5KHHA

Hcn2 cnbd in complex with inosine-3', 5'-cyclic monophosphate (cimp)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
194
Chain Sequence
SSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 64
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khhA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khhA02
5I0TA 3I59A 3TNQA 3UKNA 4JVAA 5JR7B 4Q29A 4LUKA 2GAUA 1NXMA 1O4TA 1LKNA 2D5FA 3FZ3A 3ST7A 3IDBB 1SEFA 3U0ZA 5F1RA 4LLOA 1HW5A 3E5QA 2FQPA 3BPZA 1QXJA 4QGMA 3FE5A 4KWKA 1ZZ8A 4MGZE 3L2HA 4A2UA 1XE8A 3GBFA 3ZDSA 3FHIB 3QACA 3RYPA 3NSTA 4WVZA 4E2QA 4QX5A 5KHKA 2O8QA 2VECA 3BU7A 4IEXA 4FBFA 2GZWA 2MPFA 1J3RA 5LRSA 1UIJA 4ONUA 3S7IA 5JSPA 4IEWA 3GYDA 4E2GA 3CF6E 3IBMA 5D1IA 4F8AA 1GQGA 2H6BA 3ROUA 4XFGA 5JAXA 4XFCA 3H8UA 1Y9QA 5C8WA 3D0SA 4R52A 5J48A 1X8MA 1RL3A 1RUOA 4I3PA 4Q0VA 2K0GA 3H7JA 4F7ZA 5BXXA 1L3JA 4I0AA 1IPJA 4PIZA 4EWDA 4QM9A 2PA7A 3H7YA 2PAEA 4JTOA 2BEOA 2I45A 4H7LA 2PQQA 3DL3A 1DZRA 4KWJA 4WZCA 5BPXA 5FDBA 1I6XA 2IC1A 3B02A 3FJSA 4XETA 4XFIA 2UY8A 4OFGA 1O7FA 3QOPA 1ZRFA 1CAVA 2UYAA 1X7NA 1CAUB 4O9EA 1CAXB 2OPKA 2OZ6A 4UBHA 3SCHA 5FLIA 3ES4A 4XFAA 3EHKA 3MDPA 5FLHA 2PAMA 3USSA 4META 2VPVA 1TQ5A 2QCSB 3ELNA 1VR3A 3RDIA 4Z82A 4L2NA 4FAHA 2OA2A 1ZVFA 3WW1A 3DKWA 4I0BA 5LEKA 3KSCA 5BV6A 1ZX5A 3NW4A 3BB6A 2XKOA 4MGIE 4PIXA 5T3NA 3EO6A 3KGLA 3LAGA 5J7MA 4LTAA 1WLTA 2ZCWA 3MZHA 5C6CA 4XFHA 4MUVA 3FFQA 1DGRA 2D5HA 2B9UA 3EJKA 4IEYA 5I91A 1YFYA 4ORFA 2Q1ZB 1PMIA 4HZFA 3CJXA 1OD5A 3ES1A 1IPKA 3I54A 4NVPA 5FCCA 4KU7A 2PAKA 4KU8A 3PLQA 1YUDA 3U10A 3BALA 1EP0A 1ZZ9A 3IDCB 1X82A 5BUVA 1J58A 1FT9A 5EFUA 3LA3A 2PYTA 4UBGA 4MGYE 4R8HA 4KL1A 3NL1A 1O3SA 1OI6A 2GC0A 2CAVA 3E97A 3WW3A 4IEPA 4IERA 3N4MA 4IETA 2IXLA 4XF1A 3OTFA 3I7DA 3H1WA 4P9GA 4QMAA 2B5HA 4PJYA 5BY5A 4EWEA 5FPZA 4J1XA 4AXOA 4Q0QA 4HN1A 1RC6A 2MHFA 3IIAA 4HVOA 4DINB 1I5ZA 4HN0A 3MYXA 3H50A 3H3UA 2H6CA 2PHLA 2XLFA 5I8SA 2Z2SB 4Q0PA 3NVCA 2VQAA 1JUHA 3LA7A 4UXAA 3PVBB 4JV4A 1WGPA 2ATFA 4QGNA 1NE4A 4WBBA 4AQ2A 3SMHA 1CX4A 5JSOA 1VP6A 1LB2A 3KGZA 1RUNA 4LUMA 2Z69A 1UIKA 5KHIA 4QM8A 4MX3A 2Q0AA 3DV8A 3JZVA 1H1IA 3HT2A 4MH0E 3SHRA 2HJIA 1V70A 1YWKA 1NYWA 1ZZ7A 4K8FA 3NKTA 1PM7A 4YRDA 2XL9A 1O5LA 4I09A 2P17A 2WC2A 3M3IA 3OGJA 2ET1A 5K8SA 3I59B 5CVRA 2H0VA 2FMYA 3U11A 2D40A 2PFWA 3LOIA 4XEZA 4TLFA 2Y0OA 2Q4SA 3G7DA 4IEZA 1ZZBA 4LA2A 4MZUA 2XGXA 4IEUA 4HSJA 2DCTA 1Y3TA 3FX3A 5CU1A 5E16A 3ACLA 3H9AA 3TNPB 2XL7A 4I01A 3S0MA 4L11A 2XLAA 1J1LA 2K9ZA 2N7GA 3WW2A 2PHDA 1ZREA 2QJVA 2BNOA 1UW8A 2KXLA 1OFNA 1RGSA 1Q3EA 5AVPA 3E6CC 1J3PA 1O5UA 5I0RA 4KWLA 4XFBA 3OF1A 3KMHA 2EVXA 1FI2A 5FQ0A 1O3TA 2Q30A 3PNAA 1U12A 2V09A 4CYDA 4FAGA 4O9GA 3KCCA 3LA2A 1SQ4A 1VJ2A 3IWZA 2WFPA 2HKXA 2EAAA 1QWRA 5JSRA 4BHPA 1CAUA 1Q43A 5EZWA 4X6QB 1EPZA 4OLLA 4ZU5A 2QDRA 3SCFA 3M70A 4GULA 5LEJA 1OMIA 4MV2A 2GC2A 1YFUA 4XF0A 4ZU4A 5I8YA 4AQ6A 3VHRA 4YSFA 2ZKLA 2ET7A 5LRRA 1ZZ6A 2BNNA 5FLJA 4X6RB 3RZZA 2UY9A 1WA4A 5I0SA 4J1WA 1YHFA 3OD0A 2CAUA 1CAWA 4N9HA 1YLLA 2IXIA 4HVQA 2BYVE 2B8MA 3O14A 1ZNPA 4XF9A 2GH2A 4HLTA 4Z07A 5CADA 2E9QA 1O3RA 3C3VA 1QXRA 2QVSB 4I02A 4EV0A 4XF3A 2MNGA 2CV6A 4HMZA 3E6DA 4Q0UA 1EYBA 4MGKE 4XF4A 1YFXA 3H1MA 4LA3A 2OYZA 3ETQA 1O3QA 1X8EA 3BCWA 4JTNA 3OCPA 2EA7A 3CL1A 4BYYA 4QXKA 5I0UA 1UPIA 4RD7A 2BGCA 3RPQA 1RTVA 1XRUA 3EBRA 2GU9A 1ZRDA 3UKTA 3LWCA 4AVBA 4I2OA 1GQHA 3CLPA 4BH9A 1FXZA 1EY2A 3UKVA 3EQEA 1SFNA 4IEVA 2C0ZA 1QY4A 1LRHA 1UCXA 3RYKA 2ETEA 1UD1A 5I93A 4FT8A 2XHKA 2GC3A 4IEOA 3SCGA 4HVRA 4YYOA 5KHHA 2D93A 2UYBA 4PIYA 1ZRRA 1Q5OA 4AVAA 2IXCA 3DN7A 3E5XA 1YFWA 5E1RA 4LEJA 4EWAA 4YARA 3WW4A 3E5UA 5HI0A 5I8TA 5KHGA 3D82A 1CAXA 4LULA 3HQXA 2IXHA 3R6SA 4ZU7A 5FPXA 3HIFA 5FQ0B 1LR5A 3NJZA 1DZTA 3MPBA 4IESA 3CO2A 2GC1A 3D0JA 3S7EA 3SXWA 2XLGA 1H1MA 1ZRCA 3E6BA 4N9IA 5KBFA 2CGPA 2IXKA 4E2SA 3CEWA 4AVCA 1J3QA 4BIFA 3RYRA 3RNSA 5KHJA 4HBNA 2PTMA 2BNMA 4EROA 5J3UA 1XE7A 3HT1A 1NZCA 2F4PA 5JCTA 4Q0SA 1J59A 2O1QA 4YNIA 2QNKA 3FWEA 4B29A 1CAVB 3H3ZA 1CGPA 4HSLA 2XKPA 4IEQA 4XFFA 3H1YA 4QGLA 2OZJA 1CAWB 1G6NA 1NE6A 4D7SA 1DGWA 1ZZCA 2IXJA 3LZZA 4D7TA
chains in the Genus database with same CATH superfamily
1TE1B 3CRRA 5A3UA 3RZGA 1LKNA 1EV13 2IM9A 3J7NA 2CTVA 5CA3A 3RYCA 5E89A 4OI2A 3M7MX 2JIJA 4NHMA 1WWYA 2ZGRA 4FLXA 1H8TB 3FKSG 2EZPA 3LEKA 3SISA 2XONA 4O2AA 4MGZE 4BW9A 1RUJ1 1VBA2 4LF9O 4CC5A 4QX5A 5F8PA 1XHXA 1IKPA 5FAXA 2VU9A 5FY5A 3RW0A 1VB2A 1W9TA 3KV6A 1DQ2A 4JYBA 2W1UA 5JSPA 4IEWA 1V9U1 2A5ZA 2WINB 3UJOA 4B4RA 2ZGTA 3CXCU 2RVAA 5FZ9A 1X8MA 5A1AA 2ERFA 1OLME 4UW4A 1F31A 5FWJA 3CCRV 3RQ0A 5IYZB 2RDCA 1H8TC 2PAEA 4XJ9A 1W3VA 3OTOO 3ETGA 4WZCA 3HQRA 2VQUA 1R3JC 3WZ1A 3F5WC 4WBNA 5FK8A 4O9EA 1MMMA 2CGNA 5JXIA 4QPGC 3TEYA 1S0EA 3IKWA 1NR7A 2RS33 2ES3A 4NHKA 5IYZA 1AI5A 5A3MA 3OY8B 1EAH3 3VQXA 5HXMA 3WT3A 3BGAA 2E33A 4LBQD 3DGEA 3AFGA 1XNRB 5F2SA 4INDA 5BV6A 3VDCA 3NW4A 5A6ZA 4RS5C 4QDQA 4J7JA 5H5NA 3DTUB 2JKBA 1DU3D 4TV9B 2R0HA 5J7MA 1RMU2 5JMCA 2VO5A 4FPHA 5CB4B 3E22B 4FP2A 5DABA 4KI5M 2ZA9A 4CDUC 4ORFA 4L92A 1PK6B 2UXBO 2IVIB 4GJZA 4ASLA 5DAVA 3ZMNA 2Q69A 3CJHA 1BK0A 4MGYE 2VMFA 4KL1A 3OGCC 3AMQA 2HP8A 3TJTA 4CS4A 1H8TA 2JD4A 3WW3A 4O4IA 4Y26A 3LFMA 4MVTA 3ECQA 2JDNA 1RUE3 3B8NA 1OKOA 1KECA 3I7DA 3H1WA 4LH7A 4FM1A 1W90A 4PF1A 5FXWA 1L8DA 1QH7A 3R65A 1HRV3 4GX0A 1AL21 3POSA 4HVOA 2WQZC 3O7OA 3B8MA 3T1HO 2XLFA 2DURA 3N7MA 5F5QA 3JYCA 3ZYHA 1EUTA 5DUUA 5FP9A 3KT7A 3BHPA 3K58A 5KHIA 2PELA 3EB7A 1MS1A 4HPKB 3NKTA 1FJGO 2XL9A 4EZHA 1OBNA 4CP1A 3VZLA 4IEZA 1ND3B 1GZ9A 3WHTA 4GX5A 4NTWA 3RYFB 4I0WB 5JJEB 2OQ6A 1PL4A 1AVBA 4CXWA 1PO13 4W4LA 2N7GA 3FFZA 2JKXA 1AHSA 5BY1A 1ZLZA 2VZ3A 1L0LH 5E79Z 2QKSA 4BWOA 3SJCC 2QJ1A 3BUCA 3MO4A 4XFBA 4QB1A 5FQ0A 4NTXA 1QVFU 1EV12 2ZX1A 1AR4A 3ABUA 1DQ6A 4CYDA 1KKDA 1AYM1 4GZ9A 2XJSA 1NKDA 4YY3B 3THCA 2WZR3 3CS5A 4TUYB 1QWRA 3CPWU 2AW9A 1VBA3 4BQWA 4TSVA 2ITDC 1BQPA 1BQ0A 4DUZO 1HWYA 4LBMA 1D0HA 1TVKB 2WLLA 2GBOA 4JDMA 2B9ZA 1DF4A 5BNOB 3POJA 1ZBE2 5DUWA 5H9RA 3O9OA 1JVMA 3H42B 5LK7B 3D36A 5JVDB 1CAWA 5LWBA 5H9QA 1GN6A 4XF9A 4Q4X2 1W6PA 1HDKA 1B35A 3U75A 2X5IB 4XURA 4XF4A 3AK1A 3H1MA 4CCKA 3HKDA 5AFBA 1WNSA 4FFFA 3CL1A 4YW3A 4QXKA 1ULEA 2XVLA 3IZOA 2E76B 4FFIA 2HYXA 2WAAA 4RFT0 2P4KA 1QU7A 1IS6A 4BQXA 3OYWB 1DLBA 3VLBB 2ZR3A 2Q73A 1C5IA 2BOIA 2JDYA 4GQ7A 1VRBA 1KXGA 1ULFA 5B1AC 2QQOA 3S3XA 2EIJB 4YW6A 4GMP3 5F9TA 2G9ZA 4FXGB 1O8SA 3KZIZ 1GN2A 4N9IA 1ENRA 4YXWG 2Q8CA 1C8M2 2ZGUA 3T30A 4XDJA 3AP7A 3RNSA 1VQ8V 1P7BA 2QWPB 4X1YB 1Z0HA 2ZGSA 4CS3A 4ZHQA 4Q1PA 4NROA 3QCWA 3T1CA 2QNKA 2V72A 1CGPA 1K92A 1FPN2 3AMMA 1BCXA 4H33A 4P02B 5BZBA 3PVNA 5FIXA 4EB6B 1OC1A 4AI2A 3WUCA 3AYAA 5FK7A 1TME3 5FPAA 4LUKA 5LW9A 2VZQA 1X50A 1LOAA 1LCLA 5C3OA 4KFMA 2AC1A 4NIDA 3L74H 2FQPA 1NXD1 2YC2A 3NKGA 1YJNV 4QGMA 2YC0A 4JZRA 3WD5A 4L0PA 3ZN5A 4KQ7A 1AL22 1ACCA 5E8AA 2FCVA 2UUAO 3LEMA 4ZI7B 2WT0A 1LUWA 4OX9O 2KSDA 3VBOC 1W8UA 1THZA 5CBFA 4YVWC 3AK0A 5JOWA 5KC5A 1HKDA 1V9PA 4E4ZA 1IPSA 5FL7G 3B01A 2Q8OA 1XMQO 3CCLV 1XQNA 2GP5A 4X64B 2IJHA 3ROUA 1FYJA 4NXNB 2RS53 2D97A 4YW5A 3ZFFB 1W6NB 5J37A 4Y5Z0 4WCEV 2Q7HA 2XR4A 3WQ0A 4HETA 4JYCA 2Z42A 1IPJA 1UU4A 2YV8A 5J2UA 1OLQA 5IFPA 1LULA 3H7YA 1KS5A 3WF2A 1TUEB 2PQQA 3ZXLA 5JZGB 3BTAA 3LE0A 2Q8DA 2XPJA 4CEYB 3A0NA 1N34O 1JCHA 4XJWA 1Y74B 1S4CA 1UXZA 1EN5A 3OW2U 3ABKC 1BZKA 4K3AA 4U2AA 2HEYF 4QX0A 3LPFA 4BWAA 1XNAA 1PO23 2WNUA 5A70A 5LEKA 1URFA 3SPGA 1RUG1 2ZEWA 5LGNA 5A3TA 5IT6A 1YHQV 3GALA 3ZXEA 3U14A 3AKTA 1Q6HA 1QU0A 3BRCA 3ZEDA 4LTAA 4AGRA 3HKCB 4MUVA 3FFQA 1SLBA 4COWA 2JE9A 2AHZA 4W6WA 1YFYA 2EIKC 1BMFG 1YQCA 4RUFA 5JIUA 1N36B 2J7MA 4KU8A 1X82A 2AHYA 1A8MA 4GKKO 1JS9A 5A6YA 3IJ4A 3ZHRA 1CZTA 2WSUA 4B3TB 2DUPA 1O4YA 2Q8EA 4PELA 2VNVA 4TT3G 2BSKA 4XUOA 1Q7YW 1IHMA 3ZR6A 4CU7A 1YC61 1PMJX 5EYXA 3T4DA 1SFPA 5LY2A 3G6EV 2E6VA 2PHLA 4JKLA 4FTEA 3MI8A 3NVCA 2WKKA 4X62B 4O2BA 5K9YA 1G8WA 2VGDA 3IPVA 2A6ZA 4DW0A 3I49A 1ZUQA 3CCUV 2V5YA 3D6EA 4D6RA 1YZBA 4NPLA 3BTYA 3GZEA 1C8M3 4GAZA 5LBFA 1GSLA 1DGLA 3G71V 1SHWB 4YM3A 1UU6A 4L8JA 2Q4SA 3ASOC 1COV3 2E63A 1HB2A 2DCTA 5CU1A 3ZXGA 2WLNA 2GTSA 3HPLC 5BNOA 3ZMOA 2M7WA 4L11A 2XH6A 5H2FZ 2PHDA 2B42B 2XQRA 1PM9A 4DR7B 2VBPA 4E4HA 1TG7A 1R081 4FLTA 1FAFA 3I3MA 3GM8A 1RXFA 1R3IC 3O65A 3IWZA 3K3NA 2C1FA 2XDVA 3OR7C 2OUHA 2ZR2A 1ODNA 4WFEA 1W28A 1M93A 4XJAA 4LE3A 1RUE1 2JG8A 4NPMA 1VIWB 5CG8A 2HWF2 4N90A 4ZKTB 1MPXA 4CUBA 5C8YB 4I50A 1ZRIA 1BHBA 2VZUA 3LFIA 1Y9GA 3DCQA 4LBQA 4IE7A 4HMZA 4WM7B 1IG0A 1UY4A 2Y26A 3FUOA 2YMZA 4ABMA 1JYTA 4N21A 3VB9A 2VR4A 5JI7A 4KWUA 1HXS3 5JH7A 3IDEA 1XRUA 1OVPA 1S1AA 1MSWD 5GZFA 1JUIA 2P06A 3JSLA 2ZMNA 4QB6A 5BXZA 2ZEZA 1G7YA 1H9PA 1S76D 2QQJA 4K1YA 4UUJC 5FY1A 3O1VA 1E1QG 3LCPA 2IW5A 4BU2A 2EINC 5GJ6A 3WQBA 2XAFA 4DYLA 5FPXA 3KCYA 1VMJA 3MPBA 1R092 2V4AA 4RHV3 2W52A 4QT6A 4LR4A 3KT4A 1H1MA 3POGA 4LF8B 1W2NA 2VUAA 1ULDA 4O65A 3N9OA 1PMHX 2XASA 2WSVA 1J5EB 4BQ1A 4LO8A 1VMGA 5C5TA 4NPRA 4HOOA 3W21A 4MS2A 1W8HA 3M1HA 3CCVV 1CJDA 1WPBA 1V6OA 2VW1A 1G6NA 4FOYA 4S2HA 1XL4A 3AKSA 1KBHA 4OGQB 1RM1B 1JJOA 2ZX2A 1HIXA 2FDHA 4ZONA 1EAH2 4X65B 2NYYA 3E5QA 3R66A 1SETA 2YXSA 2IFWA 1J1TA 4TZDA 1GMGA 3E8GA 3FX7A 1WP7A 4XPVA 4TWTA 1W2AX 3T4HB 2Y0IA 3I3DA 1JYVA 2IJIA 3CDZB 2DWDC 3O1UA 5CA1B 4CCLA 4XQDA 3S7IA 2AACA 1W0KG 1WLWA 3DPRA 1E5HA 1VQ4V 1G9DA 3AG3B 5BNNC 1PNKA 5C7GA 3V0BA 2BOCC 2DVBA 2NM1A 1HV0A 4QKDA 3GWOA 1HNZB 2WLPA 5A32B 5BXXA 1GOHA 4B7EA 3H01A 3MGUA 4B3RB 2YPDA 3AMPA 1GWLA 4LF4O 1N1YA 4XETA 3TN92 4MTOA 2F1MA 3R05A 3NAPB 2UYAA 1M4UA 4FTBA 1LENA 1S0DA 1H4GA 1HJFA 4YFZA 3J4UH 3ES4A 4DOUA 4D7YA 4DR2O 4EN8B 1R73A 3WDVA 1N0NA 3J8F2 1WW4A 2I07B 2ZABA 5JOXA 3AP9A 3VQYA 1KUQA 3WW1A 2XKOA 3POYA 3VBHB 4MGIE 1K34A 1CESA 2BZDA 3OGIB 2WWJA 4TOIA 3WFVA 2K2SA 5I91A 2QQPA 4CCOA 3DYOA 1YI9A 3I54A 5FCCA 1AJPA 4NN0A 1RUC1 1W0PA 1S0VA 2OT7A 4GH4A 3SKVA 4CEYA 2HBUA 2WZEA 1OI6A 1NR1A 3J9SA 2EULA 1HNWB 3LDKA 5ACA3 1UO9A 1S3JA 3WVJA 5BNNA 1DGRN 2JS5A 4AXOA 2AH2A 1QNWA 1H30A 5A3LA 2UUCB 2VVFA 1BHAA 1HP8A 2WL1A 3IAQA 3H8RA 3K48A 2WWWA 3VDDC 3HAGA 4QGNA 5FYIA 1VP6A 3KGZA 1RUNA 4FPPA 4LORA 1GK9A 5FKBA 5FYMA 1ZL8B 4LF4B 3AYEA 4AQYB 1KQSU 5LMNO 5IFTA 5H9SA 2MEV2 1E5RA 1NYWA 1NKGA 2C9KA 5FYUA 4JHTA 2WS92 4OMDA 3T1YO 2L9LA 1AYM2 1W2BU 1WP8A 3ACGA 2DVGA 1LEMA 4IE5A 1XNCA 1YTFD 1S5LZ 4X8NA 1RUD3 5LK5A 4GKYA 1POV0 3K2OA 1UYPA 1OH4A 3ME2A 1YRZA 3H0OA 4BB3A 5CKMA 4JI6B 2W1SA 1RGSA 3FYIB 3P5BA 1K73W 1IDSA 1UYZA 4KWLA 1CONA 5IJ9B 1OURA 4P9WA 3BKZA 3W5MA 1RPRA 4D3WA 2W0XA 4U3JB 3ZN1A 4NXMO 2CNAA 4BHPA 1SQGA 4GKJB 1OCRB 4W4ZA 3MIGA 5GTHZ 2VZSA 4AHZA 1OMIA 4ZIBA 3SQOA 1GQPA 3JD72 2ZKLA 4RO2A 1UMIA 3VD3A 5I0SA 2GTAA 5JMOA 2DTYA 4A7YA 4HVQA 1QQCA 4UW5A 5CADA 3ETPA 2QVSB 3Q4HB 3MHHC 4HPKA 4IV1B 5DQ0A 4DZGA 3KVAA 4LITA 4JTAB 3UT5B 1X8EA 3E89A 3BCWA 4CCCA 3PTRB 5DAWA 3A8TA 1R3LC 2J1VA 2OXBA 1VBC2 2A3XA 1XILA 3ON7A 4AEDB 2Q7GA 3ZXAC 3WLUA 1AL23 2ETEA 4LO4B 3WB0A 5FBJA 4NIIA 4RS5A 1M5IA 1W6OA 1NTMH 5FQ0B 3RBZA 4JI1O 4IESA 5A7PA 1BVP1 4BCUA 4JI5O 2R32A 2WA3A 3VBRA 4E2SA 3CEWA 1OPOA 2M6YA 1EFRG 2XAJA 5KHJA 5L7OC 1I9RA 4M4PA 4NHYA 1XE7A 4TTGA 4YWAA 1OZ0A 1U5ZA 2JIGA 2A6YA 3UGGA 5LMUO 1CAVB 4A6OA 3T0DA 2WO7A 5DDJ3 4PLOA 2DF7A 3DPRC 4XDOA 4GKJO 4MXVA 4FO9A 4N43B 2F4LA 4LBLA 2A06H 1JYXA 3GHNA 4NXNO 5F37A 4LWSA 3K4AA 1ND3C 5JR7B 1YF2A 2OIEA 4P9YA 4TXWA 4QXBA 5ACA2 2YFZA 1VARA 4JQTA 3WUDA 1H2KA 3WNLA 2J1RA 4IYHA 3RYHA 4N43A 2UWAA 4PI2A 2JG9C 4BMEA 4COYA 4AEMA 3RYPA 1M56C 4LWSB 3MAQA 4PA7A 5KHKA 3JD0A 1LU1A 3MICA 5DN2A 3NNJA 3PVOA 3IFXA 3ILFA 2P37A 4OXSA 1DQ5A 3D3IA 3AP5A 4J41A 5B66Z 2H6BA 5LCWL 5FZBA 2VMIA 4R50A 1XNQB 1Y9QA 1SQPH 2XJTA 1FV2A 3VD9A 4A7KA 1V9U3 1PZ7A 3F95A 4NR1A 4WM8A 1Q86W 1W99A 5CFDA 5A3NA 1JYWA 4GIQA 1QVGU 5BMVA 4LQRA 4JI3B 4GZRB 3ZOIA 2R9RB 4CDXB 3T2TA 5BPXA 4DEVA 1XNBA 4LFBO 1COWG 3APBA 2RNBA 2XB6C 3FLPA 3HN1A 2BOBC 3PHMA 4JGSA 3AB0A 3KQRA 2GHYA 4GUNA 4H7MA 1QJY1 3F2ZA 1JPXA 4UF0B 3GVMA 2PAMA 2WYFA 2A9HA 3JUUA 1VIBA 4FFHA 4I0BA 5JQGB 2X6CA 1WCQA 3WDUA 2WDBA 1YQ8A 4A41A 4DQAA 1F23A 3LDRA 4ATFA 4DIQA 1AVMA 2CH7A 3CJXA 1EZVH 4QPIA 3WP6A 1NT0A 4I30A 3WNMA 2XQXA 4ZXEA 2UXCB 4ES9A 1TMF3 5AG2A 2FDGA 1B6QA 4GMP1 2CAVA 5C9AC 3VL8A 1OQ1A 2PXJA 4IT5A 4DXRA 5ITZA 3U37A 1FXKC 4K8ZA 3P3PA 4Q0QA 2IU3A 3B4SA 4F4LA 4CXXA 5FJHA 3QD6A 3U1XA 3ZXDA 1N1SA 2UU8A 4ZOLA 4WM8C 1B06A 5A33A 1NE4A 3K79A 1PZ9A 4CUAA 3RI8A 1M1KW 5DUVA 2W08A 3GZTB 5AC92 1YXWA 2HVKC 2K1EA 3SH5A 2WNUB 3ETEA 2CSGA 2Y8KA 1ZZ7A 2LW8A 2E32A 3NQHA 3ASOB 4KUMA 3CRAA 2FDIA 3I59B 4DR4B 1WBLA 1YQ5A 2Q4PA 1DLCA 3I2DA 1HXS2 1X33A 4L8QA 4Q1RA 4CBCA 2JDUA 1AX1A 4PQ9A 3SPIA 2SLIA 1AR71 3A0RA 2QE7G 1K5QA 4I0XA 1R091 1WJZA 4UFIA 1E79G 1W6QB 1JA8A 1AJQA 3OR6C 4CDUB 2W87A 3INAA 5FPUA 2YIAA 5FZOB 5K1XA 4DY5A 2WN2A 3BOPA 3AEIA 4CDXC 3ZX7A 1XDCA 3SEPA 3DXUA 3NJVA 1JW6A 1RITA 1Z2GA 4IGQA 4ZU4A 2VAUA 5B3SB 1IVSA 3AVRA 1ND2C 4M0NA 2CWMA 4XHXA 4HAMA 1QIQA 1ZNPA 3DXRB 1KYOF 3ITQA 3OEEG 1FKAO 3JALB 2UUCO 3OEBA 3WG2A 2YIDA 1OT5A 1U5XA 1V54B 4KHPB 4H44B 3S57A 3VBRB 4Q6GA 1S0JA 2VTFA 1GWMA 3AL5A 5FLXN 3T0BA 3THTA 1KEXA 1ULPA 3P6BA 1QHTA 2CK3G 2XOMA 3VZJA 2ZX4A 1GZWA 2WNOA 5L36A 2YFUA 2QUOA 4MTFA 3BAAA 1W3XA 2WNUC 5CIRA 1NQJA 5KWRA 1Q5OA 1GZTA 1JZ5A 4LMFA 3E5XA 2DVDA 1K4CC 5GZDA 1I94B 3MFAA 4KG8A 1R6KA 4CEWC 4LNUB 1CN1A 2PHRA 2Y6GA 1AR1B 3ZYIB 3RS6A 1NAEA 3K08A 1SESA 5JCOC 4BOWA 5HFMA 1REEA 3CX5F 5DXDA 3SH3A 4QDRA 4XZUG 2ZDIA 4YVSC 5SV5A 4HBNA 4RN5A 3CXHF 4V2VA 4DEQA 1J59A 3RYIB 3BA8A 4B29A 4HSLA 3UETA 2ZXQA 4BMBA 4DK1A 1UY2A 1BE3H 4XDKA 1FV3A 2W95A 2YICA 4D7SA 4RHV2 1R093 4OCTA 3UKNA 3RT3C 2VQFO 3AXEA 3EMRA 4J7ZA 2X29A 1O4TA 4X8AA 2NR5A 1Y9MA 3U0ZA 4LO6B 3RMXA 5A3PA 4BLIA 3PJQA 3BPZA 5H9PA 3ZYGA 4BAYA 2P6JA 2X5IC 4A2UA 4X88A 3RZJA 3FHIB 3TEWA 4LF6B 4AFCA 2CUGA 4PD4F 1OOPA 4Y1VA 1Q8OA 2UUBB 4ZY9A 2D6NA 4IEXA 2Q5TA 5T54A 2HWE2 2DWRA 2KKWA 1BBT2 2OCHA 5LRSA 2CY6A 4ASMB 1M57C 3FB6C 4HNAA 1QJU1 2QWNB 1DGSA 4EN0A 4JRAA 3STLC 5J98B 2I2SA 2A70A 5FOBB 1C1FA 1P84F 2ORXA 1ONAA 1GOFA 4Q0VA 4FQ4A 1W0OA 4P2ZA 3HN3A 5JJJB 2F23A 1CZVA 3RZMA 4CP2A 4X20A 2XJQA 2BW8A 5FP4A 3PJSK 4GH4C 3U4XA 5FDBA 3FJSA 2UY8A 1H2SB 4GJYA 4TSFG 4Y4RA 4LCUC 5F3EA 2OKXA 2Y60A 2YGMA 1NCQB 4W8JA 1H0BA 4DV1B 3CC7V 3ELNA 2PGGA 1AI4A 4L2NA 4XQ4A 5E88A 4XILA 1I7FA 3GJBA 2EIGA 3KGLA 2WYSA 4PDMA 5L3EA 4RQPA 2GMEA 4E4EA 4S2DA 4BQ2A 4XFHA 2RG4A 5L9VA 4MYEA 4DV0O 1RUG2 4LFCO 5FZFA 1VQOV 4V2WA 3KG2A 3NNMA 1OA3A 5IYBO 5DECA 4UOJA 2NNUA 2JWPA 4HG6B 2C24A 2XHNA 5KAFZ 2WLIA 3APQA 3S3WA 3CD6V 1WW5A 2DVFA 2E75B 4IERA 2PHTA 3TYJA 2IXLA 4DXSA 3OTFA 5FPLA 5FNVA 5GLTA 3CZJA 3EXUA 4F3JA 2J1UA 1AYN2 4DUZB 4UCRA 4DR3O 1UOFA 4BIUA 1RM1C 2LO1A 5LXTB 1OCRC 5DAXA 1MS5A 3LA7A 3AX4A 4WBBA 3POEA 1LB2A 1XBLA 2Q0OC 1K7DA 4MX3A 1DIWA 3RSJA 3UKMA 1PM7A 1UF2C 2ZPXA 5CVRA 1PHMA 5A32A 2JDIG 4EN6B 2WT2A 2WNVA 4AI0A 5G04L 3WDYA 1K97A 4DUYB 2CWSA 5E16A 2F66C 3WQ7A 1H9WA 2FHRA 1EZJA 4JI1B 2XL7A 3AG3C 3ZYPA 4QPWA 1JMKC 4X1KA 1HLCA 4YZ3A 5IATA 2B9VA 2E7TA 2QSAA 2DU1A 4A44A 3M3EA 5FPOA 1AXZA 3QO5A 2D3RA 2ZBJA 3VBSC 1WPXA 2VOKA 2W68A 2WFF3 3PNAA 1U12A 2BP6A 1RUD1 2WFPA 1V6JA 5BNOC 5FKCA 4UB8Z 2FTKA 1LJ7A 4YM0A 1XNTA 4OLLA 2QDRA 5FZ4A 3SH4A 5C93A 3CCMV 3ZJZA 4ZZ5A 1VF7A 1DHKB 1NCRB 2VC9A 5F2VO 2P67A 3RZZA 3MIBA 5IJ0A 3UT5A 4N9HA 1H8HG 4MVUA 3G6BA 2B8MA 3J7AU 1X9PA 1MVEA 1TME1 3BYWA 5FMBA 1RMU3 4FLZA 5IUQA 1W0NA 4LNUA 3PURA 2CV6A 4WVVA 4Q0UA 2QM7A 2WLMA 3KCXA 1JN2P 4O4HA 3OJBA 5F6KA 4IE0A 4XTMA 4Y20B 4NXMB 1ND2A 1Q6IA 3ML0A 4RD7A 1RUI1 1W8WA 1ZWIC 3J8F1 4PLNA 5FPBA 3BVOA 5ACA1 3R4SA 1DYOA 4FMTA 1HN0A 2R072 5IJ9A 1JZ4A 4K20A 2VZOA 3CIHA 2P3KA 4LULA 3ALQA 1V6IA 4ZU7A 2JG9A 1CZSA 3C3SA 1I3HA 2IU0A 3OUJA 1GN4A 3C7GA 1ZA4A 2YS8A 5KBFA 4ASUG 2FB5A 3CJHB 4N23A 4BIFA 4P14A 5J2UB 1QOTA 1VBC3 4BZ4A 3O1MA 4UCOA 1RJ8A 2HYKA 3T2QA 4CCNA 1OCCC 3ORJA 4BPZA 1SLTA 5JZGA 3BIEA 2NP0A 5KLVH 3VBUB 1G8MA 1UJWB 2ZACA 3HNBM 1JYIA 5TISZ 2HWF3 4DR1B 4NMIA 4QQPA 1VLNA 4CDWC 1YI2V 2AYHA 1Y43B 4XJUA 2ZGNA 2C6SA 3LDDA 4I55A 1EBOA 2UXDO 3MIDA 5ABJB 2V4VA 2DDUA 1GNZA 1IS3A 5KC6A 3RYIA 1ZSPA 1IBLO 4GCZA 3SJBC 4GD4A 1NTZH 5D8AC 2EXJA 5FPRA 5EQUA 1SKVA 2R16A 1IZ3A 1LOEA 4QU2A 2UUAB 2VMGA 1YQ6A 5C8WA 1OOPC 2JEUA 3VZNA 1S72V 2W39A 2EALA 4AILC 1K5MA 2GNBA 2G9GA 4E4DX 4EWDA 1G6UA 4KNCA 1SQQH 2PA7A 3NRUA 1LOGA 4YJ2B 2I45A 3MUZ1 1ZBA3 3F7VC 1AR92 3T3YA 1US2A 4LR3A 1G9BA 3HPNA 1CAUB 2OZ6A 3CSXA 2JDHA 5JUVA 4FSJA 1SQFA 3I2IA 1PKXA 5LMUB 3WOGA 1QF3A 4AI3A 2EIMB 4B4PA 5JH7B 1HXS1 1W0JG 1RHI3 2WO3A 1ULGA 3KSCA 1JYNA 5T5LA 5BR8O 3W7XA 3NMBA 3EYPA 3E22A 5DAQA 4X1KB 3AC0A 4PIXA 2UWBA 5LXTA 3F5TA 2YUEA 4LOSA 1PMIA 1V6LA 2F4VB 1OD5A 1IPKA 1QGLA 2XJPA 1D5NA 4B3SO 2PHFA 1NA1B 1OJHA 1T6BX 3BALA 4RHV1 5EFUA 5FO8B 2G38A 1FATA 3L70H 3BOWA 4FI9A 3KV5A 1PZ8A 1JOYA 1VEWA 5BY5A 3AL6A 2PHWA 5JJNB 5JPNB 2VUJA 1JBCA 1WA8B 3OAAG 2ZZQA 2OS2A 3OE7G 1X36A 1QJY3 1OCZB 1QEXA 2LP7A 5JSOA 2DYRB 2A0LA 1UIKA 4QM8A 2E5LB 2KR2A 4K3UA 1H8EG 4QX1A 5C3RA 1M9NA 5GW7A 3FBYA 2E51A 5F3CA 5J9PC 2WIIB 4B3SB 3I2FA 4I09A 4I7ZB 2X7RB 4DV4O 1VMHA 2PFWA 2GNTA 1H8VA 3SYPA 4M3CE 1ULCA 1DG6A 4IEUA 3GZUC 2YUAA 1R1ZA 2D44A 4BIZA 2YROA 5GZEA 4P08A 1FPN1 3GDBA 5F7UA 2ZGOA 5F3GA 3WW2A 1J84A 2EXHA 4UB6Z 1ZREA 1LR1A 4UFMA 2VZ1A 3RZLA 4N53B 3FC0A 4WFFA 2Z4FA 4KHPO 2FZ1A 4DR6B 4NYKA 3FB7C 2XUEA 3KQ4B 2VUCA 1IS4A 4LKSA 3LA2A 3WF1A 2W9XA 3MW2A 4MTXA 4Z1VA 5IT9N 1E5IA 3POBA 1AB3A 4D6SA 3VD5A 2BSKB 1B35C 1RUJ3 4DV5O 2JECA 2DVAA 4M01A 3NV4A 4ITCA 4ZOLB 5FBZA 3QVNA 3OD0A 2JB4A 3WNXA 3ILRA 2BYVE 1XHZA 1KJRA 4RSUA 4Y3OA 5L73A 4EV0A 1KDMA 3LDBA 3CHXA 3PIJA 1VBC1 1WD3A 4ICGA 3TB0A 1U5IA 4LBOA 1GP5A 2JG8C 4P00B 3GF6A 4JTNA 1W05A 3RPQA 2RHPA 2P6HA 3UKTA 4I2OA 1SF9A 5HXVA 3I2GA 1EY2A 1SFNA 2LGQA 4XABA 4QDSA 4AFAA 2UXCO 3A0KA 3VL9A 2EF6A 2OWOA 4QHOA 1NVPD 3DN7A 1YFWA 3D82A 1XYOA 4R6ZA 4DV1O 2Q1MA 1BBT3 2EZOA 1KMIZ 3N9MA 2XJVA 1UPGA 1YJWV 2YGLA 2VWJA 5IJ0B 2VXRA 2KM2A 3SXWA 1S0GA 2ZGLA 4Y4YA 1D2QA 3JCUZ 3JD3A 5L9RA 1LHNA 5T5JA 5J2TB 2LFSA 1NZCA 1CPNA 4RWUA 1JH5A 2WSSG 4XJZA 1VQ9V 4J6GA 4A5UB 5D2AA 1RXGA 4AL9A 4FVMA 1K42A 3T2MA 3EVKA 1XU2A 5EYYA 1NE6A 4B1MA 2JICA 4D69A 1BQZA 1KITA 2Y33A 1CPYA 2ADPA 3AK2A 3OY8A 4HL0A 2D5FA 1JXNA 4O61A 4K9SA 1JYCA 1CEZA 1N32B 4NOTA 3T4ZA 1C8M1 3IMMA 1ZZ8A 4M3CB 1N33B 1US6A 1W6MB 4UVAA 3K06A 3A0HZ 1QOOA 3QO8A 4Q8LA 3TETA 2Y6JA 3T0AA 4FIPC 1NJIW 3CZUA 2AENA 1I5PA 4Y5SA 2RDRA 1H2MA 2JDAA 4M3CA 4HK8A 1VAMA 5D1IA 1AR73 3PUSA 2J1EA 1GQGA 4N43C 3JAKA 5LOVA 4LF9B 1Q6UA 4Y24A 1VBD3 2PLV3 1UMHA 3J7LA 1R083 3VHPA 3WP3A 1QKQA 2W91A 3D36C 2QKCA 5B1BC 5ISLA 5L3CA 4QM9A 3FYEB 4JTOA 4QPJA 5C71A 4O4HB 4XFIA 5T5OA 4ZKIA 5LYJB 4QQHA 4UXNA 3X2QB 4BA6A 1WCDJ 1PD3A 4JZGA 1DBNA 4PDRA 1CAXB 1AX0A 5HCAA 3CJIB 2BGPA 4Y1ZA 2ZGPA 3ZRSA 5GLVA 4UFLA 3K4ZA 3ABMC 4GALA 5D8AB 1GM8A 4JV5B 3W7SA 2FDFA 1O9GA 3VZKA 2YYOA 3SPCA 1P49A 5T3NA 1UOJA 3HKBA 1Q82W 2QZ2A 5GLUA 4GA9A 1NH2B 4DUYO 3RYFA 3WNPA 3RZHA 3E8FA 3WINE 4HZFA 2Y6LA 3GGLA 3B00A 4HYOA 2Y64A 3AZZA 4FZ1A 1S2EA 3RG0A 3S30A 2XAGA 3IDCB 2UUBO 1YYNA 4LHSA 1FT9A 1H6XA 2R063 2GC0A 5HV4A 4K6BA 3VHNA 2WFF2 2Z79A 3PDQA 1RUI3 2DOSA 1REFA 5C5UA 1F4MA 1P8JA 4QQ2A 1UY0A 2RS51 3WB1A 2OPWA 2G1MA 3RVZA 3VBRC 5IK8A 3K3WA 4DV7B 2ARAA 2H6CA 3Q9OA 4JX0A 2ZCEA 1DQ1A 2RS31 4Q4X1 3JASB 1SC5B 2H3OA 4GWNA 1JU4A 4XUTA 4H37A 3RWKX 1GZWB 2YBKA 1IBMB 3WNKA 1WKYA 2VBDA 1W6PB 4WVWA 2QKAA 5B1BB 5A33B 2V5DA 4FFKA 1YWKA 3E8BA 2X05A 1R3KC 3FAVA 4AOCA 1XBFA 3WB2A 2AUYA 2UXXA 1F8VA 4MW3A 4URTA 3L9DA 2W47A 4NIAA 3NNLA 1K5SA 2PHUA 2XGXA 1JJ2U 3IM0A 4PDLA 1UY3A 1QJX1 5C3PA 1XMQB 5FYTA 4IGPA 3I55V 3SITA 3WU2Z 4QIWF 3L9JT 4MGTA 1OFNA 2R073 4XW3A 4OQ8A 4EJRA 2NLRA 1VQMV 2QM4A 5CG9A 2EVXA 4UCUA 1OD3A 5EIBC 5CA1A 2R1BA 5AC91 2W3JA 3OG2A 4O9GA 3ZMVA 2EINB 3GB7C 2EAAA 3GHMA 3HKBB 3MD0A 2G9FA 1EPZA 4B7KA 4FZ0A 5FZ6A 2VOVA 2YB7A 5EK0A 5L7OB 1JZ6A 2GUZB 2GC2A 1Y76A 2HR3A 4CUGA 3RI9A 4IHJA 4R9AA 1CVNA 3J81N 2VW2A 3D8CA 3TRSB 3AG4B 3J80N 4EB6A 1FXKA 2QTOA 3N9QA 2ZT9B 4J9YB 3I2HA 4Q26A 2QGNA 2MNGA 2YZ4A 5A3WA 3ETQA 4XIOA 3TAYA 2WWSA 2ZGKA 4BYYA 5FZIA 3EFFK 5J2TA 1KGYA 5CBHA 2EILC 3BEHA 3ZN0A 5APAA 3LD8A 1H38A 4NWVA 3LB9A 4D94A 1UD1A 3K46A 2XJRA 1OUSA 4XHBA 1NZIA 3M3OA 4IL6Z 1C1LA 5KAIZ 3VN4A 3MIFA 5IY5B 2DMXA 2RS11 1MSDA 4CH5A 3NJZA 3CO2A 4LE4A 3D0JA 3OGSA 4DUWA 5ITZB 2UXDB 2ZNJA 3VKLA 2Y0PA 1CD3G 5AFEA 3AMHA 1J3QA 1V54C 2YY1A 3VQVA 2WNVB 2BNMA 3HT1A 3T1LA 4A7ZA 3I5DA 4DV3B 3OFNG 4CE8A 3T08A 5EP9A 4W4KA 4AF9A 3H1LH 1WLEA 4QGLA 3ABLB 4Q8KA 3KD4A 1ASJ2 2DFCA 1DK1A 3W7WA 1A3KA 2MK3A 1Y74A 1UQXA 4Q29A 3OM3B 3I97A 1QQP2 3RRDA 4FFBA 3C90A 4DUVA 1RUI2 5F1RA 1K9MW 4FM0A 4MO3M 5CFCA 2X6AA 3N2GA 1C28A 3TK1A 4BQ3A 1XE8A 1QLEC 2L35A 3DEMA 4OQ9A 3OUSA 4AEDA 2O8QA 1N4CA 5K1PA 4PBOA 2AEZA 2VNOA 1U5YA 4CU9A 1U0AA 3WP4A 1J3RA 4MTGA 4WM7A 3VDAA 5IVFA 3CJIA 3P1IA 1YXBA 2ZHNA 3OOXA 3QBQA 1WBFA 1AR81 5JAXA 4XFCA 2YI8A 3D0SA 1VQ6V 5J48A 2RV9A 4TV9A 4IUGA 3BTZA 2ZEXA 4N7IA 3KS7A 5LHGA 3NNGA 3N9PA 1RUF3 1COV1 1WAZA 1UXXX 5JOZA 3ABTA 2X09A 4A3XA 2A3YA 4R4XA 4BISA 4CDQB 2XUMA 3WP5A 3L2YA 4G28B 2IC1A 3M2MA 3B02A 4HKOA 1XMOO 2RDNA 1WMXA 5DG1A 4MXWB 4BLJA 3ZMZA 3SJQC 5A7WA 2HG5C 1SA0B 3M3CA 1P7GA 1S55A 2JE7A 3U07A 1K8AW 2ILMA 1M57B 3V64A 3MDPA 3X29B 1YDXA 4TQDA 2LROA 1VR3A 1V00A 4MXWA 2XXZA 1ZVFA 5A9GA 1SERA 1ZX5A 3WNNA 1WW6A 1CWPA 4RAIA 5LGUA 4NKGB 1XNQO 1TMF1 4FTSA 3GZAA 2W6JG 2D98A 4URAA 3CYOA 4WVMB 4OPHA 2IWGB 2LALA 2B9UA 3UM7A 4J10A 1W8ZA 1O6UA 3LEIA 2DYSC 4P9PA 2WPDG 3AZXA 5IVEA 4LF7B 4BM8A 4R8HA 1DP0A 4QHZA 1W6OB 1MEC3 1IGOA 5BNNB 2A7AA 5HCFA 4RS5B 4XDPA 2ZKNA 1C5HA 2UU9B 4Q4V3 2B5HA 4PJYA 3THPA 1A34A 4MADA 4YW2A 3TBDA 4I9WA 2MHFA 4RFRB 2WUHA 2FL4A 3ABLC 1LECA 1TMF2 3J7HA 1LOFA 1PK6C 1QOSA 1UWWA 3H1JH 3PUAA 3HKEB 5A1LA 2QTSA 4I3GA 4EFEA 5SV8A 5B1NA 1LODA 1RP3B 3JSNA 1VMFA 3LIGA 2YXLA 1O5LA 3M3IA 2ET1A 4MGQA 3AG7A 1KU9A 2E3CA 2D40A 3IAPA 5FY4A 2G4IA 4LA2A 3PMSA 1SQBH 1KDKA 3AJZA 3BY6A 1NLRA 2W94A 2ZMKA 3S0MA 3ZRXA 3RMYA 1ASJ1 2QJVA 4JYAB 4G3YC 2YG0A 1FYUA 1N8RW 5GLWA 1STMA 1L0NH 4FFGA 3AP6A 3OF1A 1YCIA 3B40A 2QQMA 2QQIA 1VBE1 1GUIA 3TEZA 1VP7A 3OMIB 3O1OA 4B3MO 4UW6A 4AHWA 3WG7C 3L75H 4R8CA 2VBBA 4QX7A 5LP6A 3DECA 3WDXA 1SLIA 1DFQA 1W8NA 4Z2AA 2LS6A 4FPJA 2ET7A 5LRRA 2W2IA 2AZ5A 2LW1A 2VRZA 4LO5B 4LKDA 5KA5A 4HLTA 3SC7X 2NN4A 5GTIZ 3B9CA 3C3VA 2ZDIC 4YVSA 3DPRB 2JG8B 4IXLA 3K5MA 3N2KB 3JARB 2GMMA 3HR9A 1I94O 2OYZA 5IK5A 4WV8A 1POQA 1BS3A 1RUJ2 1PO21 1RPOA 3MFCA 2HKOA 1VQNV 2CAZC 3VBSA 1OA2A 4ASKA 1SBEA 3EQEA 2Z3YA 2WLHA 4F83A 4ZHNA 4AAPA 5IWFA 1IQDC 1TGOA 3ZFEB 3DYMA 3CWBH 1RVF2 4K21A 1PM4A 1DZTA 2A71A 3ZLIA 4JAUA 4Y22A 2X5IA 5LY1A 3Q8FA 1N33O 3RWRD 4Y33A 1SCSA 1VBD2 3AZVA 3LIHA 3V0BB 3ZFFC 4LF5B 1VBB2 4JKKA 4DR3B 3NJXA 2JGDB 2QFEA 4TV8B 5JCTA 4Q0SA 3WF4A 2QQKA 1L7LA 5FR3A 5KUKA 1LTEA 1RUC3 3K9AA 4FOQA 2OZJA 3M8LA 4UCTA 5CB4A 4JI5B 2RMKB 2PF4E 4GMP0 3T1HB 2P4VA 3KM5A 1YLLA 2R0FA 1V6NA 4QNHB 3LUTB 4JVAA 3ZFFA 2FMLA 1GP6A 1I08A 3CMAV 2UU9O 1SEFA 5CBLA 5CB7A 4LXLA 1HW5A 5IK4A 4CH6A 3H1IH 2A6VA 1JFFB 3FE5A 4QX2A 1W9YA 3ZX6A 4XMIA 1SACA 2WABA 2BCCH 4BDVB 3ZIWA 2XBO3 1HN1A 1DQ0A 3BU7A 3DUIA 2D3PA 3FLRA 2E26A 1W8FA 2YBPA 5KX5B 2GZWA 1KQRA 4EFBA 1NVPB 1F4AA 3VV1A 1F35A 3FHQA 1AYM3 3VBUC 1Q8QA 1K33A 1ODMA 2DUOA 2WRAA 2FDJA 1QCEA 2GUZA 3ZSLA 3WG7B 2ARCA 4YG6A 1FMD1 2FMDA 2DYCA 5F5AA 3V65A 1BLZA 3CMEV 5A2QN 1NCRA 2AEYA 4UV9A 4JCKA 2C4XA 2J22A 4IIJA 4IV3B 1H2GA 1PIV3 3HBZA 1AXYA 2RDQA 1GTOA 1WB8A 2XOKG 4KMQA 1ORQC 4Q4W3 3OD4A 1X7NA 2C2AA 2R70A 1AR72 4XCBA 3VKMA 4LIVA 4IIJB 3QLQA 4Y1UA 1XPWA 3EHKA 4Y5TA 4X8PA 1BEV1 2EIKB 3USSA 1S5JA 2QCSB 4BXSV 1D2SA 4AI9A 3URFA 3DKWA 4JYAO 1BHGA 5JWPA 4MSVA 2HVJC 4OZXA 3M7AA 2H8PC 2RN9A 1GZCA 1XSQA 2BVBA 2WJSA 4OX9B 3EO6A 4O2BB 4ZPIA 3W9AA 1XUQA 4BXFA 1LGBA 1SQVH 1QJZA 3GBGA 4ARXA 4PJ0Z 1N32O 4AVVA 4LFCB 2VULA 1LHVA 5JCOA 3B93A 1NCQC 3D5OA 4KU7A 3JAKB 5LOVB 5E6HA 1EP0A 4X1IB 1Q8VA 3OGRA 1NOVA 1QDOA 3OB8A 1SA0A 3HBKA 3DC5A 3JBG2 5CYYA 4RQFA 4GX1A 1S0IA 5EBMC 1FNZA 5FUPA 1VBB1 3O0XA 2WZR1 2F17A 4CC6A 4P9GA 3ZRVA 3A21A 1HW7A 1Q8PA 1XI1A 4OUEA 4DB5A 1VF6C 3IIAA 4XC9A 5IAVA 1LNSA 2E31A 4JGZA 4DR1O 3OYWA 2Z2SB 3SEEA 1RVF3 3C7HA 2Z69A 5EJ1B 4QGPA 2Q0AA 2R062 1TZOA 2HJIA 1RUH1 4QXHA 1AYN3 4LIUA 2D6PA 4Q2FA 2Q1FA 2XTAA 3RVHA 1IG3A 1N1TA 1LOBA 1MABG 1R64A 1OPMA 2WZ8A 3LOBA 2HWB1 4Q4V1 5FMOL 5KXBA 1J1LA 2K9ZA 1LEDA 2QTWB 4U7NA 2QEXV 3ZFEA 4DXTA 4CSWA 2WLKA 5T52A 4LK7A 3HKEA 2P90A 3HJRA 4JZ2A 1AX2A 2C9AA 5D8AA 5FREA 4FAGA 1AZDA 4LHKA 3ZIAG 1XNKA 1BZWA 3W59A 3I4IA 3MIHA 5GONA 2VOWA 1R1A3 2E53A 1VQ5V 4QB2A 3CQOA 1G9CA 2X0LA 2VCBA 3CNAA 4MV2A 5FRAA 4AQ6A 4YSFA 2X8KA 2DYSB 1B04A 3OMAB 1VQKV 5FLJA 2UY9A 4J1WA 1SQXH 2A3WA 4AVSA 4UYBA 3UK9A 2VM9A 1FOD2 1ST8A 2E9QA 1EV11 4I4TA 4GWJA 4LH6A 1SZXA 5B1OA 2OTJV 1QNMA 1TVKA 1VQLV 1OF4A 1RUG3 4FM2A 2VQEO 3HD8B 1HRI1 2XG3A 4U36A 4U7OA 2DJVA 4PI0A 5CA0B 4QPGA 1YJ9V 2EA7A 5IWAB 2VTXA 3VKOA 3ZS8C 3D3AA 5FZ3A 3WY6A 3WF0A 2F43G 2BGCA 3PTYA 4I5SA 2P3JA 2OCCC 1TVGA 4BH9A 1L7RA 4Y1YA 3UKVA 5K4LA 3CKHA 3NV1A 3W20A 2DQ0A 3ZBHA 4CCDA 2ZNIA 3OPWA 4K7JA 2R9IA 5FYYA 5C9AA 5TSWA 5IW0A 5HI0A 4JI0O 1HQWA 2W46A 3HQXA 2IXHA 4EZ4A 5H6RA 5FP8A 5IAXA 3A0BZ 4A4AA 1XC6A 1FFTB 4ISRA 1LAJA 4AEDC 2DWEC 2LW7A 1IOAA 5EC2C 5DG2A 2DW4A 1MS4A 2IFRA 3OBTA 2D3SA 1GICA 2WLIB 5CFDB 1PGW2 4BQ4A 2LUWA 4JI3O 1K3IA 4MHRA 3PVEA 4IEQA 4RR3A 2N74A 4O4JB 2JDZA 4HKLA 4FFBB 3R4DB 4NRPA 4AYUA 1HJGA 2OVUA 2OT5A 1GU3A 2W0FC 4J25A 5DM6V 1REDA 2F6BA 4H0LB 3ZXFA 2BUKA 1RVF1 5IK7A 1AL0G 4UF0A 1SLAA 5CN0A 3IDBB 2CTQA 3CB2A 2B1IA 2BRTA 3WCRA 3NAPA 4YGDA 2HWE1 2PLV2 2OQ7A 3SYAA 1R082 2DUQA 4AE2A 1XQ8A 5AVAA 4AEJA 4X66O 5FY7A 3JALA 2EJ7A 1TA8A 2ZHMA 1MACA 1FFXA 4LOTA 4R7CA 1A8DA 3ACIA 3FB8C 4GB32 4IW3A 4ONUA 1GBGA 3O1SA 1BT8A 1KB9F 4OULA 5EV7A 3CRCA 3BFRA 2E5LO 4QPGB 3NR7A 3POWA 5LBCA 4QD2A 4R52A 1FS0G 3NAPC 4XMAA 2XNDG 2RQ6A 4F7ZA 2VTXJ 4PCRA 4YIPA 1PX4A 3AXDA 4Q4V2 2QQWA 1SLLA 3ZSMA 2P2KA 3P30A 1I6XA 2IH1C 3K5NA 2V4DA 3PUQA 4RUEA 1TAEA 1LHWA 3POFA 1GYKA 4W65A 3L73H 3W7UA 1RYYA 1C3HA 5FLHA 1TNRA 5DAPA 3RDIA 4Z82A 3E1F1 3OT7A 4CS2A 4MT8A 5FV3A 1AR93 3N2GB 5BYNA 2ZINA 1CIWA 2X10A 3SLIA 3HNYM 3CC2V 5JXHA 2A6XA 4QQOA 3M3QA 1ZL8A 2PYLA 2D6LX 4P9IA 2H0BA 3Q8CA 4XAAA 3K75B 4FPOB 2PQSA 2EIMC 4IV3C 2QQVA 3O1RA 1GKBA 1T6GC 2YEVA 3VBFB 5LBQA 5ERLA 3QG5A 2B39A 3NXSA 4AQTA 4QQLA 4XF1A 2XWBB 4JDOA 1VRH2 2QDNA 3CE2A 1JODA 1FXVA 4AQSA 4HN1A 4NHXA 5T50A 3VHOA 2CTWA 5JVDA 1I5ZA 3GXUA 1ZX3A 1JTZX 1O9HA 4CU6A 3MIEA 1UX6A 2VWKA 1BSMA 3B09A 1HB3A 4P9OA 1LHOA 1WLCA 4AVTA 1JOJA 3DV8A 4K0KB 1QHDA 2WAMA 1XEQA 4QX3A 2PN5A 3VBBA 3O0VA 3OGJA 2WC2A 5JIAA 3LOIA 2ZE8A 3LSUA 4PQQA 3JCIA 3MEPA 3IPVB 5LA2A 3ACLA 4O7XA 3H9AA 4XXAA 4I55B 1A32A 2DYRC 3HEIA 4JHZA 4JASA 4NE9A 1JZ7A 2JDMA 3VBOA 4EN9B 4OI0A 2VQFB 1ENSA 1ROPA 1Y4WA 4AI1A 3WR0A 1SQ4A 4M00A 1WMEA 4YGCA 1GM7A 4PT6A 1JZ2A 4I0XB 5FZ0A 5FZLA 3ZFEC 2W6IG 4J9ZB 2QKDA 2KQXA 4O4JA 3UJQA 2ZE5A 3M70A 2RMU1 3K9SA 3FL7A 5FZOA 1JZ3A 4DV2B 1IXBA 2OYQA 4IGGA 3I56V 4XOGA 1Y7BA 1W04A 3ABZA 1ALYA 1HRI2 1M90W 3WCSA 3O14A 2GH2A 1NLQA 4Z07A 4C8DA 2ZQMA 1FOD1 2ARBA 5H9CA 2PUSA 5FUIA 4DR6O 2QE3A 4YHHO 5IYCO 2WLQA 5FJKA 4YW4A 5I0UA 1GP4A 1UPIA 1LU2A 5CBGA 4JF3A 5GONB 3CLPA 1SZBA 2ITCC 4F6RA 4Q20A 1LRHA 2D6KA 4L9BA 4FT8A 3TXQA 4IEOA 4YYOA 3VD7A 2D93A 2ENRA 3DF0A 2EXKA 1Y6XA 5E1RA 1Z5VA 5I8TA 4IV1C 5FMOS 2JB8A 2RR11 1F9KA 1WLDA 1OSGA 4LP8A 1POV3 1QJY2 4JGZB 2UXNA 2HEPA 3ZN4A 2EAKA 3ZIXA 3ZKYA 1K5JA 2RMU3 4DR4O 2ZE6A 1CJPA 1QMJA 1J83A 2ZXWB 2GSYA 2HWB2 3FB5C 3HB3B 2Q67A 3ZVXA 1OFSA 5LHIA 2VZVA 5LYJA 1W9SA 4JC1A 1UNBA 4RL7A 1G86A 1LOCA 1BMV2 1CX1A 1S0BA 4JKMA 2GSMB 2PZSA 1QJEA 3TNQA 1L1FA 1SPPB 1NXMA 2Q68A 4LHNA 1UX7A 4AR2A 1VRH3 1UFIA 5KXDA 5F6LB 2QWRB 1VBB3 4D6TH 4CEWA 4LBEC 3GCXA 3QACA 3UGFA 3SR2C 4G9SB 2VECA 1W8TA 2PHXA 1RUC2 2JJ1G 3GCWA 4GB31 4XIKA 3K51A 5IVCA 1RUF2 1ZM1A 3ATGA 2BPA2 3USUA 2ZAHA 2MPFA 4XUQA 1UN1A 1XE0A 4AGGA 1BYHA 5L19A 2V7QG 1YSCA 4PDVA 2YDEA 4N53A 2HFEC 2HWC1 3FBMA 3MLJA 5EBWC 3P32A 1RUH3 3H8UA 2EICA 1RL3A 1NA1C 4I0AA 3N35A 2Q5ZA 1DYPA 1XREA 3G80A 1UMZA 2JXAA 1FPOA 5FNVB 2BEOA 4KXRA 1MS8A 1V55C 3PU8A 1W2TA 3DL3A 1K12A 4I9QA 5EIBD 1LGCA 4ZI7A 1ZA7A 5GALA 1IQAA 1CAVA 5JOYA 5FLIA 5FO9B 4DV2O 2Q6AA 4UVCA 5FZKA 2WQ4A 1HDJA 2QA4V 3LKJA 3ZHQA 2RM21 1APNA 4FAHA 3AZYA 2DQ3A 4B1LA 1QJX2 3B3QE 1SCRA 2VZTA 1YIFA 2BWCA 1PIV2 3LAGA 1F7YA 5CZKA 1UOBA 4JI0B 3WG1A 1T2XA 3IMNA 1TNFA 4C90A 4DY3A 4JI8O 2HEWF 1FJGB 3ABMB 1AILA 2PAKA 1Y4MA 4PA9A 4J11A 1C8NA 5CNAA 1UPSA 2Y48A 3R4UA 2C5DA 5KA6A 4IETA 1JFFA 1AR5A 2ZMLA 1T5EA 3QF7A 3K03A 3G67A 2PI5A 4FOVA 3JD71 1NTKH 1PIV1 5IJRA 1QR8A 3H50A 2WNEA 5I8SA 3RJRA 2VQAA 1JUHA 4MVMA 4KH9A 1F5FA 3BPSA 4YPJA 3SMHA 3UO2A 4LFAB 4DV6O 3KV9A 1UL9A 2CDOA 3IAYA 2KB1A 1MS9A 4P5HA 3I3BA 4NHLA 1AR82 3KF5A 4JI8B 3ZM8A 2FMYA 1MR5A 3UT0A 1X9TA 2BQPA 5JLVA 4TLFA 4Z8BA 4E4SA 4XDLA 4HSJA 2AREA 2VD7A 3LEGA 2ZIMA 1GFF2 4N53C 1CIYA 2WLJA 5J36A 2RDSA 1JOPA 4P9LA 3ZRWA 2VE1A 3KHBA 2NN8A 1D4VB 3MV01 4TV8A 1R1A1 2DTWA 1NZ6A 1Q3EA 4YHHB 2EIDA 2KG7B 1MS0A 2JDPA 1O5UA 1GANA 3KMHA 1PNLA 2VCMA 5LATA 4MVRA 3MW3A 4FP3A 2J42A 1WZXA 4XXPA 4O4IB 4DV6B 4E2LA 3SYOA 2B45X 3UNPA 2B46X 3MPPG 2JDKA 1Q43A 2FDKA 4LFBB 4FLYA 1NUKA 2ZOEB 4DRXB 3RYCB 2TEPA 5LEJA 2GNMA 1D0GA 4IV1A 3SPHA 2LRPA 3ZMUA 2R1DA 2SBAA 1OLMA 3OGVA 5L3FA 3M4FA 2A1XA 3NNFA 1HV1A 1YTFB 3O1TA 5CA0A 3JB4C 4DK0A 5CA6A 4IYIA 1G9AA 3VZMA 1QR9A 2AXTZ 1HR0B 3T4VA 2B4KA 1DZQA 4AGVA 3OSDA 5L3GA 5D5PA 5B1AB 4LA3A 4L97A 4Q4W1 1ZBA2 3ZSKA 4DXZA 2VL4A 4YZ1A 2UURA 5JXGA 3OCPA 5A1FA 1PVC1 1GO3F 4OPAA 4DV0B 5C9AB 5FFOC 4YFWA 2P3IA 4AVBA 2E7AA 4YJ3B 4IQPA 2D2CB 1QY4A 4FPFA 3SYQA 5I93A 1YIPA 1UU5A 3SCGA 1MG1A 2GP3A 2UYBA 4PIYA 1EM1A 1RHI2 4EWAA 3ZFGA 4LEJA 4YARA 3WW4A 4EKWA 4QWNA 4CZSA 3I3EA 4V1PA 4EEQA 3ZHVA 3BU0A 1L7QA 2GC1A 2YXHA 1HR0O 4PHZA 3R0RA 2R043 1ULOA 3JD2A 4G2KA 2WBKA 1Q81W 1ND3A 2HJDA 5IVYA 3B2EE 1X59A 4JPRA 3LDCA 1FAYA 5H6QA 4MGSA 3ZRWB 4SBVA 1R6TA 5A80A 4WFHA 3BIWE 4JYYA 3ABKB 3H1YA 1F4HA 2W92A 1GNHA 2QM8A 4QKNA 1E5SA 1KFXL 2LTNA 2JEXA 2XBO2 1ZZCA 5LA6A 4AFDA 2IXJA 1CR7A 2AZ2A 2HWD1 1WLTA 3L71H 4D7TA 2VOTA 3A23A 2JX9A 3ST7A 3JASA 4IL7A 2DCYA 4JI4O 1JHNA 3HR0A 1D2DA 4DRXA 1QXJA 2CU5A 3CRMA 5IVVA 1OH3A 1ASJ3 3ZDSA 1KP3A 1XXNA 1XOUA 4YZ2A 1VAKA 1F51A 1QQP3 1MZFA 4W50A 5M0TA 4M3CF 2BERA 1Z7S3 1YO8A 3JAMN 2AGSA 4CXYA 1YI7A 3BTXA 1GNYA 1WCKA 1V55B 2IJJA 4I3PA 1ZTEA 2K46A 1SLCA 3I2KA 3JQXA 4ZBMA 2TBVA 1SMVA 5IHRA 2RJZA 1H2LA 2XT9A 5LP6C 1BGYH 1JQ0A 4A6SA 1W9FA 1ENXA 4UBHA 4YGBA 3IT8A 4JGYC 3O5SA 2J1AA 4Q4Y3 5C4WA 3H8OA 4ARYA 4CZZA 1VAVA 3HOBA 4DV5B 2XMLA 5FY8A 1NX9A 2UXBB 1S2KA 1EN6A 2EX3A 2Z5UA 5IYDO 2BBVA 3LSQA 3VUOA 1WB7A 2ZE7A 3CCJV 4QKBA 5FYHA 1AR63 3C2UA 1I0HA 3AKRA 3ZPYA 3LDEA 1Y67A 1EPWA 1M06G 4CH4A 4UV8A 3VOUA 1FFXB 3ICXA 4IEYA 2HH9A 3ES1A 2B1GA 3M99B 1D5AA 4HZ3A 1KKCA 4M0HA 5J1XA 2WFF1 2DCJA 1RIRA 3DXTA 4QHBA 5FY9A 1F5JA 3OUIA 3NL1A 1BCCH 1O3SA 1WCSA 4ES8A 5A7NA 3E97A 3ILNA 1VB4A 5GM0A 1IX9A 2O57A 5FP7A 5KXCA 5JXJA 3ASNB 3JBG1 3GWKC 2JGUA 3LGRA 4J1XA 2P7TC 1RC6A 3I2JA 3LF7A 5HPOA 1XSRA 1WMFA 3L72H 1FMD3 3FD9A 2P1BA 5LA1A 4CPBD 4LFAO 1OCOB 2O8OA 2Y6HA 5JDBA 4CP0A 3KHCA 1G9FA 4QAWA 2ATFA 1FX5A 2KG7A 4AHXA 2A6WA 1PGL2 1HRI3 3FAVB 3B7MA 3JZVA 3JARA 3SHRA 1W59A 4PA3A 4K40A 2JJ2G 2FCTA 3UO3A 3JATA 1D4M3 5FZ1A 1VBA1 4DNYA 1W8OA 5FZDA 3SNMA 3AG4C 5K8SA 4J80A 2XBO1 3USUB 2A7WA 3CCQV 1AI6A 3KT1A 3O0WA 4OHWA 3VBSB 2JK5C 1WW7A 2EBOA 3UL2A 5KX5A 4YGEA 2ZJCA 3FX3A 4NIHA 5A7OA 2ZGMA 3S6PA 2NLJC 2R49A 4CTEA 1O4ZA 1UZ0A 4Q5OA 3ZXKA 1ZBE1 4YZ5A 3JQWA 4Z1MG 1UW8A 1YITV 2EILB 5C4WB 5DEDA 2BBAA 1UY1A 1QQP1 2P34A 5ABJA 2LJ2A 2YEVB 3VBFA 4A45A 2E7QA 1UKGA 3H8XA 3LSSA 3K0DA 1QH6A 1BXHA 2C26A 2ADQB 4X6QB 4XZPA 4DV7O 4ZU5A 1Z78A 4I50B 2Y34A 4GULA 2XVKA 1HQNA 3VDDB 1FXKB 4DO0A 1IBKB 1IS5A 2BV4A 4X6RB 2QZ3A 1WA4A 1YHFA 3GNEA 2VNRA 2QR4A 3DKQA 4YG0A 2DBIA 4GWIA 1HRV1 2WT1A 3QH6A 3E6DA 4MGKE 3ZYFA 5CMUA 4XDQA 1FNYA 2FYUH 3F7YC 1MQTA 3DC6A 1GWKA 3MV11 4K35A 3LWCA 3QO7A 1HB4A 3OMNB 3K3OA 2CDYA 1DGWX 3E8HA 1LHUA 4CVUA 4A3ZA 3PUIA 2DFBA 1E57A 1ZRRA 4K8RB 1H1AA 2DCKA 1CAXA 1OCCB 3R6SA 1QJU3 2VVEA 3W5NA 4JTCB 3AYCA 4WM8B 1NT2B 2A79B 3I8TA 2IJKA 1NI8A 3TXSA 3E6BA 5KMGA 5CEHA 4DW1A 2AZ0A 3UYJA 4MHUA 3AKQA 3LNNA 2Y38A 2NZ9A 3Q8BA 3TN91 3IGAC 1AR62 2R30A 2GH8A 4YNIA 4B08A 4LT5A 1BVVA 2EXIA 3U78A 4X1YA 5CFCC 1OHHG 3ZKUA 4B3MB 2YU2A 4GT1A 3K0GA 1LGNA 2VQTA 2VMHA 2ATKC 4FPYA 4LKFA 1FOD3 4YZ4A 2XJUA 5FYBA 5FZEA 3ZHTA 4GB33 4BK4A 4LLOA 3WV6A 2HWB3 5DZEA 4GLXA 4KWKA 3AZWA 3N7KA 2J1TA 2WO1A 1QJX3 2OIIA 4FBFA 4Q27A 3STZC 1MQTC 1K5MC 5FMCA 4UAPA 4LBQB 4JAAA 4F8AA 4H13B 4K0KO 5LMNB 2JJ6A 4RR3C 4XFGA 4LF6O 3SKJE 1TUBA 2BU9A 2MW2B 2K0GA 2OX0A 4O4LA 3ZMSA 4CDQC 4LO7A 1PVC2 2RS32 3OBZA 1X4TA 2Q9LA 1NCQA 4HFSA 2GDFA 2DCZA 4KWJA 1DZRA 5C3QA 4OUSA 2NPIA 1RINA 1O7FA 2VXJA 3ZCCA 1AP6A 1AUYA 4W6YA 3POIA 2WS91 1SPPA 4RQPC 4JDNA 1OCZC 2MEV1 1RUH2 4YM2A 4DV3O 2FD8A 3SYCA 1VF6A 4DXWA 4JTDB 2ARHA 5EZYA 2OA2A 1HB1A 3VBOB 5F2WA 5EC1C 2VMEA 4PF5A 4Q4W2 4CEWB 2XHBA 5C8CC 4WM7C 4CA9A 4XTPA 2P5BA 5K0UC 1V6MA 1B3QA 2D3OW 4HK9A 2WR9A 2WNVC 2BTVC 3EJKA 5FZHA 4DRRA 2Q1ZB 4GWMA 2YSUB 3AYDA 2H94A 3IC9A 2ID4A 2A3QA 2R041 4KBZA 1Z5WA 4COZA 3ZN6B 4P5YA 2R9AA 4AWDA 3Q8AA 4NB5A 4RQPB 1MNGA 3PN1A 2IVJA 3VZOA 3CCEV 5FZGA 3B9IA 3MDSA 4P30A 4BQYA 2RR13 4AI8A 4YW7A 3IDAA 4UFHA 1M4WA 3N4MA 3B69A 1H4HA 4GKXA 4QMAA 4EWEA 5FZ7A 5FPZA 3HMYA 4LBJA 5ANNA 5IYYA 3QNEA 1SS3A 4DINB 1GR3A 2LM3A 5LHHA 2FKXA 5BNPA 4UW3A 1K3EA 1AR61 4CDWA 4UXAA 2CL2A 4JV4A 3ZXJA 3KF3A 2XAQA 3RFRA 1WD4A 1ENVA 1PL0A 4GYCB 3E83A 3LPGA 1VBE3 2DV9A 1H1IA 3HT2A 4MH0E 4XYXA 4XBFA 3FN9A 5C8CA 4AFMA 1YIJV 5LZ6A 3MF6A 2DE0X 5G05L 4ZZ8A 1NQDA 2Y6FA 5C33A 2VMDA 4K8XA 3VBHA 4PA4A 3H1HH 2BGOA 1V6KA 2RJLA 1PGW1 3U4SA 4CPBA 1B09A 4ZS2A 1HQLA 3D4KA 2YIBD 5F3IA 4O2AB 4I01A 3CRQA 2XAHA 1AYN1 1XL6A 1UOGA 3AM2A 4Z2WA 2Z5WA 1NY71 5L3DA 1N3QA 4Y1XA 1KD7A 5F5CA 2HWD3 1IBLB 3IN9A 1C57A 1J3PA 1DLLA 1YNAA 4PLMA 2GMPA 2BTQB 2DN9A 1XYPA 2R7EB 4AFBA 2V09A 4A42A 3KCCA 1S2BA 1VJ2A 4CU8A 5EXOA 4QE7A 4XQWA 5EZWA 3A4UA 3ZSJA 4TWKA 5LL6Y 4BK5A 3VQWA 4DRVA 1HX6A 1YFUA 5I8YA 1SFYA 2R6QA 4FK5C 4FPGA 3JXSA 2VZRA 3ZN6A 3N27A 1POV1 5HV0A 1S0FA 5L7OA 5IVBA 4OI4A 1QXRA 4OVEA 3OEHG 3AMNA 1R1BA 5A7SA 1W2OA 2YPJA 1O3QA 4CRQA 1AI7A 3DSQA 5K0UB 3RWNA 3ZO0B 3EBRA 5HFLA 1ZRDA 5F39A 1MA1A 4B4QA 4XBNA 2C0ZA 2RMU2 3K59A 1AJOA 2XHKA 5A7QA 3JAWA 4AHYA 1WN7A 3CU7A 5K0UA 2VS0A 3VBHC 3OGGA 5KHGA 3KB5A 5JPMB 1MZ6A 2ZX0A 2DBNA 3QTCA 1FPN3 4ATEA 3C7EA 1AP5A 4DFSA 4ZS3A 1ZRCA 1PK6A 3ZDVA 2IBZH 1PNMA 2IXKA 1MZ5A 2YI9A 2PTMA 3AVSA 2PYJA 3W58A 3E86A 4XBLA 3H3ZA 2P22C 1ZAUA 2I74A 4YIOA 1JI6A 5I0DA 5B4NA 3BN6A 2JENA 5JR2A 3MLKA 1MEC2 3Q4HA 1RUF1 3AG2B 4ET7A 1CAWB 4LBKA 1XYNA 5C70A 3LZZA 5I0TA 4MVOA 5A7WB 1RUD2 4HXCA 5D5QA 5LP6B 5GZGA 2PMWB 2VOXA 3RGBA 1VF5B 2ORZA 4AW7A 2QWQB 2WWUA 4IE6A 4KG0A 5FYCA 1IURA 3BODA 3L2HA 1RFYA 5FXXA 3K57A 2BFUL 3CCSV 3BA9A 1KD1W 4UWDA 4E9KA 4IDZA 1R1A2 4BJ0A 1KFUL 3RVYA 2D6MA 5IWAO 4X65O 1PO11 1Q56A 3N9LA 1VBE2 3GYDA 2W1QA 4E2GA 3CF6E 3FHAA 3D3QA 2F93B 3BI3A 1XOYA 2N05A 4C0HA 4FPEA 2RJKA 3ZHUA 5J09A 3N9NA 3H3LA 1MEC1 2ZHKA 1BL8A 4PV1B 5C8YA 4PIZA 1JMUB 5BNPB 4UFZA 2IUWA 2WA4A 2J1SA 4D0QA 4H7LA 2VH9A 1H2NA 4X9QA 3ASNC 4TUYA 5FPVA 4P9XA 1O8PA 3QOPA 3IIIA 1BEV2 2HLDG 1DDLA 2WZPP 3APOA 4CDQA 1KRIA 3SCHA 1VALA 4XFAA 4JRLA 5JZGC 5GKAC 1JHJA 4YVWA 4AK3A 4X64O 4META 1GMMA 2VPVA 4BIOA 4JI6O 3THDA 2GALA 1AJKA 1MS3A 4R9BA 3LSDA 4GKKB 1W06A 2Y69C 3VBUA 2ZCWA 3J26N 5C6CA 2ZS6B 2D5HA 3ZSEA 2YXYA 4BR6A 2PI4A 1QLEB 5KR7A 3RZKA 2VNGA 2GN7A 4JV5O 4FLVA 1YUDA 3U10A 3C7FA 4EE2A 3S5AA 3TOJA 1IKQA 2PYTA 4UBGA 1WA6X 2JD9A 1HNXO 3DYPA 4QE9A 2ZZJA 4KP4A 1G4YB 1OHFA 2WN3A 5FYZA 5EZYB 3A22A 2KA3A 1IXMA 3E35A 4UCSA 1M56B 1FXHA 1KC8W 2Q8VA 3PU3A 3VKFC 1S5HC 1DF5A 3K04A 3JD4A 4MLOA 4RR3B 1PX3A 2JEMA 1RUE2 2Y6KA 4PDWC 4R9CA 5JI9A 4EYUA 2WO2A 1HRV2 4RA0A 4LF5O 4YRDA 2BJSA 2CYFA 4IV3A 1UKRA 2H0VA 1Y76B 2YHJA 4XEZA 1VQ7V 4X66B 4QX8A 3WEZA 1LNQA 3TNPB 5HBAA 4OHXA 4X89A 4XACA 2NMNA 4PDWA 2GNDA 4XAEA 2JG9B 1N1VA 2KXLA 4QPYA 2OCCB 4AAXA 5EJZB 4CDWB 4XUNA 4YVWB 1SG3A 4TN7A 3AJYA 5I0RA 1AJNA 1LOFC 1S0CA 1F15A 3WDWA 5FYSA 1QJU2 4PA6A 2QDOA 2G19A 3VDDA 1UZZA 4MSWC 5LA6B 1Z7S1 5C8CB 1Y66A 5JSRA 4JGZC 2RM22 1N3OA 4FJCC 1WCUA 4AEKA 3SCFA 3DXRA 4AHCA 3KLSA 2QQLA 1BMV1 3VHRA 1RMU1 2VW0A 1ZZ6A 4WF9V 2BNNA 3AFKA 1OQEA 2WQ8A 1HNZO 5CFDC 4QPIB 2IXIA 3E2EA 2JS3A 4I02A 3TEXA 1SDDB 2JVDA 3CP1A 1J5EO 4OMCA 1LESA 3ZPOA 5CKNA 4CUCA 3IC7A 1ZBE3 1HNWO 5LASA 4HONA 2V73A 2VMCA 2D43A 1RSOB 2TUNA 4IEVA 5EWSA 3EHBB 4J7KA 4XUPA 4C0BA 3PUHA 1OUXA 1RHI1 3OPTA 4CP9A 3WDTA 4DR7O 5KHHA 2RE9A 3NO8A 2IXCA 4DR5O 2VCAA 4MG2A 3A2FA 5EYPA 2R061 4MVZA 1W6QA 1LR5A 3SGIA 2FZ2A 2ZXWC 3VGIA 1JU3A 1NQTA 3BVCA 4RYDA 2XLGA 5EBLC 4WVMA 3HNMA 3GBWA 1K5MB 3ACFA 1N34B 4AVCA 1GH6A 3RYRA 2NMOA 4UT5A 1JX9A 5AC93 4OZOA 2F4PA 3AG2C 3RJ2X 2LQTA 3FWEA 2XKPA 5CAZA 5IY5C 1PPJH 1EUUA 5EIYB 3JBG3 3OUFA 1QNYA 5B2GB 1BK1A 2A73B 2HHHO 3V56A 3TGUH 2VZPA 2UWCA 1JZ8A 2ZKOA 2GAUA 3WNOA 5FOJB 1V0AA 1Z7S2 4NRQA 2ARXA 5F5IA 3HWJA 4UFJA 1UZYA 3GBFA 1XB9A 2EIEA 1GN3A 4E2QA 5KXEA 5FUNA 3UCSC 5JVVA 2K9PA 1C4RA 1NA1A 3HVDA 2YIBA 4E8DA 2JIZG 4MVQA 1UIJA 3JB8A 1W6MA 1OV9A 2W5FA 3C7OA 5FYVA 1G1XB 5KUMA 5B4XA 4MW8A 1VPHA 2FBEA 3TN93 5LGTA 1QXPA 3OBRA 3H7JA 5FY0A 3TWIA 4Q4Y2 1L3JA 3JATB 4WFGA 4E8CA 3O1PA 4CP9B 4TQFA 4NJ4A 1D4M1 4DMIA 2BFUS 2VG9A 5EHDA 3WF3A 2RS52 1ZRFA 4CDXA 4Y20A 3ENRA 1UYXA 2HEVF 3TCUA 3HQUA 1NY72 4C91A 2N04A 5HCHA 1I1EA 4FVVA 4L87A 2O0OA 2ZD9A 3V0AA 1FD9A 1CXZB 5KMGB 2QBXA 3EXAA 2F4VO 1PVC3 5FO7B 1R6NA 2GDSA 4LF8O 4RGKA 2GN3A 2XVGA 3AG1C 5LA0A 4YVSB 2ZM6O 4LNVA 1SBDA 1KP2A 4MOAA 3LNMB 1PVXA 1DGRA 1N36O 1F2NA 4JI4B 2HLEA 1TEIA 3UESA 3PLQA 1ZZ9A 3WG3A 3P3NA 1FMD2 4U3FH 4H2AA 4YG3A 2HWD2 2E74B 4DR2B 1BBT1 1IBMO 1QDCA 4TLGA 5DN6G 2Z0AA 2X6BA 2KD7A 4FPLA 5L3BA 1U96A 4NRMA 5DZGA 2B7YA 5DMYA 4X20B 3OTOB 2MEV3 5EPAA 1QLNA 4YLZA 2VCCA 1UAIA 2WS93 3H3UA 4PDWB 2ZGQA 4Q0PA 1PO12 1UYYA 3IB3A 1NH2D 1DF0A 1OQDA 1CX4A 4FQZA 2EIBA 2Y69B 2P3YA 1W6NA 4UVBA 3ZMTA 1NLSA 3FLTA 2VY0A 4XJ8A 4I4TB 2Y4UA 2OW4A 2F95B 2HWE3 5DPNA 5A6QA 3CBNA 2RR12 1V70A 4KGGA 3T2PA 1BJQA 4IGOA 4K8FA 2P17A 1SZTA 2A75A 1VRH1 2ZHLA 5BNQA 2Y0OA 2OUJA 3G7DA 2WZR2 1KS4A 4BE3A 4CEYC 3ZHSA 4MZUA 4NO4A 1W03A 1OA4A 3KVBA 1Y3TA 4YM1A 4XE9A 1Q90D 2XLAA 5EYPB 3BABA 1AR83 1AR91 3WQ1A 3ZFGB 4OYUA 4UI9L 4NIGA 2HWF1 4FPKA 4S2GA 1WA8A 5AVPA 3JD1A 2D6OX 5CKQA 2VUDA 3WHUA 1FI2A 3W7TA 2HWC3 2RS12 5FZAA 3JD73 1XU1A 2Q30A 4QXCA 3KZ4C 4CCMA 4XCAA 2RCVA 2W1WA 2CGOA 3ACHA 5DZFA 5IVJA 1CAUA 2HJFC 5FXZA 3BCCH 5EJ3A 1XMOB 2XWJB 4UCVA 4QPKA 3C8XA 4E27A 4IE4A 2BOJA 4XF0A 2HHHB 1YQ2A 3MLLA 4DO2A 4ZHQB 5T5PA 4JI2O 4JGYB 2YC4A 4FLUA 1PP9H 2JE8A 4Y22B 3NWKA 1ND2B 4XF3A 1BKZA 4L99A 5JQGA 1OCOC 3ETDA 3JU9A 2JGDA 1NBMG 2OTLV 1RJ7A 4WBNB 3M8AA 3H1KH 5LB6A 1RTVA 3CC4V 4B3NA 3CMGA 3VBFC 1GQHA 2IZWA 4FPCA 1DCSA 4CH3A 4O4LB 2ADEA 4G4FA 3VKNA 3RYKA 3MBWA 4LF7O 4D6QA 2GC3A 4DR5B 4HVRA 2BTQA 3UGHA 4AVAA 3S5QA 3E5UA 5DDJ2 5D21A 1NS1A 3N2KA 1ENQA 1SBFA 3N7LA 4QPIC 3FMGA 5A6XA 2Y4TA 4ZXKA 5B3SC 2CE4A 5L9BA 4EROA 3ZFGC 1WMDA 4GH4B 1DYKA 4X1IA 1O91A 4QJFB 2P4EA 3LQCA 2ETNA 1SRYA 4Q4X3 4P9JA 3QH7A 1W9WA 1DGWA 1HNXB 1BEV3 2TNFA 3I59A 1GV9A 2QQUA 5BNPC 3FZ3A 2ZTNA 4B3RO 3FUQA 4AZZA 4YY3O 4GXLA 4BQ5A 4H3WA 3NSTA 4CCEA 2RJ2A 4WVZA 3K5OA 1LUVA 2BWAA 1F4NA 1Q8SA 4JGYA 1V9U2 4OUMA 3MF9A 1KJLA 1GM9A 4R4ZA 2CH7B 5C4WC 2B5UA 1NCRC 4N7UA 1JR9A 4YW1A 1N47A 3RN4A 5FP3A 5CFCB 2R071 4FCAA 3IBMA 3O12A 4FXKB 2D7FA 1P4RA 2BVVA 4JAVA 2CTPA 2QQNA 4DUXA 5DDJ1 3JCZA 1ZYBA 4HNAB 3PJYA 1RUOA 4KBBA 4X62O 3WX5A 1PO22 4JI2B 1NU1H 1XJAA 3N3HA 2ZIOA 4M4RA 1PV0A 1AXKA 4AQYO 2V1DA 4XVHA 1D7PM 1OLRA 1K4DC 3VD4A 1PGL1 3AP4A 1O59A 3LSEA 2EIJC 3GJAA 1MVQA 5J96B 4OFGA 1TME2 4F6EA 2WAOA 1S77D 3T2OA 5GLZA 3WXPA 2OPKA 4B3TO 1EN4A 1YJLA 2HWC2 2RS13 1MQTB 1RSOA 1E1RG 2ZEYA 1MOFA 1RB8G 1TQ5A 3NV2A 3B5LB 4NWWA 1H6YA 4OHVA 4WFBV 2DU0A 3ASIA 3BB6A 1VBD1 4C1XA 5FZMA 3X2QC 1GRJA 1A78A 3THOA 3CJIC 3K5LA 2ZM6B 4C1WA 2R042 4QKFA 3MZHA 4OHYA 4DPNA 2OIGA 3PIGA 3OPZA 4MVSA 2Q7EA 3MW4A 3J8F3 4LJHA 5FTTC 2P5OA 4BW5A 4YJ3A 4OHZA 4NVPA 1QJFA 2ZAAA 3PMEA 1PGSA 3HKCA 5BUVA 1J58A 1CQ9A 4SLIA 3LA3A 4D8MA 1OF3A 5FMDA 3SDLA 4FLWA 4ISQA 4S2FA 1CPMA 4HKWA 4IEPA 1QBZA 4R9DA 4GX2A 2O14A 2CTRA 4LBNA 4H14A 4H55A 5K7PA 1YJKA 3B94A 4AG4A 3V0AB 3ZR5A 2RM23 2L6LA 5BMVB 4IHJB 1NG0A 5HCBA 3C3TA 4EN7B 5FZ8A 4HN0A 3H9VA 3SJAC 3MYXA 4EQVA 1UZVA 5ABJC 1K45A 4FOWA 3PVBB 1W39A 1WGPA 4LKEA 2VJXA 4LLFA 5LA9A 1OXCA 4AQ2A 1AROP 2VVDA 4LUMA 1IBKO 4W6XA 4XBQA 2PY5A 5F32A 4K1ZA 4WFAV 2R72A 5E1AC 4DS0A 3JAWB 3OUHA 2GV9A 4B8EA 2HBTA 3U11A 1OOPB 4CCJA 1UZWA 1ZZBA 3G6JB 3AK3A 2WLLB 4JQRA 4RGGA 2LGWA 4JI7B 5IE9A 4JI7O 1OVSA 3ZYRA