5KHHA

Hcn2 cnbd in complex with inosine-3', 5'-cyclic monophosphate (cimp)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
194
Chain Sequence
SSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
total genus 64
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khhA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khhA02
5T3NA 2GAUA 1XE7A 4J1WA 4IEUA 3FZ3A 4QGMA 4IESA 1CAXB 5FCCA 2BNOA 5FPXA 4MX3A 1CX4A 2XL9A 4XF9A 4IEVA 1UIKA 2PAMA 5F1RA 2BEOA 1RC6A 1CAVA 2ET7A 2XL7A 2ETEA 5LEKA 4XF1A 2PAKA 5I8YA 4Q0SA 4RD7A 2QVSB 3S0MA 3H9AA 1U12A 1RL3A 2PYTA 5KHHA 3H8UA 1OFNA 4YYOA 5JSRA 3LA3A 3D82A 4MZUA 2IC1A 1J3PA 1YHFA 2Q0AA 2OPKA 2GZWA 4HBNA 4XFAA 1UCXA 4EWEA 3CEWA 4HVOA 3H1WA 1CAWA 4F8AA 5CVRA 1FT9A 2BNNA 4PJYA 3RYKA 3EQEA 4IEXA 2V09A 3EO6A 1CAXA 4KL1A 2GU9A 2PHLA 3OCPA 3WW3A 2N7GA 3N4MA 4XFCA 4AQ2A 4FBFA 5I0RA 1ZREA 4HVQA 1UW8A 4MGIE 4EV0A 4XETA 1XE8A 4ZU4A 4XF4A 4KWLA 1EPZA 4HMZA 2HKXA 4UBGA 4I3PA 4Z07A 2UYBA 3OGJA 3RNSA 1DGWA 2H0VA 4O9EA 3LZZA 5JSOA 3PNAA 4IETA 2OYZA 4A2UA 1VJ2A 3UKVA 2XLFA 3HIFA 4L2NA 3WW1A 1OD5A 4EROA 4MV2A 3WW2A 1X82A 1SQ4A 4GULA 3I7DA 1WGPA 1ZRFA 1PMIA 5BPXA 1VP6A 3FE5A 4IEPA 1GQHA 3MDPA 4EWAA 3CL1A 5EZWA 3BU7A 5I0UA 2GH2A 1SFNA 4MH0E 4MGZE 1RTVA 1J3QA 5FDBA 1Q43A 5KHKA 4JTNA 5I8SA 4K8FA 4LA3A 4P9GA 1EP0A 1YFWA 5I91A 3D0SA 3TNQA 1RGSA 1LR5A 4KWJA 5C8WA 3L2HA 2C0ZA 4WVZA 3E6CC 4I2OA 3E6BA 1OMIA 1H1IA 3H7YA 2E9QA 5AVPA 3R6SA 5E16A 2K9ZA 1OI6A 4QM9A 1PM7A 4QXKA 5J48A 1JUHA 1GQGA 3RDIA 1ZZ8A 1SEFA 2QJVA 4X6QB 4IEWA 4BIFA 2PTMA 1FXZA 1YWKA 4B29A 4AVAA 4LA2A 1RUNA 4WZCA 1ZRRA 1O5UA 1X7NA 3GBFA 2VPVA 1CAUA 5I0TA 4LULA 1EYBA 3LWCA 4Q0UA 3O14A 4YRDA 4R8HA 5I93A 4ZU7A 5JR7B 3ZDSA 1VR3A 1J1LA 2IXHA 4J1XA 2H6CA 4XEZA 3H1MA 2GC1A 3OTFA 3SCFA 1LRHA 4QMAA 3I59B 1UD1A 2Z2SB 1NE6A 2OZ6A 2PHDA 2PQQA 1YFYA 3NVCA 1DGRA 1ZRCA 4FT8A 4QX5A 5JAXA 4XF0A 4YNIA 1ZNPA 1ZRDA 3E5QA 3IBMA 1TQ5A 1QXJA 2GC0A 4JV4A 3NL1A 3UKNA 2ET1A 4XFIA 4Q29A 2KXLA 3NW4A 5KHJA 1QWRA 1YFXA 2MHFA 1J3RA 2QCSB 4Q0PA 5I8TA 3U10A 2Q30A 4BH9A 3KGZA 2VECA 4LUMA 5CADA 1X8EA 4HSJA 2FQPA 3H3ZA 4D7TA 2D5HA 4IERA 1ZZ7A 2PFWA 3U11A 3ES1A 4I09A 4E2SA 3QOPA 4N9HA 4KU8A 3DL3A 1I6XA 1RUOA 4MGYE 5BUVA 5BY5A 5JCTA 2IXJA 2HJIA 3IIAA 4IEZA 3MPBA 4IEQA 1IPJA 4N9IA 2H6BA 4E2QA 2I45A 3D0JA 4JVAA 2UY9A 1J59A 3KGLA 2UYAA 2ZCWA 1WA4A 4Q0QA 1NXMA 1O7FA 3OD0A 3H3UA 3BB6A 3DN7A 2B9UA 3E97A 2XHKA 3H7JA 4UBHA 4Q0VA 3RPQA 1CGPA 4YSFA 2CAUA 1QY4A 2EA7A 3IWZA 1ZZ9A 1H1MA 4PIZA 3I54A 4XFFA 3H1YA 3NJZA 4L11A 3M70A 4OLLA 3FJSA 4H7LA 2XLAA 2BGCA 1J58A 2Z69A 5FLIA 1YLLA 4HN0A 5D1IA 4DINB 4JTOA 3G7DA 3CO2A 3HQXA 4FAHA 1O3TA 4NVPA 2UY8A 3FX3A 3ETQA 3ES4A 3TNPB 5J3UA 4ZU5A 2OZJA 3E5UA 3NKTA 4AVCA 3FFQA 2P17A 5LRRA 1ZZCA 2GC2A 1QXRA 1X8MA 1YUDA 1DZRA 3S7EA 1UIJA 3E6DA 1NE4A 2QDRA 2ZKLA 3E5XA 5KHIA 5LRSA 4AQ6A 3KCCA 3SHRA 4HN1A 1Q3EA 4R52A 3ELNA 3KMHA 2O8QA 2CGPA 4YARA 3FHIB 1ZZ6A 2VQAA 4QM8A 4QGNA 1Q5OA 4PIXA 1IPKA 2D5FA 3SCGA 4MGKE 3EHKA 1O3SA 3BALA 2PAEA 3LA2A 1V70A 2Y0OA 2IXKA 4ONUA 2CV6A 3HT2A 4LEJA 4E2GA 4HVRA 1Y3TA 2MNGA 4O9GA 2XGXA 2OA2A 5C6CA 2WC2A 1ZZBA 4LLOA 1FI2A 2O1QA 4BYYA 2D93A 4AVBA 4IEOA 3M3IA 4I0BA 1NYWA 2D40A 3KSCA 5I0SA 5KHGA 4F7ZA 2Q1ZB 2QNKA 3ST7A 2Q4SA 2BNMA 2EAAA 1HW5A 2XLGA 3H50A 5BV6A 4HSLA 3SCHA 3ACLA 2XKPA 5HI0A 4KWKA 4I01A 5FQ0B 4EWDA 4XF3A 3LA7A 1I5ZA 4QGLA 3CF6E 5K8SA 4ORFA 1WLTA 3U0ZA 2B5HA 3NSTA 1Y9QA 4D7SA 5J7MA 3SMHA 2MPFA 1DZTA 4BHPA 3RZZA 1L3JA 3S7IA 3USSA 1O3QA 4Z82A 3I59A 3RYRA 2PA7A 4PIYA 2CAVA 1G6NA 4OFGA 4XFHA 2IXLA 5FLJA 1YFUA 1ZX5A 3OF1A 1O5LA 3VHRA 4MUVA 2IXIA 3LOIA 4IEYA 4XFGA 2ATFA 3SXWA 3CJXA 5JSPA 5KBFA 4I02A 1UPIA 3WW4A 1O3RA 1LB2A 5CU1A 1ZVFA 4HLTA 4FAGA 3GYDA 3MYXA 5FLHA 4CYDA 4LUKA 5FQ0A 4TLFA 4X6RB 2XKOA 3LAGA 3UKTA 2GC3A 1CAVB 2BYVE 4XFBA 5EFUA 4META 2DCTA 5E1RA 2F4PA 3FWEA 3PLQA 4I0AA 3QACA 4UXAA 2EVXA 5BXXA 3BPZA 1NZCA 1CAUB 3B02A 3HT1A 3IDCB 1O4TA 4LTAA 4WBBA 3C3VA 2FMYA 3JZVA 5LEJA 2WFPA 2B8MA 2K0GA 3MZHA 1EY2A 3IDBB 3DV8A 1LKNA 3EJKA 4AXOA 3BCWA 3PVBB 1XRUA 4HZFA 3RYPA 3DKWA 3ROUA 5FPZA 2IXCA 4KU7A 3EBRA 3CLPA 1CAWB
chains in the Genus database with same CATH superfamily
1X50A 3J81N 2R072 4H2AA 5FCCA 4HPKB 5CFCB 1QHDA 5KXDA 1O9GA 5IW0A 3K48A 3AK1A 2E3CA 2ET7A 3INAA 4EN6B 4JZGA 2R042 3PMEA 3J7HA 1AJNA 2ZINA 1QH6A 2E6VA 5FBJA 5E8AA 4FVVA 4IUGA 1G6UA 3IKWA 5F37A 3NWKA 2RMU1 4QX8A 4XE9A 4TWKA 3TN92 3AL5A 2N74A 5JUVA 1QQP2 1UOGA 4OZXA 1NI8A 5I0RA 4RS5A 2ARCA 4XF4A 4FLVA 4PDLA 3SH3A 2ES3A 3VGIA 1VJ2A 2AGSA 2XLFA 3OYWA 3W7XA 4NWWA 2OS2A 4MTGA 1ULEA 2BGPA 5ACA2 4L87A 3S30A 4EWAA 2Q7GA 1DU3D 4MGZE 5A3NA 5IFPA 4DRXA 1GN6A 2V1DA 1E57A 3ZXAC 2VMGA 4P9GA 5LA6B 3T2TA 2VRZA 4JQRA 1RVF2 5I91A 5C9AC 1W8OA 4GX5A 3CRCA 4WVZA 3L71H 4RR3C 3D5OA 4LR3A 5JXHA 4X66B 4D94A 2K9ZA 3CMGA 2J1TA 3RDIA 3RZHA 2GTAA 5DAQA 1FPN1 1ASJ3 3MD0A 2WLLB 3ZR5A 1VBD1 4O2AA 5FO7B 3J7LA 5B1OA 1GWLA 1FPOA 2FTKA 4K20A 1AX1A 3APQA 2L9LA 4BQYA 4Q4V1 4NPMA 3WY6A 4RQPC 4BCUA 4J1XA 1D4VB 1S5JA 1ZX3A 4SBVA 3K75B 1LHUA 2F23A 2NLRA 4WBNA 1L8DA 5FZEA 5J1XA 4U3JB 3AMHA 3EXAA 4MTOA 1AI6A 2LW8A 3ASNB 1HV0A 4MW8A 1XC6A 3ES1A 5APAA 1SPPA 2ZACA 4UW3A 1RUOA 3T4DA 4GUNA 1IPJA 4E2QA 2P06A 2P2KA 4CTEA 1H6YA 1YJLA 3DYMA 4BLJA 4YZ2A 1IVSA 4Y5SA 4E4DX 1E5HA 1I5YA 4UBHA 2R70A 3H8XA 3SKVA 3OJBA 3G6EV 3UCSC 5CB7A 2J22A 2GNBA 1Q6IA 5IFTA 2WLQA 5CBLA 3O1SA 2QQNA 4QPWA 1SQPH 1HB3A 5CIRA 4BQWA 1JW6A 3VBSA 2Z69A 3T0DA 3WG2A 4LH7A 3ZN4A 1FD9A 1PV0A 1F7YA 1EAH2 1VBE3 3POWA 3T0BA 1CPYA 4HKLA 1OBNA 4DQAA 1KITA 5HV4A 3K77A 2P17A 2D6NA 5G04L 4AG4A 3S7EA 1SZTA 4NXNB 1W2UA 4CDUA 4JYCA 5LOVB 5D8AA 2G19A 3MIDA 1GLHA 4QGNA 2VG9A 4DY5A 3M99B 4XUTA 1AR63 4FXKB 1LOFC 3OUJA 2XJPA 1RSOB 2GDSA 2O1QA 3DECA 5JVDA 4HZ3A 2WNUC 1OLRA 3CSXA 2D40A 1M90W 4QPGA 1FNZA 4PV1B 2P34A 1VBA2 1ZBA2 4HSLA 1NAEA 3UGGA 2GN3A 1M4WA 5A3LA 1DGLA 4UFJA 1UL9A 3WX5A 5J7MA 2MW2B 3JARA 4IGPA 5IJ9B 5L73A 2FHRA 2WN3A 3ITQA 4Z82A 3WNMA 2WRAA 1DQ0A 1SS3A 5A32B 4A6SA 4JDOA 4UFZA 4GA9A 5FK8A 4GCZA 1TME1 1PK6C 4IGGA 2RDQA 2IXIA 3S5AA 4WZFA 1ONAA 2UXNA 4IEYA 4JGSA 1QCEA 3X2QC 3ECQA 1SLTA 2UWCA 2LJ2A 2GUZB 2RJKA 1UKGA 3LAGA 1L1FA 3UJQA 1BLZA 2E26A 3WDXA 1ULOA 1C8M3 4LKFA 2LRPA 4WM7A 1QU7A 4DR4B 2DF7A 5FR3A 2DFBA 2M7WA 4FP3A 1N34B 1VQ7V 1XNAA 2IFWA 4GKJB 1VRH2 4OHXA 1IS6A 1W8NA 3ASOC 2P3YA 1XRUA 3L74H 1US2A 1NZ6A 5BNOC 4R8CA 2E7AA 5FNVA 3MIGA 3AJZA 4QU2A 2WR9A 4QQHA 2RS12 4AFCA 1AROP 3I55V 1LECA 1GV9A 4Q4W1 2PAMA 5F1RA 1BCCH 3AM2A 1FMD3 1JFFB 1Q90D 3TEXA 1FS0G 3NNGA 2WNOA 3BAAA 1D4M3 4Z1MG 3OBTA 1W59A 4D3WA 3MPPG 2OPKA 2VQEO 2W46A 3HPNA 1ZAUA 1YITV 4D6SA 3T4ZA 3MV01 1U5YA 2VAUA 4S2FA 3OUHA 1R64A 4LOSA 1NOVA 2NNUA 2R32A 4ET7A 5IHRA 2DVBA 4NXNO 5C8CC 3WSOA 4HMZA 4I0XA 1RUG1 5A6ZA 4LNUA 1MEC1 1XNDA 4BA6A 4EFBA 5LA9A 4MVMA 4I30A 4F6EA 2YUAA 2BZDA 3LZZA 3V0AA 5L3FA 4X1YB 1LESA 3C2UA 1ULDA 2ZGRA 4ZS3A 3WHUA 5LHGA 1F8VA 4OGQB 4COUA 4Y1UA 2D2CB 1XU2A 4LK7A 3WG7C 5GJ6A 1YSCA 2JENA 5FFOC 4GMP0 1Q43A 5FP7A 1E5RA 2WA4A 3VB9A 3T1CA 4JKMA 4QPKA 1OCOB 1GYKA 1LR5A 1SLLA 3GM8A 4TT3G 2ZGMA 4NYKA 4IHJB 1OMIA 1HB4A 3ZJZA 5J48A 4I4TB 1LOAA 1SZXA 2IJJA 1DF0A 2R071 3ETGA 2DMXA 1FV3A 4FMTA 5FZ8A 1TMF2 2R041 4ABMA 4RHV2 4BQ5A 4D7YA 1CIWA 3PJSK 2UXDO 2JG9B 1VR3A 3LF7A 4X64O 2RJZA 5FZIA 1G7YA 2ARBA 4JGYB 4AAPA 2KG7A 2Q73A 5HCFA 2HWD2 1QNWA 3TN91 5JMOA 4MGTA 3OMIB 2X53S 4XF0A 1HV1A 4NHLA 1QQP1 3H42B 3N35A 1JXNA 3JASB 3WT3A 1LGNA 5T5PA 2JKXA 1AI7A 3WDTA 4X20B 1X8EA 3IM0A 1RUF3 1GZWA 4N9HA 1WD4A 2YIBD 3FLTA 4N53C 5CA0B 5IAXA 2VCAA 3RZMA 3OT7A 4FOWA 1THZA 5DMYA 2CHHA 4KHPB 4UVBA 4LBLA 3WCRA 1Z78A 1BQ0A 4JPRA 4NB5A 2EA7A 5C3OA 3P3NA 1QJU2 2BW8A 4ZOLB 3FL7A 5D5QA 3JSLA 1RVF1 1WAZA 3SISA 5ISLA 2XLAA 1J58A 1JOJA 1W0NA 3LKJA 3WLUA 2GMPA 1FATA 3CO2A 4P2ZA 2IH1C 2VCCA 1AP5A 4JV5B 3CNAA 1OLME 2UY8A 4EZ4A 4LC1A 5L7OA 1EUUA 3RYFA 4UI9L 2BSKB 3GALA 4CDXB 4PI0A 3KWVA 1DHKB 1UN1A 2E51A 2IJKA 5FP3A 5KUMA 2MEV2 5LA6A 1NH2D 1KD1W 4YM3A 5DDJ3 2EIDA 2EXJA 4TTGA 2DYCA 3BALA 3PU3A 1NTKH 2IXKA 5L3EA 1XYNA 1H8VA 2ZGTA 3NJYA 2YGMA 1TVKB 2Q6AA 2RMKB 4CP9B 3HPLC 2Y6KA 2UU9B 3CRAA 2VZ1A 2ZJCA 1V00A 3FYEB 4DV1B 1X9TA 5D21A 1BVVA 3Q8CA 1K4DC 3M7AA 3ZX7A 3K04A 3LA7A 4CA9A 3CF6E 3QLQA 1CD3G 3TJTA 4K9SA 3PL0A 3RYHA 2K1EA 3ICXA 2ZBJA 1FJGO 1Z7S2 4YZ3A 3O9OA 2R30A 2GSMB 4XFHA 1JMUB 4U3JA 3OF1A 2J1VA 2Q8DA 3JAMN 5JSPA 1VF5B 3VQVA 2NN8A 3WW4A 4AGGA 3IAPA 1GZ9A 1WMFA 5FLHA 5FQ0A 5GZFA 5H5NA 4GX0A 1CAVB 2OIIA 1PNGA 4XUQA 4DV6B 5AFEA 1GTOA 1M06G 3W59A 4K40A 1OC1A 5A7PA 3B02A 2XJTA 2WLMA 2YXLA 3JCIA 2C24A 4B3RB 3E22A 1PVXA 1A6CA 4XJ9A 1H2NA 1PP9H 3CCSV 5DG1A 4KU7A 3EBRA 2RVAA 3AG4B 2GAUA 4AHXA 3LSUA 3OGVA 3LEGA 4KHPO 4MVSA 1ND3C 4B3TO 4XQWA 4L8JA 3BYWA 1NU1H 1NLRA 1REEA 1PVC1 3WR0A 2H3OA 2XAQA 3BKZA 2A75A 1IBMO 5I8YA 4QKNA 3ZIXA 2V72A 2F6BA 3WQ0A 1P8JA 4OUSA 4QX7A 1XNCA 3RW0A 4MO3M 5GLWA 2BVBA 3G6JB 5JJJB 1N1YA 2BBAA 2JE7A 1VBA1 4J42A 1W9TA 2OUHA 4XTPA 2VMEA 5LOVA 3HB3B 2YMZA 4K3AA 1K3EA 4X8NA 4IL6Z 1AZDA 3I49A 2GU9A 1KP2A 2YC2A 3WW3A 4XFCA 3ZN1A 4J10A 4AQYB 4X89A 2HLEA 1GOHA 2BE3A 4UBGA 4B3NA 1VQ8V 1XNKA 4Y4YA 1RSOA 2PELA 3RNSA 4O9EA 2BTQA 1CP9A 4UFHA 1TG7A 2BRTA 1K5QA 1EFRG 1PGL2 1HRV2 1JU4A 4Z2WA 4XBLA 4I50B 4JASA 1OOPC 3PTRB 1H8EG 5BNPA 3LOBA 3GGLA 1W28A 2UU9O 5IT9N 1RTVA 3IGAC 3BTYA 4DV1O 4DFSA 4JCKA 1BGYH 4HK9A 3NO8A 4O7XA 2ZE8A 5JPNB 4AEDB 1R6KA 5A32A 2IW5A 1F2NA 1VRH1 2A7AA 2BDRA 4NR1A 3VQWA 1HN1A 3L2HA 2EJ7A 5H6QA 4MSWC 4OQ9A 1GP6A 1LJ7A 4XUOA 1UXZA 2GUZA 1N1VA 1REFA 3THPA 1YWKA 1WB7A 2HWC1 2CWMA 5ITZB 3SR2C 4JI7B 2QA4V 3M3QA 1ZRRA 5LB6A 4ITCA 2OWOA 5JH7A 2C1FA 1N33B 3IPVB 1SA0B 5I93A 1RM1C 3AG3C 2AXTZ 2XVGA 3ZDSA 4OHZA 5KX5B 2D3PA 4LFBB 5LMNB 4YIOA 2GC1A 1U96A 1VAVA 3LDEA 1N32O 4XILA 3BY6A 4M3CB 5GALA 1ZNPA 1Y4WA 3IBMA 4XFIA 1MVQA 4MXWB 5KHJA 4B3RO 2MHFA 1J3RA 1N3PA 1JFFA 1R1A2 3VV1A 2XUEA 5IYZB 2OPWA 2WO1A 3FFZA 3I8TA 1GN4A 1XBFA 1FXKA 1OHHG 4LP8A 4BDVB 4TQFA 4IV1B 5LBCA 3VUOA 2G1MA 5JCTA 2VWJA 5IK5A 1R3LC 5J2UB 4XOGA 5DUVA 1JVMA 3ABMC 2ZE6A 2ZDIA 1IPSA 2A79B 3DN7A 3RPQA 5C4WC 1HXS2 1ZWIC 3BTXA 1VQNV 2Y6HA 2HH9A 2X5IB 4XBNA 5FPVA 1QR9A 3ACIA 1P49A 2VBBA 1YJWV 3D36C 1AXZA 4SLIA 4BQXA 4OXSA 1XSRA 2DYSB 4YHHO 3VBBA 2XASA 5IK8A 2YSUB 3R65A 4Q8KA 1KKCA 1ND2B 1ZUQA 1TMF1 4YGEA 1CZSA 2ZKLA 1L0LH 4JF3A 1QOTA 1C5IA 4K8XA 4RHV1 4TWTA 5JXIA 2PI5A 2NP0A 2O8QA 2CGPA 1FYUA 2E33A 3L70H 4XVHA 4LBOA 2HEWF 1Q5OA 3ZIAG 5T50A 5FPRA 4H44B 3ETDA 1I94B 4IHJA 1W9WA 3A0KA 1BKZA 2JEMA 1RXFA 1Y3TA 4GJYA 3CJHB 3LEMA 2XAHA 2R9IA 2DJVA 4B7EA 5F6LB 4M3CF 2DCYA 4RO2A 1BZKA 4RL7A 5DAXA 4YIPA 4YVWA 3I2FA 5H9CA 3BVCA 4Y1XA 4EWDA 4CDQB 1I5ZA 4NRPA 1W06A 3H3LA 4CCMA 2ZR3A 4XZUG 3VKNA 2WLHA 3OW2U 2W2IA 3IJ4A 4C1WA 4DXSA 3UV9A 1JOYA 3W5MA 1N33O 3GVMA 2X29A 3DXRB 4JHTA 1G86A 1OKQA 2RCVA 1O5LA 3ZR6A 1WJZA 1QJU1 2LM3A 1RMU2 2VCBA 3SXWA 1SACA 3CZUA 4YJ3A 3OFNG 3BOWA 4NXMB 3J7NA 1LHVA 4FLWA 4B4RA 1QNYA 1JH5A 2ZS6B 3VKLA 3WQ1A 3UKTA 4B08A 4META 1K5MB 2VWKA 2WFF1 3QO7A 5F5IA 5BXXA 4FK5C 4FSJA 3WOGA 4LBJA 2DU0A 1JYTA 1Q56A 4C8DA 2L6LA 4XPVA 3RMYA 3EJKA 3TWIA 3PVBB 3AYDA 2WSUA 4GWIA 4ZOLA 2JG8C 1AX2A 4J1WA 3LCPA 5KMGB 3WP5A 2VUJA 4EYUA 1WW5A 1CPMA 1UZVA 3NQHA 4DXTA 5F5CA 3NJVA 3C3SA 2XL9A 4K0KB 3AVRA 2BEOA 1ZBE2 5BXZA 4DV5O 1RP3B 1IQAA 4NHMA 4QHOA 5LGTA 2W1QA 1AYM2 2ZD9A 2AREA 3OB8A 2NQYA 5JSRA 1MNGA 4TV9A 4AHZA 1VBC3 5IK7A 1BS3A 1YHFA 4EE2A 5JZGC 5FZLA 2E7TA 3J8F3 3CZJA 1I1EA 1C28A 1GWMA 1GN3A 2ZKNA 3WDVA 4JZ2A 4ISRA 4H33A 3JUUA 3KS7A 1OA2A 4QD2A 4I9WA 4OUEA 1CAXA 5JJNB 3OCPA 3VBUC 2JE9A 5FZMA 1T5EA 4R9DA 1W6NB 1A3KA 2CDYA 1Z7S1 5FZ3A 3ZN6B 5BNNB 1K4CC 1XE8A 2EIKC 4S2HA 2TEPA 4I3PA 1JYVA 3VBOB 5CZKA 2UYBA 4DR5O 2RDNA 1Y74B 3BA9A 2TUNA 3UKVA 1GMGA 3WINE 4AK3A 1NR1A 4LF7O 3C8XA 5FKCA 1RUJ2 4GULA 4JGZA 1VAMA 3TEYA 1UX7A 1VIBA 4FPLA 3MDPA 4JI4O 5EZWA 1TA8A 2FDFA 4GKYA 4MH0E 2HBUA 1S76D 2QWRB 3SYAA 4O4HB 4TUYB 2WNVC 2BP6A 5A80A 2EIEA 4J9YB 1JZ4A 1CN1A 2R9RB 4QX3A 2E31A 1IXMA 1AR82 4YVSC 3BABA 3WNKA 4AVAA 1BBT3 2YXHA 2W1SA 2VPVA 5EIBC 3DXTA 4AOCA 4FLYA 3ZYFA 2P90A 1HNXO 4NXMO 3R05A 3NR7A 2KD7A 1R6NA 5FMOL 4AW7A 4HT1T 4BAYA 2HLDG 1WMEA 3KZ4C 2PQQA 4Y26A 3BVOA 1GWKA 2ZGSA 4U2AA 4JI6O 1NVPD 1W3VA 4HSJA 3APOA 2OKXA 1MMMA 2Y48A 1SMVA 4E2SA 3SLIA 1X33A 4XJ8A 2HG5C 3DSQA 4L97A 2HJIA 2P3KA 3MPBA 1IXBA 4K0KO 3D0JA 1LULA 5FJKA 3FKSG 1PO23 5H9PA 1HRV1 3H3UA 1HNWB 2P5BA 3KLSA 4ATEA 3ZFGB 1KECA 4GLXA 3FUQA 1KFUL 2O14A 4FPKA 4UCTA 4LWSA 4NAOA 3POSA 2E32A 4OLLA 5HXVA 3M3CA 4NN0A 5FYMA 3E2EA 2RM22 3I3MA 4J9ZB 2XNDG 4DO2A 1W2BU 4QPJA 1SZBA 1W6OB 4N90A 2WUHA 1GP5A 3T1MA 4CC6A 4CP2A 2CTVA 1S77D 3WCSA 2JDIG 2XONA 4GQ7A 1X8MA 3ZXEA 5IAVA 1BEV2 3SPGA 5LP6B 5ANNA 1YI2V 5C9AA 3QH6A 2ZPXA 3ZFEB 1HKDA 3JATB 2R1BA 2BV4A 1RPRA 1YTFB 1ODMA 2JD4A 4RR3A 4AEDA 3RJRA 5LBQA 5IDJA 5FY5A 1RUC2 3AZYA 4GX1A 3OBRA 1Q8PA 1V70A 4ICGA 5F2WA 3JQXA 1TEIA 3CIHA 2EAKA 4CCOA 5IJ0A 2X10A 4XZPA 3E1F1 3VOUA 2Q9LA 2B4KA 4HKOA 5FPUA 1NYWA 3KSCA 3CC7V 5I0SA 3VD3A 4CU8A 3ZYBA 1R1A1 3BPSA 1JR9A 1JHJA 3I3QA 3URFA 4RQPA 2WWSA 1S0JA 1KMIZ 3ACLA 5HI0A 4KWKA 4DIQA 4QGLA 1Y9MA 3RSJA 4AR2A 1SDDB 4EB6A 2N04A 4Q4Y3 1Y9QA 5DECA 5KX5A 1GANA 2GHYA 3RZZA 5B1AB 2BVVA 4AEKA 1HQNA 2A70A 1PX4A 1UYPA 5E6HA 1ZX5A 2C9AA 3VBSC 3DC6A 1OV9A 1HXS1 1S0CA 4RWUA 4D8MA 3OY8B 5IYZA 5EJZB 4HLTA 3QF7A 4TOIA 2Z79A 4X6RB 5FP4A 5EFUA 2VVFA 2EVXA 4P9JA 3KV5A 1R3KC 4GKKO 4AHWA 2YU2A 5A6YA 2Q1FA 4HKWA 4CDUC 3JZVA 2WFPA 2YI8A 4BM8A 2IH3C 2VMDA 2HWC3 2X05A 3KQRA 2C9KA 4JDMA 4IGOA 5FZCA 3K79A 3PIJA 3JB4C 5IY5C 4Q4X3 1AR5A 3JBG1 3VBFC 3OUFA 3B7MA 2FB5A 4V2WA 4XF9A 4A3ZA 3WP3A 4B7KA 4DRRA 2OXBA 1ULFA 1ZA4A 3PURA 2DURA 2QE7G 3Q4HA 2PZSA 3AZWA 1XL6A 1ASJ2 4XJWA 2VZUA 2Q4PA 1HR0B 1ND2A 4NPRA 3KM5A 1XB9A 1JYIA 2QWNB 4ZBMA 3PVNA 5LK5A 2VO5A 1QF3A 3H01A 4FPYA 5EYYA 1QJEA 4EN9B 3H8OA 5GTHZ 4IQPA 5IYCO 5FXXA 5LGUA 1VQ9V 2PHLA 4B3MB 1COV1 1LOFA 1ZREA 4I3GA 1UW8A 4DUXA 2JDYA 5B3SC 1A8MA 1HX6A 4BQ2A 3O1MA 3WB1A 4F83A 4FPHA 2J42A 2H0VA 1IBKB 4UV8A 3CJIC 5EBLC 1RMU1 4A2UA 2VM9A 4EROA 1X82A 4F6RA 3K3NA 4FPPA 1Q8QA 4D6RA 5HFMA 3ZHUA 1XMOB 4IEPA 5JWPA 2W87A 5I0UA 4URAA 1PZ9A 1D5NA 2RR13 4WVMB 4O2BA 4FCAA 4K8FA 2YBKA 1PK6A 5LW9A 4YLZA 3FHAA 3RZKA 5C3PA 1MQTC 3ACFA 3WNLA 1VEWA 3N2GB 4OI4A 2JJ1G 3OGGA 1E5IA 4S2GA 3LSSA 2VOWA 1T6BX 5L3BA 1RM1B 1VBE2 1V54C 4WZCA 1K5MA 4DR1B 4QHBA 2MK3A 1AYM1 1VQ5V 4XMAA 3KV6A 3I2IA 4YRDA 1CIYA 3PJYA 5KAIZ 5BNOA 2Y69B 4IGQA 3U4XA 1UFIA 4O61A 2F43G 4QMAA 2DYRB 4OULA 2EILC 1GRJA 5KMGA 2V73A 3E5QA 3UKNA 3M4FA 4GAZA 4BXFA 2JRIA 1ENRA 1H38A 1YFXA 4YWAA 1D5AA 2ZE5A 5I8TA 1UY4A 1AR62 3VBHB 4ZI7B 3H1HH 4JYYA 1N8RW 1UPSA 3B93A 4PA7A 2O8OA 1VRBA 4ZS2A 1OURA 3B9CA 2B7YA 5A9GA 3WDYA 4GKXA 4KGQA 1H9WA 4B1LA 3VBRB 3RYIA 3ZCCA 1RUJ1 3JCZA 1ZL8B 1FOD3 2DCJA 5HCAA 1XNBA 3OD0A 5FMCA 1Q8VA 2DTYA 2K9PA 3ZSLA 5C8CA 1R6TA 4C0BA 4QQ2A 5J98B 1W6QB 1HR0O 1W6MB 2WFF3 1GFF2 3GZAA 4L11A 3IFXA 2UWAA 1YLLA 2RS53 3PDQA 1K7DA 2YB7A 3SH5A 1Y74A 2WA3A 3RI8A 3JALB 1O3TA 4K6BA 2OTLV 3ETQA 1S1AA 3TNPB 1WA8A 1ULCA 2RHPA 3CDZB 1NS1A 4A42A 4P5HA 5KC6A 4DPNA 4LNVA 1C8M2 5BY1A 3OEEG 3ZXFA 4I9QA 1ACCA 2JDNA 3RRDA 3SC7X 1YJ9V 2D6PA 4JI2B 4RGAA 2LQTA 4DY3A 1OQ1A 4AEMA 1SLBA 3O0WA 3WNOA 5CFCC 3T1YB 1S2EA 2VOXA 3PMSA 4KP4A 2WZR1 1D2DA 5JVVA 1N1TA 3KD4A 4TLGA 1FMD2 3N27A 4RN5A 2CYFA 2ZAHA 2ID4A 3DCQA 1WA6X 2K46A 2EIBA 1PGSA 4CP1A 2XKPA 2FYUH 4XF3A 1D4M2 1GZTA 2XHNA 1Y7BA 3MW4A 3W58A 3SNMA 1WW6A 2A3QA 3IZOA 1AL23 4A5UB 1BJQA 1JI6A 3VD9A 1JYCA 2D3SA 5C33A 1UJWB 3USSA 1F4HA 3K51A 2J1UA 4DR1O 1K9MW 3CCMV 2IFRA 1WNSA 2W08A 3GDBA 1K33A 1G1XB 3FC0A 2ZGNA 4Q2FA 3LOIA 2DV9A 2VUDA 3KV4A 1MS0A 3T1LA 3CYOA 1UPIA 4N53A 1VQPV 4YW2A 2GH8A 5JXGA 3GHNA 2WBKA 4NO4A 1OFSA 4ISQA 5KLVH 2RM21 3NRUA 3NKGA 5EPAA 5CA6A 1QMJA 1O4TA 3U37A 2HJFC 3ZHVA 2E5LB 3C3VA 3UGFA 3HKEB 4JI1O 1RUI3 3ORJA 1BEV1 3M8AA 1KS4A 1RITA 2EBOA 1KB9F 4OPAA 2QQPA 3VKMA 2LO1A 4JAAA 1GN2A 3HJRA 4MTFA 3CCVV 4CS4A 1RUC1 1GK9A 1X59A 1OF4A 1W2TA 1XHXA 4O4LB 5LA1A 4UF0B 4KUMA 2P3JA 4UUJC 2XQRA 4Z1VA 2Q0AA 3QNEA 4XFAA 5LY1A 4EWEA 1QH7A 2JS5A 3CRRA 1CAWA 3ZFEA 3CRQA 2D3RA 2D6MA 3AKRA 2Z0AA 5FUPA 3N7MA 2IBZH 3EO6A 1H2MA 3O5SA 4CCDA 3LPFA 1DIWA 4FBFA 2B5UA 1OH3A 2DCKA 1DQ5A 5IK4A 1V6OA 3CRMA 5E79Z 2BPA2 2JDPA 5JMCA 1IX9A 2JIZG 1DGWA 2Q0OC 4UYBA 3ZKUA 4FPJA 3N7JA 2F4VB 5FZOB 1AJQA 4DOUA 4PLNA 1RUF2 4LPLA 3AYEA 3KCYA 2JVDA 3T1YO 1K12A 2J1RA 2E7QA 1Q8IA 2P37A 5FLXN 1N1SA 5EZYA 1PHMA 4LHLA 2FKXA 3NV1A 5I8SA 4FFIA 5A3UA 1LCLA 4PQ9A 5IATA 4MSVA 2BFUL 1DG6A 2QQIA 1CZTA 4NWVA 4JI5O 5C8WA 2QTWB 2C0ZA 4XHXA 3VD7A 1LGCA 3O12A 3ML0A 4DUYB 3BRCA 2DE0X 2H0BA 3A4UA 4IEWA 4BIFA 1MSWD 4QAWA 4MLOA 1H6XA 1RUNA 4OI1A 2IJIA 4E27A 3J9SA 5L9VA 5JI9A 2VNGA 3K57A 1ASJ1 2YS8A 1NJIW 5EP9A 1NBMG 1EUTA 4D6QA 1QJY3 3O1VA 3E35A 5C3RA 1NE6A 2ZGOA 3FBYA 3IAYA 5DDJ2 2HYXA 1XYOA 3HKCA 3ABKB 2VL4A 4X9QA 4S2DA 4CS2A 2GNDA 2VNRA 4BH9A 4UFKA 2ZABA 3OGSA 4C91A 1JPXA 3GCXA 3TXSA 1O4ZA 1OVSA 4JHZA 5F3IA 3DXUA 4YM2A 1F4AA 4BIOA 2UY9A 1R3IC 2FDKA 5LWBA 4LF6O 3Q8EA 1A34A 1QHTA 4O4JA 1PL4A 3POYA 4IIJB 2XHKA 4YW3A 2ZEYA 1YQ5A 1PO11 4EQVA 4JI3B 4XFFA 1NQTA 1SLIA 2PHUA 1K5JA 1QGLA 4BB3A 2IVJA 5FY9A 1O91A 3G7DA 3F7YC 5EYPB 2J1SA 3IMMA 1MACA 1TUEB 2XH6A 4NVPA 5FPAA 4DUVA 4P30A 1R1ZA 2YFUA 4N7UA 3FFQA 3DGEA 4EN7B 2L35A 1ZZCA 4Q5OA 3WDWA 4DV4O 2YC4A 2X6CA 1Q81W 1VBE1 2CGNA 3AXDA 1SFYA 3SHRA 4HN1A 1Q8SA 3DC5A 3ZPOA 4BZ4A 1S3JA 1ZZ6A 2AUYA 2Y6GA 1EBOA 1POV3 2UXBO 3DPRB 2ITCC 1VBD2 3M7MX 5FRAA 1SCSA 3RQ0A 4FFFA 1ZRIA 4YJ2B 3CCUV 1LOCA 2DU1A 2XGXA 2XR4A 3NV2A 4BMEA 2JEXA 3ENRA 3OSDA 1COV3 4H3WA 2ADQB 1AR61 5H9RA 3SJAC 1JYXA 3IC7A 4RFT0 4NTYA 5BV6A 4FM0A 5ACA3 4DUYO 4XDKA 5CYYA 2DVAA 2R0HA 5D2AA 4AYUA 3H1IH 2MPFA 1F31A 1DZTA 4BHPA 3AG1B 5KXCA 3O1UA 5T55A 3OGRA 1DP0A 1GO3F 2P6JA 4G28B 4UXNA 1VQKV 4XDQA 3GWKC 3ABZA 3PU8A 2GDFA 3K5OA 4IE4A 4BQ4A 5FZFA 1EN6A 1S2BA 5DQ0A 2JDKA 4NROA 2A6XA 2A0LA 2NPIA 1Q86W 5LA0A 2I74A 3T08A 3VBRA 1NTMH 3ZFFB 1XI1A 3HT1A 2DWRA 3FN9A 1KDMA 1ZL8A 5C4WA 2ADDA 2DTWA 4PA6A 2IWGB 5JIAA 5IYDO 4DUZB 1DTOA 1C8M1 1GNYA 2QDNA 4UW4A 3DKWA 1OCOC 3EHBB 4DR6B 4XTMA 3VL9A 3D36A 4IESA 1RUH3 1K97A 2CH7A 5F2SA 4LBQD 1N0NA 3AMQA 2UU8A 3SYCA 5LA2A 3GXUA 4TZDA 2DQ0A 3C7FA 4P9XA 2ETEA 1W3XA 2VMCA 2WZEA 1W90A 3Q8FA 3W21A 4LORA 1JZ3A 2Y60A 4M3CE 3FLRA 2PYTA 2V5YA 1J3PA 3BI3A 4RQFA 1FMD1 3I3EA 4PBOA 2QTOA 4E8DA 3E8HA 5J36A 2AC1A 2LFRA 3CEWA 5FOJB 3AKSA 2JG9C 3DF0A 1D4M1 3ZSKA 4JGYC 1MABG 1I5XA 1OLMA 1IHMA 1K73W 5FTTC 5B3SB 3GJAA 2ZGUA 4X1KB 2GBOA 1RUD1 2P4VA 1UKRA 1WMXA 4OZOA 5FYSA 3MI8A 4JI8B 3OGJA 3RZJA 4HXCA 4IETA 3JD0A 1EAH3 1OD5A 3WW2A 5LBBA 4LT5A 1TNFA 2QKAA 3MHSC 2P1BA 1TUBB 1SFNA 5LL6Y 3K0GA 5EWSA 2BWAA 3ZOIA 2WSVA 1L7LA 3SYQA 4MHRA 5E89A 1VQ6V 2VNOA 2FCVA 3E6BA 4BWOA 1W6PB 3USUA 2IUWA 3AMMA 3H7YA 5AVPA 5E16A 5JOWA 2P67A 2E75B 3WUDA 1B35B 1LOGA 5FZ7A 2ZXWB 1WUVA 2ADPA 3K08A 2VJXA 3N36A 5F7UA 3WF3A 4CDXC 5T5LA 2QKDA 2BOIA 1XNTA 4OMCA 4IW3A 1Y76B 1UPGA 2A6WA 2JG8A 2H6CA 3J4UH 4N8MA 4YGCA 3N9NA 4QJFB 4DV7B 1OUSA 1WKYA 1LRHA 4PA3A 3HR9A 1LODA 5C3SA 4XDPA 1SQGA 1MS8A 5A33B 1ZRDA 1JZ8A 3TCUA 1TQ5A 1QXJA 1XQNA 2GC0A 2NMNA 5B5EZ 2FDGA 3POBA 5EJ3A 3E8GA 1OCZB 2EALA 2A3WA 2ZHLA 4W65A 3CB2A 2DQ3A 2VMFA 5JZGA 5FMOS 3T0AA 4DR6O 3U11A 4DNYA 1UY2A 2KR2A 1XBLA 3PIGA 3HKBB 1RIRA 1XNQB 2H6BA 3K0DA 2ZHKA 2QSAA 4GYCB 1WA4A 2D98A 1RUF1 4Q26A 2QM7A 1FFXB 4PDWB 5CEHA 1NXMA 1OQDA 2LP7A 3ZRSA 3KVAA 3OTOO 1CGPA 4YSFA 3B69A 2UXCO 1AR1B 4J80A 1J5EB 3N3HA 4Y1ZA 2W1UA 3HOBA 1I5PA 3HN3A 4Q6GA 1BT8A 4NHKA 2RS13 1URFA 1OJHA 4QQLA 2Z3YA 2Q67A 1MS3A 3F95A 3TOJA 2XG3A 5BZBA 1UU4A 1MR5A 5FXVA 4ARYA 4AVCA 5J2TA 5GONA 3THCA 4CEYB 3T1HB 1UXXX 2QDOA 3AMPA 1QXRA 5CBGA 1I7FA 2RJ2A 1BZWA 2WNVA 3T2PA 3BHPA 3AB0A 3KMHA 4X65B 2ARAA 1TAEA 2A1XA 2PHRA 3AG4C 2A71A 4HANA 2BOBC 1M5IA 3VHNA 1RYYA 1HNZB 1MOFA 3L9DA 3HT2A 1Q7YW 4YVSA 2RJLA 4O9GA 3MIHA 5DDJ1 4OX9O 1QR8A 1FI2A 1UOJA 4L0PA 1M9NA 3ZM8A 5CA1A 4LXLA 3SDLA 4Y22A 3CPWU 2ZR2A 4DV3O 2JB8A 1G9FA 3GZUC 4XC9A 1AI4A 3MUZ1 3BTZA 4I01A 3FAVB 1VBC2 5IVBA 2DOSA 1WLTA 1IOAA 3J80N 1CESA 1RUE3 3SMHA 3J8F2 4QDQA 1VBB3 4JTCB 1PNKA 1C8NA 3DYOA 1US6A 4NMIA 5K0UB 3RYRA 1XOUA 3QO5A 4FP2A 3BFRA 4NHXA 3GBWA 5FLJA 3O65A 5EIBD 1WLDA 2J1EA 3ZYGA 3LDDA 3M1HA 2VOVA 4BLIA 4LF8B 2JE8A 4DV7O 1OA3A 4LHSA 3DTUB 1JHNA 1US3A 4UCVA 4P00B 3JYCA 2HWF3 3WD5A 3SEPA 1XMQB 1YIFA 5DZFA 1CAUB 4N43B 4FPGA 5F39A 2VBPA 1H2KA 3CXHF 2K0GA 2YFZA 1EY2A 4DV2B 3ZX6A 1BCXA 4IIJA 4QPIB 4Q27A 3RYPA 1J84A 4AEDC 3NV3A 3JU9A 1XPWA 1JQ0A 4RFRB 5T3NA 3WNXA 1KEXA 1W39A 5JCOC 2HWD3 1R1BA 1XSQA 1JBCA 3JD4A 5EYPA 4HETA 3UESA 1FAYA 1OXCA 1J5EO 4G4FA 3VD5A 4EEQA 3IMNA 3KF5A 3K4ZA 3UT0A 3TEWA 5FXZA 2QWOB 1SG3A 1DGRN 4Q1PA 1UCXA 4RGGA 3C90A 4ASMB 2AHYA 1SF9A 1MZEA 1QLNA 3P32A 5CVRA 4G9SB 1AYN3 3PUQA 1S0IA 4LBQB 2XAFA 3BCCH 4DS0A 1WP8A 1XILA 4AQ2A 2OT5A 2ZNJA 5ABJB 2HKXA 2B46X 3GZTB 2DFCA 4N21A 4K1YA 2WJSA 4LE4A 2FDHA 4GWMA 2ZCEA 4IV1C 1W0JG 1PO13 2VZRA 1HNZO 2OTJV 3ZMZA 1GU3A 1PMIA 3JAWA 1R3JC 4WM8B 1GQHA 3A0BZ 5IYBO 4YG0A 4IT5A 2H94A 5FYVA 2WT2A 3VDBA 2NLJC 1PO22 5FWEA 2JGDB 1NCRB 3UO2A 3SQOA 2MEV3 2EX3A 3KQ4B 3V65A 3ZRVA 1HRI3 4KI5M 4TQDA 2DCZA 2X5IC 2V4VA 2GMMA 1YRZA 4DR3B 2HBTA 4IXLA 3N7KA 1GQGA 3N9MA 4CEWB 3P1IA 2RV9A 2FZ1A 4FI9A 4X6QB 2JK5C 4YY3B 1NTZH 2DYSC 4WVWA 4UVAA 4LA2A 4XJAA 3LIHA 2ZOEB 5C71A 2TBVA 1EV13 1ND2C 1ENVA 4DMIA 4AWDA 3NNLA 1UNBA 1Y6XA 3ZRXA 1PVC2 3H1MA 3VBFA 3IDAA 4Z8BA 1UD1A 2OZ6A 1CR7A 3NVCA 3K9SA 3GB7C 3OPTA 1J83A 1DYOA 4C1XA 3NL1A 4FQ4A 4CCCA 3NW4A 3LSQA 3ZRWA 5A7OA 2QCSB 2RG4A 3ZN5A 2Y34A 2OVUA 1O59A 1PIV3 4RUEA 4X66O 1LTEA 5A7WA 4H13B 3MHZA 1KGYA 2PFWA 3AYAA 3E89A 3KZIZ 1HQLA 4IYHA 1E1QG 1I6XA 1MPXA 3I2KA 4MGYE 5LYJB 3IIAA 3I2DA 1DF4A 4CDQC 1YDXA 3JAKB 2NR5A 5A1FA 2CTPA 1QJX3 2OQ7A 2JDZA 5FPLA 1X4TA 1COWG 4Q4Y2 1BYHA 1YI9A 2E53A 5A70A 1WBFA 1H1MA 3IB3A 5H9SA 4GX2A 5E1AC 1W03A 4PIZA 2PLV3 3GBGA 2OCCB 5KUKA 3CJIA 3ZEDA 4QT6A 2GALA 2VNVA 4CUBA 1IS3A 1W0PA 2WWUA 4HONA 2XWJB 3K3WA 4HAMA 1NA1B 5FYZA 2W9XA 2OZJA 1K5MC 4NIGA 1R083 1EM1A 2GC2A 5BR8B 1MA1A 1TUBA 4O4IA 1WMDA 4JZRA 4FIPC 1Q3EA 4O65A 1GM9A 1FFTB 1NT2B 4LF4B 1MQTA 2VW1A 1LEMA 5FYIA 4W4KA 1QJFA 3AG7A 1YXWA 4ZHQA 2HWC2 3EHKA 1W9SA 2PAEA 3TK1A 2Y0OA 3RGBA 2AYHA 4Q4X2 5C8YA 4HVRA 2MNGA 1YQCA 1PD3A 2RQ6A 1DBNA 4W4ZA 2Y4TA 3MIBA 1WW7A 3NAPB 1YZBA 1RUD3 3ILRA 4FFBA 1WZXA 2LFSA 5FYBA 5K8SA 1SERA 5F3GA 3NSTA 3A0HZ 1WW4A 4XIOA 2Q7HA 2WDBA 3EB7A 2A06H 1L3JA 4FOYA 4CCKA 1ENSA 1SBDA 4LFCB 1VMGA 4WCEV 3LSDA 1OVPA 5AC93 3THOA 4OFGA 1ST8A 5BNNC 3KCXA 3TGUH 2XT9A 4GB31 5K9YA 4XIKA 3VBOC 4I02A 4QE9A 5FWJA 4A44A 2RDSA 3NNMA 3J26N 1WLEA 3ON7A 2ZGQA 2B45X 1CONA 1KRIA 4C7UA 4EFEA 2GC3A 2FMLA 3IC9A 4W4LA 5CMUA 5A7QA 2B9VA 3QACA 1AR73 4YW7A 4QB6A 2WINB 4PF5A 3OR6C 1FX5A 1OCCB 5JQGB 2YZ4A 2WWWA 4WBBA 1IS5A 5KWRA 1ALYA 2VZTA 2ZIMA 2ZE7A 3H1KH 4MG2A 5FKBA 5HPOA 5FPOA 4DW0A 3B09A 1NCQB 3O1RA 1D0GA 2QWQB 2RR12 1VP6A 4PD4F 1O8PA 1XE7A 5DPNA 4U36A 3OE7G 2YUEA 2LTNA 4UT5A 1SETA 5FPXA 2EINB 4CH3A 4MX3A 3N7LA 3VDAA 5FJHA 5LMUB 1RC6A 3CCEV 2HWB1 4RS5B 3NJXA 2PAKA 4Q0SA 3G6BA 4JDNA 2W1WA 1U12A 1WCDJ 1BXHA 3N9PA 4YYOA 5L3CA 5IE9A 5CB4A 1UYZA 2ADEA 3VKOA 4HBNA 5BMVA 1YJKA 1N36B 3OYWB 3MIEA 2KQXA 4WFHA 1CJDA 4URTA 4LITA 2BCCH 2Y4UA 1V6NA 1S55A 4DR4O 4ZKTB 4CPBA 1QIQA 1N34O 1VBC1 2V09A 1NXD1 2QKCA 5CNAA 4HPKA 5CFCA 3K2OA 1YJNV 1RXGA 5H6RA 3J8F1 2XBO3 4Y5Z0 4GKJO 4DRXB 5A7NA 2C2AA 1UZ0A 3VZMA 2DWDC 3LPGA 2QTSA 5JOXA 3OD4A 1GAXA 2YU1A 4XACA 1JOPA 2QWPB 1AI5A 1I9RA 1VQOV 3MW2A 1LUWA 2ETNA 2BWCA 4CPBD 2ZX0A 3I7DA 1BE3H 4H37A 2HWE3 5FZKA 2TNFA 2XQXA 3K9AA 3S6PA 2CE4A 3VHOA 2LUWA 1EZJA 3H0OA 3FB6C 2R6QA 5FPBA 1FOD2 3KHBA 3V0BB 1AX0A 1W0OA 3ZFGC 3D0SA 1QKQA 1YO8A 4J7ZA 1PPJH 2AZ0A 4FLZA 4FFHA 2XDVA 4LOTA 2YIAA 5FYUA 2WFF2 5FY7A 4J11A 1Q82W 3R6SA 4B4QA 4WBNB 3OMNB 2ZA9A 4J41A 2QQKA 2RS52 2QJVA 4G2KA 2Q1MA 1QDCA 1CAUA 1DZQA 4LULA 1IKPA 2DDUA 2C26A 4N43A 2ZX1A 4L99A 5LP6C 1O6UA 1NX9A 1ZSPA 3HKDB 3ZFEC 2IXHA 2EXIA 3QVNA 2KA3A 2IU0A 1AXYA 2B39A 1BBT1 4HYOA 4UCRA 2WAOA 1P7GA 4PHZA 5K1PA 4ES9A 4C0HA 2YBSA 3MLKA 1SQQH 2A7WA 3MBWA 4MS2A 3CS5A 1DGRA 2FDIA 2XUMA 3QCWA 5KAFZ 3BN6A 2G4IA 3OUIA 2XTAA 2WLLA 3TBDA 1QWRA 3EVKA 4BISA 2HFEC 3RS6A 2X6AA 2EICA 2YXSA 2VZVA 3B01A 2OT7A 3N9LA 2D5HA 1KYOF 3QOPA 1K92A 3VZKA 3AG2B 3BOPA 2HYKA 1QEXA 4K7JA 4IEQA 3AYCA 2R7EB 5LMUO 3ABLB 2RE9A 1F23A 5DZEA 4KBBA 3QBQA 4BMBA 4ZHNA 5B1AC 3RMXA 4JQTA 1AL22 2VC9A 3ILNA 3PN1A 4FZ1A 4IE0A 1H2LA 5D8AB 4UCSA 2WT1A 1PO21 3NJZA 3F2ZA 5ABJA 3FJSA 2WLJA 4CU9A 5FLIA 2IU3A 1STMA 5A3OA 5DUUA 3I2JA 1LU2A 1ZBE3 5C3QA 3THDA 2VTXA 4FAHA 1MZ5A 5L9RA 3DGTA 3UK9A 2Q69A 3FX3A 4AHCA 1H2GA 3A23A 3ES4A 5EK0A 5JVDB 4IE6A 4QPGB 2CTWA 2DVDA 4TSFG 1IS4A 1W9FA 3MAQA 4K3UA 1ZLZA 1W8TA 3O1PA 3U78A 4WFEA 3K4AA 1P7BA 1VIWB 3ACHA 1FNYA 1RUI2 3RWRD 3JARB 2P4EA 1RJ8A 4PQQA 4ZZ8A 4KH9A 3SPIA 3WU2Z 3LA2A 1DQ1A 4LBMA 1V6IA 1U5ZA 5FZ4A 2R063 1HJGA 1TE1B 2W3JA 5EC2C 5FYHA 3BIWE 2WC2A 3HD8B 2B42B 4DR7B 4CEWA 2R16A 5GLTA 1F5JA 3X29B 2VQTA 4TN7A 4F7ZA 3V64A 2ZM6B 4LFAB 2HJDA 3ALQA 3SCHA 2DW4A 4JV5O 3HBZA 4ORFA 3C7EA 4D7SA 1W2NA 4WM7B 2UUBB 4FTSA 1O3QA 4NKGB 4QB2A 4AVSA 3OEHG 2VCMA 1ROPA 2CAVA 4CZSA 4Q4Y1 2ZMNA 1YFUA 1SLCA 3LGRA 2XJRA 2CK3G 2P7TC 5DM6V 5FNVB 3FB7C 5KBFA 4QGPA 3TB0A 1A32A 4CYDA 4G3YC 3STLC 1AR83 1MS4A 4P02B 1E79G 5J9PC 1W8ZA 5LYJA 3ABUA 2JXAA 3FWEA 4OVEA 2BU9A 3LEKA 4UXAA 5IJ9A 3OGIB 3LDKA 4GZ9A 3D8CA 5B1BB 5LEJA 3QTCA 4QNHB 5SV8A 3BCWA 4P9PA 1OPOA 5FPZA 3WF4A 1POQA 1JU3A 4ATFA 4IEUA 1GR3A 3F5TA 4A7YA 1UIKA 3SJCC 4XF1A 3AJYA 4MVOA 1GNHA 3POJA 4Q4X1 3S0MA 4I0XB 4LKSA 4LNUB 4NHYA 2LROA 2VU9A 3D82A 4P9YA 5C5TA 4GWJA 4UVCA 2PHTA 4JI0B 2V7QG 4MW3A 4FLUA 3B77A 4L92A 4DV6O 3ASIA 2IJHA 2Y69C 2QR4A 4LJHA 5FZ0A 3K5NA 4PJYA 4V1PA 2DYRC 3N4MA 4E4HA 3M8LA 2CU5A 1UAIA 2J1AA 1OPMA 2YV8A 2O0OA 2WQ4A 2EIJB 3VBHC 3VDDB 1ZA7A 2EXKA 5JSOA 2OYZA 3T4HB 3NAPA 3SH4A 3B4SA 4MV2A 3M2MA 2AW9A 1GP4A 1SQ4A 2YYOA 3VBRC 5IYYA 2YDEA 3ILFA 3W20A 5IVCA 2ZMKA 4RA0A 3E8FA 3FUOA 3C7HA 4FPEA 2VVEA 3FHQA 2ZM6O 5BYNA 3I3BA 4B8EA 2JIGA 3MEPA 2DUQA 2VXRA 4JRAA 4I2OA 1D2SA 2KG7B 2RR11 3FBMA 1LR1A 4CH5A 4X1YA 4AQYO 5DAPA 5FY0A 3OEAA 4P9WA 4Y3OA 1JUHA 2X0LA 4MOAA 3MDSA 3M3OA 2AACA 1RHI3 3SEEA 1LHOA 1OUXA 2Q5TA 1JYWA 2Q68A 3AK2A 1O5UA 4AI1A 2VOTA 3KV9A 4ZPIA 1GZWB 3O14A 4M01A 3WF0A 5JQGA 3AP9A 3JBG2 4AI0A 3AZZA 1I3HA 2ORZA 1CJPA 1J1LA 1Z0HA 4P5YA 3RVYA 4OI0A 3W9AA 4XEZA 1NCQA 4DR2B 2VVDA 3OR7C 3K5MA 4KG8A 1M56B 5CBHA 4CU7A 5JAXA 4I4TA 3WF1A 4CC5A 1CWPA 3AMNA 5FYYA 1JZ2A 3I56V 1F5FA 2WKKA 3HNMA 4Q0PA 2RS33 2FQPA 4PCRA 1NH2B 4BU2A 1ZZ7A 5LZ6A 2EULA 2D6LX 2JG9A 1COV2 1Q6UA 2WPDG 4GB33 4JGYA 3KGLA 4GT1A 4JI7O 2UYAA 4GH4B 5L7OB 2QEXV 4QU1A 2PQSA 1MS1A 3RYFB 5FAXA 4DXZA 1LUVA 1ORQC 4B3SB 4Q0VA 3EYPA 1BSMA 1C4RA 3JASA 2A5ZA 4JAVA 4UB8Z 4JI0O 4LFBO 5LMNO 1G8WA 1BK0A 1FOD1 1DDLA 5KA6A 4X20A 3WB2A 2HP8A 2CTRA 1NKGA 3QG5A 5CA0A 1F9KA 1VPHA 3HQXA 4BOWA 4RSUA 2GMEA 2ENRA 4YPJA 3L73H 2ZNIA 2RS51 4IDZA 1UOBA 2FDJA 3AC0A 5B4NA 2ZEXA 4V2VA 4IV3C 5KHIA 1W8WA 4KBZA 1H8TB 1EPWA 4BIZA 2HWB3 4AQ6A 3PVEA 3ZYJB 5T52A 1LU1A 3V0BA 2WO7A 3FHIB 2E76B 1AR93 3WUCA 4MYEA 4XURA 2BOJA 3FD9A 3RYHB 2FCUA 1NKDA 3ETEA 5HBAA 2CV6A 4PBPA 2JX9A 4E2GA 1XOYA 1RUH2 5C6CA 2AZ2A 4JTAB 2BSKA 5B2GB 3O1OA 4CDXA 5KHGA 3APBA 4KMQA 5IWAB 2Q8CA 5FQ0B 2Y0PA 4HNAB 1WLCA 4JKKA 1H4GA 4BR6A 1F4NA 2RN9A 4CCJA 4AVTA 3HKDA 1HWYA 1VALA 1E5SA 3JCUZ 4D6TH 4YM0A 4PLMA 2JWPA 4PIYA 1G8MA 2W95A 1TVKA 5FYCA 4CP9A 1AUYA 3E22B 5FO9B 1AL21 4R50A 4Y1VA 4NAMA 4XFGA 4F4LA 3P30A 1X9PA 4QKFA 2XJVA 4DR2O 2VTFA 5CU1A 4OCTA 1O4YA 1I94O 1DLBA 2VQEB 2BYVE 3BPZA 1MZFA 2KM2A 2LGWA 1JMKC 2ZTNA 4TV8B 4D0QA 5AG2A 5FZDA 4KG0A 3KB5A 2IM9A 2B8MA 1SLAA 4W50A 2CAZC 3ZHQA 5HV0A 1PMJX 1DYKA 2WAMA 2IXCA 3IT8A 2YROA 5L3DA 2AEYA 4QGMA 2UXXA 4XAEA 1QLEB 2AHZA 1MS9A 1RUI1 4QKDA 4AFDA 4LBKA 1CAVA 4XJUA 4B3SO 5GM0A 2ARHA 3NNJA 2F4LA 4MVRA 3NV4A 1KC8W 4AL9A 4NTXA 3H8UA 3P3PA 3IAQA 4E9KA 2BTQB 4Y20B 3EFFK 3R4SA 2YEVB 2EIGA 4HVOA 1M57B 1XJAA 3SPJA 1FT9A 2BNNA 4QDRA 2R49A 2WZR2 5BNPB 4QB1A 5GZDA 2SLIA 3CMEV 3OPZA 2AENA 2VOKA 5IVJA 4OYUA 3ABKC 4WFFA 1VQLV 1B3QA 3P5BA 5EJ1B 4JAUA 1NY71 4LLFA 2JDAA 1R73A 3W7SA 3D4KA 1DF5A 3WFVA 2P5OA 3LDRA 1YI7A 4L2NA 5CAZA 3MHHC 3CHXA 3UYJA 1V55B 2UXDB 1VAKA 4GZRB 5FUIA 2XVLA 1WCSA 4LKDA 4X64B 3T30A 1A8DA 4BK5A 5IJRA 4GMP3 5FY1A 5JH7B 1C3HA 3ZSMA 3AKQA 4JTNA 3WG3A 1QDOA 3AP5A 5IWAO 1SQFA 1MG1A 4AFMA 5CISA 5A7SA 4DXRA 1ODNA 1JJOA 2XXZA 2A6ZA 2WS91 1S0VA 3A7QA 3J7MA 2WSSG 4W8JA 5KR7A 3A0NA 4GIQA 2VZQA 5L19A 1AB3A 1AF9A 5C93A 3MLJA 3CC2V 3ZS8C 5JOZA 4I50A 1C5HA 1KJLA 4LH6A 1HN0A 4BPZA 1LGBA 4QQOA 1OCRB 5GTIZ 3AZVA 3J7AU 2BQPA 1FXKB 4AILC 5FL7G 5A6XA 2C4XA 4Q1RA 2YC0A 1WCUA 4LF9B 2PF4E 4X1IB 5JCOA 4R4ZA 1T2XA 4UWDA 3W5NA 2ZHNA 3ABTA 3DPRC 4PDRA 3ZXKA 3KVBA 1I0HA 5JIUA 2Q8VA 4NIAA 3CMAV 5KXEA 3VLBB 1QJY1 2KXLA 2J7MA 5ITZA 3L9JT 2DWEC 2Y33A 3KGZA 1DK1A 1H8HG 1FYJA 1GKBA 4TSVA 4ZY9A 1XL4A 3ACGA 3AXEA 3H3ZA 4D7TA 3IPVA 4IERA 1SA0A 5LBEA 4X62B 3K58A 5IVVA 1VF6C 1JX9A 1QU0A 2F17A 3KT4A 2GV9A 1SQBH 4YM1A 1J59A 5LATA 3E83A 3POFA 1SQVH 3POIA 3G80A 4JTDB 1BMV2 4M3CA 2FMDA 1L0NH 3AG1C 3E97A 4NRQA 2FL4A 1NQDA 1RUE2 3ATGA 1VBB2 4MXWA 5F6KA 1YF2A 4CH4A 1V9U1 3B8NA 1WN7A 2YBPA 1KU9A 4IV1A 2KB1A 1J1TA 2D6OX 4FTBA 3O0VA 3VDDA 3WDUA 1U97A 5J2UA 1WLWA 4ZXEA 3WVJA 2WNEA 2QE3A 1GKFA 3ZPYA 3ZFFC 4YG3A 5FZHA 3CP1A 3SYOA 1P84F 1YUDA 2HWF2 1FJGB 2VGDA 4YVWB 4DYLA 3FYIB 4ZKIA 4LHNA 2ZX2A 5DG2A 4XQDA 2X5IA 5F32A 5LGNA 3ZIWA 1W8UA 4MGSA 2YIBA 1IPKA 2XOKG 2D5FA 3CU7A 4CDWB 3SCGA 5B1NA 3I5DA 1HNWO 1KKDA 5JJEB 4ASUG 5C7GA 1WP7A 4DRVA 3R66A 3IN9A 2B1IA 5FV3A 1BQZA 1ZZBA 2WT0A 4DEQA 1D0HA 5SV5A 1POV1 4KXRA 2HHHB 4IEOA 4AZZA 1C1LA 3EMRA 4CXYA 4YJ3B 1Z2GA 1VE0A 2WQZC 1AILA 2B5HA 4YFZA 5TISZ 5CG8A 3ZYHA 2H8PC 2VBDA 5FZBA 4WVVA 3KKYA 5FY4A 3WEZA 4B3TB 1K45A 1JZ5A 5ACA1 1AYN2 4QKBA 2ZT9B 3CJHA 1G6NA 4COZA 1R093 3JD73 1IBMB 3RBZA 2NZ9A 4LF9O 2PYLA 2VTXJ 4XAAA 3S5QA 1S5LZ 2R1DA 2ZGLA 3WP4A 3MYXA 5GKAC 4BJ0A 4CDQA 5K7PA 4WFAV 4XBFA 4GJZA 2XKOA 1BHGA 1PO12 1BHAA 5L3GA 4FO9A 4LTAA 4AEJA 1GH6A 2Y6JA 4H0LB 1H30A 4TV9B 4GH4A 3O1TA 3VQXA 2VZ3A 3V56A 3DXRA 3AFKA 4X62O 1DLCA 4A7KA 4ZXKA 2I2SA 1B04A 3BTAA 5G05L 1Q6HA 2HVJC 1JZ6A 1DYPA 1CAXB 2BNOA 2DUOA 2JKBA 3UNPA 1HRI2 4J7JA 2CY6A 1B35C 1G9BA 2P4KA 4X8AA 2RMU3 4RD7A 1XNRB 1Y4MA 4YZ5A 1RUH1 2ZXWC 5EYXA 2EIMB 2DBIA 5T5OA 3KHCA 1EV12 3W7TA 1Q8OA 1H8TA 2VUCA 1YEWA 1ENQA 4JGZB 4CE8A 4A45A 4PA4A 2K2SA 3K46A 5AVAA 5B66Z 4QX2A 2A73B 1BK1A 4EV0A 1DQ4A 5DABA 3PUHA 1OCZC 3ME2A 1PM4A 4Z92B 4FFKA 3T4VA 3T2OA 5IVEA 1LENA 3PNAA 3TETA 2RNBA 3SJBC 3JQWA 1UYXA 3TXQA 1C57A 1PIV2 3I2HA 3M3EA 3MFAA 4HNAA 4I55B 4PT6A 5BPXA 3FE5A 4IE5A 3AEIA 3OG2A 1ULPA 2HHHO 1N32B 4PDWC 1EAH1 1YCIA 1NVPB 1W6NA 2YHJA 4KQ7A 5KHKA 3ZN6A 2VD7A 2VMIA 5BNNA 1QJX2 3I4IA 1PGW2 1GSLA 4CSWA 1WD3A 3TNQA 4AGRA 3HN1A 1FPN3 4JC1A 2A3YA 3VBOA 3WZ1A 1BVP1 1VBD3 4B3MO 4P9IA 3ZHSA 2PLV2 1PM7A 4Q4V3 4NTWA 4ZONA 1UMIA 2W6IG 3OBZA 4LK6A 1DGSA 5FZGA 1OKOA 2HEVF 1FXZA 3WQBA 2EJRA 4QIWF 4CXWA 5F5AA 3VHPA 2VQ0A 1IBKO 1ULGA 4M00A 4CEYC 5I0TA 2W47A 3LDCA 3LWCA 4O4HA 4TV8A 3UGHA 2GTSA 4TUYA 1R082 3HMYA 2JJ2G 1CEZA 1PZ8A 3STZC 4G27B 2Z4FA 2WZ8A 1XMOO 3HVDA 4ZIBA 3LSEA 2F66C 1ZBA1 3I59B 2Z2SB 3CE2A 1AXKA 4K8RB 4LO7A 4XUNA 4JV4A 1MSDA 4Q29A 1N3QA 2PYJA 3I2OA 4LWSB 4NUBA 2VECA 4YHHB 1V6MA 4K1ZA 5CG9A 3SITA 3AX4A 1FXVA 2CNAA 1Z5WA 5DAVA 1CXZB 2QQUA 5BUVA 2IXJA 3PUSA 3AK3A 4GD4A 4Y20A 1RUD2 2YY1A 2ZCWA 2YEVA 4AI9A 3AKTA 5CKMA 4Z2AA 5JI7A 3F7VC 1XNRO 2B9UA 3WF2A 1OZ0A 5K0UC 3IWZA 1ZZ9A 1SRYA 5C9AB 4PF1A 3LNMB 3HEIA 2VZSA 1BQPA 3M70A 4M0HA 5AC92 4OHVA 4RR3B 3UKMA 5FREA 2NN4A 4TYSA 3ZMTA 4XDJA 3UL2A 1PNFA 3QD6A 1IDSA 2O57A 4XBQA 3WHTA 3RT3C 3C3TA 4HL0A 2AEZA 2XAJA 2JECA 3POEA 5IJ0B 4IV3B 2RS11 1W2AX 5LRRA 3LE0A 1APNA 4N43C 1OLQA 1AR72 3T09A 4YW1A 3ZFGA 1HP8A 5JOYA 1HIXA 4RQPB 1DFQA 3CCRV 4INDA 4YARA 4QPIC 3WB0A 3HQUA 4NE9A 4EB6B 4LF5B 3FX7A 2VXJA 2XWBB 3HNYM 3IIIA 1UOFA 4UCOA 5F3EA 2WO2A 1WPXA 1UY3A 1W6OA 4Y5TA 5A1LA 4HOOA 3G4SV 3HBKA 2VY0A 1D2QA 5LP6A 2XPJA 3HWJA 3JATA 4R6ZA 5IT6A 3U0ZA 3RN4A 4ASKA 1XUQA 1TME3 2PY5A 4X1IA 4JX0A 4R9CA 1CX1A 2PA7A 1BMV1 2ZQMA 4UAPA 1P4RA 1PKXA 1RUE1 1JN2P 4DV5B 5CFDC 2LW1A 2XBO2 3UJOA 4FJCC 1VBB1 5ABJC 4MUVA 4JI2O 4PI2A 4FPOB 3BODA 2Q8OA 1AJKA 1ZVFA 3CXCU 1YTFD 2JICA 3H1JH 1SC5B 1AL0G 4TLFA 4BQ1A 4XFBA 2DCTA 4I0AA 3PLQA 2WS93 1O8SA 4OI2A 1UX6A 4WM8C 3Q4HB 3ZYIB 2HWE2 4CBCA 2IVIB 1HB1A 3IDBB 4QWNA 2HWF1 5EBMC 4Q4W3 4AXOA 1NCRC 4H14A 5LHIA 4CVUA 3CCLV 3OY8A 3ZMVA 1SBEA 2QJ1A 3AL6A 4DR5B 3MICA 4XYXA 2VQFB 4JYAB 4IEVA 1FV2A 5JPMB 4COWA 1OD3A 3N2KB 4LO6B 4LF7B 1JJ2U 4WFGA 5LEKA 4CUGA 2VZOA 4CEWC 1LOBA 4HK8A 1U0AA 5DUWA 2WNUB 4D69A 3H9AA 2HWD1 1UZZA 5L9BA 4JI4B 4MZUA 2R72A 5DN2A 2AGAA 2GZWA 1XQ8A 2C6SA 5T5JA 1UU5A 4DW1A 5FZ6A 4F6RB 4X8PA 2OCHA 4F8AA 2PGGA 2XAGA 4IEXA 4AI8A 1RUG3 1MEC3 2E5LO 4CDWA 4J6GA 1LOEA 4O2BB 5HXMA 4ZU4A 1PK6B 1AYN1 1UZWA 5GLZA 1IG0A 3X2QB 5LCWL 2ERFA 3K06A 4LF5O 1YQ2A 3PUIA 5FBZA 1IQDC 1HNXB 1V9U3 3A2FA 1WGPA 5FMDA 4Y24A 3WV6A 2D44A 3MW3A 4CRQA 4ES8A 2GH2A 5FIXA 5DXDA 1SQXH 1J3QA 5FDBA 2W6JG 3ZHRA 1CZVA 2JS3A 2VULA 3ASOB 2QGNA 1URXA 3CCQV 5BNOB 3S3WA 2R073 2IZWA 5JR2A 3R4UA 4JI6B 2OCCC 5A3TA 3POGA 2R043 5GZGA 2MEV1 3QH7A 1CVNA 2WLNA 1HRI1 4PA9A 4AI3A 3N9OA 2PTMA 4W6WA 1NA1C 2B9ZA 2NMOA 5IVFA 4UCUA 2WLKA 4WVMA 1EYBA 2F4VO 2VMHA 4NOTA 1UMHA 4ZU7A 5DZGA 3TN93 4J7KA 4AQSA 1QQP3 2A3XA 5JLVA 1EV11 3RYIB 3I2GA 1UU6A 5M0TA 2ZGKA 3N2GA 3JB8A 2WYFA 1YFYA 4FT8A 5FP8A 4EZHA 1G4YB 5C8CB 1PL0A 2ET1A 2AH2A 4MVTA 3UT5B 2WLPA 1S0DA 2XHBA 5F5QA 2R062 4LIVA 1B09A 2WIIB 5F2VO 3ZMOA 1XREA 3NAPC 4I09A 1UQXA 4M4RA 3WNNA 2VQFO 1LHWA 2X6BA 1MS5A 5BNQA 4JYAO 4CCEA 4Q8LA 2Q7EA 1PIV1 4MADA 4QPYA 3WG7B 4XMIA 1WA8B 1UWWA 2ZZJA 1RVF3 3E8BA 5F3CA 3BB6A 4CU6A 3R4DB 3AZXA 1QY4A 3I54A 1QJX1 2P3IA 3VBHA 4ZI7A 1PGW1 3CBNA 4UW5A 4H7LA 1ZTEA 3RWKX 2BGCA 5D1IA 5LY2A 3B40A 1QJZA 4LMFA 2PLV1 1W8HA 4W6YA 2WAAA 3H9VA 4I55A 1W99A 5JXJA 1UYYA 1OCCC 1DGWX 1UIJA 4AFBA 2QDRA 5AFBA 1W9YA 3JSNA 1W6QA 1W6MA 5D5PA 4R52A 1NCQC 3AKPA 1R081 3LFMA 1YHQV 5HFLA 1FXHA 5LHHA 1GBGA 2CWSA 3MF6A 1POV0 2FZ2A 3KT1A 2ZKOA 3JALA 2EINC 2BTVC 4LEJA 2G38A 1JUIA 4L9BA 3CKHA 4JI3O 2CUGA 4KNCA 4RS5C 4BYYA 3PVOA 4K8ZA 4GKKB 1IBLB 3ST7A 2Q4SA 3CWBH 4N23A 4N53B 3B2EE 1L7RA 4H55A 3PHMA 1SCRA 1N3OA 1KQSU 3ZYPA 2D43A 4XCBA 3A22A 4W6XA 1XE0A 2QQMA 3S7IA 4I5SA 2V4AA 3B8MA 1ZYBA 3I59A 1PGL1 3MIFA 1VARA 2IXLA 3RJ2X 2LALA 4LQRA 4AI2A 4LHKA 2UWBA 1I08A 3L72H 3QO8A 2WO3A 5AC91 1PNLA 1H0BA 1HDKA 2M6YA 4XHBA 5KA5A 1PM9A 1T6GC 2AZ5A 1HLCA 4NJ4A 1NZCA 3IDCB 3MLLA 1S4CA 4IE7A 3ZLIA 3I97A 3ZHTA 3B5LB 1RJ7A 2FMYA 2D97A 5C5UA 4P14A 1LKNA 1KDKA 3VZJA 4XXAA 4I0WB 1AR71 2FCTA 3MGUA 1PVC3 3OAAG 1CAWB 2E74B 5A3MA 4RYDA 3BA8A 1VQMV 3SGIA 2E63A 1VBA3 1ZBA3 3JD1A 2QBXA 5KHHA 1V6JA 4QDSA 5CKQA 3THTA 4IV3A 2VUAA 2XMLA 3HKEA 1RHI2 2UUAB 2QKSA 1SFPA 1NZIA 3GHMA 1KP3A 3EQEA 1VMFA 2ZZQA 1REDA 4KL1A 5E88A 3K5LA 1Y9GA 5I0DA 1IKQA 2HVKC 3VD4A 4A41A 4DUZO 5EZYB 4YGBA 4FOQA 4MGIE 3GF6A 4O4LA 4UF0A 3LD8A 4FZ0A 3LDBA 2Y8KA 1GNZA 4AQTA 4Z07A 1ZM1A 2XBO1 2XJSA 2QQWA 3W7UA 4GALA 1PZ7A 1N47A 3HIFA 3PJQA 3WW1A 3ZKYA 2RS32 3AG2C 4E2LA 4COYA 4GXLA 3ZMUA 5ANQA 4JRLA 4DEVA 1G9AA 3ABLC 2WLIB 2A6YA 1VRH3 2BOCC 2A6VA 4GB32 1QQCA 1M1KW 1OT5A 3CD6V 5FK7A 2W0XA 1IBLO 2PI4A 2HWE1 5EV7A 5FXWA 1XEQA 3NMBA 5D8AC 1LNSA 2V5DA 1ND3B 2DVFA 2XOMA 2E9QA 5FZOA 1B6QA 1JTZX 2I07B 4QXKA 1GMMA 3I3DA 3ZN0A 3TAYA 3KF3A 1JCHA 1SDWA 1SEFA 3HKCB 2YGLA 2Y38A 1G9DA 2Y6FA 1QBZA 4JI8O 2JGUA 4IYIA 4XDOA 2GNTA 1QOSA 4QPGC 4HFSA 2QZ2A 4Q0UA 4BK4A 2XB6C 4FLTA 4K35A 2XVKA 4DK1A 2HWB2 1XHZA 4ASLA 4AE2A 4FTEA 4UW6A 3U07A 3MF9A 2PHDA 2QM8A 4XQ4A 4R7CA 4P9LA 3OBAA 3U75A 1ZRCA 4O4JB 4WFBV 4AF9A 1W2OA 1AR92 2CDOA 3ZXGA 3C7GA 4DV0B 3N2KA 1NT0A 4MVZA 3VQYA 3ZSEA 3O0XA 4YW5A 3R0RA 5CADA 2WNUA 3LQCA 2F1MA 2WL1A 1AP6A 1F15A 1YIPA 4KU8A 4BIUA 2ODMA 4MVQA 3FMGA 3RZLA 3Q8BA 1WWYA 4OUMA 5FMBA 1OOPB 1K3IA 2JEUA 1E1RG 2WABA 4WM7C 3GCWA 3K59A 3H7JA 2HKOA 2CAUA 3NNFA 4UOJA 5FZ1A 1RFYA 2UUAO 2DVGA 4LO8A 1A78A 4IL7A 1NG0A 3LB9A 5A2QN 1ENXA 5DUXA 4HN0A 3U4SA 5HCHA 3MFCA 3LNNA 1TMF3 4LE3A 3RYCB 4RGKA 4RHV3 5GLVA 4U7OA 4LR4A 4ZU5A 5A1AA 3ZMSA 3E5UA 2WWJA 3WQ7A 5B1BC 5T54A 1KXGA 1ZBE1 4UB6Z 1OA4A 3AG3B 4DXWA 3E5XA 3UO3A 4QE7A 2BGOA 2HEYF 1HQWA 5FY8A 5LRSA 1DLLA 5TSWA 5CA3A 1XNQO 1YIJV 4Y1YA 3ZVXA 2JIJA 2Y0IA 3ZXDA 4FVMA 2OYQA 2YPDA 2VQAA 4QM8A 4R9BA 2P6CA 1TVGA 3WG1A 3TEZA 3ZXLA 2D6KA 4YZ4A 1KUQA 1G9CA 2ZHMA 4CZZA 1WBLA 4CXXA 2PHXA 2ZGPA 4C90A 2QM4A 2D93A 3HNBM 2YXYA 5FP9A 2P6HA 2NYYA 1BBT2 4OHWA 2Q1ZB 3U1XA 4AGVA 2BNMA 4UV9A 4KGGA 1HW5A 4BXSV 2R061 4QXBA 4JI1B 4FLXA 2QQOA 3RWNA 1GQPA 1W04A 1QOOA 3AVSA 3A21A 3DPRA 3ABMB 3VKFC 1SESA 3T1HO 4ARXA 3VN4A 3T3YA 1QJU3 2W68A 5CFDB 5A6QA 1V6KA 5C4WB 4CUAA 1JS9A 4YJ2A 4YZ1A 2JDUA 1SBFA 4FM1A 1RB8G 3H1LH 4X65O 3SYPA 4PDVA 5H9QA 5CBFA 1KBHA 2C5DA 4COVA 2EZOA 3EXUA 2EIJC 2BJSA 2OIGA 4KFMA 1S72V 3LIGA 3UT5A 3CJXA 1VF6A 3VDDC 1EN4A 1K8AW 2ITDC 1DQ2A 4MT8A 2VE1A 2CH7B 4LUKA 5FOBB 5CN0A 2QQLA 5E1RA 2FD8A 4DV0O 1L7QA 3HQRA 4CH6A 3GWOA 4DO0A 3MUY1 1AR81 4B1MA 1F35A 3ZO0B 4YFWA 3MZHA 3DV8A 4MHUA 2OIEA 1SHWB 5LXTB 1LHNA 3ROUA 1BHBA 3CLPA 1U5XA 3D3QA 2Q8EA 4F3JA 3FZ3A 4XW3A 3AK0A 2ZEZA 4XABA 1N4CA 3TYJA 1S0FA 4A3XA 3ZFFA 2QVSB 4LF8O 1OFNA 2IC1A 3AP6A 4OQ8A 3GZEA 3S57A 5LASA 3HR0A 4Y4RA 3LUTB 5H2FZ 1F51A 4X88A 1Z7S3 1XMQO 4WV8A 4YG6A 3C7OA 4Y33A 3DKQA 3RYKA 4JI5B 3CQOA 1BMFG 1YXBA 3AP7A 3ETPA 2N7GA 1M56C 1UO9A 4PLOA 4DV2O 4E4ZA 3ZMNA 5LBFA 4UFMA 4XETA 3S3XA 3K3OA 1XDCA 2A9HA 4NIIA 4U7NA 4QHZA 4E4SA 1EN5A 4EJRA 1TGOA 3SPHA 2Y64A 2LGQA 2EZPA 3USUB 1V0AA 4QQPA 1LNQA 2D3OW 2CGOA 2JD9A 5KXBA 1XXNA 3D3IA 2JJ6A 2BTOA 1H2SB 2W0FC 5F9TA 2Z5WA 5L36A 5LK7B 3RVZA 3BU7A 4GH4C 5L7OC 4CS3A 4X1KA 3JXSA 2DN9A 3FB8C 1Y67A 5FZAA 3T2QA 4LA3A 1EP0A 2ORXA 2KSDA 4LO4B 4XCAA 4DK0A 3BEHA 2JG8B 1RGSA 1CQ9A 1V9PA 3NXSA 4CUCA 4J25A 3B94A 1H1IA 3B3QE 3ZSJA 4BW5A 1UY0A 1VMJA 1XYPA 5DEDA 4YW6A 2JDHA 4LF6B 5IUQA 5DN6G 1OSGA 4A6OA 5JZGB 4E8CA 4PJ0Z 1QXPA 4EN8B 1H8TC 1W8FA 1YNAA 1RHI1 1QVGU 5ERLA 3B9IA 3OTFA 3SCFA 1W6PA 3VBUB 2G9ZA 5HCBA 1B35A 1VQ4V 2EIKB 1H9PA 1V6LA 4LUMA 4QXCA 4CP0A 3KT7A 1VF7A 2PN5A 4DR3O 4RUFA 1HRV3 4DV4B 3ASNC 4DB5A 3DL3A 3VZNA 1Y76A 1NR7A 5J09A 3F5WC 4IEZA 4B4PA 4N9IA 1GZCA 4YY3O 2I45A 3HAGA 4JVAA 5FZ9A 2RS31 1GM7A 2RDRA 2SBAA 4XJZA 5J2TB 5GONB 2X8KA 4Q0QA 2UXBB 5A33A 4EKWA 3CC4V 5J96B 3O7OA 1WCQA 2F93B 2WYSA 4LBNA 1D7PM 2ZX4A 2WNVB 3H1YA 1S2KA 4R9AA 3H8RA 1R092 3JD72 2N05A 3JD3A 4DINB 3UM7A 1AVBA 4M0NA 3OPWA 3HKBA 1LAJA 2PHWA 1K34A 4DUWA 5EBWC 2Z42A 3N9QA 4YVSB 4FFGA 4ZZ5A 4H7MA 1FFXA 4PDWA 1GUIA 5CA1B 2WLIA 4M4PA 4Y22B 3E6DA 1H1AA 4XDLA 1VLNA 1W0KG 1DCSA 3OEBA 1RPOA 4P9OA 4NRMA 4PIXA 3T2MA 1DQ6A 3DEMA 1S0EA 3E86A 1VP7A 4OPHA 4OMDA 3P6BA 4MGKE 1QLEC 2Y6LA 1ND3A 1R1A3 1N0JA 4NIHA 3L2YA 5IVYA 5EIYB 3WP6A 2V4DA 1AR91 1M4UA 4LLOA 4GWNA 4YGDA 4CEYA 1IURA 3D3AA 4I0BA 1SKVA 1X36A 2Z5UA 3GNEA 1OH4A 4U3FH 4RAIA 2XLGA 2RMU2 3MO4A 1F4MA 2PXJA 2W52A 4XXPA 1KS5A 2VW0A 3OM3B 2YIDA 1M57C 1OHFA 5BR8O 3PUAA 4R4XA 1HXS3 2X7RB 5BNPC 2LS6A 4JYBA 4LF4O 2LW7A 2FBEA 2AR6A 1YVWA 2YG0A 1GM8A 5C70A 2ATFA 4JKLA 1KJRA 2BERA 4AVVA 4AHYA 3VDCA 1TZOA 1O3RA 5EHDA 2OQ6A 5CKNA 3FAVA 3G71V 1NLQA 1V55C 2KKWA 4O2AB 1CPNA 3CEIA 4LO5B 4UFIA 3W7WA 5FO8B 2G9FA 3LEIA 1BL8A 1OOPA 4L8QA 3K4DA 3GJBA 5K0UA 4RQEA 1UZYA 3JBG3 1B06A 1S0BA 2GN7A 4AAXA 2UUCB 3D6EA 2PMWB 3VZLA 1GICA 2OUJA 1HW7A 3CX5F 4DZGA 2HR3A 4LBEC 4LFCO 1FPN2 1J95A 1CX4A 2QFEA 5B4XA 2XL7A 1OQEA 5A3WA 2JDMA 2BFUS 1M93A 2GSYA 4Q4V2 2QZ3A 3RYCA 1RL3A 3G67A 3LA3A 3WG4A 1SPPB 2WN2A 3U14A 1OCRC 3MV11 4AFAA 3WXPA 1FXKC 4QPIA 3AFGA 2QUOA 3B00A 5J37A 2ZMLA 3SKJE 2VR4A 3H1WA 2DUPA 1OF3A 1JODA 3JAWB 3BUCA 4MTXA 4LKEA 1EZVH 2ZDIC 4HVQA 4FQZA 1AVMA 1RMU3 1YYNA 2HEPA 4PDMA 1YQ6A 4CCLA 4KWLA 2PHFA 1EPZA 4FOVA 3VBSB 3ZBHA 1QNMA 2W92A 2ZEWA 1IZ3A 2QQVA 2GP3A 2W94A 2VS0A 2G9GA 3OMAB 1W05A 1Y66A 2W91A 5A3PA 5KC5A 2VH9A 3VZOA 4QX1A 1NLSA 1KQRA 3DYPA 1ZRFA 5FUNA 4LBQA 1UMZA 3CL1A 1WB8A 3BIEA 2JB4A 4MXVA 4CDUB 1UF2C 4QXHA 1N36O 4LCUC 1XU1A 5CFDA 1YFWA 3A8TA 3CCJV 3UQ8A 2YICA 4YXWG 4KWUA 4KWJA 4GMP1 1VMHA 5IY5B 1Z5VA 2P22C 4BWAA 3E6CC 3VBFB 3OOXA 4BQ3A 1C1FA 3ZXJA 3SJQC 1OI6A 1AYM3 4QM9A 5GZCA 2F95B 2GNMA 1ZZ8A 1JYNA 3DUIA 5GLUA 2R9AA 4WM8A 4B29A 3UETA 3ZRWB 2ZXQA 1AJPA 4FPCA 3ZDVA 4QX0A 1X7NA 3GBFA 5A7WB 1FKAO 1GOGA 4R8HA 2JGDA 1NCRA 5JR7B 3RFRA 3JD2A 3OTOB 4YVWC 3AP4A 2UXCB 3ZYRA 1YQ8A 4OHYA 2OX0A 5LXTA 5EXOA 1NQJA 4NPLA 4CDWC 2ARXA 4QX5A 1AHSA 1JA8A 4YNIA 1KFXL 2B1GA 4CCNA 3RG0A 1AJOA 4A7ZA 2CDPA 3U10A 2Q30A 4TXWA 2WZPP 2UUCO 3RVHA 1RUJ3 3CJIB 3BU0A 1HB2A 5BY5A 1WCKA 2X09A 4MGQA 2D7FA 3K03A 1O7FA 1NY72 1YC61 5FYTA 4WF9V 2NM1A 2BBVA 4O4IB 1PMHX