5KGWA

Hiv1 catalytic core domain in complex with inhibitor: (2~{s})-2-[3-(3,4-dihydro-2~{h}-chromen-6-yl)-1-methyl-indol-2-yl]-2-[(2-methylpropan-2-yl)oxy]ethanoic acid
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
153
structure length
134
Chain Sequence
b'CSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
molecule tags Transferase/transferase inhibitor
source organism Human immunodeficiency virus 1
publication title Indole-based allosteric inhibitors of HIV-1 integrase.
pubmed doi rcsb
total genus 44
structure length 134
sequence length 153
ec nomenclature
pdb deposition date 2016-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5kgwA00
1BGXT 3L2QA 4CHQA 5KI6A 1UA0A 1VK0A 2HB5A 4CFCA 5J2MA 1FK9A 4E0DA 4DSKA 1NK9A 2DTUA 3C6TA 4W5OA 2HVIA 5HRRA 3TARA 4CF2A 3AA2A 2HHSA 4CEOA 2HHWA 1D5AA 4DFPA 3NF8A 2ZD1A 2IAJA 3CM6A 3OYLA 3V6DA 1CZBA 1GOBA 5EU7A 3KKRA 3TAGA 2GUIA 3DLKA 1RTIA 2RN2A 4KHNA 3L3VA 2WOMA 1D9DA 1NJYA 3S3OA 1N5YA 4DTXA 2Z1GA 3OYNA 4CGGA 4B9MA 3ZSWA 4DQQA 1T05A 1LV5A 3DRSA 1WNSA 4DG1A 4IFVA 4AHUA 1RBRA 4NYNA 3ZT4A 1D8YA 2IDOA 1RT1A 1RTJA 4LY7A 3VQCA 3CFPA 1Q8IA 3S9HA 1U04A 3VQBA 3AO1A 3IG1A 4OVLA 1WN7A 4Z4CA 2OA8A 3NE6A 1EP4A 2BE2A 3QETA 4PWDA 3B6PA 4CJWA 3MXMA 1VSMA 1HNVA 4FK2A 3HK2A 3V9SA 4IDKA 1NK8A 4DU1A 4HCBA 1TL1A 3K2PA 3KD5E 1IKVA 1WSHA 2G8UA 4E7IA 3RMAA 3QEPA 4DF4A 1RDBA 4H4OA 4DSIA 3DMJA 3HJFA 4J2EA 4K8XA 1A5VA 3LDSA 1BISA 3OYHA 4KPYA 2D0AA 3HO1A 2B4JA 1VSDA 1KLNA 1KFSA 1VSJA 1QE1A 4DF8A 1UOCA 3DI6A 5KRTA 1YVUA 2O4IA 3VA3A 4CJPA 2YHBA 3QESA 1BI4A 2ETJA 3QNOA 1X9MA 1BIZA 4HVJA 4ELTA 4K8ZA 4M3WA 1C0TA 4PA1A 3U6FA 3RRHA 3L3UA 1VSEA 4BE1A 4CJLA 4CHYA 2OZMA 1VRUA 1ZBFA 2D0BA 1LAWA 4FJXA 3KLEA 2FC0A 4O44A 4DMNA 3DLRA 4CK1A 1S1UA 2IOCA 4FLXA 3PV8A 1U48A 1L3SA 4DLEA 4OGEA 2RPIA 4FZYA 3QINA 3WNGA 3ZSRA 1HNIA 3KLIA 3CFOA 4MQ3A 3V1RA 2X6SA 1SKSA 4OJRA 1QSSA 3L8BA 4CJSA 2G8VA 4CEQA 4KFBA 3V1QA 3KJVA 3ZT3A 3LPTA 4H8KA 3ZSYA 4KB1A 4Z0UA 2OPSA 4KRFA 4EZ6A 3A2FA 4AHTA 1TKXA 4DFJA 2KW4A 1LW2A 2P1JA 1QHTA 2GBZA 3M8QA 4RW7A 3ZT0A 4FM1A 4E7LA 1RDCA 5J2QA 3HSTB 3RMDA 2F8SA 2XHBA 3K59A 1KVCA 4OPKA 3KLGA 1ZBIA 1EXQA 3K57A 3KTQA 3ZSQA 5E41A 3PX0A 1L3UA 5FDLA 3VQEA 3OYBA 3SV3A 3ZSVA 1JLCA 3KK3A 2G8KA 4AHVA 2XO7A 1RBTA 4DU4A 1G15A 3SQ1A 1U47A 4B9UA 4KB0A 3EYZA 4NCAA 3V9XA 1R0AA 1IKYA 3TAQA 4CK3A 1QSLA 4CJFA 4DQPA 4ELVA 2B6AA 3NFAA 1LAVA 2VWKA 3PO4A 2OPPA 3QO9A 2GV9A 3RRGA 3MECA 3O3GA 4M3XA 2HHQA 1BQNA 1RTHA 4IG3A 1KSPA 4CEAA 4JRQA 5I3UA 1SUQA 3KIOA 4QOZB 4FW1A 2LSNA 2JGUA 1RNHA 1ASUA 4BE0A 2D0CA 3SPYA 1NJZA 4JS4A 5HBMA 4KHWA 1WSGA 4Z4EA 3AVCA 3NF9A 3VQ8A 4EP5A 3L2UA 3SZ2A 1ITGA 1N6QA 2BDPA 4F3OA 2EHGA 3CM5A 1BI4B 4CF0A 1B92A 1UAXA 3T3FA 1RTDA 1F21A 4OKEA 3JYTA 1C1BA 4C8NA 5HRSA 4BDYA 2YV0X 4BACA 4KHUA 1A5XA 4FW2A 4KTQA 4F3TA 4CJQA 3AVKA 3L2VA 4FLVA 2PYLA 1J5OA 2VWJA 3F73A 1GOCA 1NKBA 4IFYA 4E89A 2VG5A 2FBTA 1ASWA 2VG6A 1NK7A 1X9SA 2AJQA 3MXJA 4KKOA 3T1AA 2E6MA 4Q5VA 1LWFA 4CJ3A 4DQRA 4M42A 4OLBA 3WNEA 1DTQA 3E01A 3ASMA 4CF8A 4DU3A 2XY6A 2D5RA 4DTJA 1RBSA 2RF2A 2G8HA 1C1CA 4MFBA 1NOZA 2I5JA 5CYQA 1XHXA 2P5OA 1NJXA 3OYEA 4KREA 4DSFA 4M3ZA 2KFZA 1ZYQA 3OS2A 1T7PA 4KHSA 1QS4A 4OKKA 1KCFA 3V81A 1TKZA 1Z25A 2ZQBA 4EZ9A 3AA4A 3TI0A 2G8IA 5HRPA 1QTMA 4CK2A 4FJLA 3CQ8A 3S3MA 4J2DA 3I0SA 3LAKA 3U3YA 2HHUA 1NK6A 4KV8A 4QAGA 1KVAA 3PY8A 4I9QA 2DFFA 2P5GA 4CEZA 1NKEA 4W5NA 4BDPA 1BIUA 4DS5A 1UWBA 4N76A 1TL3A 1EX4A 4J2AA 5KGWA 1VSFA 3THVA 2YNFA 4FJ5A 3D0PA 4LD0A 3VQQA 3I8DA 3VQ5A 4DQIA 1C1AA 3TR8A 4F8RA 4E1NA 1KLMA 4DTPA 2Y1JA 3G0ZA 4BDZA 4CFAA 2JLEA 1IO2A 3IAYA 3QEWA 4N56A 4CGJA 3HM9A 2PY5A 1TK0A 2KQ2A 4FXDA 3IS9A 2XY8A 4JLHA 4LSNA 4CEFA 1BL3A 3C6UA 4NCBA 1DTTA 1VSLA 2XRIA 4O4GA 4AHCA 3NH0A 1TKDA 4E3SA 1Z26A 5DK5A 3SUQA 4LSLA 4G1QA 1J54A 4H4MA 3SI6A 4CEBA 4AHRA 2G8WA 5HLFA 4FJGA 3ZSXA 4O0IA 1ZBLA 2HHXA 3MAQA 2Z1JA 3DM2A 3VQAA 4PUOA 1K6YA 3AVBA 1JLEA 1O1WA 2VG7A 3WNHA 3OYGA 1J53A 4KI6A 4E7HA 3DOKA 1CXUA 1ZBUA 3OYAA 5J1EA 1NJWA 4O55A 4N41A 4CHPA 3RTVA 3AVNA 3AO4A 4FK0A 1RT6A 4Z4GA 2W42A 3VQDA 4FJKA 1RCHA 3OJUA 4N47A 3ZSOA 2X78A 1WAFA 1HQUA 4CEDA 3LANA 4CGFA 3OY9A 1LWCA 3KD1E 2FBXA 4CJKA 3HT3A 1KFDA 3ZSZA 1FKPA 5C25A 3U3GA 3F9KA 1LWEA 4FLYA 2KZMA 4Z4IA 1RILA 3DLHA 1WSEA 4RW4A 4NYFA 4YFUA 4JRPA 3G10A 4JS5A 4O0JA 4HUEA 1TV6A 3TAFA 1SL1A 4CIEA 1FKOA 1RT5A 1L3VA 3LZIA 3VQ7A 5CZ2A 3NAEA 3M8RA 1RBVA 4O5BA 3NH1A 1C0UA 2HNYA 3SCXA 4ZTFA 2R7YA 2F96A 1I3AA 1X1PA 4RW6A 4CF1A 5HP1A 3AVJA 2QKBA 2QKKA 4CE9A 4CIFA 1FXXA 4DTOA 5HRNA 1QQCA 3QIPA 1TAQA 1TVRA 1SV5A 2IS3A 3IRXA 1REVA 4B9LA 3LP3A 3O3HA 1L3TA 4CHZA 1S1XA 3P83D 3KLFA 3EY1A 4C8KA 1VSHA 3HVTA 4L8RB 4FJ8A 1CXQA 3AV9A 1B9FA 1HRHA 4AH9A 3RWUA 3TAPA 4AHSA 3VA0A 3AVIA 3C95A 3T19A 1JKHA 4XIUA 1VRTA 1EKEA 2OPRA 3AVGA 3V1OA 3ISNC 4W5RA 3RMCA 4DTNA 1TK8A 2HMIA 4DFMA 1C6VA 4CFBA 3NGZA 3NH2A 3SV4A 3DRRA 3NGYA 4CHNA 3SUPA 2Z1HA 4ICLA 1CLQA 3NF7A 1BCMA 1JLAA 2IC3A 2ITGA 4J2BA 2G8FA 1JLFA 4GMJB 2DFHA 4C8MA 3K58A 3AVLA 4CGHA 4F2RA 4Z4FA 3DRPA 3PX4A 4N5SA 4WE1A 1U4BA 2YNIA 5FRNA 1Y97A 3SYZA 3QEIA 2EX3A 2Z1IA 4FJJA 3TABA 1TGOA 3I0RA 3PUFA 3O4QA 4DSEA 1IG9A 2KTQA 3LP0A 3PX6A 3M8PA 2XY7A 4ZTJA 4E19A 1HMVA 3D45A 3HL8A 3TAMA 4RW9A 3VQ9A 4CJEA 3QEVA 4HCCA 2DY4A 3MEGA 1XI1A 4B9NA 2PZSA 4FCYA 2ZE2A 3AO2A 5KGXA 4FJIA 1NK0A 3SPZA 4QCLA 3LWLA 4KI4A 4KTWA 1YTAA 4ID1A 5CY4A 3V9ZA 4M3YA 4FM2A 2YKMA 3V4IA 3HPHA 3OYJA 3LZJA 4DS4A 4CJ4A 5J2PA 1A5WA 5DMRA 5FROA 4CHOA 2A1RA 3PO5A 3AA5X 1WLJA 2B5JA 4I2PA 4IBNA 3RMBA 2RKIA 3HPGA 3DLEA 5T7BA 1QSYA 3ZCMA 3V9WA 3NF6A 4HUGA 4KAZA 1B9DA 3DLGA 3O4NA 3OJSA 1DLOA 1RT4A 3VQ6A 5I42A 4DTRA 4FLTA 1T8EA 2O4GA 2HNZA 1NOYA 4FVMA 4I2QA 1IKWA 3LWMA 2HHVA 4HTUA 3LAMA 1HJRA 2KZZA 4DTMA 4IG0A 2F8TA 3OVNA 2NUBA 2X6NA 4Q0BA 5HROA 4IKFA 2A1SA 3KK2A 4CEEA 1HPZA 5SWMA 1JXBA 3ULDA 4DSLA 4CCHA 4BWJA 1XC9A 1HQEA 4FZZA 1BCOA 1RT3A 4CESA 4OGCA 5SZTA 1SKWA 3KK1A 3OYCA 1WAJA 4KO0A 4B9VA 1WSIA 3B6OA 1S1VA 3LP1A 1KTQA 2Q3SA 3KKSA 1S9EA 4LH5A 4RW8A 3OS0A 1Q9XA 1S9GA 3VN5A 2FBVA 3KLHA 1WSFA 3CYMA 3MXIA 1W0HA 3K5NA 5K14A 4KHYA 4HUFA 4CF9A 1X9WA 1J9AA 3QLHA 4B08A 3ZT1A 4FJNA 4TSXA 3AA3A 1C0MA 3AVHA 3BDPA 2YNGA 1XWLA 4M3UA 4E1MA 4W5QA 3CG7A 3P5JA 3SNNA 5C24A 1S1WA 2BGGA 1D9FA 1Q9YA 3MEDA 4OLAA 3BGRA 3QERA 4CJTA 1KRPA 4ZHRA 4CERA 3VQ4A 2ATQA 3HP6A 3SUNA 4FJMA 1ZBHA 1HYSA 1YTUA 1BQMA 4M45A 4E7KA 3SQ4A 3QIOA 3HXMA 1NK4A 2PYJA 2HHTA 1S6PA 1U49A 4GVMA 1EETA 1VSKA 4CJRA 1L5UA 3HPOA 5JS2A 4FZXC 4W5TA 3V9UA 3L2WA 1UA1A 4YNQA 3M8SA 3EZ5A 4LH4A 3NDKA 1JLBA 1KVBA 2Y1IA 1SL2A 4KHQA 2QK9A 3OS1A 3SUOA 4B8CA 1RT7A 4NCGA 3AO5A 2WONA 4FLZA 5JS1A 3OYKA 3JSMA 5KRSA 3SQ0A 4DLGA 1ASVA 3LP2A 3O3FA 3HYFA 4F2SA 3DOLA 4KTZA 1S6QA 4RG8A 5CZ1A 3ITHA 4DTSA 1NK5A 2OPQA 1JL1A 4DFKA 1GOAA 2DFEA 4FJ7A 1W9HA 4I9LA 1I39A 2P51A 4M3RA 3ALYA 2HW3A 5J2NA 3K5MA 1TK5A 1TKTA 4C8LA 1XHZA 1LW0A 4M41A 1SKRA 1U45A 4FJ9A 3AVFA 3WNFA 4B9SA 4CJVA 3CFRA 3NBPA 1BHLA 1RT2A 1T03A 2E6LA 4OPJA 3ZT2A 4E7JA 5CYMA 4EP4A 4DTUA 4PQUA 4CGIA 1IH7A 3AVMA 3MEEA 3HVRA 4OKJA 4C8OA 1TAUA 3UIQA 4GW6A 3K5LA 3DYAA 1YT3A 4UQGA 3RR8A 3TWHA 3FFIA 3NHGA 3QEXA 4FYDA 3RR7A 2IGIA 3OYFA 4R5PA 4CJUA 2KFNA 3QNNA 4Y1CA 1HYVA 3TAEA 1JL2A 3OYMA 2BANA 3P1GA 3NGIA 4DWIA 2YHAA 4CFDA 4DSJA 3NCIA 4F4KA 4CJ5A 3SJJA 2OYQA 3AO3A 4FJHA 1RDAA 2X74A 2YNHA 3H08A 4ELUA 4AILC 4I7FA 3L2RA 3C94A 3OYIA 5KTQA 1IKXA 1MU2A 3SQ2A 3S3NA 1HYZA 4Y1DA 4B9TA 4FLUA 4FLWA 1JXEA 3HP9A 1JLQA 3TANA 2HVHA 2E4LA 1JLGA 1RBUA 1VSIA 4HHTA 1RDDA 3LALA 4FM0A 3LPUA 4BWMA 4PY5A 1S5JA 4B3OA 2OZSA 1S1TA 3VQPA 3AVAA 1SL0A 1NKCA 4M3TA 2HNDA 3OYDA 2QXFA 4FK4A 5FRMA 4B8AB 3K5OA 1WSJA 4CECA 4Z4HA 5D3GA 2FBYA 4CIGA 1CZ9A 2XY5A 4BE2A 2YKNA 4ID5A 5C42A 4DQSA 3DLBA 4CGDA
chains in the Genus database with same CATH superfamily
4CHQA 2QTDA 4DV6K 5GAGP 1EO1A 3AGRA 2DTUA 2HVIA 4W5OA 3TU5A 3TARA 3AA2A 3V6DA 2IAJA 1OVYA 3KKRA 3TAGA 4PKHA 5C10A 3DLKA 2FSJA 1NJYA 2O8FB 1NWKA 1N5YA 4CGGA 3ZEUA 5F0XA 4B9MA 1LV5A 3J8AA 5EVZA 4FVUA 3TTCA 4IFVA 5AQZA 1NGAA 4C1NK 4JKBA 4LF5K 3IG1A 2BE2A 4PWDA 3R1XA 2WTUA 1VSMA 3MXMA 3CCRN 2P9IA 4IDKA 1TYQB 4BGAA 4FOEA 5HL7L 4BRLA 3KD5E 3CPEA 4FWNA 4GVEA 4DF4A 2P9NB 1W7AA 1A5VA 4J8FA 2D0AA 3U9DA 4A59A 1VSDA 1KLNA 2O4IA 5KRTA 1YVUA 1BI4A 1X9MA 4ELTA 3U6FA 4BE1A 2P9UB 4CJLA 1VRUA 2D0BA 1ZBSA 2CH5A 3A5MC 4ISEA 3CXCM 5AQNA 3E9OA 4JV5K 3ZSRA 3CFOA 2W40A 2X6SA 1QSSA 2ZWHA 2QWRA 4CJSA 4B3RK 3V1QA 4NB4A 2O8EA 4DR1K 3ZSYA 1ZXOA 4WF9L 4Z0UA 3WXIA 4EZ6A 3A2FA 2BTFA 2W6LA 4DFJA 1QHTA 2GBZA 4RW7A 4FM1A 4E7LA 4HWIA 1WBBA 2XHBA 2CGJA 3LDOA 3ZSQA 1HUXA 2HF3A 5FDLA 4AHVA 2P9SB 1RBTA 4NCAA 3VF2A 3V9XA 4CJFA 1HNWK 2NRTA 5TKYA 3PO4A 2GV9A 2HHQA 3MECA 1Q7YO 1GLAG 3BY5A 4WFBL 4FW1A 1RNHA 3SPYA 4IDHA 4Z4EA 4JS4A 4KHWA 4M7XA 3L2UA 2BDPA 4WYBA 3CM5A 4CF0A 4A62A 3WXLA 5EOYA 1A5XA 2VQFK 3AVKA 1OH8A 4BR7A 3F73A 1NKBA 1OH6A 2VCPA 5AQXA 4KKOA 4DR7K 4JI0K 4M42A 2Q31A 3WNEA 1DTQA 3E01A 1S22A 1YAGA 3VF4A 1YF5L 1NOZA 2I5JA 3CCSN 1NJXA 4KREA 2A5XA 1T3VA 2Q1NA 1Z25A 2ZQBA 4EZ9A 3AA4A 1P90A 5HRPA 1QTMA 4CK2A 4FJLA 3CQ8A 3AAQA 3U3YA 4DR6K 2QI2A 4I9QA 1MWKA 3JXUA 4CEZA 5AQUA 4W5NA 1BDGA 1BIUA 1W97L 4HTLA 4IOCL 1EX4A 4J2AA 1VSFA 4H0PA 3VQQA 3I8DA 4DQIA 1C1AA 4F8RA 4E1NA 3GDQA 3T1YK 3K9JA 4CFAA 3QEWA 3O9TA 4N56A 2D0OA 1KAYA 1ATSA 4CEFA 1DTTA 1TKDA 5FPDA 3SUQA 3EZWA 5TKWA 4LF4K 3SI6A 2GWJA 5C0YA 5HLFA 3ZSXA 5LJWA 4DR5K 2Z1JA 3O9RA 3VQAA 2F4VK 1NBWA 5IT9O 3WNHA 3A5OC 4KI6A 4E7HA 3CQXA 1CXUA 3OYAA 5EY4A 3UKUA 4CHPA 4FK0A 3AO4A 1RT6A 3D2EA 4N47A 2P9LA 1WAFA 4BRIA 4CEDA 3OY9A 3UB5A 3C0BA 5C25A 3F9KA 2ZGZA 3D2FB 4CW7B 4I6MA 3W3DA 4JKGB 4BGBA 4LF6K 4O0JA 3TAFA 3O9SA 2YX6A 4GY2B 3WXKA 3R9PA 3VGKA 3OW2M 1ATNA 2R7YA 4JKEA 1N33K 1MA9B 4CIFA 4QS7A 3WEEB 2Q36A 1QQCA 3UKUB 2A3ZA 3LP3A 3O3HA 4CHZA 1S1XA 1NGEA 3P83D 4C8KA 2UU9K 1VSHA 3LDPA 4YOYA 4FJ8A 1VQ7N 1CXQA 1HRHA 4AH9A 1J6ZA 1JKHA 2GELA 3AVGA 3ISNC 1G99A 3L6QA 1X3NA 4DFMA 3DRRA 1KAXA 3H3OB 3ENOA 4H03B 3NF7A 1BCMA 2ITGA 4J2BA 2DFHA 3G25A 3AVLA 1E4GT 4BR2A 4F2RA 5FRNA 4FJJA 1GLEG 4A57A 3NVKA 4LF7K 3BUZB 4RW9A 2DY4A 5FPEA 4IO9L 2ZE2A 3AO2A 2IVOA 3A5LC 4A2BA 3D7EO 3OYJA 3MN6A 3AARA 5FROA 1VQON 2A1RA 3AA5X 2B5JA 4JN4A 2NLXA 1QVGM 3V9WA 4HUGA 1HX1A 4LF8K 2V51B 1RT4A 3VGMA 3CQYA 2HNZA 1SS6A 4H5RA 4JK9A 3LAMA 3P39A 4IG0A 4FWPA 2X6NA 4Q0BA 4IKFA 2A1SA 3VETA 5SWMA 3H1QA 5EX5A 4BROA 1JCFA 1BCOA 3KK1A 1WAJA 3B6OA 1S1VA 3KKSA 2FBVA 4IXCA 1WSFA 3FZLA 4JI7K 1HKGA 1C0MA 4C1NI 2YNGA 4B1YB 3P5JA 5C24A 5C2FA 1D9FA 1Q9YA 1YHQN 4CJTA 3JS6A 4ZHRA 3HP6A 2ATQA 3QBWA 4FJMA 1YTUA 3HXMA 2PYJA 5AQIA 5AQSA 1EETA 1VSKA 3LDNA 3D2FA 4JI2K 3DLLL 1UA1A 4YNQA 3K0SA 3NDKA 1JLBA 2E2PA 3ATUA 3OS1A 1YUWA 3BZCA 3Q7BA 2QM1A 1GLCG 4CBWA 4DLGA 3O08A 3O8MA 3HYFA 4F2SA 3MDQA 3NVMA 3ITHA 1NK5A 1JL1A 1ATRA 4FJ7A 1I39A 4JI6K 3ALYA 4MLEA 3K5MA 2GUPA 1IJJA 1SKRA 3AVFA 4FWLA 3HM8A 1T03A 1YJ9N 4E7JA 3ZT2A 4EP4A 2RE2A 4PQUA 4DR4K 3MEEA 1DKGD 1QQNA 4C8OA 1RDUA 3UIQA 3DYAA 5C15A 3TWHA 5KPRA 5AZIA 3RR7A 2IGIA 4DV7K 3O9QA 4R5PA 3FGUA 4CJUA 4B3TK 3QFPA 3OYMA 5DM6L 3D2EB 2YHAA 4CFDA 3SJJA 4FJHA 3FR0A 3S3NA 2QWOA 4FLUA 5ELZA 4FLWA 1JLQA 1SAZA 2P9UA 3FZFA 1RBUA 4CD1A 4K41A 5JMVA 5IWAK 1S1TA 3AVAA 2YHWA 4M3TA 3VTHA 2WBNA 3L4QA 4CIGA 4BE2A 2ASPA 4ID5A 3O4WA 3EE9A 2D4WA 5JVHL 3TTFA 5I9EB 4BRDA 3VENA 4CFCA 1LOTB 1NK9A 5HRRA 5AZJB 3SBTA 2HHSA 1D5AA 4DFPA 2ZD1A 3CM6A 2GUIA 2RN2A 3S3OA 3VGLA 2Z1GA 3IMXA 1S3XA 4V19S 1NGJA 3DRSA 1WNSA 1RBRA 1D8YA 2IDOA 1RT1A 1RTJA 4LY7A 5KQDA 3AO1A 4OVLA 1WN7A 2OA8A 4BRKA 5CE3A 3V9SA 4DU1A 2E1ZA 4HCBA 3K2PA 4K25A 1N36K 3RSEA 2A40A 4AM6A 1WB9A 3J7AP 4BVPA 1WSHA 4E7IA 2QWNA 3QEPA 4FPBA 4FSVA 4H4OA 4DSIA 4PL8A 4K8XA 3N4QA 3OYHA 4KPYA 5E84A 2W6KA 4DF8A 3FFKB 3VA3A 2P9KA 4M3WA 3QNOA 4GV3A 3L3UA 1VQLN 2ITMA 4CHYA 2OZMA 3EO3A 1W2BM 4FJXA 1Q81O 3CETA 4YORA 5AR0A 3U4LA 3EE8A 4FLXA 1U48A 1TUYA 4DLEA 4FZYA 3ZX2A 1BA0A 1HNIA 3KLIA 1SKSA 4OJRA 2NZTA 4CEQA 5AQLA 4KFBA 3KJVA 3LPTA 4KB1A 1Z05A 2KW4A 1NGBA 3OA9A 2OCEA 3VTIA 3ZT0A 5J2QA 1RDCA 4NLBA 5AQVA 3KTQA 5AZIB 1NLVA 3SV3A 1IBLK 3KK3A 1JLCA 1GLBG 1G15A 4B9UA 3G71N 4DQPA 1QSLA 4CK3A 3NMUA 3RRGA 2OPPA 3QO9A 3QFUA 4CEAA 1OH5A 1V4SA 3H1VX 2HBMA 1U2VB 5I3UA 5H1SQ 3KIOA 4DV0K 1BO5O 2JGUA 2QEXN 1ASUA 2D0CA 4FWMA 1WSGA 4EP5A 3C6HA 1NJIO 3DAWA 3ZEUB 3F9MA 1ITGA 4F3OA 3DWLA 3HTVA 4GKJK 1UAXA 5GADP 3THXA 2QXLA 4C8NA 5HRSA 2YV0X 4BACA 4KHUA 4F3TA 4X62K 4JHDB 4FLVA 2VG6A 1LWFA 3HZ6A 4YOWA 1X3MA 4DQRA 2XY6A 1RBSA 2G8HA 1C1CA 4MFBA 3O5BA 1XHXA 4EFHA 3SAGA 1NNEA 2KFZA 1T7PA 4KHSA 1QS4A 1TKZA 3TI0A 2G8IA 3F5TA 3SMSA 3S3MA 4J2DA 2YHXA 3C7NB 3I0SA 3OHRA 3CD6N 1KVAA 2PFUA 1NGIA 4PHTX 3ID6A 3CCJN 4N76A 4MDBA 3THVA 4FJ5A 1Y64A 4LD0A 2YHYA 4H5VA 2P9SA 3TR8A 5AQHA 3G0ZA 1IO2A 5ADXH 5KPTA 3UE5A 5EXWA 3VEVA 3HM9A 4U67L 2KQ2A 2WC9A 3IS9A 4JLHA 3C6UA 4O4GA 4LSLA 3E9PA 4CZHA 5BRDA 4FPAA 3O6WA 4CEBA 3OBYA 4O0IA 3DM2A 3SBGA 1V4TA 3M3ZA 4MDAA 3J81O 4PUOA 1JLEA 4FWQA 1EWRA 3DOKA 5LJVA 3N4PA 5J1EA 4O55A 4N41A 3RTVA 4Z4GA 2W42A 1RCHA 3ZSOA 2X78A 4A2AA 3E1YA 3E9LA 2HBLA 4AQYK 3U3GA 2KZMA 5FPMA 4ISGA 4YHHK 3BP8A 4JKHA 4RW4A 4NYFA 4YFUA 4JRPA 3G10A 1SL1A 5BRHA 4CIEA 1RT5A 4KH4A 3ZETB 3LZIA 3VQ7A 4CD3A 5CZ2A 3WXMB 4O5BA 3NH1A 2HNYA 4LFCK 4RW6A 5HP1A 4A5AA 2YI1A 2QW9A 5AJ3K 2E2OA 4CZMA 3L4IA 2NRWA 1TAQA 3QIPA 1HJOA 3CC2N 1TVRA 1REVA 4AF1A 3CI5A 3EY1A 3KLFA 3ENHA 5AQTA 3GE1A 1WOQA 3KHYA 3RWUA 2NRZA 3TAPA 4AHSA 1DGKN 3SJHA 3VA0A 3AVIA 3C95A 4XIUA 1VRTA 4IJNA 5AQYA 2V7ZA 5BN8A 4W5RA 3VEOA 2KKZA 4DTNA 1KD1O 2A41A 3NH2A 1VAZA 3KWGA 2Z1HA 1CLQA 1JLAA 2E2NA 4C8MA 2BH1A 3LM9A 2D1KA 3HI0A 4CGHA 4BG9A 3T7ZA 4E1JA 1TGOA 4ISFA 2P9LB 1GLLO 5JVGL 4UY8O 4DSEA 2KTQA 3LDQA 3M8PA 1HMVA 1NG9A 3HL8A 3TAMA 3VQ9A 5JLFA 3QEVA 1FW6A 4CVNE 4R79A 1XI1A 2PZSA 3R3LA 1NK0A 3LWLA 1YTAA 2FF3B 3HPHA 2P9PB 2HMPA 3LZJA 4DS4A 4CJ4A 2OTJN 5AQRA 3QDKA 4FWOA 3PO5A 1WLJA 4IBNA 3CPWM 4H5TA 2VWBA 4X66K 1VQMN 1B9DA 3CJBA 4XEIA 3O4NA 5I42A 3VQ6A 4DTRA 2O4GA 3BZKA 3U8XA 1NOYA 4I2QA 2IIRA 3CJ7A 3LWMA 4GKKK 2HHVA 4C23A 5HROA 2P9NA 3KK2A 2HHHK 4BWJA 1XC9A 4JI5K 1FJGK 1NGFA 3H46O 3DXKB 1RT3A 4BR5A 3IFRA 1IBKK 4BRHA 2P9PA 4RW8A 1S9EA 3EKUA 4YY3K 3K5NA 1HPMA 4KHYA 1J9AA 3O9UA 4B08A 4H0VB 3ZT1A 2W41A 4FO0A 4M3UA 3J7YP 1BA1A 3BGRA 3VQ4A 3SUNA 4M45A 2PAVA 3QIOA 3AAPA 1U49A 5BREA 3HPOA 3M8SA 4LH4A 3D6RA 2QK9A 3SUOA 4B8CA 3A5NC 4H0YB 2FF6A 3AO5A 4XH4A 1XC3A 4YOUA 2WONA 5DM7L 5KRSA 2E5LK 1ASVA 3ULEB 5FPNA 1S6QA 5CZ1A 4DTSA 2OPQA 3CCUN 3Q7CA 4O8KA 4K0KK 1RDWX 2HW3A 4JKFA 4GV9A 4C8LA 1LW0A 4FJ9A 1WUAA 4CJVA 3CFRA 1RT2A 3THYA 2E6LA 3DXMB 2NRHA 4CGIA 3ZX3A 3AVMA 4OKJA 4GW6A 2QWLA 4BC5A 4FYDA 2KFNA 3G6EN 5FLXO 4DKWA 3TAEA 1JL2A 3P1GA 3NGIA 4F4KA 3WQUA 1RDAA 2YNHA 4ELUA 2ZJPL 1NU0A 3VOVA 3C94A 4M7YA 3OYIA 5KTQA 4B9TA 4DV2K 3GL1A 1VQKN 2HVHA 1JLGA 1RDDA 3LPUA 4BWMA 1OVQA 1SL0A 5BPMA 5AQFA 3VESA 2FSNA 2HNDA 3OYDA 3VMFB 5FRMA 2UXCK 1VQPN 3ENBA 4Z4HA 4JAXA 1JJ2M 3CJAA 1BGXT 3L2QA 2UUCK 5KI6A 3CMEN 3K9KA 4JI8K 2YJEA 5J2MA 2YCHA 1ILYA 4E0DA 3OBWA 4IFEA 3C6TA 3WUHA 3CCMN 1NMNA 4JI1K 2HHWA 4CZEA 4JKDA 1GOBA 1RTIA 4WQ5C 4JNEA 1VQNN 4CBXA 1XNQK 4DTXA 2NRRA 3C65A 3ZSWA 4DQQA 1T05A 5AQGA 4AHUA 3P38A 4NYNA 2FXUA 5LMNK 4RTFD 3S9HA 1U04A 2ASMA 4Z4CA 3NE6A 2AA4A 4BR4A 1EP4A 3B6PA 4CJWA 3HK2A 1U2VA 1NK8A 1TL1A 3MN5A 3S41A 2IVPA 1IKVA 2G8UA 2ASOA 3RMAA 4NXMK 1MDUB 4BC4A 3LDSA 3HO1A 2B4JA 1KFSA 1QE1A 3DI6A 1ZC6A 4CJPA 2YHBA 4K8ZA 2Q97A 1VSEA 5KQ8A 1LAWA 3KLEA 2FC0A 3DLRA 3TTDA 2WFBA 2IOCA 3PV8A 1VQ5N 1L3SA 4OGEA 1VQ4N 3QINA 3WNGA 4BRAA 3EL2A 3V1RA 3T1HK 3L8BA 2I7PA 3ZT3A 4H8KA 3MN7A 1TKXA 1LW2A 2P1JA 4DV5K 4LFAK 2F8SA 4CZIA 3HSTB 3QICA 3K59A 4OPKA 1EXQA 3TSQA 2E2QA 5E41A 3VQEA 5F2RA 1U47A 3SQ1A 1BG3A 3EYZA 4ELVA 4B1XB 3NFAA 2VWKA 4M3XA 4DV4K 4IG3A 1KSPA 4EIAA 4H0TB 4CI6A 1JCGA 4JRQA 3ZX0A 2LSNA 4BE0A 4BR9A 3GBTA 5HBMA 3NF9A 1N6QA 2HF4A 2EHGA 1B92A 3I56N 5M1PA 3T3FA 1RTDA 1F21A 3JYTA 3OTOK 4WQ4C 4KTQA 3ZETA 4CJQA 3L2VA 2PYLA 3B8AX 2VG5A 2FBTA 1ASWA 1X9SA 1NK7A 4JYAK 3MXJA 4Q5VA 3TSPA 3VPZA 4OLBA 3ASMA 4CF8A 4DU3A 4DTJA 5AFUH 3EEQA 2RF2A 3O1BA 1O13A 4BY9C 5C12A 1Q82O 3OS2A 4OKKA 1KCFA 3THWA 3V81A 4BRNA 1YITN 3VEZA 3A8YA 3AY9A 3LAKA 2HHUA 4QAGA 1KQSM 3PY8A 3CERA 2DFFA 3IDHA 2P5GA 4KH6A 3CC7N 1BUPA 1UWBA 5KGWA 4RWTA 2YNFA 3C6AA 1N34K 3D0PA 5AQPA 5BPNA 1KXPA 4DB3A 4DCHA 4BDZA 2JLEA 1HLUA 2PY5A 4FXDA 1HNZK 4NCBA 4GNIA 2XRIA 4AHCA 4KBOA 1Z26A 5DK5A 3L0QA 2O8CA 4M63C 2E8AA 4H4MA 4AHRA 4FJGA 1ZBLA 2HHXA 4FWSA 1K6YA 1O1WA 2VG7A 3AVBA 4BRPA 2EWSA 1ZBUA 4IEIA 3AVNA 3UKRB 2O8FA 3CJCA 5CR4A 4CGFA 1HQUA 3LANA 1LWCA 4B9QA 4CBUA 1KFDA 3ZSZA 1FKPA 4DHYA 1XNRK 1LWEA 4FLYA 4Z4IA 5JICA 1QZ5A 5LY3A 2UYTA 1FKOA 4LC9B 2A6AA 2Q0UA 3M8RA 1RBVA 2NNWA 3O1WA 4ZTFA 3SCXA 2F96A 1VQ6N 3AVJA 2GX9A 4H0XB 1Q86O 1NGGA 1FXXA 1GLJO 1SV5A 2IS3A 4MLHA 5KPZA 3AV9A 4BR0A 1EKEA 3KK7A 4MO5A 3RMCA 1TK8A 2HMIA 1C6VA 4CFBA 3NGZA 4CHNA 4ICLA 2G8FA 3HSCA 4GMJB 1Q18A 1X9JA 5AQJA 3K58A 4DR2K 4Z4FA 2E20A 3DRPA 1K9MO 1U4BA 1HKCA 2YNIA 3SYZA 2UUAK 3TABA 4KH5A 1I94K 2CH6A 3O4QA 3U9ZA 1IG9A 4YDUA 3PX6A 4ZTJA 4JEPA 3FE1A 4CJEA 1C0GA 3MEGA 5KGXA 4QCLA 3SPZA 4KTWA 4ID1A 3V9ZA 1YI2N 4M3YA 4FM2A 3V4IA 5M1QA 1A5WA 5DMRA 4CHOA 3ID8A 5BR8K 3RMBA 2RKIA 3HPGA 5BN9A 5BRFA 1QSYA 3NF6A 3DLGA 3OJSA 1DLOA 2ZJRL 1XQSC 4DTMA 4O5FA 2NUBA 4O8UA 1HPZA 4JI4K 4DSLA 4CCHA 3THYB 1HQEA 4A5BA 3ZLJA 4FZZA 5SZTA 3MWPA 4KO0A 1WSIA 1P8ZA 3LP1A 4DUYK 4BC3A 4LH5A 1Q9XA 3R6MA 5GINA 3VN5A 3MXIA 5AQWA 4CF9A 1X9WA 2FSKA 3EN9A 2F9WA 3AA3A 3AVHA 1XWLA 3MCPA 3CG7A 1S1WA 2BGGA 2QWPA 4OLAA 4NO7A 1C0FA 3VF6A 3QBXA 4CERA 4LFBK 2IVNA 2KLAA 1BQMA 4E7KA 3SQ4A 3WXJA 1S6PA 4GVMA 5JS2A 1QQOA 2GWKA 1QQMA 4IJAA 3L2WA 3EZ5A 1SZ2A 1KVBA 4KHQA 2Y1IA 1SL2A 1XMQK 4NCGA 4U7BA 2NRXA 4FLZA 3VEXA 1HR0K 3THXB 3SQ0A 5M1OA 4B1VA 3LP2A 3O3FA 3DOLA 4KTZA 2V7YA 3HRGA 4RG8A 1J5EK 2WUSA 2DFEA 4PL7A 1W9HA 1R59O 2P51A 5F1XA 1YIJN 4K42A 3CMAN 2VYPA 4QS9A 1TK5A 1XHZA 4M41A 1U45A 2KHOA 3M5RA 4L3QA 3GOIA 3NBPA 4OPJA 4JKGA 4DTUA 5C2DA 2A42A 2Q0RA 5GAHP 3MX5A 1YT3A 4UQGA 3RR8A 4BQLA 3FFIA 3QEXA 4I6MB 1XMOK 3OYFA 4JHDA 3VEWA 2AP1A 1HYVA 3WQTA 3FZMA 1KC8O 4DWIA 1NGDA 4CJ5A 2BUPA 2OYQA 3AO3A 3H08A 3CF5L 4AILC 4YOXA 3L2RA 5LMUK 4DQ8A 3HOSA 1MU2A 3SQ2A 1HYZA 4DUZK 3W0LA 4BREA 4ILHA 1JXEA 3HP9A 3TANA 1M1KO 2E4LA 4HHTA 1VSIA 3P4IA 5A2QO 3C7NA 3LALA 4FM0A 4B3SK 1S5JA 4PY5A 2ZF5O 4JD2A 3PLAA 4FK4A 2QXFA 2OTLN 1KAZA 1WSJA 2FBYA 1CZ9A 2YKNA 3BF3A 5E26A 5C42A 4DQSA 4CGDA 5M1FA 3CCEN 3TSUA 3LM2A 1VK0A 2HB5A 1UA0A 2DPNA 1FK9A 4DSKA 3MWTA 1SQKA 3GG4A 4WQ5A 4BRCA 4CF2A 4YOVA 1XUPO 4CEOA 1VQ8N 3NF8A 3OYLA 1CZBA 5EU7A 4KHNA 3L3VA 2WOMA 1D9DA 1QVFM 1RGIA 2HSTA 2UUBK 5GIOA 3OYNA 4KHPK 4BRFA 4DG1A 4CJ7A 4CZLA 3ZT4A 3VQCA 3CFPA 3E66A 1Q8IA 3QB0A 3VQBA 2O8DA 3ULEA 4AM7A 3QETA 4FK2A 1HNVA 2F7TA 4H5WA 4WFNL 1RDBA 3CCLN 4EHTA 3DMJA 3CIPA 4IO8A 4J2EA 3HJFA 2HBKA 3H45C 1BISA 4IOAL 3DXMA 3MMVA 1VSJA 1UOCA 1NGCA 2E88A 3QESA 2ETJA 1BIZA 4HVJA 1C0TA 4PA1A 3RRHA 3CCVN 1ZBFA 3DJCA 4O44A 1YVNA 4DMNA 3BF1A 4CK1A 1S1UA 2F9TA 2RPIA 4DV1K 3ATVA 4BVOA 4K43A 4MQ3A 5B8HA 2G8VA 1K73O 2J4RA 2OPSA 4KRFA 1HKBA 1BOTO 4AHTA 3M8QA 3RMDA 1IV0A 1YXQA 1KVCA 4OO1J 3KLGA 1ZBIA 3MK6A 3K57A 3PX0A 1L3UA 5JLHA 3OYBA 3VEYA 4PKIA 3ZSVA 2G8KA 5BPLA 2XO7A 4DU4A 4KB0A 1R0AA 1IKYA 3TAQA 1E3MA 1TYQA 1T44A 2B6AA 1LAVA 3O3GA 1BQNA 1RTHA 4JK8A 1SUQA 4QOZB 4NXNK 4F9OA 1NJZA 3AVCA 3VQ8A 3SZ2A 4GV6A 1NGHA 1BI4B 5AQMA 4X64K 1H1VA 4OKEA 4BDYA 1C1BA 3KWIA 4FW2A 2ZJQL 4FOIA 1J5OA 2VWJA 1GOCA 2QWMA 4WCEL 4IFYA 4XH5A 4E89A 2V52B 3A0IX 2AJQA 3T1AA 2E6MA 4CJ3A 1IBMK 2D5RA 4RCHA 2VQEK 2P9IB 3FZHA 5CYQA 1WBDA 2P5OA 3UKRA 3O80A 2PBDA 3OYEA 4DSFA 2D0PA 4Y0WA 4M3ZA 1BWFO 1ZYQA 3TPQA 4B3MK 4BQZA 4B1UB 5GAEP 5AQQA 3IKMA 1NK6A 4KV8A 1YJNN 2O8BA 4CZFA 1NKEA 1TUUA 4BDPA 4DS5A 1TL3A 1NM1A 1N32K 5GIPA 3VQ5A 4OX9K 3AGKA 3LDLA 1KLMA 4DTPA 2Y1JA 3H3NO 3MX2A 3IAYA 4OPHA 3J7ZO 5AZJA 4CGJA 3G4SN 1TK0A 2XY8A 2O8EB 3H6EA 4LSNA 1BL3A 4JD2B 1VSLA 3NH0A 4E3SA 1HNXK 2ZM6K 4G1QA 1J54A 3CC4N 1NMDA 3SAHA 4IZ9A 3J80O 4JKAA 1DEJA 2G8WA 1BU6O 2QA4N 3MAQA 3EKSA 4WQ4A 2O8DB 3OYGA 1J53A 2JWLA 2VGNA 4IEEA 3SLCA 1NJWA 3WT0A 5M1NA 3VQDA 1DT9A 4XH1A 4FJKA 5M1KA 3OJUA 2CGKA 2UXBK 3KD1E 2FBXA 4CJKA 2QWQA 4X65K 3HT3A 1K8KB 4ILGB 1RILA 3DLHA 1WSEA 4JS5A 4HUEA 1TV6A 1L3VA 2FLOA 3PSIA 3NAEA 4IOXA 1C0UA 1I3AA 1X1PA 4CF1A 2QKBA 4FL9A 2QKKA 1D4XA 4CE9A 1ESVA 5HRNA 4DTOA 4BRGA 3KZBA 3IRXA 4B9LA 1L3TA 3HVTA 4L8RB 3THWB 2CGLA 1B9FA 5AFUA 3T19A 2OPRA 1VHXA 3V1OA 4Z94A 1K8AO 4LF9K 3HBTA 1T6DA 3SV4A 1RFQA 3NGYA 3SUPA 5ADXA 2IC3A 1JLFA 1GLFO 5AQKA 2OANA 3PX4A 4N5SA 3BEXA 4WE1A 1Y97A 3QEIA 2EX3A 2Z1IA 2O8BB 1QZ6A 3I0RA 3PUFA 4CZKA 2NRVA 3LP0A 2XY7A 4E19A 3HOTA 3D45A 4QS8A 1OH7A 3VERA 2GEMA 3ZYYX 3MCAB 4HCCA 3M6GA 4IWVA 4FWKA 4B9NA 4FCYA 1LCUA 4FJIA 4OPAA 3DXKA 2Q2RA 4KI4A 5CY4A 3FLCO 2YKMA 3RVCA 1EWQA 5J2PA 1CZAN 3R8EA 4I2PA 5MLCQ 5T7BA 3DLEA 3SMPA 2YJFA 3ZCMA 3JAMO 4KAZA 4MO4A 4ILJA 1OKJA 1IG8A 1T8EA 5BR9A 4FLTA 2H3GX 3CJ9A 4FVMA 1IKWA 4HTUA 4BRMA 4FWRA 1HJRA 2KZZA 2F8TA 3OVNA 4EAHD 4CEEA 4PKGA 4B1ZA 1JXBA 3ULDA 2HOEA 5LL6Z 4NLCA 4OGCA 4CESA 1SKWA 3FZKA 3OYCA 4B9VA 1KTQA 2Q3SA 3M1FA 3OS0A 1S9GA 3KLHA 1E4FT 3CYMA 4DR3K 1W0HA 2VGMA 5K14A 4HUFA 3WEEA 3QLHA 4FJNA 4EHUA 4TSXA 3BDPA 4YOTA 4E1MA 2GTDA 4W5QA 3SNNA 1EQYA 1Z6RA 4CZJA 3MEDA 3QERA 3P31A 1KRPA 1HYSA 4BRQA 1ZBHA 3T69A 2HHTA 1NK4A 4WFAL 1L5UA 4FZXC 3MN9A 4CJRA 4W5TA 1U6ZA 4YDUC 3V9UA 4BC2A 4H0OA 2UXDK 5AQOA 3CJ1A 3QMLA 1RT7A 2HBJA 4JKCA 5JS1A 3OYKA 4BG8A 3JSMA 3RSEB 4CZGA 3KVGA 3PSFA 1VQ9N 2ZGYA 4JK7A 4DFKA 3PIPL 1GOAA 2RHKA 1YJWN 3CHWA 4I9LA 1S72N 4M3RA 4B1WB 1QHAA 5J2NA 2JWKA 4H5NA 1TKTA 1JCEA 4DV3K 3WNFA 4B9SA 1BHLA 5CHIA 5CYMA 1IH7A 3HVRA 3SK3A 1TAUA 1K8KA 3K5LA 3NHGA 5HOOA 3PIOL 3QNNA 1T6CA 1MWMA 4Y1CA 3I55N 3CCQN 3IUCA 2BANA 4DSJA 3NCIA 2X74A 3LL3A 4I7FA 1IKXA 4Y1DA 4JI3K 4A61A 1GLDG 1N8RO 3I33A 3SAFA 2E1YA 4B3OA 2OZSA 3VQPA 2P9KB 3I8BA 2I7NA 1NKCA 3F2KA 4G9ZA 1M90O 4B8AB 3K5OA 4CECA 2O8CB 5D3GA 2XY5A 3DLBA
chains in the Genus database with same CATH topology
1BGXT 3L2QA 4CHQA 5KI6A 1UA0A 1VK0A 2HB5A 4CFCA 5J2MA 1FK9A 4E0DA 4DSKA 1NK9A 2DTUA 3C6TA 4W5OA 2HVIA 5HRRA 3TARA 4CF2A 3AA2A 2HHSA 4CEOA 2HHWA 1D5AA 4DFPA 3NF8A 2ZD1A 2IAJA 3CM6A 3OYLA 3V6DA 1CZBA 1GOBA 5EU7A 3KKRA 3TAGA 2GUIA 3DLKA 1RTIA 2RN2A 4KHNA 3L3VA 2WOMA 1D9DA 1NJYA 3S3OA 1N5YA 4DTXA 2Z1GA 3OYNA 4CGGA 4B9MA 3ZSWA 4DQQA 1T05A 1LV5A 3DRSA 1WNSA 4DG1A 4IFVA 4AHUA 1RBRA 4NYNA 3ZT4A 1D8YA 2IDOA 1RT1A 1RTJA 4LY7A 3VQCA 3CFPA 1Q8IA 3S9HA 1U04A 3VQBA 3AO1A 3IG1A 4OVLA 1WN7A 4Z4CA 2OA8A 3NE6A 1EP4A 2BE2A 3QETA 4PWDA 3B6PA 4CJWA 3MXMA 1VSMA 1HNVA 4FK2A 3HK2A 3V9SA 4IDKA 1NK8A 4DU1A 4HCBA 1TL1A 3K2PA 3KD5E 1IKVA 1WSHA 2G8UA 4E7IA 3RMAA 3QEPA 4DF4A 1RDBA 4H4OA 4DSIA 3DMJA 3HJFA 4J2EA 4K8XA 1A5VA 3LDSA 1BISA 3OYHA 4KPYA 2D0AA 3HO1A 2B4JA 1VSDA 1KLNA 1KFSA 1VSJA 1QE1A 4DF8A 1UOCA 3DI6A 5KRTA 1YVUA 2O4IA 3VA3A 4CJPA 2YHBA 3QESA 1BI4A 2ETJA 3QNOA 1X9MA 1BIZA 4HVJA 4ELTA 4K8ZA 4M3WA 1C0TA 4PA1A 3U6FA 3RRHA 3L3UA 1VSEA 4BE1A 4CJLA 4CHYA 2OZMA 1VRUA 1ZBFA 2D0BA 1LAWA 4FJXA 3KLEA 2FC0A 4O44A 4DMNA 3DLRA 4CK1A 1S1UA 2IOCA 4FLXA 3PV8A 1U48A 1L3SA 4DLEA 4OGEA 2RPIA 4FZYA 3QINA 3WNGA 3ZSRA 1HNIA 3KLIA 3CFOA 4MQ3A 3V1RA 2X6SA 1SKSA 4OJRA 1QSSA 3L8BA 4CJSA 2G8VA 4CEQA 4KFBA 3V1QA 3KJVA 3ZT3A 3LPTA 4H8KA 3ZSYA 4KB1A 4Z0UA 2OPSA 4KRFA 4EZ6A 3A2FA 4AHTA 1TKXA 4DFJA 2KW4A 1LW2A 2P1JA 1QHTA 2GBZA 3M8QA 4RW7A 3ZT0A 4FM1A 4E7LA 1RDCA 5J2QA 3HSTB 3RMDA 2F8SA 2XHBA 3K59A 1KVCA 4OPKA 3KLGA 1ZBIA 1EXQA 3K57A 3KTQA 3ZSQA 5E41A 3PX0A 1L3UA 5FDLA 3VQEA 3OYBA 3SV3A 3ZSVA 1JLCA 3KK3A 2G8KA 4AHVA 2XO7A 1RBTA 4DU4A 1G15A 3SQ1A 1U47A 4B9UA 4KB0A 3EYZA 4NCAA 3V9XA 1R0AA 1IKYA 3TAQA 4CK3A 1QSLA 4CJFA 4DQPA 4ELVA 2B6AA 3NFAA 1LAVA 2VWKA 3PO4A 2OPPA 3QO9A 2GV9A 3RRGA 3MECA 3O3GA 4M3XA 2HHQA 1BQNA 1RTHA 4IG3A 1KSPA 4CEAA 4JRQA 5I3UA 1SUQA 3KIOA 4QOZB 4FW1A 2LSNA 2JGUA 1RNHA 1ASUA 4BE0A 2D0CA 3SPYA 1NJZA 4JS4A 5HBMA 4KHWA 1WSGA 4Z4EA 3AVCA 3NF9A 3VQ8A 4EP5A 3L2UA 3SZ2A 1ITGA 1N6QA 2BDPA 4F3OA 2EHGA 3CM5A 1BI4B 4CF0A 1B92A 1UAXA 3T3FA 1RTDA 1F21A 4OKEA 3JYTA 1C1BA 4C8NA 5HRSA 4BDYA 2YV0X 4BACA 4KHUA 1A5XA 4FW2A 4KTQA 4F3TA 4CJQA 3AVKA 3L2VA 4FLVA 2PYLA 1J5OA 2VWJA 3F73A 1GOCA 1NKBA 4IFYA 4E89A 2VG5A 2FBTA 1ASWA 2VG6A 1NK7A 1X9SA 2AJQA 3MXJA 4KKOA 3T1AA 2E6MA 4Q5VA 1LWFA 4CJ3A 4DQRA 4M42A 4OLBA 3WNEA 1DTQA 3E01A 3ASMA 4CF8A 4DU3A 2XY6A 2D5RA 4DTJA 1RBSA 2RF2A 2G8HA 1C1CA 4MFBA 1NOZA 2I5JA 5CYQA 1XHXA 2P5OA 1NJXA 3OYEA 4KREA 4DSFA 4M3ZA 2KFZA 1ZYQA 3OS2A 1T7PA 4KHSA 1QS4A 4OKKA 1KCFA 3V81A 1TKZA 1Z25A 2ZQBA 4EZ9A 3AA4A 3TI0A 2G8IA 5HRPA 1QTMA 4CK2A 4FJLA 3CQ8A 3S3MA 4J2DA 3I0SA 3LAKA 3U3YA 2HHUA 1NK6A 4KV8A 4QAGA 1KVAA 3PY8A 4I9QA 2DFFA 2P5GA 4CEZA 1NKEA 4W5NA 4BDPA 1BIUA 4DS5A 1UWBA 4N76A 1TL3A 1EX4A 4J2AA 5KGWA 1VSFA 3THVA 2YNFA 4FJ5A 3D0PA 4LD0A 3VQQA 3I8DA 3VQ5A 4DQIA 1C1AA 3TR8A 4F8RA 4E1NA 1KLMA 4DTPA 2Y1JA 3G0ZA 4BDZA 4CFAA 2JLEA 1IO2A 3IAYA 3QEWA 4N56A 4CGJA 3HM9A 2PY5A 1TK0A 2KQ2A 4FXDA 3IS9A 2XY8A 4JLHA 4LSNA 4CEFA 1BL3A 3C6UA 4NCBA 1DTTA 1VSLA 2XRIA 4O4GA 4AHCA 3NH0A 1TKDA 4E3SA 1Z26A 5DK5A 3SUQA 4LSLA 4G1QA 1J54A 4H4MA 3SI6A 4CEBA 4AHRA 2G8WA 5HLFA 4FJGA 3ZSXA 4O0IA 1ZBLA 2HHXA 3MAQA 2Z1JA 3DM2A 3VQAA 4PUOA 1K6YA 3AVBA 1JLEA 1O1WA 2VG7A 3WNHA 3OYGA 1J53A 4KI6A 4E7HA 3DOKA 1CXUA 1ZBUA 3OYAA 5J1EA 1NJWA 4O55A 4N41A 4CHPA 3RTVA 3AVNA 3AO4A 4FK0A 1RT6A 4Z4GA 2W42A 3VQDA 4FJKA 1RCHA 3OJUA 4N47A 3ZSOA 2X78A 1WAFA 1HQUA 4CEDA 3LANA 4CGFA 3OY9A 1LWCA 3KD1E 2FBXA 4CJKA 3HT3A 1KFDA 3ZSZA 1FKPA 5C25A 3U3GA 3F9KA 1LWEA 4FLYA 2KZMA 4Z4IA 1RILA 3DLHA 1WSEA 4RW4A 4NYFA 4YFUA 4JRPA 3G10A 4JS5A 4O0JA 4HUEA 1TV6A 3TAFA 1SL1A 4CIEA 1FKOA 1RT5A 1L3VA 3LZIA 3VQ7A 5CZ2A 3NAEA 3M8RA 1RBVA 4O5BA 3NH1A 1C0UA 2HNYA 3SCXA 4ZTFA 2R7YA 2F96A 1I3AA 1X1PA 4RW6A 4CF1A 5HP1A 3AVJA 2QKBA 2QKKA 4CE9A 4CIFA 1FXXA 4DTOA 5HRNA 1QQCA 3QIPA 1TAQA 1TVRA 1SV5A 2IS3A 3IRXA 1REVA 4B9LA 3LP3A 3O3HA 1L3TA 4CHZA 1S1XA 3P83D 3KLFA 3EY1A 4C8KA 1VSHA 3HVTA 4L8RB 4FJ8A 1CXQA 3AV9A 1B9FA 1HRHA 4AH9A 3RWUA 3TAPA 4AHSA 3VA0A 3AVIA 3C95A 3T19A 1JKHA 4XIUA 1VRTA 1EKEA 2OPRA 3AVGA 3V1OA 3ISNC 4W5RA 3RMCA 4DTNA 1TK8A 2HMIA 4DFMA 1C6VA 4CFBA 3NGZA 3NH2A 3SV4A 3DRRA 3NGYA 4CHNA 3SUPA 2Z1HA 4ICLA 1CLQA 3NF7A 1BCMA 1JLAA 2IC3A 2ITGA 4J2BA 2G8FA 1JLFA 4GMJB 2DFHA 4C8MA 3K58A 3AVLA 4CGHA 4F2RA 4Z4FA 3DRPA 3PX4A 4N5SA 4WE1A 1U4BA 2YNIA 5FRNA 1Y97A 3SYZA 3QEIA 2EX3A 2Z1IA 4FJJA 3TABA 1TGOA 3I0RA 3PUFA 3O4QA 4DSEA 1IG9A 2KTQA 3LP0A 3PX6A 3M8PA 2XY7A 4ZTJA 4E19A 1HMVA 3D45A 3HL8A 3TAMA 4RW9A 3VQ9A 4CJEA 3QEVA 4HCCA 2DY4A 3MEGA 1XI1A 4B9NA 2PZSA 4FCYA 2ZE2A 3AO2A 5KGXA 4FJIA 1NK0A 3SPZA 4QCLA 3LWLA 4KI4A 4KTWA 1YTAA 4ID1A 5CY4A 3V9ZA 4M3YA 4FM2A 2YKMA 3V4IA 3HPHA 3OYJA 3LZJA 4DS4A 4CJ4A 5J2PA 1A5WA 5DMRA 5FROA 4CHOA 2A1RA 3PO5A 3AA5X 1WLJA 2B5JA 4I2PA 4IBNA 3RMBA 2RKIA 3HPGA 3DLEA 5T7BA 1QSYA 3ZCMA 3V9WA 3NF6A 4HUGA 4KAZA 1B9DA 3DLGA 3O4NA 3OJSA 1DLOA 1RT4A 3VQ6A 5I42A 4DTRA 4FLTA 1T8EA 2O4GA 2HNZA 1NOYA 4FVMA 4I2QA 1IKWA 3LWMA 2HHVA 4HTUA 3LAMA 1HJRA 2KZZA 4DTMA 4IG0A 2F8TA 3OVNA 2NUBA 2X6NA 4Q0BA 5HROA 4IKFA 2A1SA 3KK2A 4CEEA 1HPZA 5SWMA 1JXBA 3ULDA 4DSLA 4CCHA 4BWJA 1XC9A 1HQEA 4FZZA 1BCOA 1RT3A 4CESA 4OGCA 5SZTA 1SKWA 3KK1A 3OYCA 1WAJA 4KO0A 4B9VA 1WSIA 3B6OA 1S1VA 3LP1A 1KTQA 2Q3SA 3KKSA 1S9EA 4LH5A 4RW8A 3OS0A 1Q9XA 1S9GA 3VN5A 2FBVA 3KLHA 1WSFA 3CYMA 3MXIA 1W0HA 3K5NA 5K14A 4KHYA 4HUFA 4CF9A 1X9WA 1J9AA 3QLHA 4B08A 3ZT1A 4FJNA 4TSXA 3AA3A 1C0MA 3AVHA 3BDPA 2YNGA 1XWLA 4M3UA 4E1MA 4W5QA 3CG7A 3P5JA 3SNNA 5C24A 1S1WA 2BGGA 1D9FA 1Q9YA 3MEDA 4OLAA 3BGRA 3QERA 4CJTA 1KRPA 4ZHRA 4CERA 3VQ4A 2ATQA 3HP6A 3SUNA 4FJMA 1ZBHA 1HYSA 1YTUA 1BQMA 4M45A 4E7KA 3SQ4A 3QIOA 3HXMA 1NK4A 2PYJA 2HHTA 1S6PA 1U49A 4GVMA 1EETA 1VSKA 4CJRA 1L5UA 3HPOA 5JS2A 4FZXC 4W5TA 3V9UA 3L2WA 1UA1A 4YNQA 3M8SA 3EZ5A 4LH4A 3NDKA 1JLBA 1KVBA 2Y1IA 1SL2A 4KHQA 2QK9A 3OS1A 3SUOA 4B8CA 1RT7A 4NCGA 3AO5A 2WONA 4FLZA 5JS1A 3OYKA 3JSMA 5KRSA 3SQ0A 4DLGA 1ASVA 3LP2A 3O3FA 3HYFA 4F2SA 3DOLA 4KTZA 1S6QA 4RG8A 5CZ1A 3ITHA 4DTSA 1NK5A 2OPQA 1JL1A 4DFKA 1GOAA 2DFEA 4FJ7A 1W9HA 4I9LA 1I39A 2P51A 4M3RA 3ALYA 2HW3A 5J2NA 3K5MA 1TK5A 1TKTA 4C8LA 1XHZA 1LW0A 4M41A 1SKRA 1U45A 4FJ9A 3AVFA 3WNFA 4B9SA 4CJVA 3CFRA 3NBPA 1BHLA 1RT2A 1T03A 2E6LA 4OPJA 3ZT2A 4E7JA 5CYMA 4EP4A 4DTUA 4PQUA 4CGIA 1IH7A 3AVMA 3MEEA 3HVRA 4OKJA 4C8OA 1TAUA 3UIQA 4GW6A 3K5LA 3DYAA 1YT3A 4UQGA 3RR8A 3TWHA 3FFIA 3NHGA 3QEXA 4FYDA 3RR7A 2IGIA 3OYFA 4R5PA 4CJUA 2KFNA 3QNNA 4Y1CA 1HYVA 3TAEA 1JL2A 3OYMA 2BANA 3P1GA 3NGIA 4DWIA 2YHAA 4CFDA 4DSJA 3NCIA 4F4KA 4CJ5A 3SJJA 2OYQA 3AO3A 4FJHA 1RDAA 2X74A 2YNHA 3H08A 4ELUA 4AILC 4I7FA 3L2RA 3C94A 3OYIA 5KTQA 1IKXA 1MU2A 3SQ2A 3S3NA 1HYZA 4Y1DA 4B9TA 4FLUA 4FLWA 1JXEA 3HP9A 1JLQA 3TANA 2HVHA 2E4LA 1JLGA 1RBUA 1VSIA 4HHTA 1RDDA 3LALA 4FM0A 3LPUA 4BWMA 4PY5A 1S5JA 4B3OA 2OZSA 1S1TA 3VQPA 3AVAA 1SL0A 1NKCA 4M3TA 2HNDA 3OYDA 2QXFA 4FK4A 5FRMA 4B8AB 3K5OA 1WSJA 4CECA 4Z4HA 5D3GA 2FBYA 4CIGA 1CZ9A 2XY5A 4BE2A 2YKNA 4ID5A 5C42A 4DQSA 3DLBA 4CGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGX T;  3L2Q A;  4CHQ A;  5KI6 A;  1UA0 A;  1VK0 A;  2HB5 A;  4CFC A;  5J2M A;  1FK9 A;  4E0D A;  4DSK A;  1NK9 A;  2DTU A;  3C6T A;  4W5O A;  2HVI A;  5HRR A;  3TAR A;  4CF2 A;  3AA2 A;  2HHS A;  4CEO A;  2HHW A;  1D5A A;  4DFP A;  3NF8 A;  2ZD1 A;  2IAJ A;  3CM6 A;  3OYL A;  3V6D A;  1CZB A;  1GOB A;  5EU7 A;  3KKR A;  3TAG A;  2GUI A;  3DLK A;  1RTI A;  2RN2 A;  4KHN A;  3L3V A;  2WOM A;  1D9D A;  1NJY A;  3S3O A;  1N5Y A;  4DTX A;  2Z1G A;  3OYN A;  4CGG A;  4B9M A;  3ZSW A;  4DQQ A;  1T05 A;  1LV5 A;  3DRS A;  1WNS A;  4DG1 A;  4IFV A;  4AHU A;  1RBR A;  4NYN A;  3ZT4 A;  1D8Y A;  2IDO A;  1RT1 A;  1RTJ A;  4LY7 A;  3VQC A;  3CFP A;  1Q8I A;  3S9H A;  1U04 A;  3VQB A;  3AO1 A;  3IG1 A;  4OVL A;  1WN7 A;  4Z4C A;  2OA8 A;  3NE6 A;  1EP4 A;  2BE2 A;  3QET A;  4PWD A;  3B6P A;  4CJW A;  3MXM A;  1VSM A;  1HNV A;  4FK2 A;  3HK2 A;  3V9S A;  4IDK A;  1NK8 A;  4DU1 A;  4HCB A;  1TL1 A;  3K2P A;  3KD5 E;  1IKV A;  1WSH A;  2G8U A;  4E7I A;  3RMA A;  3QEP A;  4DF4 A;  1RDB A;  4H4O A;  4DSI A;  3DMJ A;  3HJF A;  4J2E A;  4K8X A;  1A5V A;  3LDS A;  1BIS A;  3OYH A;  4KPY A;  2D0A A;  3HO1 A;  2B4J A;  1VSD A;  1KLN A;  1KFS A;  1VSJ A;  1QE1 A;  4DF8 A;  1UOC A;  3DI6 A;  5KRT A;  1YVU A;  2O4I A;  3VA3 A;  4CJP A;  2YHB A;  3QES A;  1BI4 A;  2ETJ A;  3QNO A;  1X9M A;  1BIZ A;  4HVJ A;  4ELT A;  4K8Z A;  4M3W A;  1C0T A;  4PA1 A;  3U6F A;  3RRH A;  3L3U A;  1VSE A;  4BE1 A;  4CJL A;  4CHY A;  2OZM A;  1VRU A;  1ZBF A;  2D0B A;  1LAW A;  4FJX A;  3KLE A;  2FC0 A;  4O44 A;  4DMN A;  3DLR A;  4CK1 A;  1S1U A;  2IOC A;  4FLX A;  3PV8 A;  1U48 A;  1L3S A;  4DLE A;  4OGE A;  2RPI A;  4FZY A;  3QIN A;  3WNG A;  3ZSR A;  1HNI A;  3KLI A;  3CFO A;  4MQ3 A;  3V1R A;  2X6S A;  1SKS A;  4OJR A;  1QSS A;  3L8B A;  4CJS A;  2G8V A;  4CEQ A;  4KFB A;  3V1Q A;  3KJV A;  3ZT3 A;  3LPT A;  4H8K A;  3ZSY A;  4KB1 A;  4Z0U A;  2OPS A;  4KRF A;  4EZ6 A;  3A2F A;  4AHT A;  1TKX A;  4DFJ A;  2KW4 A;  1LW2 A;  2P1J A;  1QHT A;  2GBZ A;  3M8Q A;  4RW7 A;  3ZT0 A;  4FM1 A;  4E7L A;  1RDC A;  5J2Q A;  3HST B;  3RMD A;  2F8S A;  2XHB A;  3K59 A;  1KVC A;  4OPK A;  3KLG A;  1ZBI A;  1EXQ A;  3K57 A;  3KTQ A;  3ZSQ A;  5E41 A;  3PX0 A;  1L3U A;  5FDL A;  3VQE A;  3OYB A;  3SV3 A;  3ZSV A;  1JLC A;  3KK3 A;  2G8K A;  4AHV A;  2XO7 A;  1RBT A;  4DU4 A;  1G15 A;  3SQ1 A;  1U47 A;  4B9U A;  4KB0 A;  3EYZ A;  4NCA A;  3V9X A;  1R0A A;  1IKY A;  3TAQ A;  4CK3 A;  1QSL A;  4CJF A;  4DQP A;  4ELV A;  2B6A A;  3NFA A;  1LAV A;  2VWK A;  3PO4 A;  2OPP A;  3QO9 A;  2GV9 A;  3RRG A;  3MEC A;  3O3G A;  4M3X A;  2HHQ A;  1BQN A;  1RTH A;  4IG3 A;  1KSP A;  4CEA A;  4JRQ A;  5I3U A;  1SUQ A;  3KIO A;  4QOZ B;  4FW1 A;  2LSN A;  2JGU A;  1RNH A;  1ASU A;  4BE0 A;  2D0C A;  3SPY A;  1NJZ A;  4JS4 A;  5HBM A;  4KHW A;  1WSG A;  4Z4E A;  3AVC A;  3NF9 A;  3VQ8 A;  4EP5 A;  3L2U A;  3SZ2 A;  1ITG A;  1N6Q A;  2BDP A;  4F3O A;  2EHG A;  3CM5 A;  1BI4 B;  4CF0 A;  1B92 A;  1UAX A;  3T3F A;  1RTD A;  1F21 A;  4OKE A;  3JYT A;  1C1B A;  4C8N A;  5HRS A;  4BDY A;  2YV0 X;  4BAC A;  4KHU A;  1A5X A;  4FW2 A;  4KTQ A;  4F3T A;  4CJQ A;  3AVK A;  3L2V A;  4FLV A;  2PYL A;  1J5O A;  2VWJ A;  3F73 A;  1GOC A;  1NKB A;  4IFY A;  4E89 A;  2VG5 A;  2FBT A;  1ASW A;  2VG6 A;  1NK7 A;  1X9S A;  2AJQ A;  3MXJ A;  4KKO A;  3T1A A;  2E6M A;  4Q5V A;  1LWF A;  4CJ3 A;  4DQR A;  4M42 A;  4OLB A;  3WNE A;  1DTQ A;  3E01 A;  3ASM A;  4CF8 A;  4DU3 A;  2XY6 A;  2D5R A;  4DTJ A;  1RBS A;  2RF2 A;  2G8H A;  1C1C A;  4MFB A;  1NOZ A;  2I5J A;  5CYQ A;  1XHX A;  2P5O A;  1NJX A;  3OYE A;  4KRE A;  4DSF A;  4M3Z A;  2KFZ A;  1ZYQ A;  3OS2 A;  1T7P A;  4KHS A;  1QS4 A;  4OKK A;  1KCF A;  3V81 A;  1TKZ A;  1Z25 A;  2ZQB A;  4EZ9 A;  3AA4 A;  3TI0 A;  2G8I A;  5HRP A;  1QTM A;  4CK2 A;  4FJL A;  3CQ8 A;  3S3M A;  4J2D A;  3I0S A;  3LAK A;  3U3Y A;  2HHU A;  1NK6 A;  4KV8 A;  4QAG A;  1KVA A;  3PY8 A;  4I9Q A;  2DFF A;  2P5G A;  4CEZ A;  1NKE A;  4W5N A;  4BDP A;  1BIU A;  4DS5 A;  1UWB A;  4N76 A;  1TL3 A;  1EX4 A;  4J2A A;  5KGW A;  1VSF A;  3THV A;  2YNF A;  4FJ5 A;  3D0P A;  4LD0 A;  3VQQ A;  3I8D A;  3VQ5 A;  4DQI A;  1C1A A;  3TR8 A;  4F8R A;  4E1N A;  1KLM A;  4DTP A;  2Y1J A;  3G0Z A;  4BDZ A;  4CFA A;  2JLE A;  1IO2 A;  3IAY A;  3QEW A;  4N56 A;  4CGJ A;  3HM9 A;  2PY5 A;  1TK0 A;  2KQ2 A;  4FXD A;  3IS9 A;  2XY8 A;  4JLH A;  4LSN A;  4CEF A;  1BL3 A;  3C6U A;  4NCB A;  1DTT A;  1VSL A;  2XRI A;  4O4G A;  4AHC A;  3NH0 A;  1TKD A;  4E3S A;  1Z26 A;  5DK5 A;  3SUQ A;  4LSL A;  4G1Q A;  1J54 A;  4H4M A;  3SI6 A;  4CEB A;  4AHR A;  2G8W A;  5HLF A;  4FJG A;  3ZSX A;  4O0I A;  1ZBL A;  2HHX A;  3MAQ A;  2Z1J A;  3DM2 A;  3VQA A;  4PUO A;  1K6Y A;  3AVB A;  1JLE A;  1O1W A;  2VG7 A;  3WNH A;  3OYG A;  1J53 A;  4KI6 A;  4E7H A;  3DOK A;  1CXU A;  1ZBU A;  3OYA A;  5J1E A;  1NJW A;  4O55 A;  4N41 A;  4CHP A;  3RTV A;  3AVN A;  3AO4 A;  4FK0 A;  1RT6 A;  4Z4G A;  2W42 A;  3VQD A;  4FJK A;  1RCH A;  3OJU A;  4N47 A;  3ZSO A;  2X78 A;  1WAF A;  1HQU A;  4CED A;  3LAN A;  4CGF A;  3OY9 A;  1LWC A;  3KD1 E;  2FBX A;  4CJK A;  3HT3 A;  1KFD A;  3ZSZ A;  1FKP A;  5C25 A;  3U3G A;  3F9K A;  1LWE A;  4FLY A;  2KZM A;  4Z4I A;  1RIL A;  3DLH A;  1WSE A;  4RW4 A;  4NYF A;  4YFU A;  4JRP A;  3G10 A;  4JS5 A;  4O0J A;  4HUE A;  1TV6 A;  3TAF A;  1SL1 A;  4CIE A;  1FKO A;  1RT5 A;  1L3V A;  3LZI A;  3VQ7 A;  5CZ2 A;  3NAE A;  3M8R A;  1RBV A;  4O5B A;  3NH1 A;  1C0U A;  2HNY A;  3SCX A;  4ZTF A;  2R7Y A;  2F96 A;  1I3A A;  1X1P A;  4RW6 A;  4CF1 A;  5HP1 A;  3AVJ A;  2QKB A;  2QKK A;  4CE9 A;  4CIF A;  1FXX A;  4DTO A;  5HRN A;  1QQC A;  3QIP A;  1TAQ A;  1TVR A;  1SV5 A;  2IS3 A;  3IRX A;  1REV A;  4B9L A;  3LP3 A;  3O3H A;  1L3T A;  4CHZ A;  1S1X A;  3P83 D;  3KLF A;  3EY1 A;  4C8K A;  1VSH A;  3HVT A;  4L8R B;  4FJ8 A;  1CXQ A;  3AV9 A;  1B9F A;  1HRH A;  4AH9 A;  3RWU A;  3TAP A;  4AHS A;  3VA0 A;  3AVI A;  3C95 A;  3T19 A;  1JKH A;  4XIU A;  1VRT A;  1EKE A;  2OPR A;  3AVG A;  3V1O A;  3ISN C;  4W5R A;  3RMC A;  4DTN A;  1TK8 A;  2HMI A;  4DFM A;  1C6V A;  4CFB A;  3NGZ A;  3NH2 A;  3SV4 A;  3DRR A;  3NGY A;  4CHN A;  3SUP A;  2Z1H A;  4ICL A;  1CLQ A;  3NF7 A;  1BCM A;  1JLA A;  2IC3 A;  2ITG A;  4J2B A;  2G8F A;  1JLF A;  4GMJ B;  2DFH A;  4C8M A;  3K58 A;  3AVL A;  4CGH A;  4F2R A;  4Z4F A;  3DRP A;  3PX4 A;  4N5S A;  4WE1 A;  1U4B A;  2YNI A;  5FRN A;  1Y97 A;  3SYZ A;  3QEI A;  2EX3 A;  2Z1I A;  4FJJ A;  3TAB A;  1TGO A;  3I0R A;  3PUF A;  3O4Q A;  4DSE A;  1IG9 A;  2KTQ A;  3LP0 A;  3PX6 A;  3M8P A;  2XY7 A;  4ZTJ A;  4E19 A;  1HMV A;  3D45 A;  3HL8 A;  3TAM A;  4RW9 A;  3VQ9 A;  4CJE A;  3QEV A;  4HCC A;  2DY4 A;  3MEG A;  1XI1 A;  4B9N A;  2PZS A;  4FCY A;  2ZE2 A;  3AO2 A;  5KGX A;  4FJI A;  1NK0 A;  3SPZ A;  4QCL A;  3LWL A;  4KI4 A;  4KTW A;  1YTA A;  4ID1 A;  5CY4 A;  3V9Z A;  4M3Y A;  4FM2 A;  2YKM A;  3V4I A;  3HPH A;  3OYJ A;  3LZJ A;  4DS4 A;  4CJ4 A;  5J2P A;  1A5W A;  5DMR A;  5FRO A;  4CHO A;  2A1R A;  3PO5 A;  3AA5 X;  1WLJ A;  2B5J A;  4I2P A;  4IBN A;  3RMB A;  2RKI A;  3HPG A;  3DLE A;  5T7B A;  1QSY A;  3ZCM A;  3V9W A;  3NF6 A;  4HUG A;  4KAZ A;  1B9D A;  3DLG A;  3O4N A;  3OJS A;  1DLO A;  1RT4 A;  3VQ6 A;  5I42 A;  4DTR A;  4FLT A;  1T8E A;  2O4G A;  2HNZ A;  1NOY A;  4FVM A;  4I2Q A;  1IKW A;  3LWM A;  2HHV A;  4HTU A;  3LAM A;  1HJR A;  2KZZ A;  4DTM A;  4IG0 A;  2F8T A;  3OVN A;  2NUB A;  2X6N A;  4Q0B A;  5HRO A;  4IKF A;  2A1S A;  3KK2 A;  4CEE A;  1HPZ A;  5SWM A;  1JXB A;  3ULD A;  4DSL A;  4CCH A;  4BWJ A;  1XC9 A;  1HQE A;  4FZZ A;  1BCO A;  1RT3 A;  4CES A;  4OGC A;  5SZT A;  1SKW A;  3KK1 A;  3OYC A;  1WAJ A;  4KO0 A;  4B9V A;  1WSI A;  3B6O A;  1S1V A;  3LP1 A;  1KTQ A;  2Q3S A;  3KKS A;  1S9E A;  4LH5 A;  4RW8 A;  3OS0 A;  1Q9X A;  1S9G A;  3VN5 A;  2FBV A;  3KLH A;  1WSF A;  3CYM A;  3MXI A;  1W0H A;  3K5N A;  5K14 A;  4KHY A;  4HUF A;  4CF9 A;  1X9W A;  1J9A A;  3QLH A;  4B08 A;  3ZT1 A;  4FJN A;  4TSX A;  3AA3 A;  1C0M A;  3AVH A;  3BDP A;  2YNG A;  1XWL A;  4M3U A;  4E1M A;  4W5Q A;  3CG7 A;  3P5J A;  3SNN A;  5C24 A;  1S1W A;  2BGG A;  1D9F A;  1Q9Y A;  3MED A;  4OLA A;  3BGR A;  3QER A;  4CJT A;  1KRP A;  4ZHR A;  4CER A;  3VQ4 A;  2ATQ A;  3HP6 A;  3SUN A;  4FJM A;  1ZBH A;  1HYS A;  1YTU A;  1BQM A;  4M45 A;  4E7K A;  3SQ4 A;  3QIO A;  3HXM A;  1NK4 A;  2PYJ A;  2HHT A;  1S6P A;  1U49 A;  4GVM A;  1EET A;  1VSK A;  4CJR A;  1L5U A;  3HPO A;  5JS2 A;  4FZX C;  4W5T A;  3V9U A;  3L2W A;  1UA1 A;  4YNQ A;  3M8S A;  3EZ5 A;  4LH4 A;  3NDK A;  1JLB A;  1KVB A;  2Y1I A;  1SL2 A;  4KHQ A;  2QK9 A;  3OS1 A;  3SUO A;  4B8C A;  1RT7 A;  4NCG A;  3AO5 A;  2WON A;  4FLZ A;  5JS1 A;  3OYK A;  3JSM A;  5KRS A;  3SQ0 A;  4DLG A;  1ASV A;  3LP2 A;  3O3F A;  3HYF A;  4F2S A;  3DOL A;  4KTZ A;  1S6Q A;  4RG8 A;  5CZ1 A;  3ITH A;  4DTS A;  1NK5 A;  2OPQ A;  1JL1 A;  4DFK A;  1GOA A;  2DFE A;  4FJ7 A;  1W9H A;  4I9L A;  1I39 A;  2P51 A;  4M3R A;  3ALY A;  2HW3 A;  5J2N A;  3K5M A;  1TK5 A;  1TKT A;  4C8L A;  1XHZ A;  1LW0 A;  4M41 A;  1SKR A;  1U45 A;  4FJ9 A;  3AVF A;  3WNF A;  4B9S A;  4CJV A;  3CFR A;  3NBP A;  1BHL A;  1RT2 A;  1T03 A;  2E6L A;  4OPJ A;  3ZT2 A;  4E7J A;  5CYM A;  4EP4 A;  4DTU A;  4PQU A;  4CGI A;  1IH7 A;  3AVM A;  3MEE A;  3HVR A;  4OKJ A;  4C8O A;  1TAU A;  3UIQ A;  4GW6 A;  3K5L A;  3DYA A;  1YT3 A;  4UQG A;  3RR8 A;  3TWH A;  3FFI A;  3NHG A;  3QEX A;  4FYD A;  3RR7 A;  2IGI A;  3OYF A;  4R5P A;  4CJU A;  2KFN A;  3QNN A;  4Y1C A;  1HYV A;  3TAE A;  1JL2 A;  3OYM A;  2BAN A;  3P1G A;  3NGI A;  4DWI A;  2YHA A;  4CFD A;  4DSJ A;  3NCI A;  4F4K A;  4CJ5 A;  3SJJ A;  2OYQ A;  3AO3 A;  4FJH A;  1RDA A;  2X74 A;  2YNH A;  3H08 A;  4ELU A;  4AIL C;  4I7F A;  3L2R A;  3C94 A;  3OYI A;  5KTQ A;  1IKX A;  1MU2 A;  3SQ2 A;  3S3N A;  1HYZ A;  4Y1D A;  4B9T A;  4FLU A;  4FLW A;  1JXE A;  3HP9 A;  1JLQ A;  3TAN A;  2HVH A;  2E4L A;  1JLG A;  1RBU A;  1VSI A;  4HHT A;  1RDD A;  3LAL A;  4FM0 A;  3LPU A;  4BWM A;  4PY5 A;  1S5J A;  4B3O A;  2OZS A;  1S1T A;  3VQP A;  3AVA A;  1SL0 A;  1NKC A;  4M3T A;  2HND A;  3OYD A;  2QXF A;  4FK4 A;  5FRM A;  4B8A B;  3K5O A;  1WSJ A;  4CEC A;  4Z4H A;  5D3G A;  2FBY A;  4CIG A;  1CZ9 A;  2XY5 A;  4BE2 A;  2YKN A;  4ID5 A;  5C42 A;  4DQS A;  3DLB A;  4CGD A; 
#chains in the Genus database with same CATH topology
 4CHQ A;  2QTD A;  4DV6 K;  5GAG P;  1EO1 A;  3AGR A;  2DTU A;  2HVI A;  4W5O A;  3TU5 A;  3TAR A;  3AA2 A;  3V6D A;  2IAJ A;  1OVY A;  3KKR A;  3TAG A;  4PKH A;  5C10 A;  3DLK A;  2FSJ A;  1NJY A;  2O8F B;  1NWK A;  1N5Y A;  4CGG A;  3ZEU A;  5F0X A;  4B9M A;  1LV5 A;  3J8A A;  5EVZ A;  4FVU A;  3TTC A;  4IFV A;  5AQZ A;  1NGA A;  4C1N K;  4JKB A;  4LF5 K;  3IG1 A;  2BE2 A;  4PWD A;  3R1X A;  2WTU A;  1VSM A;  3MXM A;  3CCR N;  2P9I A;  4IDK A;  1TYQ B;  4BGA A;  4FOE A;  5HL7 L;  4BRL A;  3KD5 E;  3CPE A;  4FWN A;  4GVE A;  4DF4 A;  2P9N B;  1W7A A;  1A5V A;  4J8F A;  2D0A A;  3U9D A;  4A59 A;  1VSD A;  1KLN A;  2O4I A;  5KRT A;  1YVU A;  1BI4 A;  1X9M A;  4ELT A;  3U6F A;  4BE1 A;  2P9U B;  4CJL A;  1VRU A;  2D0B A;  1ZBS A;  2CH5 A;  3A5M C;  4ISE A;  3CXC M;  5AQN A;  3E9O A;  4JV5 K;  3ZSR A;  3CFO A;  2W40 A;  2X6S A;  1QSS A;  2ZWH A;  2QWR A;  4CJS A;  4B3R K;  3V1Q A;  4NB4 A;  2O8E A;  4DR1 K;  3ZSY A;  1ZXO A;  4WF9 L;  4Z0U A;  3WXI A;  4EZ6 A;  3A2F A;  2BTF A;  2W6L A;  4DFJ A;  1QHT A;  2GBZ A;  4RW7 A;  4FM1 A;  4E7L A;  4HWI A;  1WBB A;  2XHB A;  2CGJ A;  3LDO A;  3ZSQ A;  1HUX A;  2HF3 A;  5FDL A;  4AHV A;  2P9S B;  1RBT A;  4NCA A;  3VF2 A;  3V9X A;  4CJF A;  1HNW K;  2NRT A;  5TKY A;  3PO4 A;  2GV9 A;  2HHQ A;  3MEC A;  1Q7Y O;  1GLA G;  3BY5 A;  4WFB L;  4FW1 A;  1RNH A;  3SPY A;  4IDH A;  4Z4E A;  4JS4 A;  4KHW A;  4M7X A;  3L2U A;  2BDP A;  4WYB A;  3CM5 A;  4CF0 A;  4A62 A;  3WXL A;  5EOY A;  1A5X A;  2VQF K;  3AVK A;  1OH8 A;  4BR7 A;  3F73 A;  1NKB A;  1OH6 A;  2VCP A;  5AQX A;  4KKO A;  4DR7 K;  4JI0 K;  4M42 A;  2Q31 A;  3WNE A;  1DTQ A;  3E01 A;  1S22 A;  1YAG A;  3VF4 A;  1YF5 L;  1NOZ A;  2I5J A;  3CCS N;  1NJX A;  4KRE A;  2A5X A;  1T3V A;  2Q1N A;  1Z25 A;  2ZQB A;  4EZ9 A;  3AA4 A;  1P90 A;  5HRP A;  1QTM A;  4CK2 A;  4FJL A;  3CQ8 A;  3AAQ A;  3U3Y A;  4DR6 K;  2QI2 A;  4I9Q A;  1MWK A;  3JXU A;  4CEZ A;  5AQU A;  4W5N A;  1BDG A;  1BIU A;  1W97 L;  4HTL A;  4IOC L;  1EX4 A;  4J2A A;  1VSF A;  4H0P A;  3VQQ A;  3I8D A;  4DQI A;  1C1A A;  4F8R A;  4E1N A;  3GDQ A;  3T1Y K;  3K9J A;  4CFA A;  3QEW A;  3O9T A;  4N56 A;  2D0O A;  1KAY A;  1ATS A;  4CEF A;  1DTT A;  1TKD A;  5FPD A;  3SUQ A;  3EZW A;  5TKW A;  4LF4 K;  3SI6 A;  2GWJ A;  5C0Y A;  5HLF A;  3ZSX A;  5LJW A;  4DR5 K;  2Z1J A;  3O9R A;  3VQA A;  2F4V K;  1NBW A;  5IT9 O;  3WNH A;  3A5O C;  4KI6 A;  4E7H A;  3CQX A;  1CXU A;  3OYA A;  5EY4 A;  3UKU A;  4CHP A;  4FK0 A;  3AO4 A;  1RT6 A;  3D2E A;  4N47 A;  2P9L A;  1WAF A;  4BRI A;  4CED A;  3OY9 A;  3UB5 A;  3C0B A;  5C25 A;  3F9K A;  2ZGZ A;  3D2F B;  4CW7 B;  4I6M A;  3W3D A;  4JKG B;  4BGB A;  4LF6 K;  4O0J A;  3TAF A;  3O9S A;  2YX6 A;  4GY2 B;  3WXK A;  3R9P A;  3VGK A;  3OW2 M;  1ATN A;  2R7Y A;  4JKE A;  1N33 K;  1MA9 B;  4CIF A;  4QS7 A;  3WEE B;  2Q36 A;  1QQC A;  3UKU B;  2A3Z A;  3LP3 A;  3O3H A;  4CHZ A;  1S1X A;  1NGE A;  3P83 D;  4C8K A;  2UU9 K;  1VSH A;  3LDP A;  4YOY A;  4FJ8 A;  1VQ7 N;  1CXQ A;  1HRH A;  4AH9 A;  1J6Z A;  1JKH A;  2GEL A;  3AVG A;  3ISN C;  1G99 A;  3L6Q A;  1X3N A;  4DFM A;  3DRR A;  1KAX A;  3H3O B;  3ENO A;  4H03 B;  3NF7 A;  1BCM A;  2ITG A;  4J2B A;  2DFH A;  3G25 A;  3AVL A;  1E4G T;  4BR2 A;  4F2R A;  5FRN A;  4FJJ A;  1GLE G;  4A57 A;  3NVK A;  4LF7 K;  3BUZ B;  4RW9 A;  2DY4 A;  5FPE A;  4IO9 L;  2ZE2 A;  3AO2 A;  2IVO A;  3A5L C;  4A2B A;  3D7E O;  3OYJ A;  3MN6 A;  3AAR A;  5FRO A;  1VQO N;  2A1R A;  3AA5 X;  2B5J A;  4JN4 A;  2NLX A;  1QVG M;  3V9W A;  4HUG A;  1HX1 A;  4LF8 K;  2V51 B;  1RT4 A;  3VGM A;  3CQY A;  2HNZ A;  1SS6 A;  4H5R A;  4JK9 A;  3LAM A;  3P39 A;  4IG0 A;  4FWP A;  2X6N A;  4Q0B A;  4IKF A;  2A1S A;  3VET A;  5SWM A;  3H1Q A;  5EX5 A;  4BRO A;  1JCF A;  1BCO A;  3KK1 A;  1WAJ A;  3B6O A;  1S1V A;  3KKS A;  2FBV A;  4IXC A;  1WSF A;  3FZL A;  4JI7 K;  1HKG A;  1C0M A;  4C1N I;  2YNG A;  4B1Y B;  3P5J A;  5C24 A;  5C2F A;  1D9F A;  1Q9Y A;  1YHQ N;  4CJT A;  3JS6 A;  4ZHR A;  3HP6 A;  2ATQ A;  3QBW A;  4FJM A;  1YTU A;  3HXM A;  2PYJ A;  5AQI A;  5AQS A;  1EET A;  1VSK A;  3LDN A;  3D2F A;  4JI2 K;  3DLL L;  1UA1 A;  4YNQ A;  3K0S A;  3NDK A;  1JLB A;  2E2P A;  3ATU A;  3OS1 A;  1YUW A;  3BZC A;  3Q7B A;  2QM1 A;  1GLC G;  4CBW A;  4DLG A;  3O08 A;  3O8M A;  3HYF A;  4F2S A;  3MDQ A;  3NVM A;  3ITH A;  1NK5 A;  1JL1 A;  1ATR A;  4FJ7 A;  1I39 A;  4JI6 K;  3ALY A;  4MLE A;  3K5M A;  2GUP A;  1IJJ A;  1SKR A;  3AVF A;  4FWL A;  3HM8 A;  1T03 A;  1YJ9 N;  4E7J A;  3ZT2 A;  4EP4 A;  2RE2 A;  4PQU A;  4DR4 K;  3MEE A;  1DKG D;  1QQN A;  4C8O A;  1RDU A;  3UIQ A;  3DYA A;  5C15 A;  3TWH A;  5KPR A;  5AZI A;  3RR7 A;  2IGI A;  4DV7 K;  3O9Q A;  4R5P A;  3FGU A;  4CJU A;  4B3T K;  3QFP A;  3OYM A;  5DM6 L;  3D2E B;  2YHA A;  4CFD A;  3SJJ A;  4FJH A;  3FR0 A;  3S3N A;  2QWO A;  4FLU A;  5ELZ A;  4FLW A;  1JLQ A;  1SAZ A;  2P9U A;  3FZF A;  1RBU A;  4CD1 A;  4K41 A;  5JMV A;  5IWA K;  1S1T A;  3AVA A;  2YHW A;  4M3T A;  3VTH A;  2WBN A;  3L4Q A;  4CIG A;  4BE2 A;  2ASP A;  4ID5 A;  3O4W A;  3EE9 A;  2D4W A;  5JVH L;  3TTF A;  5I9E B;  4BRD A;  3VEN A;  4CFC A;  1LOT B;  1NK9 A;  5HRR A;  5AZJ B;  3SBT A;  2HHS A;  1D5A A;  4DFP A;  2ZD1 A;  3CM6 A;  2GUI A;  2RN2 A;  3S3O A;  3VGL A;  2Z1G A;  3IMX A;  1S3X A;  4V19 S;  1NGJ A;  3DRS A;  1WNS A;  1RBR A;  1D8Y A;  2IDO A;  1RT1 A;  1RTJ A;  4LY7 A;  5KQD A;  3AO1 A;  4OVL A;  1WN7 A;  2OA8 A;  4BRK A;  5CE3 A;  3V9S A;  4DU1 A;  2E1Z A;  4HCB A;  3K2P A;  4K25 A;  1N36 K;  3RSE A;  2A40 A;  4AM6 A;  1WB9 A;  3J7A P;  4BVP A;  1WSH A;  4E7I A;  2QWN A;  3QEP A;  4FPB A;  4FSV A;  4H4O A;  4DSI A;  4PL8 A;  4K8X A;  3N4Q A;  3OYH A;  4KPY A;  5E84 A;  2W6K A;  4DF8 A;  3FFK B;  3VA3 A;  2P9K A;  4M3W A;  3QNO A;  4GV3 A;  3L3U A;  1VQL N;  2ITM A;  4CHY A;  2OZM A;  3EO3 A;  1W2B M;  4FJX A;  1Q81 O;  3CET A;  4YOR A;  5AR0 A;  3U4L A;  3EE8 A;  4FLX A;  1U48 A;  1TUY A;  4DLE A;  4FZY A;  3ZX2 A;  1BA0 A;  1HNI A;  3KLI A;  1SKS A;  4OJR A;  2NZT A;  4CEQ A;  5AQL A;  4KFB A;  3KJV A;  3LPT A;  4KB1 A;  1Z05 A;  2KW4 A;  1NGB A;  3OA9 A;  2OCE A;  3VTI A;  3ZT0 A;  5J2Q A;  1RDC A;  4NLB A;  5AQV A;  3KTQ A;  5AZI B;  1NLV A;  3SV3 A;  1IBL K;  3KK3 A;  1JLC A;  1GLB G;  1G15 A;  4B9U A;  3G71 N;  4DQP A;  1QSL A;  4CK3 A;  3NMU A;  3RRG A;  2OPP A;  3QO9 A;  3QFU A;  4CEA A;  1OH5 A;  1V4S A;  3H1V X;  2HBM A;  1U2V B;  5I3U A;  5H1S Q;  3KIO A;  4DV0 K;  1BO5 O;  2JGU A;  2QEX N;  1ASU A;  2D0C A;  4FWM A;  1WSG A;  4EP5 A;  3C6H A;  1NJI O;  3DAW A;  3ZEU B;  3F9M A;  1ITG A;  4F3O A;  3DWL A;  3HTV A;  4GKJ K;  1UAX A;  5GAD P;  3THX A;  2QXL A;  4C8N A;  5HRS A;  2YV0 X;  4BAC A;  4KHU A;  4F3T A;  4X62 K;  4JHD B;  4FLV A;  2VG6 A;  1LWF A;  3HZ6 A;  4YOW A;  1X3M A;  4DQR A;  2XY6 A;  1RBS A;  2G8H A;  1C1C A;  4MFB A;  3O5B A;  1XHX A;  4EFH A;  3SAG A;  1NNE A;  2KFZ A;  1T7P A;  4KHS A;  1QS4 A;  1TKZ A;  3TI0 A;  2G8I A;  3F5T A;  3SMS A;  3S3M A;  4J2D A;  2YHX A;  3C7N B;  3I0S A;  3OHR A;  3CD6 N;  1KVA A;  2PFU A;  1NGI A;  4PHT X;  3ID6 A;  3CCJ N;  4N76 A;  4MDB A;  3THV A;  4FJ5 A;  1Y64 A;  4LD0 A;  2YHY A;  4H5V A;  2P9S A;  3TR8 A;  5AQH A;  3G0Z A;  1IO2 A;  5ADX H;  5KPT A;  3UE5 A;  5EXW A;  3VEV A;  3HM9 A;  4U67 L;  2KQ2 A;  2WC9 A;  3IS9 A;  4JLH A;  3C6U A;  4O4G A;  4LSL A;  3E9P A;  4CZH A;  5BRD A;  4FPA A;  3O6W A;  4CEB A;  3OBY A;  4O0I A;  3DM2 A;  3SBG A;  1V4T A;  3M3Z A;  4MDA A;  3J81 O;  4PUO A;  1JLE A;  4FWQ A;  1EWR A;  3DOK A;  5LJV A;  3N4P A;  5J1E A;  4O55 A;  4N41 A;  3RTV A;  4Z4G A;  2W42 A;  1RCH A;  3ZSO A;  2X78 A;  4A2A A;  3E1Y A;  3E9L A;  2HBL A;  4AQY K;  3U3G A;  2KZM A;  5FPM A;  4ISG A;  4YHH K;  3BP8 A;  4JKH A;  4RW4 A;  4NYF A;  4YFU A;  4JRP A;  3G10 A;  1SL1 A;  5BRH A;  4CIE A;  1RT5 A;  4KH4 A;  3ZET B;  3LZI A;  3VQ7 A;  4CD3 A;  5CZ2 A;  3WXM B;  4O5B A;  3NH1 A;  2HNY A;  4LFC K;  4RW6 A;  5HP1 A;  4A5A A;  2YI1 A;  2QW9 A;  5AJ3 K;  2E2O A;  4CZM A;  3L4I A;  2NRW A;  1TAQ A;  3QIP A;  1HJO A;  3CC2 N;  1TVR A;  1REV A;  4AF1 A;  3CI5 A;  3EY1 A;  3KLF A;  3ENH A;  5AQT A;  3GE1 A;  1WOQ A;  3KHY A;  3RWU A;  2NRZ A;  3TAP A;  4AHS A;  1DGK N;  3SJH A;  3VA0 A;  3AVI A;  3C95 A;  4XIU A;  1VRT A;  4IJN A;  5AQY A;  2V7Z A;  5BN8 A;  4W5R A;  3VEO A;  2KKZ A;  4DTN A;  1KD1 O;  2A41 A;  3NH2 A;  1VAZ A;  3KWG A;  2Z1H A;  1CLQ A;  1JLA A;  2E2N A;  4C8M A;  2BH1 A;  3LM9 A;  2D1K A;  3HI0 A;  4CGH A;  4BG9 A;  3T7Z A;  4E1J A;  1TGO A;  4ISF A;  2P9L B;  1GLL O;  5JVG L;  4UY8 O;  4DSE A;  2KTQ A;  3LDQ A;  3M8P A;  1HMV A;  1NG9 A;  3HL8 A;  3TAM A;  3VQ9 A;  5JLF A;  3QEV A;  1FW6 A;  4CVN E;  4R79 A;  1XI1 A;  2PZS A;  3R3L A;  1NK0 A;  3LWL A;  1YTA A;  2FF3 B;  3HPH A;  2P9P B;  2HMP A;  3LZJ A;  4DS4 A;  4CJ4 A;  2OTJ N;  5AQR A;  3QDK A;  4FWO A;  3PO5 A;  1WLJ A;  4IBN A;  3CPW M;  4H5T A;  2VWB A;  4X66 K;  1VQM N;  1B9D A;  3CJB A;  4XEI A;  3O4N A;  5I42 A;  3VQ6 A;  4DTR A;  2O4G A;  3BZK A;  3U8X A;  1NOY A;  4I2Q A;  2IIR A;  3CJ7 A;  3LWM A;  4GKK K;  2HHV A;  4C23 A;  5HRO A;  2P9N A;  3KK2 A;  2HHH K;  4BWJ A;  1XC9 A;  4JI5 K;  1FJG K;  1NGF A;  3H46 O;  3DXK B;  1RT3 A;  4BR5 A;  3IFR A;  1IBK K;  4BRH A;  2P9P A;  4RW8 A;  1S9E A;  3EKU A;  4YY3 K;  3K5N A;  1HPM A;  4KHY A;  1J9A A;  3O9U A;  4B08 A;  4H0V B;  3ZT1 A;  2W41 A;  4FO0 A;  4M3U A;  3J7Y P;  1BA1 A;  3BGR A;  3VQ4 A;  3SUN A;  4M45 A;  2PAV A;  3QIO A;  3AAP A;  1U49 A;  5BRE A;  3HPO A;  3M8S A;  4LH4 A;  3D6R A;  2QK9 A;  3SUO A;  4B8C A;  3A5N C;  4H0Y B;  2FF6 A;  3AO5 A;  4XH4 A;  1XC3 A;  4YOU A;  2WON A;  5DM7 L;  5KRS A;  2E5L K;  1ASV A;  3ULE B;  5FPN A;  1S6Q A;  5CZ1 A;  4DTS A;  2OPQ A;  3CCU N;  3Q7C A;  4O8K A;  4K0K K;  1RDW X;  2HW3 A;  4JKF A;  4GV9 A;  4C8L A;  1LW0 A;  4FJ9 A;  1WUA A;  4CJV A;  3CFR A;  1RT2 A;  3THY A;  2E6L A;  3DXM B;  2NRH A;  4CGI A;  3ZX3 A;  3AVM A;  4OKJ A;  4GW6 A;  2QWL A;  4BC5 A;  4FYD A;  2KFN A;  3G6E N;  5FLX O;  4DKW A;  3TAE A;  1JL2 A;  3P1G A;  3NGI A;  4F4K A;  3WQU A;  1RDA A;  2YNH A;  4ELU A;  2ZJP L;  1NU0 A;  3VOV A;  3C94 A;  4M7Y A;  3OYI A;  5KTQ A;  4B9T A;  4DV2 K;  3GL1 A;  1VQK N;  2HVH A;  1JLG A;  1RDD A;  3LPU A;  4BWM A;  1OVQ A;  1SL0 A;  5BPM A;  5AQF A;  3VES A;  2FSN A;  2HND A;  3OYD A;  3VMF B;  5FRM A;  2UXC K;  1VQP N;  3ENB A;  4Z4H A;  4JAX A;  1JJ2 M;  3CJA A;  1BGX T;  3L2Q A;  2UUC K;  5KI6 A;  3CME N;  3K9K A;  4JI8 K;  2YJE A;  5J2M A;  2YCH A;  1ILY A;  4E0D A;  3OBW A;  4IFE A;  3C6T A;  3WUH A;  3CCM N;  1NMN A;  4JI1 K;  2HHW A;  4CZE A;  4JKD A;  1GOB A;  1RTI A;  4WQ5 C;  4JNE A;  1VQN N;  4CBX A;  1XNQ K;  4DTX A;  2NRR A;  3C65 A;  3ZSW A;  4DQQ A;  1T05 A;  5AQG A;  4AHU A;  3P38 A;  4NYN A;  2FXU A;  5LMN K;  4RTF D;  3S9H A;  1U04 A;  2ASM A;  4Z4C A;  3NE6 A;  2AA4 A;  4BR4 A;  1EP4 A;  3B6P A;  4CJW A;  3HK2 A;  1U2V A;  1NK8 A;  1TL1 A;  3MN5 A;  3S41 A;  2IVP A;  1IKV A;  2G8U A;  2ASO A;  3RMA A;  4NXM K;  1MDU B;  4BC4 A;  3LDS A;  3HO1 A;  2B4J A;  1KFS A;  1QE1 A;  3DI6 A;  1ZC6 A;  4CJP A;  2YHB A;  4K8Z A;  2Q97 A;  1VSE A;  5KQ8 A;  1LAW A;  3KLE A;  2FC0 A;  3DLR A;  3TTD A;  2WFB A;  2IOC A;  3PV8 A;  1VQ5 N;  1L3S A;  4OGE A;  1VQ4 N;  3QIN A;  3WNG A;  4BRA A;  3EL2 A;  3V1R A;  3T1H K;  3L8B A;  2I7P A;  3ZT3 A;  4H8K A;  3MN7 A;  1TKX A;  1LW2 A;  2P1J A;  4DV5 K;  4LFA K;  2F8S A;  4CZI A;  3HST B;  3QIC A;  3K59 A;  4OPK A;  1EXQ A;  3TSQ A;  2E2Q A;  5E41 A;  3VQE A;  5F2R A;  1U47 A;  3SQ1 A;  1BG3 A;  3EYZ A;  4ELV A;  4B1X B;  3NFA A;  2VWK A;  4M3X A;  4DV4 K;  4IG3 A;  1KSP A;  4EIA A;  4H0T B;  4CI6 A;  1JCG A;  4JRQ A;  3ZX0 A;  2LSN A;  4BE0 A;  4BR9 A;  3GBT A;  5HBM A;  3NF9 A;  1N6Q A;  2HF4 A;  2EHG A;  1B92 A;  3I56 N;  5M1P A;  3T3F A;  1RTD A;  1F21 A;  3JYT A;  3OTO K;  4WQ4 C;  4KTQ A;  3ZET A;  4CJQ A;  3L2V A;  2PYL A;  3B8A X;  2VG5 A;  2FBT A;  1ASW A;  1X9S A;  1NK7 A;  4JYA K;  3MXJ A;  4Q5V A;  3TSP A;  3VPZ A;  4OLB A;  3ASM A;  4CF8 A;  4DU3 A;  4DTJ A;  5AFU H;  3EEQ A;  2RF2 A;  3O1B A;  1O13 A;  4BY9 C;  5C12 A;  1Q82 O;  3OS2 A;  4OKK A;  1KCF A;  3THW A;  3V81 A;  4BRN A;  1YIT N;  3VEZ A;  3A8Y A;  3AY9 A;  3LAK A;  2HHU A;  4QAG A;  1KQS M;  3PY8 A;  3CER A;  2DFF A;  3IDH A;  2P5G A;  4KH6 A;  3CC7 N;  1BUP A;  1UWB A;  5KGW A;  4RWT A;  2YNF A;  3C6A A;  1N34 K;  3D0P A;  5AQP A;  5BPN A;  1KXP A;  4DB3 A;  4DCH A;  4BDZ A;  2JLE A;  1HLU A;  2PY5 A;  4FXD A;  1HNZ K;  4NCB A;  4GNI A;  2XRI A;  4AHC A;  4KBO A;  1Z26 A;  5DK5 A;  3L0Q A;  2O8C A;  4M63 C;  2E8A A;  4H4M A;  4AHR A;  4FJG A;  1ZBL A;  2HHX A;  4FWS A;  1K6Y A;  1O1W A;  2VG7 A;  3AVB A;  4BRP A;  2EWS A;  1ZBU A;  4IEI A;  3AVN A;  3UKR B;  2O8F A;  3CJC A;  5CR4 A;  4CGF A;  1HQU A;  3LAN A;  1LWC A;  4B9Q A;  4CBU A;  1KFD A;  3ZSZ A;  1FKP A;  4DHY A;  1XNR K;  1LWE A;  4FLY A;  4Z4I A;  5JIC A;  1QZ5 A;  5LY3 A;  2UYT A;  1FKO A;  4LC9 B;  2A6A A;  2Q0U A;  3M8R A;  1RBV A;  2NNW A;  3O1W A;  4ZTF A;  3SCX A;  2F96 A;  1VQ6 N;  3AVJ A;  2GX9 A;  4H0X B;  1Q86 O;  1NGG A;  1FXX A;  1GLJ O;  1SV5 A;  2IS3 A;  4MLH A;  5KPZ A;  3AV9 A;  4BR0 A;  1EKE A;  3KK7 A;  4MO5 A;  3RMC A;  1TK8 A;  2HMI A;  1C6V A;  4CFB A;  3NGZ A;  4CHN A;  4ICL A;  2G8F A;  3HSC A;  4GMJ B;  1Q18 A;  1X9J A;  5AQJ A;  3K58 A;  4DR2 K;  4Z4F A;  2E20 A;  3DRP A;  1K9M O;  1U4B A;  1HKC A;  2YNI A;  3SYZ A;  2UUA K;  3TAB A;  4KH5 A;  1I94 K;  2CH6 A;  3O4Q A;  3U9Z A;  1IG9 A;  4YDU A;  3PX6 A;  4ZTJ A;  4JEP A;  3FE1 A;  4CJE A;  1C0G A;  3MEG A;  5KGX A;  4QCL A;  3SPZ A;  4KTW A;  4ID1 A;  3V9Z A;  1YI2 N;  4M3Y A;  4FM2 A;  3V4I A;  5M1Q A;  1A5W A;  5DMR A;  4CHO A;  3ID8 A;  5BR8 K;  3RMB A;  2RKI A;  3HPG A;  5BN9 A;  5BRF A;  1QSY A;  3NF6 A;  3DLG A;  3OJS A;  1DLO A;  2ZJR L;  1XQS C;  4DTM A;  4O5F A;  2NUB A;  4O8U A;  1HPZ A;  4JI4 K;  4DSL A;  4CCH A;  3THY B;  1HQE A;  4A5B A;  3ZLJ A;  4FZZ A;  5SZT A;  3MWP A;  4KO0 A;  1WSI A;  1P8Z A;  3LP1 A;  4DUY K;  4BC3 A;  4LH5 A;  1Q9X A;  3R6M A;  5GIN A;  3VN5 A;  3MXI A;  5AQW A;  4CF9 A;  1X9W A;  2FSK A;  3EN9 A;  2F9W A;  3AA3 A;  3AVH A;  1XWL A;  3MCP A;  3CG7 A;  1S1W A;  2BGG A;  2QWP A;  4OLA A;  4NO7 A;  1C0F A;  3VF6 A;  3QBX A;  4CER A;  4LFB K;  2IVN A;  2KLA A;  1BQM A;  4E7K A;  3SQ4 A;  3WXJ A;  1S6P A;  4GVM A;  5JS2 A;  1QQO A;  2GWK A;  1QQM A;  4IJA A;  3L2W A;  3EZ5 A;  1SZ2 A;  1KVB A;  4KHQ A;  2Y1I A;  1SL2 A;  1XMQ K;  4NCG A;  4U7B A;  2NRX A;  4FLZ A;  3VEX A;  1HR0 K;  3THX B;  3SQ0 A;  5M1O A;  4B1V A;  3LP2 A;  3O3F A;  3DOL A;  4KTZ A;  2V7Y A;  3HRG A;  4RG8 A;  1J5E K;  2WUS A;  2DFE A;  4PL7 A;  1W9H A;  1R59 O;  2P51 A;  5F1X A;  1YIJ N;  4K42 A;  3CMA N;  2VYP A;  4QS9 A;  1TK5 A;  1XHZ A;  4M41 A;  1U45 A;  2KHO A;  3M5R A;  4L3Q A;  3GOI A;  3NBP A;  4OPJ A;  4JKG A;  4DTU A;  5C2D A;  2A42 A;  2Q0R A;  5GAH P;  3MX5 A;  1YT3 A;  4UQG A;  3RR8 A;  4BQL A;  3FFI A;  3QEX A;  4I6M B;  1XMO K;  3OYF A;  4JHD A;  3VEW A;  2AP1 A;  1HYV A;  3WQT A;  3FZM A;  1KC8 O;  4DWI A;  1NGD A;  4CJ5 A;  2BUP A;  2OYQ A;  3AO3 A;  3H08 A;  3CF5 L;  4AIL C;  4YOX A;  3L2R A;  5LMU K;  4DQ8 A;  3HOS A;  1MU2 A;  3SQ2 A;  1HYZ A;  4DUZ K;  3W0L A;  4BRE A;  4ILH A;  1JXE A;  3HP9 A;  3TAN A;  1M1K O;  2E4L A;  4HHT A;  1VSI A;  3P4I A;  5A2Q O;  3C7N A;  3LAL A;  4FM0 A;  4B3S K;  1S5J A;  4PY5 A;  2ZF5 O;  4JD2 A;  3PLA A;  4FK4 A;  2QXF A;  2OTL N;  1KAZ A;  1WSJ A;  2FBY A;  1CZ9 A;  2YKN A;  3BF3 A;  5E26 A;  5C42 A;  4DQS A;  4CGD A;  5M1F A;  3CCE N;  3TSU A;  3LM2 A;  1VK0 A;  2HB5 A;  1UA0 A;  2DPN A;  1FK9 A;  4DSK A;  3MWT A;  1SQK A;  3GG4 A;  4WQ5 A;  4BRC A;  4CF2 A;  4YOV A;  1XUP O;  4CEO A;  1VQ8 N;  3NF8 A;  3OYL A;  1CZB A;  5EU7 A;  4KHN A;  3L3V A;  2WOM A;  1D9D A;  1QVF M;  1RGI A;  2HST A;  2UUB K;  5GIO A;  3OYN A;  4KHP K;  4BRF A;  4DG1 A;  4CJ7 A;  4CZL A;  3ZT4 A;  3VQC A;  3CFP A;  3E66 A;  1Q8I A;  3QB0 A;  3VQB A;  2O8D A;  3ULE A;  4AM7 A;  3QET A;  4FK2 A;  1HNV A;  2F7T A;  4H5W A;  4WFN L;  1RDB A;  3CCL N;  4EHT A;  3DMJ A;  3CIP A;  4IO8 A;  4J2E A;  3HJF A;  2HBK A;  3H45 C;  1BIS A;  4IOA L;  3DXM A;  3MMV A;  1VSJ A;  1UOC A;  1NGC A;  2E88 A;  3QES A;  2ETJ A;  1BIZ A;  4HVJ A;  1C0T A;  4PA1 A;  3RRH A;  3CCV N;  1ZBF A;  3DJC A;  4O44 A;  1YVN A;  4DMN A;  3BF1 A;  4CK1 A;  1S1U A;  2F9T A;  2RPI A;  4DV1 K;  3ATV A;  4BVO A;  4K43 A;  4MQ3 A;  5B8H A;  2G8V A;  1K73 O;  2J4R A;  2OPS A;  4KRF A;  1HKB A;  1BOT O;  4AHT A;  3M8Q A;  3RMD A;  1IV0 A;  1YXQ A;  1KVC A;  4OO1 J;  3KLG A;  1ZBI A;  3MK6 A;  3K57 A;  3PX0 A;  1L3U A;  5JLH A;  3OYB A;  3VEY A;  4PKI A;  3ZSV A;  2G8K A;  5BPL A;  2XO7 A;  4DU4 A;  4KB0 A;  1R0A A;  1IKY A;  3TAQ A;  1E3M A;  1TYQ A;  1T44 A;  2B6A A;  1LAV A;  3O3G A;  1BQN A;  1RTH A;  4JK8 A;  1SUQ A;  4QOZ B;  4NXN K;  4F9O A;  1NJZ A;  3AVC A;  3VQ8 A;  3SZ2 A;  4GV6 A;  1NGH A;  1BI4 B;  5AQM A;  4X64 K;  1H1V A;  4OKE A;  4BDY A;  1C1B A;  3KWI A;  4FW2 A;  2ZJQ L;  4FOI A;  1J5O A;  2VWJ A;  1GOC A;  2QWM A;  4WCE L;  4IFY A;  4XH5 A;  4E89 A;  2V52 B;  3A0I X;  2AJQ A;  3T1A A;  2E6M A;  4CJ3 A;  1IBM K;  2D5R A;  4RCH A;  2VQE K;  2P9I B;  3FZH A;  5CYQ A;  1WBD A;  2P5O A;  3UKR A;  3O80 A;  2PBD A;  3OYE A;  4DSF A;  2D0P A;  4Y0W A;  4M3Z A;  1BWF O;  1ZYQ A;  3TPQ A;  4B3M K;  4BQZ A;  4B1U B;  5GAE P;  5AQQ A;  3IKM A;  1NK6 A;  4KV8 A;  1YJN N;  2O8B A;  4CZF A;  1NKE A;  1TUU A;  4BDP A;  4DS5 A;  1TL3 A;  1NM1 A;  1N32 K;  5GIP A;  3VQ5 A;  4OX9 K;  3AGK A;  3LDL A;  1KLM A;  4DTP A;  2Y1J A;  3H3N O;  3MX2 A;  3IAY A;  4OPH A;  3J7Z O;  5AZJ A;  4CGJ A;  3G4S N;  1TK0 A;  2XY8 A;  2O8E B;  3H6E A;  4LSN A;  1BL3 A;  4JD2 B;  1VSL A;  3NH0 A;  4E3S A;  1HNX K;  2ZM6 K;  4G1Q A;  1J54 A;  3CC4 N;  1NMD A;  3SAH A;  4IZ9 A;  3J80 O;  4JKA A;  1DEJ A;  2G8W A;  1BU6 O;  2QA4 N;  3MAQ A;  3EKS A;  4WQ4 A;  2O8D B;  3OYG A;  1J53 A;  2JWL A;  2VGN A;  4IEE A;  3SLC A;  1NJW A;  3WT0 A;  5M1N A;  3VQD A;  1DT9 A;  4XH1 A;  4FJK A;  5M1K A;  3OJU A;  2CGK A;  2UXB K;  3KD1 E;  2FBX A;  4CJK A;  2QWQ A;  4X65 K;  3HT3 A;  1K8K B;  4ILG B;  1RIL A;  3DLH A;  1WSE A;  4JS5 A;  4HUE A;  1TV6 A;  1L3V A;  2FLO A;  3PSI A;  3NAE A;  4IOX A;  1C0U A;  1I3A A;  1X1P A;  4CF1 A;  2QKB A;  4FL9 A;  2QKK A;  1D4X A;  4CE9 A;  1ESV A;  5HRN A;  4DTO A;  4BRG A;  3KZB A;  3IRX A;  4B9L A;  1L3T A;  3HVT A;  4L8R B;  3THW B;  2CGL A;  1B9F A;  5AFU A;  3T19 A;  2OPR A;  1VHX A;  3V1O A;  4Z94 A;  1K8A O;  4LF9 K;  3HBT A;  1T6D A;  3SV4 A;  1RFQ A;  3NGY A;  3SUP A;  5ADX A;  2IC3 A;  1JLF A;  1GLF O;  5AQK A;  2OAN A;  3PX4 A;  4N5S A;  3BEX A;  4WE1 A;  1Y97 A;  3QEI A;  2EX3 A;  2Z1I A;  2O8B B;  1QZ6 A;  3I0R A;  3PUF A;  4CZK A;  2NRV A;  3LP0 A;  2XY7 A;  4E19 A;  3HOT A;  3D45 A;  4QS8 A;  1OH7 A;  3VER A;  2GEM A;  3ZYY X;  3MCA B;  4HCC A;  3M6G A;  4IWV A;  4FWK A;  4B9N A;  4FCY A;  1LCU A;  4FJI A;  4OPA A;  3DXK A;  2Q2R A;  4KI4 A;  5CY4 A;  3FLC O;  2YKM A;  3RVC A;  1EWQ A;  5J2P A;  1CZA N;  3R8E A;  4I2P A;  5MLC Q;  5T7B A;  3DLE A;  3SMP A;  2YJF A;  3ZCM A;  3JAM O;  4KAZ A;  4MO4 A;  4ILJ A;  1OKJ A;  1IG8 A;  1T8E A;  5BR9 A;  4FLT A;  2H3G X;  3CJ9 A;  4FVM A;  1IKW A;  4HTU A;  4BRM A;  4FWR A;  1HJR A;  2KZZ A;  2F8T A;  3OVN A;  4EAH D;  4CEE A;  4PKG A;  4B1Z A;  1JXB A;  3ULD A;  2HOE A;  5LL6 Z;  4NLC A;  4OGC A;  4CES A;  1SKW A;  3FZK A;  3OYC A;  4B9V A;  1KTQ A;  2Q3S A;  3M1F A;  3OS0 A;  1S9G A;  3KLH A;  1E4F T;  3CYM A;  4DR3 K;  1W0H A;  2VGM A;  5K14 A;  4HUF A;  3WEE A;  3QLH A;  4FJN A;  4EHU A;  4TSX A;  3BDP A;  4YOT A;  4E1M A;  2GTD A;  4W5Q A;  3SNN A;  1EQY A;  1Z6R A;  4CZJ A;  3MED A;  3QER A;  3P31 A;  1KRP A;  1HYS A;  4BRQ A;  1ZBH A;  3T69 A;  2HHT A;  1NK4 A;  4WFA L;  1L5U A;  4FZX C;  3MN9 A;  4CJR A;  4W5T A;  1U6Z A;  4YDU C;  3V9U A;  4BC2 A;  4H0O A;  2UXD K;  5AQO A;  3CJ1 A;  3QML A;  1RT7 A;  2HBJ A;  4JKC A;  5JS1 A;  3OYK A;  4BG8 A;  3JSM A;  3RSE B;  4CZG A;  3KVG A;  3PSF A;  1VQ9 N;  2ZGY A;  4JK7 A;  4DFK A;  3PIP L;  1GOA A;  2RHK A;  1YJW N;  3CHW A;  4I9L A;  1S72 N;  4M3R A;  4B1W B;  1QHA A;  5J2N A;  2JWK A;  4H5N A;  1TKT A;  1JCE A;  4DV3 K;  3WNF A;  4B9S A;  1BHL A;  5CHI A;  5CYM A;  1IH7 A;  3HVR A;  3SK3 A;  1TAU A;  1K8K A;  3K5L A;  3NHG A;  5HOO A;  3PIO L;  3QNN A;  1T6C A;  1MWM A;  4Y1C A;  3I55 N;  3CCQ N;  3IUC A;  2BAN A;  4DSJ A;  3NCI A;  2X74 A;  3LL3 A;  4I7F A;  1IKX A;  4Y1D A;  4JI3 K;  4A61 A;  1GLD G;  1N8R O;  3I33 A;  3SAF A;  2E1Y A;  4B3O A;  2OZS A;  3VQP A;  2P9K B;  3I8B A;  2I7N A;  1NKC A;  3F2K A;  4G9Z A;  1M90 O;  4B8A B;  3K5O A;  4CEC A;  2O8C B;  5D3G A;  2XY5 A;  3DLB A; 
#chains in the Genus database with same CATH homology
 1BGX T;  3L2Q A;  4CHQ A;  5KI6 A;  1UA0 A;  1VK0 A;  2HB5 A;  4CFC A;  5J2M A;  1FK9 A;  4E0D A;  4DSK A;  1NK9 A;  2DTU A;  3C6T A;  4W5O A;  2HVI A;  5HRR A;  3TAR A;  4CF2 A;  3AA2 A;  2HHS A;  4CEO A;  2HHW A;  1D5A A;  4DFP A;  3NF8 A;  2ZD1 A;  2IAJ A;  3CM6 A;  3OYL A;  3V6D A;  1CZB A;  1GOB A;  5EU7 A;  3KKR A;  3TAG A;  2GUI A;  3DLK A;  1RTI A;  2RN2 A;  4KHN A;  3L3V A;  2WOM A;  1D9D A;  1NJY A;  3S3O A;  1N5Y A;  4DTX A;  2Z1G A;  3OYN A;  4CGG A;  4B9M A;  3ZSW A;  4DQQ A;  1T05 A;  1LV5 A;  3DRS A;  1WNS A;  4DG1 A;  4IFV A;  4AHU A;  1RBR A;  4NYN A;  3ZT4 A;  1D8Y A;  2IDO A;  1RT1 A;  1RTJ A;  4LY7 A;  3VQC A;  3CFP A;  1Q8I A;  3S9H A;  1U04 A;  3VQB A;  3AO1 A;  3IG1 A;  4OVL A;  1WN7 A;  4Z4C A;  2OA8 A;  3NE6 A;  1EP4 A;  2BE2 A;  3QET A;  4PWD A;  3B6P A;  4CJW A;  3MXM A;  1VSM A;  1HNV A;  4FK2 A;  3HK2 A;  3V9S A;  4IDK A;  1NK8 A;  4DU1 A;  4HCB A;  1TL1 A;  3K2P A;  3KD5 E;  1IKV A;  1WSH A;  2G8U A;  4E7I A;  3RMA A;  3QEP A;  4DF4 A;  1RDB A;  4H4O A;  4DSI A;  3DMJ A;  3HJF A;  4J2E A;  4K8X A;  1A5V A;  3LDS A;  1BIS A;  3OYH A;  4KPY A;  2D0A A;  3HO1 A;  2B4J A;  1VSD A;  1KLN A;  1KFS A;  1VSJ A;  1QE1 A;  4DF8 A;  1UOC A;  3DI6 A;  5KRT A;  1YVU A;  2O4I A;  3VA3 A;  4CJP A;  2YHB A;  3QES A;  1BI4 A;  2ETJ A;  3QNO A;  1X9M A;  1BIZ A;  4HVJ A;  4ELT A;  4K8Z A;  4M3W A;  1C0T A;  4PA1 A;  3U6F A;  3RRH A;  3L3U A;  1VSE A;  4BE1 A;  4CJL A;  4CHY A;  2OZM A;  1VRU A;  1ZBF A;  2D0B A;  1LAW A;  4FJX A;  3KLE A;  2FC0 A;  4O44 A;  4DMN A;  3DLR A;  4CK1 A;  1S1U A;  2IOC A;  4FLX A;  3PV8 A;  1U48 A;  1L3S A;  4DLE A;  4OGE A;  2RPI A;  4FZY A;  3QIN A;  3WNG A;  3ZSR A;  1HNI A;  3KLI A;  3CFO A;  4MQ3 A;  3V1R A;  2X6S A;  1SKS A;  4OJR A;  1QSS A;  3L8B A;  4CJS A;  2G8V A;  4CEQ A;  4KFB A;  3V1Q A;  3KJV A;  3ZT3 A;  3LPT A;  4H8K A;  3ZSY A;  4KB1 A;  4Z0U A;  2OPS A;  4KRF A;  4EZ6 A;  3A2F A;  4AHT A;  1TKX A;  4DFJ A;  2KW4 A;  1LW2 A;  2P1J A;  1QHT A;  2GBZ A;  3M8Q A;  4RW7 A;  3ZT0 A;  4FM1 A;  4E7L A;  1RDC A;  5J2Q A;  3HST B;  3RMD A;  2F8S A;  2XHB A;  3K59 A;  1KVC A;  4OPK A;  3KLG A;  1ZBI A;  1EXQ A;  3K57 A;  3KTQ A;  3ZSQ A;  5E41 A;  3PX0 A;  1L3U A;  5FDL A;  3VQE A;  3OYB A;  3SV3 A;  3ZSV A;  1JLC A;  3KK3 A;  2G8K A;  4AHV A;  2XO7 A;  1RBT A;  4DU4 A;  1G15 A;  3SQ1 A;  1U47 A;  4B9U A;  4KB0 A;  3EYZ A;  4NCA A;  3V9X A;  1R0A A;  1IKY A;  3TAQ A;  4CK3 A;  1QSL A;  4CJF A;  4DQP A;  4ELV A;  2B6A A;  3NFA A;  1LAV A;  2VWK A;  3PO4 A;  2OPP A;  3QO9 A;  2GV9 A;  3RRG A;  3MEC A;  3O3G A;  4M3X A;  2HHQ A;  1BQN A;  1RTH A;  4IG3 A;  1KSP A;  4CEA A;  4JRQ A;  5I3U A;  1SUQ A;  3KIO A;  4QOZ B;  4FW1 A;  2LSN A;  2JGU A;  1RNH A;  1ASU A;  4BE0 A;  2D0C A;  3SPY A;  1NJZ A;  4JS4 A;  5HBM A;  4KHW A;  1WSG A;  4Z4E A;  3AVC A;  3NF9 A;  3VQ8 A;  4EP5 A;  3L2U A;  3SZ2 A;  1ITG A;  1N6Q A;  2BDP A;  4F3O A;  2EHG A;  3CM5 A;  1BI4 B;  4CF0 A;  1B92 A;  1UAX A;  3T3F A;  1RTD A;  1F21 A;  4OKE A;  3JYT A;  1C1B A;  4C8N A;  5HRS A;  4BDY A;  2YV0 X;  4BAC A;  4KHU A;  1A5X A;  4FW2 A;  4KTQ A;  4F3T A;  4CJQ A;  3AVK A;  3L2V A;  4FLV A;  2PYL A;  1J5O A;  2VWJ A;  3F73 A;  1GOC A;  1NKB A;  4IFY A;  4E89 A;  2VG5 A;  2FBT A;  1ASW A;  2VG6 A;  1NK7 A;  1X9S A;  2AJQ A;  3MXJ A;  4KKO A;  3T1A A;  2E6M A;  4Q5V A;  1LWF A;  4CJ3 A;  4DQR A;  4M42 A;  4OLB A;  3WNE A;  1DTQ A;  3E01 A;  3ASM A;  4CF8 A;  4DU3 A;  2XY6 A;  2D5R A;  4DTJ A;  1RBS A;  2RF2 A;  2G8H A;  1C1C A;  4MFB A;  1NOZ A;  2I5J A;  5CYQ A;  1XHX A;  2P5O A;  1NJX A;  3OYE A;  4KRE A;  4DSF A;  4M3Z A;  2KFZ A;  1ZYQ A;  3OS2 A;  1T7P A;  4KHS A;  1QS4 A;  4OKK A;  1KCF A;  3V81 A;  1TKZ A;  1Z25 A;  2ZQB A;  4EZ9 A;  3AA4 A;  3TI0 A;  2G8I A;  5HRP A;  1QTM A;  4CK2 A;  4FJL A;  3CQ8 A;  3S3M A;  4J2D A;  3I0S A;  3LAK A;  3U3Y A;  2HHU A;  1NK6 A;  4KV8 A;  4QAG A;  1KVA A;  3PY8 A;  4I9Q A;  2DFF A;  2P5G A;  4CEZ A;  1NKE A;  4W5N A;  4BDP A;  1BIU A;  4DS5 A;  1UWB A;  4N76 A;  1TL3 A;  1EX4 A;  4J2A A;  5KGW A;  1VSF A;  3THV A;  2YNF A;  4FJ5 A;  3D0P A;  4LD0 A;  3VQQ A;  3I8D A;  3VQ5 A;  4DQI A;  1C1A A;  3TR8 A;  4F8R A;  4E1N A;  1KLM A;  4DTP A;  2Y1J A;  3G0Z A;  4BDZ A;  4CFA A;  2JLE A;  1IO2 A;  3IAY A;  3QEW A;  4N56 A;  4CGJ A;  3HM9 A;  2PY5 A;  1TK0 A;  2KQ2 A;  4FXD A;  3IS9 A;  2XY8 A;  4JLH A;  4LSN A;  4CEF A;  1BL3 A;  3C6U A;  4NCB A;  1DTT A;  1VSL A;  2XRI A;  4O4G A;  4AHC A;  3NH0 A;  1TKD A;  4E3S A;  1Z26 A;  5DK5 A;  3SUQ A;  4LSL A;  4G1Q A;  1J54 A;  4H4M A;  3SI6 A;  4CEB A;  4AHR A;  2G8W A;  5HLF A;  4FJG A;  3ZSX A;  4O0I A;  1ZBL A;  2HHX A;  3MAQ A;  2Z1J A;  3DM2 A;  3VQA A;  4PUO A;  1K6Y A;  3AVB A;  1JLE A;  1O1W A;  2VG7 A;  3WNH A;  3OYG A;  1J53 A;  4KI6 A;  4E7H A;  3DOK A;  1CXU A;  1ZBU A;  3OYA A;  5J1E A;  1NJW A;  4O55 A;  4N41 A;  4CHP A;  3RTV A;  3AVN A;  3AO4 A;  4FK0 A;  1RT6 A;  4Z4G A;  2W42 A;  3VQD A;  4FJK A;  1RCH A;  3OJU A;  4N47 A;  3ZSO A;  2X78 A;  1WAF A;  1HQU A;  4CED A;  3LAN A;  4CGF A;  3OY9 A;  1LWC A;  3KD1 E;  2FBX A;  4CJK A;  3HT3 A;  1KFD A;  3ZSZ A;  1FKP A;  5C25 A;  3U3G A;  3F9K A;  1LWE A;  4FLY A;  2KZM A;  4Z4I A;  1RIL A;  3DLH A;  1WSE A;  4RW4 A;  4NYF A;  4YFU A;  4JRP A;  3G10 A;  4JS5 A;  4O0J A;  4HUE A;  1TV6 A;  3TAF A;  1SL1 A;  4CIE A;  1FKO A;  1RT5 A;  1L3V A;  3LZI A;  3VQ7 A;  5CZ2 A;  3NAE A;  3M8R A;  1RBV A;  4O5B A;  3NH1 A;  1C0U A;  2HNY A;  3SCX A;  4ZTF A;  2R7Y A;  2F96 A;  1I3A A;  1X1P A;  4RW6 A;  4CF1 A;  5HP1 A;  3AVJ A;  2QKB A;  2QKK A;  4CE9 A;  4CIF A;  1FXX A;  4DTO A;  5HRN A;  1QQC A;  3QIP A;  1TAQ A;  1TVR A;  1SV5 A;  2IS3 A;  3IRX A;  1REV A;  4B9L A;  3LP3 A;  3O3H A;  1L3T A;  4CHZ A;  1S1X A;  3P83 D;  3KLF A;  3EY1 A;  4C8K A;  1VSH A;  3HVT A;  4L8R B;  4FJ8 A;  1CXQ A;  3AV9 A;  1B9F A;  1HRH A;  4AH9 A;  3RWU A;  3TAP A;  4AHS A;  3VA0 A;  3AVI A;  3C95 A;  3T19 A;  1JKH A;  4XIU A;  1VRT A;  1EKE A;  2OPR A;  3AVG A;  3V1O A;  3ISN C;  4W5R A;  3RMC A;  4DTN A;  1TK8 A;  2HMI A;  4DFM A;  1C6V A;  4CFB A;  3NGZ A;  3NH2 A;  3SV4 A;  3DRR A;  3NGY A;  4CHN A;  3SUP A;  2Z1H A;  4ICL A;  1CLQ A;  3NF7 A;  1BCM A;  1JLA A;  2IC3 A;  2ITG A;  4J2B A;  2G8F A;  1JLF A;  4GMJ B;  2DFH A;  4C8M A;  3K58 A;  3AVL A;  4CGH A;  4F2R A;  4Z4F A;  3DRP A;  3PX4 A;  4N5S A;  4WE1 A;  1U4B A;  2YNI A;  5FRN A;  1Y97 A;  3SYZ A;  3QEI A;  2EX3 A;  2Z1I A;  4FJJ A;  3TAB A;  1TGO A;  3I0R A;  3PUF A;  3O4Q A;  4DSE A;  1IG9 A;  2KTQ A;  3LP0 A;  3PX6 A;  3M8P A;  2XY7 A;  4ZTJ A;  4E19 A;  1HMV A;  3D45 A;  3HL8 A;  3TAM A;  4RW9 A;  3VQ9 A;  4CJE A;  3QEV A;  4HCC A;  2DY4 A;  3MEG A;  1XI1 A;  4B9N A;  2PZS A;  4FCY A;  2ZE2 A;  3AO2 A;  5KGX A;  4FJI A;  1NK0 A;  3SPZ A;  4QCL A;  3LWL A;  4KI4 A;  4KTW A;  1YTA A;  4ID1 A;  5CY4 A;  3V9Z A;  4M3Y A;  4FM2 A;  2YKM A;  3V4I A;  3HPH A;  3OYJ A;  3LZJ A;  4DS4 A;  4CJ4 A;  5J2P A;  1A5W A;  5DMR A;  5FRO A;  4CHO A;  2A1R A;  3PO5 A;  3AA5 X;  1WLJ A;  2B5J A;  4I2P A;  4IBN A;  3RMB A;  2RKI A;  3HPG A;  3DLE A;  5T7B A;  1QSY A;  3ZCM A;  3V9W A;  3NF6 A;  4HUG A;  4KAZ A;  1B9D A;  3DLG A;  3O4N A;  3OJS A;  1DLO A;  1RT4 A;  3VQ6 A;  5I42 A;  4DTR A;  4FLT A;  1T8E A;  2O4G A;  2HNZ A;  1NOY A;  4FVM A;  4I2Q A;  1IKW A;  3LWM A;  2HHV A;  4HTU A;  3LAM A;  1HJR A;  2KZZ A;  4DTM A;  4IG0 A;  2F8T A;  3OVN A;  2NUB A;  2X6N A;  4Q0B A;  5HRO A;  4IKF A;  2A1S A;  3KK2 A;  4CEE A;  1HPZ A;  5SWM A;  1JXB A;  3ULD A;  4DSL A;  4CCH A;  4BWJ A;  1XC9 A;  1HQE A;  4FZZ A;  1BCO A;  1RT3 A;  4CES A;  4OGC A;  5SZT A;  1SKW A;  3KK1 A;  3OYC A;  1WAJ A;  4KO0 A;  4B9V A;  1WSI A;  3B6O A;  1S1V A;  3LP1 A;  1KTQ A;  2Q3S A;  3KKS A;  1S9E A;  4LH5 A;  4RW8 A;  3OS0 A;  1Q9X A;  1S9G A;  3VN5 A;  2FBV A;  3KLH A;  1WSF A;  3CYM A;  3MXI A;  1W0H A;  3K5N A;  5K14 A;  4KHY A;  4HUF A;  4CF9 A;  1X9W A;  1J9A A;  3QLH A;  4B08 A;  3ZT1 A;  4FJN A;  4TSX A;  3AA3 A;  1C0M A;  3AVH A;  3BDP A;  2YNG A;  1XWL A;  4M3U A;  4E1M A;  4W5Q A;  3CG7 A;  3P5J A;  3SNN A;  5C24 A;  1S1W A;  2BGG A;  1D9F A;  1Q9Y A;  3MED A;  4OLA A;  3BGR A;  3QER A;  4CJT A;  1KRP A;  4ZHR A;  4CER A;  3VQ4 A;  2ATQ A;  3HP6 A;  3SUN A;  4FJM A;  1ZBH A;  1HYS A;  1YTU A;  1BQM A;  4M45 A;  4E7K A;  3SQ4 A;  3QIO A;  3HXM A;  1NK4 A;  2PYJ A;  2HHT A;  1S6P A;  1U49 A;  4GVM A;  1EET A;  1VSK A;  4CJR A;  1L5U A;  3HPO A;  5JS2 A;  4FZX C;  4W5T A;  3V9U A;  3L2W A;  1UA1 A;  4YNQ A;  3M8S A;  3EZ5 A;  4LH4 A;  3NDK A;  1JLB A;  1KVB A;  2Y1I A;  1SL2 A;  4KHQ A;  2QK9 A;  3OS1 A;  3SUO A;  4B8C A;  1RT7 A;  4NCG A;  3AO5 A;  2WON A;  4FLZ A;  5JS1 A;  3OYK A;  3JSM A;  5KRS A;  3SQ0 A;  4DLG A;  1ASV A;  3LP2 A;  3O3F A;  3HYF A;  4F2S A;  3DOL A;  4KTZ A;  1S6Q A;  4RG8 A;  5CZ1 A;  3ITH A;  4DTS A;  1NK5 A;  2OPQ A;  1JL1 A;  4DFK A;  1GOA A;  2DFE A;  4FJ7 A;  1W9H A;  4I9L A;  1I39 A;  2P51 A;  4M3R A;  3ALY A;  2HW3 A;  5J2N A;  3K5M A;  1TK5 A;  1TKT A;  4C8L A;  1XHZ A;  1LW0 A;  4M41 A;  1SKR A;  1U45 A;  4FJ9 A;  3AVF A;  3WNF A;  4B9S A;  4CJV A;  3CFR A;  3NBP A;  1BHL A;  1RT2 A;  1T03 A;  2E6L A;  4OPJ A;  3ZT2 A;  4E7J A;  5CYM A;  4EP4 A;  4DTU A;  4PQU A;  4CGI A;  1IH7 A;  3AVM A;  3MEE A;  3HVR A;  4OKJ A;  4C8O A;  1TAU A;  3UIQ A;  4GW6 A;  3K5L A;  3DYA A;  1YT3 A;  4UQG A;  3RR8 A;  3TWH A;  3FFI A;  3NHG A;  3QEX A;  4FYD A;  3RR7 A;  2IGI A;  3OYF A;  4R5P A;  4CJU A;  2KFN A;  3QNN A;  4Y1C A;  1HYV A;  3TAE A;  1JL2 A;  3OYM A;  2BAN A;  3P1G A;  3NGI A;  4DWI A;  2YHA A;  4CFD A;  4DSJ A;  3NCI A;  4F4K A;  4CJ5 A;  3SJJ A;  2OYQ A;  3AO3 A;  4FJH A;  1RDA A;  2X74 A;  2YNH A;  3H08 A;  4ELU A;  4AIL C;  4I7F A;  3L2R A;  3C94 A;  3OYI A;  5KTQ A;  1IKX A;  1MU2 A;  3SQ2 A;  3S3N A;  1HYZ A;  4Y1D A;  4B9T A;  4FLU A;  4FLW A;  1JXE A;  3HP9 A;  1JLQ A;  3TAN A;  2HVH A;  2E4L A;  1JLG A;  1RBU A;  1VSI A;  4HHT A;  1RDD A;  3LAL A;  4FM0 A;  3LPU A;  4BWM A;  4PY5 A;  1S5J A;  4B3O A;  2OZS A;  1S1T A;  3VQP A;  3AVA A;  1SL0 A;  1NKC A;  4M3T A;  2HND A;  3OYD A;  2QXF A;  4FK4 A;  5FRM A;  4B8A B;  3K5O A;  1WSJ A;  4CEC A;  4Z4H A;  5D3G A;  2FBY A;  4CIG A;  1CZ9 A;  2XY5 A;  4BE2 A;  2YKN A;  4ID5 A;  5C42 A;  4DQS A;  3DLB A;  4CGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...