Q A;  1KFS A;  4HCC A;  2G8H A;  4KHQ A;  4CJU A;  4CEQ A;  4ELU A;  3PY8 A;  5SWM A;  4BE0 A;  4E19 A;  4EZ6 A;  1GOB A;  2G8F A;  4CHO A;  3PX0 A;  3OS0 A;  3UIQ A;  1NKC A;  4DU3 A;  2VG5 A;  1WAJ A;  4CIG A;  2EHG A;  4E1N A;  2KFZ A;  4B9V A;  4E3S A;  2Q3S A;  4FJI A;  2BE2 A;  1YVU A;  2VG6 A;  1RDD A;  4W5O A;  5I42 A;  1VSM A;  4MFB A;  5FRN A;  1YTU A;  4CEE A;  2RPI A;  3V1Q A;  4FM2 A;  2Z1J A;  3ZSZ A;  3NAE A;  4FLW A;  4DU1 A;  3MXM A;  2G8K A;  4DWI A;  2A1R A;  4HUE A;  4KPY A;  4CHN A;  3IG1 A;  3O3F A;  1EET A;  4KI6 A;  1EXQ A;  3ALY A;  1TK0 A;  4O44 A;  3OVN A;  4RW4 A;  1SV5 A;  3ZCM A;  3LZJ A;  3OYA A;  1IKW A;  4PQU A;  2QKK A;  5HLF A;  1ASU A;  4W5R A;  4DLG A;  3OYD A;  4FK2 A;  3SQ1 A;  1FKP A;  1BIU A;  4O5B A;  1S6P A;  1C1A A;  2XO7 A;  3L2W A;  1JKH A;  3TAG A;  1TL3 A;  2NUB A;  1NJY A;  1CLQ A;  2YNH A;  1EKE A;  3V9S A;  2GV9 A;  1SL1 A;  2GBZ A;  4HUF A;  1I3A A;  3HP9 A;  3I8D A;  4F8R A;  4F3T A;  4B3O A;  3VQ6 A;  4Y1D A;  3CYM A;  3DLK A;  4O0I A;  1Q8I A;  1RTH A;  1RBR A;  4Q0B A;  2VG7 A;  1ZBU A;  4CJ3 A;  2E6M A;  4DU4 A;  1NK7 A;  4DMN A;  4OLB A;  1RT1 A;  1U4B A;  2D0A A;  2O4G A;  3NF8 A;  3OYJ A;  3QET A;  4O0J A;  4CER A;  3QO9 A;  4DSF A;  1RT6 A;  1K6Y A;  1JLB A;  4OGE A;  3OYB A;  4FJM A;  3V9U A;  1VSK A;  3DOK A;  3U6F A;  4BDZ A;  3ZT0 A;  3MXI A;  5C42 A;  1VSD A;  4B9T A;  4HCB A;  4N47 A;  3L3V A;  1T7P A;  4NCB A;  5HRN A;  2YNI A;  1BI4 B;  1FK9 A;  1TV6 A;  3AA3 A;  1QHT A;  4ZHR A;  1L5U A;  1VSF A;  3P83 D;  4CFA A;  4F3O A;  4M45 A;  4J2E A;  1S1V A;  3DM2 A;  4B9N A;  2XY5 A;  2BDP A;  4CJ5 A;  3AO1 A;  3CFP A;  5J2N A;  4DFJ A;  1WAF A;  3AO3 A;  1TKD A;  4KHS A;  1C0T A;  3ZSV A;  3KLI A;  4FCY A;  4OKE A;  4TSX A;  2IGI A;  3WNE A;  1NJX A;  1RBV A;  3SPZ A;  2DY4 A;  4ELT A;  2D0C A;  1G15 A;  1C1C A;  4N56 A;  3M8R A;  3T3F A;  1JLC A;  1JXE A;  1ZBI A;  2GUI A;  3VQD A;  5HRO A;  4F4K A;  2KFN A;  4LY7 A;  1TKZ A;  4O4G A;  3ZSO A;  4K8X A;  4CF9 A;  3VA0 A;  3D45 A;  4DQS A;  2P5G A;  1S1X A;  3VQE A;  4CIF A;  3OJU A;  1KVA A;  3AVF A;  2X6N A;  2Y1I A;  1SL0 A;  5C25 A;  3KKS A;  4GMJ B;  3M8P A;  2D0B A;  4AHS A;  1NK4 A;  1NOZ A;  1T05 A;  2O4I A;  2IAJ A;  1IKY A;  2YNG A;  4FJG A;  3LWL A;  4CEB A;  3KTQ A;  4FVM A;  2B6A A;  1NK6 A;  1QTM A;  3VQ4 A;  4DG1 A;  3ITH A;  4KTW A;  3KK2 A;  3SV4 A;  2D5R A;  3SUP A;  2DFH A;  3LAK A;  1W9H A;  3M8S A;  4UQG A;  2HMI A;  3IS9 A;  3KK1 A;  1A5W A;  4R5P A;  3NDK A;  4QCL A;  4CEA A;  4CE9 A;  3WNG A;  4E89 A;  3TAN A;  1UA1 A;  1HJR A;  3DRR A;  2HB5 A;  1JLF A;  1RT2 A;  2RKI A;  5HBM A;  5FRO A;  1Z25 A;  3HPG A;  4CK3 A;  3NCI A;  3SUO A;  1HYS A;  4OGC A;  1S1W A;  3LDS A;  4DFP A;  1B92 A;  3VQQ A;  3IAY A;  2A1S A;  4GVM A;  1VSJ A;  3VQP A;  2FBV A;  4CHQ A;  3AVG A;  3ZSQ A;  4B08 A;  2R7Y A;  1REV A;  4OPJ A;  4JLH A;  4DTU A;  1EX4 A;  3C6U A;  3FFI A;  4RW8 A;  4E7L A;  3TAB A;  5D3G A;  4DTN A;  1JLQ A;  5KTQ A;  1C6V A;  3LAN A;  1L3S A;  4FJ9 A;  4FLY A;  3I0S A;  4RW9 A;  4CJF A;  1ITG A;  2FBX A;  4I9Q A;  4KTZ A;  3CM6 A;  1VSI A;  3LP1 A;  1NJW A;  2WOM A;  4CF8 A;  1VRU A;  2X78 A;  4KO0 A;  5JS1 A;  4B9U A;  3NF9 A;  4KI4 A;  1RBU A;  4CED A;  3B6O A;  4KHN A;  2IOC A;  3NF6 A;  4DSJ A;  2XY6 A;  1N5Y A;  2HNZ A;  2IS3 A;  3ASM A;  4CJL A;  3VN5 A;  3CFR A;  3V6D A;  1RBT A;  3S3M A;  3RR8 A;  5CYM A;  4BE2 A;  3H08 A;  1DLO A;  3AVN A;  4B8A B;  3RR7 A;  2QKB A;  4M3Z A;  3HVT A;  4K8Z A;  1RDA A;  3ZSY A;  1HMV A;  3K5M A;  5J1E A;  5E41 A;  1TK5 A;  1C0M A;  2JGU A;  2F8T A;  3L2R A;  2XY8 A;  2HHU A;  3O3H A;  4I7F A;  4M3R A;  4CGG A;  3OYG A;  3OJS A;  2G8U A;  4DSE A;  4CEO A;  1RBS A;  3QLH A;  4M3Y A;  2HVI A;  4KB0 A;  2KZM A;  3DLG A;  2X6S A;  3ZT3 A;  3ZT1 A;  3V9X A;  1NOY A;  3M8Q A;  2G8I A;  4NCG A;  2OPQ A;  1TL1 A;  1RCH A;  1HRH A;  3VQ8 A;  3KLF A;  4CIE A;  1Q9X A;  4ELV A;  1LAV A;  4FM0 A;  1SKW A;  4J2D A;  3SCX A;  4PWD A;  4OLA A;  4C8L A;  4FJ8 A;  3DRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...