5KHHA

Hcn2 cnbd in complex with inosine-3', 5'-cyclic monophosphate (cimp)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
194
Chain Sequence
b'SSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
molecule tags Transport protein
source organism Mus musculus
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
total genus 64
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khhA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khhA02
3DKWA 1ZZ7A 3GYDA 4HZFA 4MV2A 4IEVA 4R8HA 2GU9A 3I59B 2E9QA 3E97A 3EO6A 1YFWA 3ETQA 2GZWA 2D40A 4WBBA 4E2QA 1O3QA 4HSLA 4IERA 2XLAA 1NXMA 4E2SA 3RNSA 2PAKA 5BPXA 1UD1A 1O4TA 3EHKA 5LRRA 3I59A 1CAWA 2Z2SB 2ZCWA 4ZU7A 4XFFA 1Q3EA 5EFUA 3FHIB 4Q0PA 1ZZ8A 5FPXA 3SMHA 3O14A 2PA7A 1CAUB 3OGJA 3DV8A 2CAVA 3CEWA 3DL3A 2VQAA 4N9HA 4XEZA 3VHRA 1XRUA 2BEOA 4MGYE 5J48A 3HIFA 2O1QA 4HSJA 5FQ0A 3H1MA 3H8UA 4H7LA 1CAWB 4LEJA 3B02A 3FWEA 1DGRA 4YSFA 3U0ZA 3E5XA 2IXKA 2GC0A 2IXCA 3L2HA 1SQ4A 5KHHA 3BPZA 1ZRRA 1UIJA 3H7YA 3RDIA 2OZJA 2XLGA 4D7SA 4KWLA 4IEUA 4QM8A 4E2GA 1YUDA 2IC1A 4QGNA 4FT8A 1OD5A 4PIXA 3LA7A 5C8WA 1VP6A 2QDRA 1JUHA 1Q43A 1NE4A 2D5HA 1LR5A 4IEYA 4CYDA 5FPZA 5K8SA 4XFCA 3EBRA 3IDCB 2D93A 3RZZA 4HBNA 5BXXA 3E6BA 3MPBA 2N7GA 4A2UA 4MGKE 4ZU5A 1PM7A 4P9GA 4MX3A 3N4MA 1CAXA 4XFGA 4OFGA 4AVCA 3TNPB 4I09A 5KHKA 3OF1A 1RL3A 1O5LA 4FAGA 1LKNA 3R6SA 1EY2A 3ROUA 4Q0VA 5E16A 1ZRDA 1ZZ9A 1O3TA 4XF1A 3MDPA 4LULA 4FAHA 3LA3A 5I8YA 3I54A 1O3RA 2DCTA 3RYRA 1CAVB 1CX4A 1NZCA 1UW8A 3PVBB 4LLOA 4I3PA 4I02A 4OLLA 2UYAA 2QCSB 4LA2A 3SXWA 1OI6A 4AXOA 2BNMA 2PAMA 3DN7A 5JSOA 4N9IA 3H1WA 3WW1A 3H9AA 4QGLA 2GC3A 5LEKA 1OMIA 3SCFA 2ET7A 2O8QA 3SHRA 1LB2A 3ES4A 1WLTA 3USSA 4HN1A 2I45A 2OPKA 4AQ6A 2ZKLA 3WW4A 1XE8A 4L11A 1NE6A 4IEPA 2HKXA 5I0TA 2CAUA 4FBFA 3E6CC 2QVSB 2V09A 4MUVA 4QXKA 5HI0A 1FI2A 1NYWA 4Q0QA 5FLHA 2Z69A 4HN0A 4XETA 5KHGA 3FX3A 2QJVA 3BB6A 4EWAA 5JCTA 1CGPA 2K9ZA 4EWDA 3E5UA 3WW2A 1QXJA 1G6NA 3S0MA 2BGCA 3HT1A 1UPIA 1Y3TA 2XGXA 4IEXA 2FMYA 5I91A 4X6QB 3H7JA 1Y9QA 4I0BA 4Q0SA 4IEQA 1CAUA 2Y0OA 2MPFA 5J7MA 4IEZA 3LAGA 2XL7A 4KWKA 1LRHA 2BYVE 4IESA 4BIFA 2PHDA 4QMAA 1EP0A 5FQ0B 3NKTA 3H3ZA 3EQEA 4JTOA 2IXJA 5CADA 2XL9A 2Q4SA 3H3UA 5LRSA 3TNQA 3BALA 4TLFA 3H1YA 2ETEA 3CO2A 1VJ2A 1J3QA 5JAXA 3C3VA 1YLLA 2BNNA 3IIAA 3CJXA 2XKPA 4AVAA 3BCWA 1EYBA 4RD7A 1YFYA 1YWKA 2PHLA 2IXIA 3KMHA 2Q0AA 1I6XA 4JV4A 1GQHA 1H1MA 5JSRA 3MZHA 3LZZA 4ORFA 4AVBA 4J1XA 2XKOA 2VECA 3IWZA 2PYTA 3OD0A 3HQXA 2VPVA 1L3JA 4I0AA 5T3NA 1ZRCA 2P17A 2PFWA 4UBGA 4HMZA 1ZNPA 3SCGA 1QWRA 2EA7A 4X6RB 1I5ZA 2HJIA 2BNOA 2GC1A 2PQQA 3OTFA 2GC2A 2CV6A 4Z07A 4MZUA 3UKTA 5EZWA 5JR7B 4WZCA 4NVPA 1V70A 3NSTA 3BU7A 3KCCA 4YNIA 2ATFA 2WFPA 3RYKA 4XF3A 1DZRA 1YFXA 5JSPA 5BV6A 1CAVA 3FZ3A 3ST7A 1FT9A 1XE7A 3OCPA 3RYPA 4IEWA 5I8SA 1DGWA 4IETA 5C6CA 3IDBB 3MYXA 3KGZA 1RUOA 4PIZA 4LA3A 3E5QA 2PTMA 2IXLA 4I01A 1X7NA 3CLPA 4ONUA 1O3SA 3E6DA 3NVCA 1RTVA 3ZDSA 1YHFA 4O9EA 2CGPA 1WA4A 4Q0UA 1CAXB 3U10A 3GBFA 4UXAA 4XF4A 5CU1A 4HVRA 1H1IA 1U12A 2OYZA 4F8AA 3LWCA 3QOPA 5AVPA 1O7FA 3H50A 4YARA 4WVZA 3KGLA 3M3IA 3SCHA 3S7EA 3IBMA 4LTAA 1RGSA 1FXZA 2B8MA 3HT2A 1X8MA 2H0VA 4Z82A 1RC6A 1YFUA 5CVRA 5FLJA 5F1RA 1TQ5A 1VR3A 2C0ZA 1ZREA 5KHIA 2H6BA 4HVOA 4KU7A 5KBFA 4ZU4A 4HVQA 3LOIA 3PNAA 5I0RA 4XF9A 4MGIE 5FCCA 1J59A 1QY4A 4BYYA 1DZTA 3FE5A 3G7DA 3I7DA 3NW4A 1OFNA 1ZVFA 2KXLA 3ES1A 4F7ZA 2MHFA 4O9GA 4QM9A 1IPKA 2UYBA 4I2OA 1WGPA 2Q30A 4XFBA 1ZZBA 4YYOA 4BH9A 5I0SA 5FLIA 1ZZ6A 3UKVA 1X8EA 2F4PA 3M70A 1ZRFA 2EAAA 2GAUA 2ET1A 4QGMA 4B29A 4XF0A 4MH0E 2K0GA 3ACLA 2UY8A 5I8TA 5I93A 4L2NA 4YRDA 4JTNA 5BY5A 3D0SA 1UCXA 4K8FA 1ZZCA 4R52A 4KU8A 1O5UA 3D0JA 3JZVA 4EROA 4XFAA 3S7IA 4LUMA 3NJZA 2XLFA 4EWEA 2WC2A 1GQGA 1J1LA 3FJSA 3D82A 4Q29A 1RUNA 3PLQA 4KL1A 2OZ6A 4J1WA 1Q5OA 2FQPA 5I0UA 2XHKA 4AQ2A 5E1RA 2D5FA 3WW3A 1J3PA 1X82A 3U11A 4XFIA 3RPQA 4PJYA 5BUVA 1J58A 3ELNA 3EJKA 4LUKA 4PIYA 2UY9A 4UBHA 3CL1A 1QXRA 4KWJA 2IXHA 4D7TA 2B9UA 3QACA 4XFHA 4HLTA 2QNKA 5KHJA 1PMIA 4META 5FDBA 5J3UA 1SEFA 2Q1ZB 4BHPA 3FFQA 2H6CA 5D1IA 1SFNA 2PAEA 1EPZA 3KSCA 2GH2A 1UIKA 1J3RA 4GULA 3CF6E 4IEOA 4JVAA 2MNGA 5LEJA 1HW5A 2OA2A 3LA2A 3NL1A 3UKNA 1IPJA 2EVXA 4DINB 4MGZE 4QX5A 4EV0A 2B5HA 1ZX5A
chains in the Genus database with same CATH superfamily
3ZYRA 2VU9A 1L7QA 1G86A 2W95A 2E31A 1AI7A 5FK7A 3I59B 4CH3A 1BEV3 5B5EZ 1D5NA 3NR7A 1IHMA 4LKDA 3NNFA 4I9QA 1KITA 1LODA 5L19A 3SPCA 2YROA 4CEWB 1YZBA 3VKNA 1LR1A 4KXRA 3HEIA 5LRRA 3CXCU 1GRJA 3UCSC 4X88A 2NN4A 3O14A 1BQZA 3VL9A 4YFWA 1R081 3A21A 4QD2A 4XJAA 4ZZ5A 1NVPB 4K8XA 3FWEA 1OQDA 1MR5A 4N43B 5LMNO 5GLZA 4LR4A 4YIPA 3CPWU 3WHUA 1HN0A 4LFAO 3OEHG 5JH7B 1TNRA 4FJCC 3GVMA 1K5QA 1W05A 5A1FA 3P3PA 4Q2FA 4S2GA 3LA7A 2VQEB 3J81N 3UT5B 1OQ1A 3MD0A 4AOCA 4A42A 3JASB 3CMEV 3OEAA 3T2MA 3Q8BA 1VQ7V 3AKSA 3SH5A 4ZXEA 5IDJA 1DQ4A 4XBLA 3QO5A 3BKZA 1QIQA 4AHWA 1GTOA 4FAGA 5LW9A 1NH2D 4AI0A 4XCAA 1OOPC 4XW3A 4FAHA 4EN9B 1KC8W 4FPCA 4BW5A 1WW5A 4XJZA 1SLIA 3TN92 4RA0A 1UW8A 5B1BB 5LBBA 4AXOA 4GXLA 2RS33 4YLZA 5EC2C 2QTWB 4N9IA 3H1WA 3VQVA 3AKRA 5CFDC 1DF4A 4JYCA 2XAFA 3OGIB 4FIPC 1LJ7A 2NZ9A 1P7BA 2ZT9B 1HNWB 5CG8A 4I3GA 3UT5A 1QR8A 4FXGB 3POIA 2K9ZA 2AZ0A 2FTKA 4YM1A 2R042 1C8NA 4D69A 2Q73A 2UWBA 1DCSA 2JVDA 2D3OW 2JEXA 2GSMB 5C33A 4KH9A 5B1AC 2WWSA 3WNOA 4D6QA 4KWKA 5GJ6A 2G9ZA 1D4M1 2Q5TA 4JTOA 5DABA 1RJ8A 5A70A 5EWSA 3R0RA 3WF2A 3K04A 1EPWA 4BQ3A 4M4RA 3Q8EA 1G9FA 5CEHA 3BUCA 3ZXFA 1AXYA 1VIBA 1ODMA 3SEPA 2D6PA 1KQRA 5FXVA 3N9PA 2RR12 4UF0A 3T1YB 2O0OA 1YWKA 3D3IA 2VMCA 4DXSA 5J9PC 1I5YA 1Q6HA 1G4YB 1PNMA 1XL4A 4J6GA 4QB1A 1OV9A 1HLCA 4AWDA 4DV0O 2AENA 3K4DA 2JK5C 5IT6A 3HBZA 1MS0A 4DR6O 1WPBA 2P17A 3MDSA 3H8OA 5LL6Y 2EA7A 4TXWA 1DQ5A 3J8F2 4PDWC 3VBSA 4LF5B 4XACA 5KX5A 1Y4MA 2FMDA 1LHVA 5DAXA 5F5IA 1GO3F 3V0BA 1QR9A 4M3CA 1AR4A 3RRDA 1XJAA 4FPGA 2WLIA 3RYPA 2ZE6A 1F4AA 2EIGA 3AXEA 3IDBB 4OQ8A 3KGZA 4CDQB 2XXZA 4YW6A 4YW3A 3IMNA 2WO3A 3RQ0A 4QKBA 2B1IA 3RYFB 1SDDB 1RUH2 4XAEA 2WLLB 1FX5A 4FOVA 3UKMA 1HW7A 1JBCA 3VHNA 3SJQC 3NXSA 2UXBO 1V9U3 4GAZA 1U12A 4LF5O 4WVZA 3LEIA 5SV8A 5L3GA 4Q1PA 3LEGA 5DZEA 1ZREA 5KBFA 4DYLA 1CP9A 2Y6FA 1MVEA 2E33A 1YI7A 4XF9A 2A70A 3HKEB 5M0TA 1GN6A 1DQ2A 3MHHC 2VE1A 4X89A 2K46A 4I0XA 5IVBA 3SPGA 2VXJA 4QM9A 3E22A 4JDNA 1G8MA 5FBJA 2A3QA 3T0BA 5T5LA 4XF0A 4DRRA 1NJIW 4YHHO 1V00A 2HWC1 2YIDA 3OYWA 1C5HA 4O2BB 2D6KA 3ZM8A 1UCXA 3THOA 1C57A 4LUMA 3FKSG 1US2A 5DZGA 1RUC3 2HLDG 5FY9A 5I0UA 3VBFB 2P2KA 3ZX7A 1GM8A 1YTFD 3APOA 1VBA3 4NYKA 2V7QG 2Q8OA 3LDEA 2ZACA 1ZL8A 2ZE5A 3AM2A 4KWJA 3QACA 1E1RG 5C8CB 5LBQA 1NCQC 1X33A 3R4SA 4AHXA 2LW8A 3AZWA 5C93A 5A6ZA 3CWBH 1VBD3 3ZFEC 1WA8B 4TV8B 4JI1O 4B4RA 4TUYB 3CNAA 2Y4TA 4TV9B 4AI8A 2VBPA 3NL1A 3UKNA 5FIXA 3ZMNA 2HWE3 4DINB 1OOPA 4PDMA 1ZBA2 3OD0A 2R073 4D94A 1KS5A 1EAH2 1PMHX 4Y5SA 4DV5O 2BOIA 2ZKOA 4DXRA 3S3XA 2ZZJA 1AX1A 2XHBA 3RN4A 1W2BU 1NXMA 3GXUA 4FMTA 3W5NA 1S72V 2WNVC 4XURA 2GNMA 2DDUA 4JV5B 1IKQA 2VQEO 2WABA 5LHIA 1IS3A 1VBB2 3HPLC 1CAUB 4B3RB 3MF9A 2L35A 5J48A 1BBT2 5LOVB 3MO4A 1HKDA 2CAZC 2ZJCA 1NXD1 3GBGA 4IGPA 2ZS6B 3UGGA 3P30A 5CMUA 3GCWA 4HL0A 4QM8A 3QO7A 4NROA 5DN2A 1WW7A 1ZM1A 3FHAA 4IT5A 4A7YA 2QQKA 3N7KA 1C28A 1GN4A 3V0AB 2D93A 2OPWA 1MS3A 4I30A 3GZAA 4GH4C 3U14A 3ZRSA 2JS5A 2AYHA 2HYKA 1AYM3 1CAXA 3FHQA 3AP7A 1OCRC 3D36A 1JPXA 1WMDA 5FP3A 1JXNA 4DEVA 3A0BZ 3GALA 5E16A 1KD7A 1YJKA 5B1NA 1MEC2 1D5AA 1V9U2 2R071 2ZR2A 3VZJA 1XMQO 1JOJA 1LU2A 3DXRA 3JD73 1GN3A 1OBNA 1N8RW 4G2KA 3JAKB 4LFCB 3N2KB 4F6RA 1B06A 1SQQH 1THZA 1NLSA 1VBB1 2IH1C 4JDMA 4H2AA 4OGQB 3LOBA 4CUGA 2X53S 2ZGTA 4ZHQA 4MUVA 3B8MA 4LPLA 2JG8A 3TEYA 4IV3B 4QPIC 4CP0A 1VQMV 3BB6A 1XI1A 3FAVA 5LATA 4IEXA 3GCXA 4MGQA 3J26N 3IDAA 3MEPA 2XH6A 3ABKC 1SBDA 2JDAA 2EXIA 2HBTA 1F8VA 3AFKA 3PTYA 2BYVE 5TISZ 4JV5O 5LZ6A 4WF9V 2IU3A 3ABLC 5CADA 1UOBA 4XDPA 4ZXKA 2PHUA 1RUC2 4YXWG 2YMZA 5F5AA 4M4PA 2BNNA 1FXKC 2JX9A 2NMNA 4IE5A 4RD7A 2AXTZ 3EMRA 4FPYA 4BLJA 2LO1A 4C8DA 2FDJA 2XUMA 3ZFFB 3WNKA 3BYWA 4S2FA 1R64A 3M7AA 4LHSA 1FAFA 4HAMA 2A9HA 2LS6A 1PM9A 2LM3A 4FP2A 1UMZA 2NMOA 3SCGA 1XNQO 1WCDJ 2RJLA 3I2OA 4UCOA 3OUHA 3B00A 4NTYA 4AEDC 4CXWA 1BQ0A 2B9VA 3B94A 2ORXA 1NUKA 3OY8B 3BVOA 4CCMA 4JQRA 2N74A 4DUYB 1XQ8A 5EJ1B 2WSSG 3MI8A 1XBFA 1ZTEA 3FLRA 1DYPA 2ZGRA 1X7NA 5LGTA 3CLPA 5J36A 1NR1A 2E3CA 3T08A 5JOXA 4NXNO 5IJ9B 1Z7S1 1COV1 3S6PA 2EICA 2RMU2 1BVP1 1VBB3 2Q5ZA 5AC93 2BERA 3F5WC 2JDYA 5CU1A 3TYJA 5AVPA 5FRAA 3VOUA 2BSKA 3KGLA 3DEMA 3SQOA 3WQ0A 3IBMA 3SJCC 4HNAA 1NG0A 2F93B 3UO2A 1JN2P 2C0ZA 1F35A 3W7TA 3C7FA 3UESA 4HVOA 4UVCA 4LBEC 4AEDA 3OPWA 2H94A 4FI9A 3LSUA 1GP5A 2X6BA 3ZXDA 5C4WB 3K3NA 1FJGO 1LENA 1IPKA 2VO5A 4X8PA 4XFBA 1WCKA 2ADEA 3UKVA 1VRH2 3M70A 4LP8A 4E8CA 2B7YA 1DFQA 3UO3A 4CEWC 4UFLA 4X65B 4IE0A 3MLJA 1W59A 4XPVA 1N4CA 1EV13 2JJ1G 3NV3A 1GLHA 4LBLA 4R52A 4ZONA 4MXWB 5IATA 1XNRO 3D8CA 3G6EV 1A34A 3PLQA 3KB5A 2XHKA 2YU2A 4CU8A 3I2KA 5C8CA 1AR93 1UF2C 4LO8A 5GKAC 4QXHA 1FNZA 3OG2A 5A1LA 2QQPA 1WA8A 3OM3B 1OUSA 1B04A 5FMCA 4NXNB 2P5OA 3CCQV 3JALB 2P5BA 2WLIB 4COYA 4W65A 5C9AC 1AYN1 5AC91 5BNNC 4B7EA 1FOD2 1RUJ3 1EN4A 1KS4A 2HYXA 2XOKG 2MEV3 4IIJB 3G6BA 4GX0A 2TBVA 2CSGA 4NRQA 1FAYA 2GH8A 4UCSA 5CB4B 1COV3 3T1YO 1FYUA 3PUHA 3ZPYA 1S2KA 5IW0A 3N7LA 3JASA 3QD6A 4DK0A 4XTPA 4UV9A 3ZSJA 4YIOA 1CQ9A 3C3SA 2WZR3 4C1WA 2RE9A 4X66O 1BCCH 1J83A 1GZTA 2WFF3 3KT7A 1H2SB 4DV3O 3CEWA 2VQAA 1SKVA 4QQLA 3ZHVA 2NLJC 2Q69A 2BQPA 2VZPA 1XBLA 2IXCA 1ZRRA 3RDIA 4KWLA 2IC1A 3AK3A 3L72H 1OD5A 1K45A 3DXTA 3NJYA 2OS2A 3AP6A 4UI9L 4DO2A 1TMF1 2EXKA 1EV11 1HDKA 3VBBA 1DQ6A 2OCHA 4U7NA 2QZ2A 4YVWC 5A1AA 4XTMA 4GJZA 3AZXA 5F3CA 3RVHA 3U4SA 3M8LA 2DE0X 1IBLO 1BSMA 1RL3A 1SMVA 2WZ8A 3V0AA 1LKNA 5FV3A 3R6SA 5LYJA 3WDVA 4HKWA 4XF1A 2XUEA 2ZHKA 3ETGA 1HXS2 4LFCO 5EZYA 1W2AX 3CB2A 3WR0A 5FXZA 4WFAV 2ZAHA 5H2FZ 2Y69C 2UYAA 5A6QA 4XUQA 1R1A2 5LEKA 4CA9A 1R6TA 3VBRB 3SHRA 1E5SA 1LB2A 1WLDA 2I45A 1JYIA 1UXZA 2QBXA 2RDSA 4AQ6A 4JZGA 5IVEA 3ABZA 3ABMB 4QXKA 3PU3A 1K3IA 3AG3B 3UGFA 2QJVA 1PZ9A 2MW2B 4FCAA 4ZS2A 5GLWA 1CPYA 3UGHA 4FFFA 2EJ7A 5FZOB 5IY5B 5HFMA 4AQSA 4J9ZB 3ABLB 1L8DA 2B45X 3M99B 5HCBA 1WD4A 1OOPB 2XL9A 2QTOA 4XIOA 4AVVA 2UUBO 2GNDA 3OFNG 2B39A 1XNCA 2BTQB 2UU8A 1VJ2A 1QQCA 4AI1A 1YLLA 1Q82W 1AJNA 4RL7A 2IXIA 3KMHA 4M3CE 2VWJA 1LOGA 1AX0A 1DBNA 5DAPA 4TWKA 3OMNB 3J8F3 3HQXA 3I3QA 1Z0HA 4U3FH 1ZRCA 1KMIZ 4PDRA 1V55C 3ETDA 1RUG2 3NV1A 4DV5B 4KMQA 3E35A 4E2LA 4NRPA 5J2UB 3T09A 4XUPA 4NVPA 4Q4W2 1V70A 3KCCA 4KUMA 1BBT1 5JOZA 2QM7A 3LE0A 4IGGA 4BU2A 1S5JA 1Q86W 3OD4A 1BHGA 4AW7A 4OVEA 4JI1B 2DCJA 5DUWA 2UUAO 3INAA 4DR7B 5KAFZ 4I01A 3ZFGB 1OA2A 5JWPA 1SZBA 3M3EA 1JR9A 5FP8A 4CPBD 1W9WA 1WA4A 4JI2B 3AMHA 2BGPA 3T3YA 2EULA 3BRCA 1NTMH 3U10A 4IV3A 3E8GA 4GKJO 4XF4A 4NMIA 1WKYA 4IE4A 1F5FA 4XCBA 3GB7C 2ZABA 4LQRA 1FMD3 2H0VA 1TQ5A 3GM8A 1R6NA 1U5XA 3DYMA 3I97A 1UYXA 2E51A 3SNMA 4BYYA 3SH3A 3FE5A 3G7DA 4F7ZA 3VL8A 4DPNA 1MQTB 4O9GA 4CDUC 1WGPA 1RUG1 2P6JA 1IS5A 4R8CA 3K4ZA 2W1UA 2RS31 4DR2B 5CA3A 2VUDA 4GA9A 1FPN3 1N36O 3T4VA 3WG3A 1POV0 1TAEA 5I93A 1RUE1 1QH6A 2QQNA 4OYUA 1F51A 1K42A 4RHV1 5JMOA 4D3WA 4OZOA 3HMYA 2ZGQA 1SS3A 4Q29A 3KHBA 2WZPP 2OIEA 1PIV3 3WW3A 3PMEA 3K57A 3B9CA 4TN7A 2X0LA 4DV2B 2HVJC 1PVC2 4PLOA 3ZRVA 3AP4A 3POWA 2IXHA 1BT8A 4W6XA 1CR7A 1DTOA 2VUAA 5C8YB 4Y1ZA 4BHPA 3VZKA 3OOXA 2FCVA 3LSEA 5D1IA 4D6RA 3QLQA 2HWF2 4DNYA 5A33A 4HYOA 2EIKB 5IAXA 1PHMA 1I94O 4HPKB 4QPYA 5FY0A 3RYIB 1N33B 3KHCA 3K3OA 1SQFA 3AB0A 4JYBA 5BNOC 3EO6A 5J96B 1R1A1 5CBLA 3U37A 1AYN2 4GJYA 2UWCA 3JD2A 4DMIA 1W6PA 4B8EA 4O4JA 1M90W 2ZCWA 3PVEA 3X2QC 1UZVA 5IAVA 3ZXEA 4X8AA 4FLUA 3MV11 1UKGA 4IE7A 2YIAA 2Q8VA 4UWDA 1H4HA 1L7LA 3WP6A 1KKCA 2JIGA 4CEYA 4DY3A 5B4XA 3PUQA 4V2VA 5GTHZ 1RUG3 2GC0A 3BPZA 4LMFA 4FFGA 2IJJA 1K33A 4IGOA 1M56B 4XMAA 4LBJA 1QJFA 5JJNB 4RHV2 5JMCA 4NPLA 4FFHA 1V9PA 2VZSA 4XFCA 4R9AA 1JHNA 3O0WA 2AUYA 2QTSA 3MPBA 3M7MX 4WM8B 4DS0A 3H0OA 3BTXA 4XFGA 2BTOA 1PIV1 5F5CA 2W92A 4ASMB 4MVMA 1O5LA 4K0KO 1AXZA 1LGNA 2WYFA 4Q0VA 5FZ1A 3CU7A 4JGYC 2CY6A 1AP6A 4Y5Z0 3PVBB 4QE7A 1GWLA 1AR1B 2XVLA 4OLLA 2YZ4A 1FMD2 3RZGA 2R041 2BNMA 4E4DX 3W59A 2YUEA 4XJ8A 1BK0A 2RMU1 3SCFA 5CB4A 3ZIAG 5KUMA 4KWUA 2AZ2A 5FZHA 3RZHA 2ZKLA 4BW9A 3ZMVA 4Y33A 2HLEA 3JUUA 3LDKA 2CAUA 2Q1MA 3C7HA 2ADDA 4Q20A 3FX3A 1OC1A 4EZ4A 4EKWA 3GNEA 1REDA 3UJOA 3WW2A 4JI8O 1KXGA 1OXCA 2FMYA 2WLNA 5GM0A 4Q4V3 2ZXWB 2D43A 4EB6B 1R092 2A06H 1QH7A 2PHDA 3MLKA 4X8NA 3BTAA 5B2GB 1AR71 3CX5F 1VP7A 1XL6A 2G19A 5FYHA 4JGYA 5K7PA 2EIJB 5IK8A 1SCRA 4E4HA 2IUWA 2VD7A 3R65A 3BALA 1PMJX 3JU9A 3WQBA 1PIV2 3EXAA 4BPZA 3WDUA 1W2UA 2XKPA 2JECA 4BAYA 2XQRA 1YFYA 1E1QG 1FNYA 4LKEA 2R0FA 1N36B 4NXMB 3S5AA 3RVZA 2H8PC 2LROA 5LA9A 2BTVC 3BPSA 4S2DA 1HX6A 2RM23 1QLNA 3ZXJA 1M06G 1EFRG 2HWF3 4IYIA 5B1BC 1VBE3 1BE3H 4EN8B 3CDZB 1S0FA 4F6EA 2AW9A 5FR3A 3JD0A 3KV9A 4ZIBA 2VRZA 4QPJA 1DZRA 3RYFA 4LK7A 3MW2A 4IEWA 1AL23 2XBO1 3ML0A 1M4WA 1AROP 2QDOA 2K9PA 4UW4A 3TOJA 2YI9A 5LK7B 1QHTA 3JD4A 4ONUA 5FZ4A 2WT1A 1V6NA 1H8TA 2BOCC 1W8OA 4MXVA 1JFFB 3K51A 2CGPA 3M3CA 3MIGA 5HXMA 2BOBC 2XB6C 4EYUA 3CE2A 3T1CA 1LU1A 4GMP0 2HKOA 1TUBA 5GZEA 3PIJA 5GLVA 3IB3A 4GD4A 4IE6A 5LB6A 1X8MA 3VBOA 2DCZA 4BK4A 1J95A 4EJRA 3A23A 3J7HA 4RYDA 4XJWA 2J1RA 2RS51 1QJX1 3ZSEA 5FCCA 1W39A 4XE9A 5IWAB 5K4LA 2BVBA 1NA1A 3NW4A 4Q27A 2IH3C 4ES8A 5BMVB 5CA6A 2JG9B 2RV9A 1ZZBA 1G7YA 1AJPA 1VB2A 3L2YA 4HKLA 3ASNC 3MUY1 3CEIA 4JHTA 5DDJ2 2GMEA 2JXAA 2VBBA 1VEWA 1H8HG 1S2BA 4DR3O 5FLXN 1JW6A 4AAXA 2EILB 2DF7A 3ETPA 3TB0A 4XXPA 2W6JG 1GKFA 4V2WA 1RUH3 5JCOA 5LP6B 1W90A 2O57A 4DV4B 4HKOA 4SBVA 1W0JG 5FPOA 3MV01 4AHYA 3BCCH 5JLVA 2GP5A 4WFHA 4PJYA 3N2GA 2IW5A 5AG2A 3M3OA 3Q4HA 4BWAA 3CL1A 4TUYA 3KV5A 5ITZA 3R05A 4GIQA 1XU2A 5L3FA 4RGKA 4QPGC 2VMFA 5J3UA 3D3AA 3CCVV 4WVMB 3OW2U 2VWKA 2D3SA 5IJRA 3THCA 4CP9A 4J7JA 1J3RA 4GULA 1NCRA 5C9AB 3KQRA 2J42A 2OTJV 2IFWA 4PBPA 1AJQA 1CEZA 1IBKB 2HEVF 2E9QA 1UMIA 2VQUA 2EZPA 2DYSB 2G9FA 1LHUA 2Y60A 1JCHA 1ULDA 1BEV2 2WKKA 1QJU2 1HRV1 2RR11 4JYYA 4CXYA 1F15A 1WB8A 3KVAA 1TME2 3UETA 1T6BX 1FXHA 4MT8A 3EHKA 4FP3A 2W68A 3JARB 5DAQA 4DR5O 1ZZ8A 1X9PA 3I2HA 3N2GB 2PA7A 5I0DA 3WNXA 3TK1A 5A6XA 2ZDIA 4ZHNA 3LNNA 2CDPA 4LF4O 1PK6C 4MTFA 2N05A 2K2SA 3WQ7A 1OLME 2O14A 2IVJA 3ZFEA 4CDWC 1WMEA 4E2GA 2UXBB 1YUDA 3TBDA 2VMIA 3GHMA 1COV2 2VTXJ 4DO0A 3RZMA 5B3SB 1CZVA 3KZIZ 1H8EG 4N23A 3H1IH 3OTOB 4DR2O 3H01A 3WF1A 2TUNA 1NQDA 5F2VO 4ARXA 4HBNA 4AFDA 3E6BA 5A3TA 1XYPA 3WEZA 2RJ2A 4ZU5A 3JB8A 3AG2B 2DTWA 2WZEA 5KHKA 4E9KA 5KXEA 4GB33 3JBG3 3BIWE 4Z2WA 2VS0A 4MTGA 1TA8A 2A1XA 3W5MA 3O1UA 1BYHA 1KECA 2AZ5A 2Y34A 2DCTA 1FKAO 1NZCA 5T5OA 2J1EA 3BTYA 4Y1YA 1JQ0A 1J5EB 4DR4O 1HRV2 5CFCA 1SC5B 5FKBA 4LA2A 1OI6A 4TV9A 2ZX1A 5BNOA 3AZYA 4FFBB 5A3WA 4YZ5A 3Q8CA 5IYDO 5FYVA 4ZY9A 1WLTA 3USSA 2SLIA 3HNBM 2FZ1A 4LE4A 5T54A 4B3MO 4CUCA 1AR81 5J09A 1Q8VA 4MOAA 2EBOA 1XE8A 4PQQA 4IEPA 4MG2A 2HJDA 4TSFG 3PUIA 4FTSA 4UCVA 2HH9A 3NAPC 3HNMA 2X09A 4EWDA 1RUD2 4MADA 4LF4B 2JS3A 2WSUA 4FTEA 1Y3TA 4LBOA 2GALA 1WMFA 4ICGA 1WP7A 3V65A 1TVKA 5FYTA 3G6JB 4JZ2A 1KYOF 2EIJC 4FM1A 1WCUA 4IESA 2YIBA 2VMGA 3R66A 3PUSA 3AG4C 5D5QA 4L9BA 1UZZA 1UNBA 2AC1A 1OH4A 3TEWA 2ETEA 4GKYA 5A2QN 4FLXA 3N7MA 1OCCB 1NZIA 1ZBE3 3VKMA 4OXSA 4M3CF 4M0HA 1E79G 1NLRA 1NCQB 1SF9A 4PQ9A 1VF6A 1P4RA 1FXKA 4GZRB 1GOHA 3WVJA 5ISLA 2FBEA 4LKSA 5JPMB 3FB5C 3RWNA 4HK9A 1QJU1 3CP1A 3CCMV 4IV1A 1RHI1 4QQOA 1C5IA 1XPWA 3HJRA 4JZRA 1SBEA 4JRAA 5FZGA 4XF3A 3T4DA 4P00B 3A0KA 3K0DA 2QSAA 1UKRA 1UZWA 5LY2A 4PA6A 3ZHUA 1T2XA 5KXDA 1XE7A 3WY6A 1YQ2A 3AYDA 5JCOC 5I8SA 4DY5A 4H0LB 3AKTA 1SQXH 4CCEA 3KF3A 1RUOA 3QNEA 1LCLA 3GWOA 1RTVA 3AG2C 1VQLV 5L9VA 1FOD1 4YPJA 1NCQA 2I74A 3GBFA 3K58A 2W2IA 5G04L 4AEDB 4JI6B 3ILRA 3U1XA 3CCSV 1BHBA 2WYSA 1JOYA 3VBUB 3N3HA 3ABMC 1RC6A 2WLJA 3K79A 4A4AA 3V0BB 2PXJA 3T4HB 3PL0A 4PCRA 1QY4A 1CESA 1OFNA 1OT5A 1KFXL 2XASA 5C3PA 1OJHA 1F4NA 3OGGA 1OCRB 2UYBA 1VMHA 2CTPA 2ORZA 2X29A 3H8XA 4I9WA 2JG8B 4FM2A 1I08A 4X62O 2ET1A 3ZOIA 3VD9A 4IYHA 5HCFA 4I5SA 3N9OA 3FUQA 3CRCA 2D3PA 2DV9A 3ZSMA 2P4KA 1WLEA 5A3MA 3A7QA 1QEXA 4AGRA 3D0JA 2HP8A 1J1LA 3FJSA 5B1OA 1S0CA 1NTKH 4J1WA 3K06A 5E1RA 2D5FA 1H2GA 2KSDA 1OH3A 3LNMB 3EXUA 1VRH1 1Y7BA 2ZBJA 3ZO0B 1AR72 2V73A 4LO4B 2E76B 3U4XA 2UXDO 3E8BA 1QXRA 4J42A 2R9RB 2DJVA 2W9XA 2EINB 3VBFC 1SZXA 2QQUA 3WP5A 5ACA3 1Q90D 1C8M3 3BAAA 1OVSA 1XNBA 2EVXA 4MGZE 1SG3A 3V64A 2OUJA 4HZFA 3THTA 2ZEYA 4I55A 4OPHA 2R32A 3I2FA 3KD4A 1P8JA 5IVFA 4E2SA 1YEWA 3VBHB 3RNSA 2RG4A 2VW0A 1B6QA 4Q8KA 5EFUA 1U96A 2PF4E 1RVF3 4OUMA 4U3JB 2JIJA 3SYQA 5CA0A 2VQFB 4M00A 4O61A 2ENRA 2P37A 5CKNA 1ACCA 2BU9A 4JRLA 1U5ZA 5F32A 2HEPA 3ZHTA 2GMMA 5CFDB 1UMHA 4EN0A 3KT4A 5KHHA 3ZRXA 2E5LO 4FPOB 1G9CA 4JI0O 1VAVA 2YFZA 4X65O 1BZWA 3T2TA 4XDOA 4YM3A 1IBMB 1VP6A 5T52A 1LGCA 5FPZA 5FZIA 4X1YA 4YVSC 4ZOLA 4AFCA 4P9XA 1PL4A 5C4WA 4L87A 3PIGA 4P9PA 2JDPA 4L8JA 4NWWA 3CC2V 5BNPC 4XHXA 3WCSA 1APNA 3Q4HB 5DAVA 5FZDA 5D8AA 4AI2A 2VCAA 5LA6A 1D2QA 4QIWF 1FXVA 4K0KB 4YVSB 5ITZB 1PL0A 2DWEC 4ES9A 3IKWA 4N90A 3B7MA 5DZFA 3PTRB 1WNSA 5D5PA 3E2EA 4Q4X2 3RFRA 2F23A 1I5XA 1NT2B 4I02A 4OMDA 4AG4A 3LEKA 3DN7A 3H9AA 4LBQB 1S3JA 4LBKA 1VIWB 2V1DA 2O8QA 1JZ5A 5DDJ1 3B93A 5DUVA 4X64B 1KD1W 2WQ8A 1Z7S2 2W1WA 2DN9A 2XJVA 3WUCA 2AGAA 1ZWIC 4QDSA 3ZN1A 2W5FA 3E5UA 5K0UB 4HOOA 4NHLA 1JZ2A 1CN1A 1XMOB 2OWOA 4BQ2A 2JEUA 2YC0A 3O1PA 4X6QB 4WM7C 1Y9QA 1MACA 4LFBO 4QPWA 3LPGA 3SPIA 4E4SA 2GDFA 3KF5A 4LFBB 3AC0A 1GQPA 4QMAA 4YG6A 2IXJA 1X59A 1JZ7A 3KQ4B 2ADQB 3TAYA 5LRSA 1SQBH 1RFYA 3MW4A 5F2SA 1I0HA 2OYQA 1ASJ3 4DR1B 3H1YA 3IM0A 4QX1A 2CTQA 2JRIA 3CJXA 1MPXA 2BE3A 1UJWB 1EYBA 2VZQA 1WZXA 2ADPA 1T6GC 3J80N 5JSRA 3ZCCA 1Z5VA 1V6IA 4O4IA 2BBVA 1WW4A 1I94B 4BM8A 3RW0A 3VUOA 5CB7A 3W58A 3AG1C 4UBGA 1W28A 3CMGA 4UW3A 5GONA 1CVNA 4J7ZA 2HJIA 3WG1A 2BNOA 1HRI2 4QU2A 2VW1A 1H4GA 3BGAA 4FLWA 3NNMA 3BU7A 1D2SA 4A6OA 1IS4A 1YFXA 4KQ7A 1GM9A 5J37A 1PVXA 1DGWA 4Q4X1 5BNOB 3FBYA 2Y8KA 3ATGA 4PIZA 1RUF3 4W4LA 4TV8A 1OCOC 3NAPA 1YNAA 3WG4A 1O4YA 2W52A 1AB3A 1RVF2 2HHHO 4LBMA 1XILA 2ETNA 2A79B 4LNUB 4OX9O 3F95A 4YARA 5AC92 1ENVA 5FYCA 5BNQA 2A3XA 3ME2A 1HB2A 4IL7A 2JIZG 2AHYA 1LOBA 1MQTA 2PYLA 5KHIA 1SA0B 1FFTB 4BDVB 3O9OA 4DK1A 3UM7A 4XZUG 3ZLIA 1DQ1A 4HANA 3I7DA 1JS9A 2MHFA 4UFJA 4FVVA 4XBNA 3ZYPA 3OUIA 4BXSV 4Q4W3 1K8AW 1S76D 1PM4A 1ASJ1 2IJIA 2ITDC 3B8NA 1K92A 2OUHA 1PK6A 3KCXA 1S1AA 1UY1A 3JAWA 2DVFA 1KU9A 4QPKA 1JYWA 4Y22A 2HVKC 4K40A 1B35A 1PD3A 3L73H 1YXWA 2HEWF 2EALA 1W3VA 4QX7A 3GJBA 1S0BA 1NT0A 2KA3A 3B4SA 1X82A 4XFIA 5BR8B 4CZZA 1ZA4A 2LRPA 2PGGA 3BU0A 4UT5A 2QKAA 1Z7S3 2QFEA 2DVAA 1XOUA 1D4M3 1ULPA 1I9RA 4META 5FDBA 4Y20A 2FKXA 3FFQA 5F5QA 3K9SA 2GH2A 4XJ9A 1MOFA 2YG0A 4GMP1 5IYZA 4U36A 4YG0A 3OEEG 3POBA 3CJIC 1AXKA 5EHDA 3ZFGC 5CFCC 1US6A 2P1BA 4COWA 3CXHF 1ZAUA 2RM21 3WNMA 4MXWA 1VMGA 4Q5OA 1JYCA 1Y43B 1LHWA 4YW2A 4RQEA 3CMAV 3P1IA 2RCVA 4CE8A 2V5YA 1A78A 4QKFA 1CAWA 5A32A 5IYBO 4XUNA 2XONA 3SMHA 3I2GA 3M1HA 4CC6A 1OZ0A 5J1XA 2ZE7A 5HV0A 4FLVA 5FY7A 5L9BA 3AG1B 1POV3 3J9SA 5FQ0A 1WD3A 5EYPA 4Y26A 1DGRA 3QG5A 3E5XA 4XIKA 1PNFA 3W7XA 3H7YA 1X50A 4QKNA 1DYKA 3IDEA 2FZ2A 4IIJA 4YHHB 3GHNA 4PIXA 2QDRA 4IEYA 3L75H 5K8SA 3UL2A 3EBRA 3K0GA 4MVZA 1U5IA 4JGZA 4H33A 4UVAA 4TTGA 4OFGA 1LOAA 1RHI2 3MPPG 2C4XA 4FPFA 4BE3A 5A80A 3I2DA 4FTBA 2CL2A 1M93A 3F5TA 2VVDA 2VQTA 1F5JA 3RYRA 5FBZA 4CDWB 1O4ZA 1LECA 5H9RA 4QGLA 2WQZC 1TE1B 2R30A 1BLZA 3EHBB 4K3AA 3ES4A 3JSNA 3W21A 1R3JC 2VG9A 1GMMA 1V6KA 3WW4A 4LCUC 3C7OA 4XXAA 4Z8BA 5I0TA 3K5MA 4UCUA 4QAWA 2JGDB 2J1TA 2ZMNA 5H9SA 5KA6A 3ZR6A 1FI2A 3T1MA 4I7ZB 2GUZB 1RUC1 4BWOA 3WD5A 3VV1A 4AVTA 5DM6V 3D5OA 2Q9LA 1VARA 1G6NA 4OUEA 1SBFA 4RFRB 3K5OA 1OA3A 2JG8C 1GYKA 4U3JA 5B4NA 5J7MA 2VCBA 3LAGA 2YC2A 3OR6C 4OULA 1YO8A 4C91A 2IVIB 4CU7A 4HK8A 3HNYM 4I0WB 1TMF3 3H42B 1ZBE2 1K97A 3RZLA 3VN4A 1MSWD 3AXDA 2H3OA 3AP5A 3MBWA 1Q81W 4LXLA 1RUE3 1H1MA 3LZZA 3PMSA 2WO2A 5F3GA 4AVBA 4YFZA 2ZGLA 5DQ0A 2EX3A 2XJQA 2WA3A 1UU6A 2A75A 4XUOA 5KLVH 1HNZO 1AJOA 2GUZA 2OXBA 4A7KA 1VF7A 1AZDA 3VD4A 5LP6A 3SKJE 4FOQA 3J7MA 1N34O 5CIRA 4KG8A 4FPEA 3VD7A 4QQPA 3RYCA 5LWBA 1LNSA 4MVTA 1EN6A 4QDRA 5FWEA 2QJ1A 4RQFA 2BWCA 2AACA 1GNZA 2VCCA 3I2IA 1FV3A 2IWGB 2VNGA 1XNRB 4H55A 2VNVA 2ZZQA 2PI5A 1NCRB 3W7SA 2C9KA 1URFA 5IYZB 4RS5A 3ZDSA 1YHFA 4O9EA 5BXZA 4Q0UA 1CAXB 2G4IA 1W9FA 3QOPA 3M3IA 2D7FA 2Y6KA 3WG7B 5KR7A 3RMXA 3FYIB 4LNVA 2J1SA 1H6YA 5CVRA 3SPJA 1SQGA 3P3NA 3ZR5A 3ZHSA 2B46X 3CJIA 2FDIA 2P3KA 3AJZA 5JOWA 1QVFU 1O6UA 5I0RA 2Y48A 4X64O 2WAOA 3B5LB 3MIDA 3KVBA 1SERA 4JGYB 3VQWA 5JIUA 1JU3A 2OTLV 1N1SA 4JKKA 3BY6A 3AKQA 1B35B 3VLBB 5LYJB 5FK8A 2F4PA 5GZCA 1UZYA 5LBCA 1IBKO 3CC7V 2EAAA 4UB8Z 1NA1B 4B29A 4H14A 1K73W 3X29B 4KG0A 3ZFFA 4C7UA 3RJRA 3TEXA 3R4UA 3N35A 4LHNA 4KU8A 1NQTA 5FY8A 1VQKV 3WCRA 2YXSA 1RXFA 3D82A 1WJZA 4BQYA 3ASOB 1AF9A 1LOFA 1GUIA 4LWSA 4BZ4A 3WQ1A 1H8VA 2YPDA 5FO8B 1XHXA 4W6WA 1LOEA 1JU4A 3EJKA 3T0DA 1X4TA 1OURA 2QWRB 4UBHA 1Q8IA 1NS1A 2B9UA 4P9YA 1B09A 5KHJA 3FL7A 1QHDA 4CEYB 4PDWB 4MW8A 4LF6B 1GZWB 1AI6A 4PI2A 2OIIA 4K3UA 5LGUA 2WO7A 5LMUO 4DR3B 1FMD1 3JALA 4EV0A 1RUH1 1DF0A 1YVWA 3AG4B 4XZPA 4RFT0 1CONA 2ZEWA 5GALA 3AK1A 3ZVXA 2QDNA 4DV7O 2Z79A 1LTEA 4WBBA 1HQLA 1DP0A 1KKDA 3ACFA 4JASA 1LUWA 2UXNA 4P30A 1N47A 5BPXA 1KBHA 4Q4V1 2P4EA 4NOTA 3ICXA 1O4TA 4FK5C 1GAXA 2WJSA 1GM7A 3LF7A 1H30A 1YCIA 3RWRD 4DUWA 1LOCA 1Z5WA 5JJEB 5IJ0A 4FM0A 5EPAA 5IFPA 1W06A 3BA9A 1QLEC 1CAWB 1DU3D 3JSLA 4PDWA 3DSQA 3U0ZA 4JI7O 4JDOA 2UUCO 1F4HA 3JD3A 5JXGA 4DR5B 3F7YC 3WZ1A 3C7EA 5DG2A 5FOBB 3RZZA 2YI8A 2DUPA 2YIBD 4LO6B 3POEA 4B3TB 1XMQB 5JH7A 2C6SA 4RHV3 4DEQA 1SZTA 2K1EA 1ULGA 2N7GA 3FLTA 1H2KA 5E88A 2CDYA 2ATKC 2R9IA 2EXJA 3OBAA 3JYCA 1R6KA 2D6OX 3RI8A 4P9OA 2FDFA 4LF9O 3JAMN 1REFA 1K12A 4PA4A 1TVGA 1UZ0A 1FS0G 3HKCA 4X62B 4JPRA 3RBZA 5IJ0B 3M8AA 4UFZA 3QF7A 2JJ6A 2JB8A 2HWF1 2UUBB 1UU4A 1ND2C 2V4VA 3OAAG 2XOMA 2XMLA 3POYA 4W4ZA 2Q68A 4GALA 3O1TA 5FO7B 2DUOA 4CU9A 2OX0A 4XC9A 4CZSA 2RQ6A 5FREA 3ZHQA 1HXS1 2D98A 2XAJA 5FLHA 3SITA 4UVBA 2XHNA 4CUBA 4CDXA 5H9PA 3H7JA 1OLQA 3ACGA 2UXDB 3P5BA 5ANQA 1AVMA 3RSJA 3H1HH 1RB8G 2OT5A 3PUAA 1Y74B 1S55A 2W3JA 3J7LA 4GB32 5LA1A 3N9QA 3C3VA 1GSLA 5IWAO 3IIAA 3BCWA 2RS53 5CBHA 3SJBC 3ECQA 4XDLA 4YJ3A 3UT0A 3VBSC 3NNJA 3EFFK 3AG7A 3CJHB 4RSUA 5A33B 1L3JA 2FDKA 4WFBV 1ZNPA 5FMOS 4X1IB 4QPIA 5LK5A 2WO1A 5EIBC 5K0UA 1KP3A 1PO13 3OTFA 1QLEB 3ILNA 2WT2A 4MZUA 3UKTA 1Z2GA 5EZWA 2VC9A 4AI9A 2HWE2 2WFF1 2B9ZA 1QOSA 2JDHA 1Q8SA 4DFSA 2HWD3 3FFZA 5BV6A 3ST7A 1O91A 2D2CB 4GWJA 4NAMA 4DRXA 3O12A 2P22C 4RUFA 4RR3A 4MSWC 1YIPA 2PTMA 3OUFA 1AL22 4QT6A 3JQXA 1PGW1 5J2TA 4UW5A 4N8MA 4P08A 1PGL2 2HG5C 4W6YA 3WFVA 1M4UA 1UWWA 1Q8QA 4O4IB 4C0HA 2PHTA 2OYZA 1YJ9V 4P02B 4DQAA 1A6CA 3S7EA 1DHKB 4Q4Y2 2ZCEA 4N21A 4PLMA 2ZIMA 3J4UH 3SYPA 4HVQA 4X1YB 4ASLA 3APBA 3PNAA 4QU1A 3RMYA 1EN5A 4AAPA 1VB4A 2WWUA 2JDMA 2Q8EA 1CPMA 4OHXA 2QQMA 1RSOA 2Q30A 5AVAA 1JODA 1YRZA 1ZZ6A 4AYUA 2NLRA 2X5IC 2P6CA 3GJAA 3M4FA 1IDSA 2A6YA 2WIIB 5F6LB 1D2DA 2VOVA 2DYCA 4JI3O 2A6XA 3NNGA 5F3EA 1C4RA 2EIBA 1MEC3 2E53A 1ZZCA 2QQOA 4KHPB 1G9DA 2E26A 2Y6JA 1NU1H 2P4VA 1J84A 3ASIA 1IOAA 1RUNA 4GKXA 1NI8A 2W47A 3PVOA 4CS3A 1XC6A 4G9SB 4OX9B 1D4M2 1EUUA 4R9CA 4ZKIA 2AGSA 1XHZA 2Y26A 1NKGA 4NWVA 2VY0A 1W9TA 3WNLA 5FO9B 4LWSB 5FP9A 2V72A 3I56V 1OVPA 2PHRA 3LEMA 4NHKA 2GHYA 1SFNA 3PDQA 4PJ0Z 4DR6B 4DUVA 5JVDB 4C1XA 4EN7B 2DCYA 3O65A 2E75B 4FOWA 4C90A 1W6MA 1QJX2 1PK6B 4F3JA 3B77A 4MV2A 4ET7A 1NZ6A 2VVFA 4V1PA 2P06A 1AR63 2GZWA 4HSLA 1JOPA 1J5EO 2XLAA 1K9MW 2Q8DA 1VMJA 3VQXA 5DXDA 1VQ8V 2C26A 5LOVA 3HN1A 3GBWA 4ZU7A 1KB9F 3OGCC 5GZDA 2HBUA 3OGJA 3WNNA 1I3HA 3DL3A 1N3PA 1SLLA 2VULA 4M01A 3VHRA 3ZKYA 1FFXB 4MGYE 3HIFA 3KG2A 2ZKNA 2ES3A 2BDRA 3I3DA 3B02A 4YSFA 3VDDC 3L9DA 3K77A 3SLIA 2W91A 2MK3A 4DIQA 3WB0A 3PURA 2RS13 3RVYA 3B01A 5FZ6A 3LB9A 4WCEV 5GTIZ 1O8SA 1LEDA 5JXIA 4QGNA 2PHWA 3GDBA 1NLQA 2BZDA 4JI2O 5FZCA 2Y6HA 2WINB 1JUHA 1Q43A 5EK0A 3CBNA 3L9JT 3FYEB 3AMQA 3LSSA 5FYIA 3O1RA 3MLLA 4K6BA 3ZN5A 3I5DA 4X20B 4CC5A 1JJ2U 2X8KA 3DGEA 4RN5A 4DW0A 2ZHMA 4AVCA 1Y4WA 3WG2A 2VCMA 1EY2A 4QWNA 1HB4A 2BSKB 1XNDA 1HV1A 4GLXA 1GWKA 2P3YA 2VVEA 2GTAA 1ULCA 1CAVB 3TEZA 1WCQA 2J1VA 1GZWA 1VAKA 1EAH1 2RJZA 4I3PA 1WB7A 3T1HB 1HR0B 4CH5A 5FWJA 5FP7A 2PLV2 2Y0IA 1HRV3 1RMU2 2RR13 2JG9C 5FPLA 2WSVA 1L0NH 2V5DA 3B9IA 4DUXA 3QO8A 3ZXAC 5IVJA 3HR9A 1UX6A 4UUJC 2YDEA 2QVSB 3ZYHA 1MA1A 2F95B 4PF1A 1NYWA 3NQHA 2GNBA 2H0BA 1BEV1 4Q0QA 2R9AA 4O4HB 4EWAA 2CWMA 1S2EA 1RUI3 1BXHA 1XXNA 2JB4A 4BOWA 3ETEA 2QQLA 1XQNA 1UPGA 4RGGA 3ZBHA 2D44A 3CSXA 3RYCB 3I49A 3WDYA 4FLZA 3OGVA 3ZN6A 1LRHA 5FY5A 2Q8CA 3HPNA 4AVSA 1NH2B 3B2EE 2DU0A 1ZYBA 3H3UA 2KQXA 5A3UA 4MLOA 5BMVA 1H9WA 1R73A 4UCTA 3A0RA 2OIGA 1Y9MA 5DEDA 3ZYBA 2C5DA 1TME1 3MAQA 1W2OA 3NKGA 3KV6A 4YJ2B 2YV8A 5T3NA 5DECA 5C5TA 5KA5A 2F43G 1OHFA 1VRBA 4R50A 2CV6A 2YBSA 5TSWA 4F4LA 2DYSC 2W1QA 3B40A 1WAZA 2EIMB 4LF8O 3ZMUA 3NO8A 4MSVA 4MYEA 3OJBA 4K21A 2O8OA 1TMF2 5A32B 1AR62 4EN6B 3O0XA 3WLUA 5HCHA 3E5QA 2RDCA 1DDLA 4PLNA 1S5HC 3LDDA 5A7WB 3ZEDA 2WS93 3NJVA 4FFKA 4UXAA 4LORA 5HV4A 2VZ3A 4TZDA 3FAVB 2TEPA 1S0GA 3K3WA 4Z82A 1RUD1 2X5IB 5A3OA 3J7AU 1RUJ2 1QKQA 1JUIA 4LBNA 2BP6A 2WAMA 1ND3A 4ISQA 2Q4PA 2QA4V 1PO23 4NHYA 4MGTA 3ZSLA 1J59A 4EFBA 1JTZX 5C71A 1KDKA 1AR82 5KC6A 2WLMA 2FCUA 2VQ0A 1HNXB 4GX5A 1GICA 5GLTA 5FJKA 2DQ0A 4PV1B 3POFA 3S30A 1X8EA 3ZXGA 2IJKA 1VBC3 3I3BA 3U07A 3FX7A 2R072 4FVMA 2CH7A 1LGBA 3CIHA 4J80A 1L1FA 3UYJA 4YZ2A 1IX9A 4K8FA 1VALA 2CUGA 1HXS3 1M9NA 1US3A 3I55V 3A4UA 1GU3A 4XQDA 2Q7HA 4Y1XA 3ASNB 2L9LA 4COZA 4GQ7A 3BVCA 3AK2A 2EXHA 1LNQA 1NQJA 3ILFA 4CCKA 2JGDA 1IG3A 1OSGA 1QBZA 4LE3A 1MQTC 5JOYA 5BZBA 2GBOA 4JI4O 3S3WA 1AR73 5H6RA 2WS91 3MUZ1 4JI8B 3JD71 5E8AA 2Q0OC 1MS4A 2VM9A 1MS8A 1UXXX 3ALQA 5FOJB 1OPOA 2XQXA 1R083 4H37A 4QX5A 1UU5A 4JI5B 2B5HA 3O7OA 1ZZ7A 4Y20B 1O8PA 1H38A 1FYJA 4ISRA 1QJEA 4IEVA 3K5NA 4COUA 1GK9A 1W03A 1V9U1 2YXYA 4P9JA 1QQP2 2VNOA 1VPHA 3IT8A 1JHJA 1H9PA 4OUSA 3SYOA 3CS5A 3WDTA 4FPKA 4ASKA 4PDLA 1GN2A 5FZEA 5EIYB 2CAVA 3CZUA 2VOXA 3SYCA 3NMBA 4JQTA 4OI1A 4FQZA 1C1LA 4HSJA 2XBO3 4P5HA 3H8UA 1WMXA 4QX8A 4GB31 1IQDC 4TOIA 5L3DA 5IYYA 4XOGA 3LSQA 1W0OA 4YGEA 2IXKA 2E32A 1G9BA 4RS5C 2ZGPA 1LOFC 4FT8A 2AHZA 2QEXV 2A7AA 1K3EA 1AI5A 5FYZA 4XJUA 5IUQA 1NE4A 1HQWA 3L71H 2D5HA 4CYDA 2W39A 4TT3G 3QTCA 1DGSA 4M0NA 4PELA 1EM1A 1UY2A 4Y4YA 2GV9A 3L74H 4P9GA 3JCZA 2R063 2I07B 1L7RA 1VQ6V 3AMNA 4DUYO 2CE4A 2PY5A 1HDJA 1L0LH 2WA4A 2A7WA 4MW3A 4WV8A 2OCCC 5BNNB 1F9KA 5I8YA 3ENRA 5K0UC 1PNKA 2YXLA 3ZJZA 2P3IA 1Q6UA 2WL1A 1LHOA 2P34A 5IY5C 1W3XA 1MS5A 1XNQB 2BCCH 3WW1A 3AYAA 3WXPA 2ID4A 3A22A 4E27A 3E1F1 2DVBA 4J25A 1GH6A 3VDAA 1GZCA 3V56A 5JXHA 3HKDB 5HXVA 4IXLA 3FB8C 1YQ8A 1Y66A 5KMGA 3O1VA 2RDRA 1UO9A 5IT9N 5JCTA 2QQJA 3WP3A 1YF2A 3AYEA 4YZ1A 4TLGA 1KGYA 3SEEA 4AR2A 5HBAA 4LK6A 4HT1T 1G9AA 4XQ4A 3OR7C 1NAEA 3FC0A 4BR6A 2CTVA 4H13B 1D0HA 1Q7YW 2Y0OA 5EJZB 3JCUZ 1FFXA 4PBOA 4BIFA 3DKQA 5C3RA 4AEKA 2WNEA 1MSDA 4Y5TA 2Q4SA 4NUBA 4O2AA 3JD72 3FB6C 2UURA 3O1OA 3CRAA 4DUZO 1LESA 2WN2A 3NAPB 4RQPA 1VQ9V 4AEMA 5J2TB 3B3QE 2R061 2VOKA 1I6XA 3MZHA 4LH7A 3TCUA 3IWZA 2E6VA 1RM1C 5A7NA 3CKHA 4MO3M 1XNAA 4G28B 4Y1UA 2CYFA 1JYXA 4JKMA 3IAYA 5JR7B 1OF4A 4EEQA 2F66C 3DC5A 4WM8C 4AE2A 4PHZA 5LXTA 3H3LA 4NAOA 2XAHA 2WFPA 3RYKA 4LFAB 4XDKA 3NJXA 2DUQA 5GLUA 4O4JB 1QQP3 3ZYJB 3PJSK 4YY3B 1YI2V 4IETA 5IK7A 5C6CA 1SDWA 5FZMA 4FFBA 3S5QA 1ENQA 2YC4A 4GZ9A 4JCKA 1PVC1 3U75A 3GWKC 3G67A 1DGRN 3ASOC 5KUKA 3E86A 4RQPB 4G4FA 3B09A 2JE7A 4BXFA 2P7TC 3CYOA 4YW5A 4K8ZA 1ND3B 1O7FA 1QMJA 3ZKUA 4AQYB 2MEV1 4LTAA 5GONB 3HT2A 4MVRA 1AL0G 3O0VA 4J11A 4DV1B 5FY1A 5LA2A 2VTXA 3LOIA 4PA3A 1ZSPA 1XB9A 1XSRA 4BLIA 4K7JA 1BKZA 5F3IA 3W20A 2YXHA 2Z5UA 2VZUA 2JD4A 1YJLA 4OHZA 2R16A 1HR0O 4QDQA 3MHSC 2VOTA 4RR3B 2R043 1NA1C 2ZA9A 4B3SB 4QGMA 4GYCB 4UOJA 2RMU3 2ZMLA 5L7OB 3AKPA 5IVYA 5FZOA 5BR8O 4FFIA 5BYNA 2WNUC 4YM0A 1REEA 4MGSA 3JZVA 4AZZA 3OMIB 1QDOA 1V6LA 1GQGA 5K9YA 3WNPA 5FZAA 4CEWA 3OSDA 4N53C 4B08A 2JICA 3OYWB 1QOTA 3HKDA 4I4TA 3RWKX 3RPQA 4QPGB 2Q1FA 2IZWA 1PGL1 4P5YA 4CRQA 4D7TA 2XWJB 3VBUC 1RIRA 1JJOA 4N43A 4CUAA 4CDQA 3HKBA 4AGGA 1FXKB 2G38A 1UIKA 2MNGA 4D6SA 1JYNA 4LF9B 1GFF2 3DF0A 3AFGA 5LBEA 1WLWA 1YSCA 2DBNA 3C3TA 2QE3A 4FXKB 4PD4F 3ZS8C 2CNAA 3ETQA 4QX0A 4X20A 4K1ZA 4E2QA 1POQA 2JDUA 2XR4A 1HQNA 3GF6A 4HXCA 1BMFG 2M7WA 2Z3YA 2PAKA 3CJIB 3R4DB 1UFIA 4IL6Z 1VQNV 4J9YB 3PN1A 2IJHA 3PJQA 2E63A 1IPSA 3LD8A 2BV4A 4MTOA 1WWYA 2DBIA 4G3YC 1UL9A 3RI9A 1B3QA 3VHOA 2MEV2 5IFTA 1SQ4A 3OGRA 2G1MA 1R1A3 5CA1A 1VBE2 4X1KA 1BZKA 2OW4A 4NRMA 3PHMA 2R49A 4FZ0A 2F1MA 3HN3A 3OEBA 3T4ZA 2V4AA 3A0NA 2CGNA 1S0JA 5F7UA 3OMAB 3KKYA 5FMBA 5ABJC 1XU1A 5FMDA 3N36A 4MX3A 3D4KA 4IUGA 1ZBA3 2R6QA 4S2HA 1EZJA 2OVUA 1CIYA 4UV8A 1WW6A 1W0KG 2WNVA 5BNPB 3ROUA 5C3SA 4GH4A 4IHJB 3K08A 1O3TA 5LMUB 2XDVA 4EFEA 3LA3A 4BCUA 5A7QA 1VAMA 5F9TA 2KKWA 3LDBA 5CN0A 1I7FA 5LHHA 4HETA 2QCSB 2ZAAA 2VJXA 5FJHA 5FMOL 5JSOA 3WP4A 4RUEA 3HKCB 1TG7A 2ET7A 4BMBA 5E89A 1VBA2 3VKOA 4OHWA 4CU6A 4TWTA 2QGNA 2DMXA 3OUSA 2ARXA 1M56C 4L11A 1EBOA 1W2NA 2HKXA 1XNKA 1XYNA 5SV5A 3N7JA 4LBQA 2F4VO 4QHZA 3USUA 4DXZA 3LGRA 5I91A 1K5JA 1SA0A 4K8RB 2J22A 3ZFFC 2EAKA 2C24A 2BJSA 4HPKA 3VD5A 1EP0A 3AL6A 3EQEA 4AGVA 4QX2A 1HNZB 3H1JH 3VBOC 5JPNB 5L3EA 5ACA1 5C3QA 4ZBMA 4C0BA 4I55B 2HR3A 1R1ZA 4N53A 4OHYA 1ULFA 5F37A 4E4EA 4CTEA 2DVDA 4BQWA 1BK1A 1K7DA 4JV4A 3P32A 2OQ6A 2YYOA 4H7MA 2VECA 3EYPA 3T30A 1RUE2 2ZX0A 4N7IA 4ZZ8A 2RVAA 2WAAA 2P3JA 2LQTA 1RUI2 4XBFA 3BODA 3POGA 5CA0B 2B4KA 2DWDC 3CJHA 1UOJA 1XE0A 3A2FA 1ORQC 3BOWA 3OUJA 5IJ9A 2WT0A 1GWMA 3FZ3A 1KJLA 2LP7A 4A44A 2JDIG 1W8UA 5JDBA 5KXCA 4LA3A 3NV4A 2JWPA 3DPRA 2IXLA 5FZ7A 3VZNA 1M1KW 4LJHA 1VQ4V 4JI3B 4QQ2A 2ZINA 1K34A 1Y9GA 5CBFA 1PO11 3W9AA 3A0HZ 1I5PA 5CAZA 1VBE1 5EP9A 2A3YA 4HFSA 2VZRA 2GNTA 3WINE 2Y6LA 1ULEA 1UN1A 1FXZA 2KG7B 3CCUV 1AL21 2JG9A 5D8AC 3WDXA 1W8ZA 3L70H 2R0HA 2ZX3A 1TZOA 3FUOA 3THDA 4QX3A 2XJTA 1QOOA 2LALA 2DFCA 4I2OA 4KBBA 3WF0A 3HOBA 4RO2A 5FPUA 3ZSKA 1HNXO 2LW7A 2AH2A 4DB5A 2GAUA 1G1XB 2VZOA 4ATEA 4MH0E 3NWKA 4CDUA 1DLBA 1RPRA 2QWPB 1YIFA 4WM7B 5BY5A 2GDSA 2A6VA 4BQ5A 4GMP3 2EIKC 1ENSA 4KL1A 3IMMA 5FXXA 1W6NB 2A3WA 2Y4UA 1HNWO 4HG6B 4GKJB 4PA9A 1K5MC 2DYRC 3LUTB 4AILC 4PIYA 3SH4A 2BWAA 2RDNA 3DTUB 4JGZC 5E79Z 4B7KA 2L6LA 2YGMA 4D0QA 3J7NA 3THPA 1UX7A 4OZXA 4DR7O 2H6CA 3WHTA 1H2LA 3AEIA 1STMA 3N27A 4JVAA 3K5LA 5L36A 4GWMA 1VBC2 3WG7C 1K4CC 1Z78A 1GOFA 5F2WA 2QQVA 4Z92B 3ZMTA 3K2OA 1MMMA 2GU9A 2W6IG 5GW7A 1JYTA 1D0GA 2A6WA 2KR2A 3LPFA 1AI4A 5FUPA 3DYPA 4URTA 1CPNA 1M57B 3I59A 3OBTA 4XFFA 4Q0PA 5C8CC 5FPXA 4YZ3A 3M3QA 1ZUQA 1NTZH 2VNRA 3ZN0A 1UYYA 3ZN6B 3K75B 1V0AA 3KCYA 4B4QA 1F31A 1HJGA 3G71V 3DCQA 4D7YA 2O1QA 3H1MA 4K1YA 1MS9A 1FD9A 5JUVA 5JVVA 1J1TA 1RUF1 4AQYO 3BABA 4UYBA 5FZ0A 3I8TA 3LIGA 4YGDA 3SR2C 3FD9A 2AEYA 2XLGA 3UV9A 2LGQA 4D7SA 2UU9O 2KD7A 3VDDA 4CH4A 4MVUA 4ZHQB 2UU9B 1HJFA 5L3CA 1LR5A 3TN91 1ONAA 3ZMSA 1UY4A 4MVSA 3KV4A 3I3MA 1YQ5A 3N4MA 5KX5B 2DU1A 3VBHA 3WF3A 3OF1A 2FDHA 4NHMA 2WQ4A 4URAA 1BL8A 3TGUH 1QF3A 3MDPA 2X10A 2R72A 5LY1A 3I54A 4WVMA 1BHAA 4WVVA 3AYCA 4JAVA 4CP9B 2YGLA 2E7QA 4JYAB 2ZOEB 3SXWA 4LHKA 2EZOA 4I50B 3P6BA 4BQXA 1VBC1 1H6XA 2A6ZA 2VAUA 4YWAA 2EIDA 4IDZA 4DUZB 2IBZH 1CZSA 4XETA 2RS12 2ARBA 1A32A 2YFUA 3SGIA 1UPIA 5IYCO 4IEZA 3MFAA 4XUTA 1AP5A 4W50A 2YBKA 1NY71 4K20A 3NKTA 5FZ8A 3TNQA 5FFOC 5T55A 3K9AA 3DC6A 4DV6B 1YIJV 4JTCB 3RT3C 1FPOA 1U97A 2RN9A 4FPHA 2UXCB 4B3NA 5T50A 3IIIA 1XUQA 4DR1O 2VPVA 3SKVA 3CRQA 4U7OA 2QUOA 4FO9A 1QWRA 5H9QA 1Y76B 4P9LA 5ACA2 1C8M2 2PQQA 2HWB2 1XDCA 2WZR1 3BN6A 4AFMA 3NSTA 4GH4B 4YNIA 5K1PA 1R3KC 4RGAA 1XNTA 2W1SA 2VMEA 5JSPA 4AHZA 1ZL8B 2ZDIC 1FT9A 1POV1 2LUWA 1XEQA 1LHNA 5CFCB 4AEJA 1HV0A 1CZTA 5CKQA 5LASA 2ZGOA 1E5RA 2QWNB 1W2TA 4UAPA 1DLLA 1SHWB 3LDCA 2RM22 3LWCA 4Y3OA 2OKXA 4JYAO 3PU8A 3VHPA 1FPN1 3SYAA 3H1KH 4RS5B 4GWNA 2B8MA 2VXRA 4IV3C 5DN6G 2ITCC 3VGIA 2QZ3A 4KHPO 4J41A 3D36C 4ZU4A 1HIXA 1W6OA 1V54C 1OPMA 2XVGA 4OI0A 4QKDA 4R7CA 1RXGA 2XJRA 1SLCA 2FB5A 4DRVA 1ZVFA 3MHZA 5DMYA 3WSOA 3BHPA 3T1LA 2IM9A 4O2BA 5I0SA 5FLIA 1ND2A 4XYXA 2RS11 5CFDA 5LGNA 1AVBA 2ZHNA 2Z5WA 1IBMO 1GMGA 3KZ4C 1GV9A 2K0GA 1IG0A 3T2QA 2ZIOA 1URXA 4CCLA 1H8TB 3IAPA 2X6AA 3MGUA 4EROA 3ZIXA 3RYHB 4NR1A 4LF7O 1QXPA 3NJZA 5CYYA 1JA8A 4KFMA 2AREA 3CC4V 1OKQA 2OZ6A 1PNGA 4KNCA 4CDUB 1DGLA 4QB6A 3IC7A 5BUVA 1JYVA 2YHJA 3ELNA 4LUKA 1N3QA 3JXSA 3U78A 4XABA 1C1FA 4XFHA 3K48A 2LFSA 5ERLA 4Q8LA 5C70A 1EPZA 1U5YA 1ND2B 3JBG1 4CCCA 1IPJA 4IQPA 1HRI1 2ZXQA 4FZ1A 5FZ3A 1Y74A 1OLRA 1AR83 4FOYA 3DKWA 3GYDA 2PLV1 2VOWA 1NKDA 2W08A 3J8F1 1VF6C 3WB1A 1QJX3 3E97A 3IPVB 3ZYFA 2RJKA 3POJA 1OCOB 1S0EA 4W4KA 3AMMA 1ASJ2 5D2AA 2CTWA 5FPAA 2VR4A 1YJNV 1ENXA 4I4TB 3FHIB 2FHRA 2BFUL 3DPRB 5IK5A 2EIMC 2YEVA 1R1BA 1XYOA 5FYYA 1JZ8A 4QGPA 2E7AA 1Y6XA 4LEJA 1BVVA 3WDWA 2D97A 3BFRA 4O2AB 1YQCA 1W8WA 1OLMA 1PVC3 2Y38A 1N1TA 5A3PA 4YGCA 1SQPH 2WDBA 5A6YA 5L73A 4WVWA 2N04A 3BEHA 2JGUA 1QGLA 1K4DC 1HWYA 4XDJA 5KAIZ 3D6EA 2Y33A 4B1MA 3UNPA 2X5IA 3Q8AA 5C8WA 1GR3A 2EF6A 4QNHB 1WA6X 1MVQA 2IFRA 5FPBA 5IE9A 1RVF1 1PNLA 3USUB 5IK4A 4BIUA 2J7MA 4NPRA 2WR9A 2KM2A 1QJU3 2PN5A 4MGKE 1SLTA 1ZBE1 2ODMA 1TME3 2I2SA 2ZX2A 4KGGA 1WBFA 1FPN2 2BUKA 1BCXA 4LF8B 4GUNA 2ZEXA 4LULA 2YY1A 4KGQA 4UXNA 4A45A 3VBOB 5C8YA 1W99A 2RS32 2Q67A 1CX4A 2BVVA 2CH7B 1U0AA 1HN1A 4ATFA 1RM1B 1UOFA 4IGQA 4XILA 4PI0A 2PI4A 2DW4A 1WP8A 4ITCA 1HRI3 3VBRC 2EJRA 4JTDB 4K35A 2XBO2 2PLV3 5J98B 1RMU3 5EV7A 4YM2A 3E6CC 2A0LA 1AX2A 4CBCA 5T5JA 1Q8OA 4A3ZA 2ZTNA 4A6SA 3W7WA 2C1FA 2BGCA 1OCZB 4I0BA 1BMV1 4AF9A 5IVCA 2JDNA 2MPFA 5EYYA 2ZXWC 4YW4A 4DXWA 4QHBA 2UUCB 3O1MA 2GN3A 3H3ZA 4LIUA 4GCZA 1AYN3 2XVKA 1H2NA 2FD8A 3Q8FA 4AHCA 3FLPA 1DQ0A 1J3QA 4AVAA 2GN7A 2HWC3 5JI7A 4QPIB 2Q0AA 3G4SV 2JEMA 2W0FC 4CCJA 3LDRA 5H9CA 2D6NA 5KWRA 3DYOA 1KQSU 2XAQA 1JMKC 4H3WA 1X9TA 2XWBB 1SESA 1IS6A 2GC1A 1SQVH 4X9QA 1AUYA 4Z07A 4YVWA 2OCCB 3GZUC 1KFUL 1OQEA 4QPGA 5FYSA 1SPPA 3SDLA 2FMLA 1MZ6A 1K5SA 2G9GA 1NCRC 3ZPOA 5EYXA 5FPVA 3ZIWA 2CHHA 4LF6O 4XDQA 3UJQA 3HKBB 4TQDA 4CXXA 3N2KA 5CZKA 2PQSA 5JIAA 3E6DA 1ULOA 3NVCA 2VUJA 2Q7EA 3VZOA 2JJ2G 3MF6A 5C7GA 4UFKA 2P90A 4TQFA 2EILC 5IVVA 4CS2A 1DF5A 1LEMA 1A8DA 1N32B 1KRIA 4HVRA 5F6KA 4EQVA 4FPLA 1VBD1 2XJSA 4F8AA 2LGWA 5LA6B 4YVSA 3SCHA 4A41A 1V6JA 5H5NA 1JFFA 1SLBA 5F1RA 5FZ9A 2QKDA 1YDXA 2H6BA 2ZGKA 2ZNJA 4MS2A 1RSOB 4AK3A 1BMV2 3O5SA 3TJTA 4MGIE 4GKKO 4P9WA 1DZTA 4F6RB 2W0XA 4HNAB 3ZRWB 2CK3G 1V6MA 1UYPA 3HWJA 4OI2A 2R1DA 4BQ4A 2BBAA 4ZS3A 2GP3A 4DV2O 1RJ7A 4NHXA 5ABJA 3Q9OA 4CCNA 2QM4A 1W6QB 3T2PA 4L92A 3S7IA 2WC2A 2A73B 1KUQA 4L99A 5FAXA 3C8XA 3ORJA 1G8WA 1J3PA 3OE7G 1DYOA 3OY8A 1QU7A 2XAGA 1QNMA 5CBGA 1NY72 1KEXA 4PF5A 1N1VA 5FKCA 1Q56A 4B4PA 4G27B 1VBD2 3HAGA 2BFUS 2VGDA 1DK1A 5FNVB 3OPZA 2JE9A 2ZMKA 5C5UA 2RNBA 1XREA 2R7EB 2UWAA 2ZX4A 5JR2A 2DQ3A 1VQOV 5LEJA 4GKKB 1HW5A 3OB8A 3DXUA 2UXCO 4TSVA 4JC1A 1H0BA 4LOTA 2QM8A 2VMHA 3ZX6A 3AX4A 4CCDA 2PHFA 2JKXA 1R082 4R8HA 2W87A 4KI5M 1N34B 3B69A 5JVDA 2ZD9A 1PO21 1Y67A 2YB7A 2D40A 4W8JA 3JATB 4HZ3A 1X36A 1PZ8A 3CZJA 4A5UB 1WLCA 5DDJ3 2VZ1A 3WF4A 4DRXB 2ZM6O 4RQPC 2Z2SB 4U2AA 2YICA 2HWC2 1BJQA 4DXTA 1VMFA 4SLIA 2SBAA 5L9RA 4CEYC 1BBT3 2HWD1 1JH5A 3IAQA 4N9HA 1W9YA 3ZYIB 2YSUB 3AL5A 1XRUA 3ACHA 4XQWA 1GANA 2E74B 5A7OA 5KC5A 3QH6A 4IV1B 4H7LA 5FL7G 2VTFA 2D6LX 3BA8A 5FNVA 4LBQD 2ZGSA 4N43C 4O65A 2F4LA 3L2HA 4RWUA 3K46A 5FYUA 5L7OA 3CRRA 3JAWB 4UF0B 3FN9A 3RS6A 3HVDA 1Q6IA 4OI4A 3RYHA 2YUAA 3LCPA 5CKMA 3VQYA 3LQCA 4LC1A 1P84F 4A2UA 3ZMZA 1FV2A 4JAAA 4WFEA 1C8M1 1H2MA 4YW7A 1F4MA 2HWE1 1RUI1 4DV1O 1R3IC 3E89A 4RR3C 1QQP1 1IURA 3IC9A 3LFMA 1OF3A 1TGOA 2PAMA 4MHUA 3NRUA 1W8HA 2QQWA 2GC3A 1OMIA 2QQIA 2OPKA 3CHXA 4JI5O 2E5LB 4FBFA 2WRAA 3STZC 3JCIA 4AL9A 4X1IA 2PYJA 1Q8PA 4HN0A 4YY3O 1ZRIA 5KHGA 4LO7A 4JX0A 1VF5B 4PDVA 1MZFA 2IU0A 3HT1A 3NV2A 1NBMG 2CDOA 4JI4B 2WLHA 1NOVA 2VH9A 2XL7A 4N53B 2Z42A 4PA7A 1PV0A 2XT9A 2JDKA 2JDZA 1WCSA 4OHVA 4NIHA 1AJKA 3O1SA 5BNNA 1GP4A 3X2QB 3HD8B 4I0XB 1TEIA 2DFBA 4BB3A 2VBDA 3ZDVA 2WLKA 1UQXA 3JBG2 3CO2A 1MS1A 3RJ2X 3LIHA 1RUF2 5CA1B 3H8RA 1UY3A 3JAKA 4NIAA 1AYM1 3CQOA 4R9DA 3STLC 4JF3A 2XKOA 3F2ZA 5LP6C 1RYYA 3QVNA 1JI6A 4NTXA 1AR61 1N1YA 3HBKA 4Y24A 2PFWA 4JGZB 1SRYA 1PX4A 4L97A 1I5ZA 5JQGA 1CJDA 2GC2A 3LSDA 4DW1A 5DUUA 4QQHA 4WZCA 4CDXC 3VZMA 1S77D 4CP2A 4XBQA 2BPA2 2WBKA 2NYYA 4YG3A 1W0NA 1S5LZ 2Y0PA 4GT1A 3EB7A 1RUD3 3OCPA 4YVWB 3MYXA 5EJ3A 1OCZC 1YITV 1S4CA 4LLFA 2WLQA 4M3CB 3VBHC 5AFEA 4DV3B 2WLPA 1O3SA 4IW3A 4LH6A 3MFCA 1N0JA 2PHXA 3ON7A 3BTZA 3BOPA 1YYNA 3TXSA 3IJ4A 1H1IA 3H9VA 4JI7B 3KLSA 5FY4A 5DG1A 5C4WC 4Q26A 1RGSA 2RMKB 1V54B 5EZYB 5EBLC 2XTAA 1BS3A 3ZRWA 1VR3A 1CIWA 2NN8A 1YI9A 2B42B 4QJFB 4A7ZA 4IV1C 4B3MB 4ZKTB 5DPNA 2EINC 1QJZA 2A5ZA 3I4IA 2WUHA 2ZM6B 1DGWX 4GX2A 2BOJA 1VRH3 4FPPA 4OQ9A 1EAH3 1W6QA 2ZNIA 4DR4B 1C3HA 2XNDG 4JI6O 4BH9A 1VBA1 1ND3C 4MTXA 1W04A 1ZRFA 4WBNA 5JZGC 2VZVA 1H1AA 2P6HA 1TUEB 4YJ2A 2UY8A 3VB9A 5LBFA 4E4ZA 2PZSA 5EBWC 4L2NA 2ZGNA 5FPRA 4XAAA 1N0NA 3EVKA 3FMGA 5JZGA 3FBMA 3DECA 1P7GA 4EWEA 3KWVA 2QE7G 3AVSA 1JZ4A 2QWOB 4LF7B 2CTRA 1QNYA 2DCKA 2CU5A 4WM7A 1A8MA 4LHLA 1E57A 5KMGB 1QDCA 1A3KA 2HHHB 4LOSA 4H44B 2AEZA 3E83A 5DUXA 2JE8A 3VDBA 1GP6A 4HLTA 2GSYA 2QNKA 3HR0A 2Y6GA 5FUIA 1F2NA 2Q1ZB 1NX9A 1DZQA 2ZQMA 2FL4A 1EUTA 4UW6A 3MIHA 4D8MA 4X1KB 3LA2A 4I50A 3VZLA 3UQ8A 2F6BA 3OT7A 1JOBA 2NM1A 2OQ7A 3VD3A 3BI3A 2V4DA 2JENA 2PELA 2XG3A 1UPSA 3MW3A 2DURA 4UFIA 1S0DA 3N9NA 1O3QA 4WZFA 3T1HO 1IZ3A 4NPMA 1WPXA 1KP2A 4NIDA 1RHI3 1Q3EA 3WV6A 4IHJA 3HKEA 2D6MA 1V55B 4XVHA 2Z4FA 5JI9A 1QNWA 1JMUB 4XEZA 4BJ0A 2BEOA 3TXQA 3M2MA 4CDWA 1S0VA 5DAWA 3VDDB 2F4VB 5E1AC 3RZKA 3ZMOA 1R3LC 1PP9H 1VQ5V 1GNHA 4QXCA 5FZBA 4OPAA 1O59A 2QR4A 4DZGA 4IEUA 2KG7A 4NE9A 2FCTA 4YJ3B 4K9SA 2UXXA 1COWG 3IDCB 3F7VC 4ZPIA 4UB6Z 4WFFA 5BXXA 1M5IA 3GZTB 3K03A 4GWIA 3VBFA 1PM7A 1OFSA 2ZPXA 2YBPA 4HONA 1YTFB 1QJY1 1SFPA 4LIVA 5FYBA 5JQGB 1YXBA 4I09A 5B1AB 1QU0A 2Y69B 4N7UA 1PGSA 3SISA 4L8QA 3AZVA 1P49A 2W94A 1ZRDA 1KDMA 5AFBA 3WOGA 2JD9A 5ABJB 1SACA 1DLCA 4Z2AA 4LLOA 1D7PM 3K4AA 1RPOA 1N3OA 1RUJ1 1HB3A 4PT6A 5FUNA 3TN93 4YGBA 2ARAA 4GX1A 3OTOO 4JAUA 2DVGA 1JZ3A 2ZEZA 1PO12 2QKSA 1VE0A 5A7SA 5EC1C 5HI0A 3QCWA 2UUAB 4WBNB 2HWD2 1DG6A 1IKPA 4RAIA 2LTNA 2X6CA 3AZZA 3ACIA 1W6PB 1CXZB 1XOYA 3S0MA 3CCJV 5EXOA 1IXBA 1RP3B 4Q0SA 2HJFC 4CP1A 5C3OA 1CAUA 3JD1A 3ABKB 4ZI7A 1SLAA 5FTTC 5FYMA 1MZ5A 3ZXLA 4JI0B 4CDXB 2NQYA 3WT3A 4AFAA 3ITQA 5FP4A 5EQUA 2HFEC 4UFHA 2PUSA 2PHLA 3E8FA 4Y4RA 1Y76A 4FQ4A 4ORFA 4J1XA 3MIEA 2HEYF 4Q4X3 4JHZA 4HMZA 1LUVA 1SETA 2NP0A 4X6RB 3C90A 4ARYA 2BW8A 1VLNA 1ZBA1 4R6ZA 2WNUA 4NXMO 1YJWV 4CS4A 5HFLA 1ENRA 1W8NA 2OT7A 4DV4O 1H8TC 4XHBA 1OA4A 3LFIA 2D3RA 3KM5A 5G05L 4DOUA 3ZHRA 4INDA 5FXWA 2CWSA 4ZOLB 3TRSB 4B3RO 4BIOA 3IGAC 2ZGMA 1AR92 5BY1A 4B3SO 1UOGA 1SCSA 1W6OB 3IFXA 3H50A 1IGOA 2GMPA 3E8HA 4JGSA 4CSWA 1GBGA 2WNOA 5FLJA 1ALYA 2Z0AA 5A3LA 1HP8A 2R1BA 1NR7A 4QE9A 2F17A 5A9GA 2PMWB 4UCRA 3CCRV 1MG1A 3QBQA 2KXLA 3W7UA 3N9MA 3G80A 1CD3G 1IQAA 1UY0A 4YYOA 1JVMA 2GTSA 1W8TA 4EE2A 3RYIA 1MABG 1GZ9A 3N9LA 1YQ6A 3UK9A 3CRMA 4BIZA 4B1LA 3ACLA 5A7WA 5I8TA 4YRDA 2XJPA 1ZX3A 5F39A 1RMU1 3AG3C 2LJ2A 2FDGA 4XFAA 4LR3A 2XLFA 4JKLA 4QB2A 1TNFA 1XSQA 2RDQA 4AQ2A 3VBUA 2YU1A 4FPJA 3U11A 2ZE8A 4NIGA 4YW1A 2ZHLA 4LO5B 4MHRA 1J58A 4X66B 3T0AA 2UY9A 5CISA 4JTAB 4TYSA 4R4XA 2TNFA 1RITA 3ABTA 1PMIA 2X7RB 1PPJH 1SEFA 3MICA 3RG0A 3SJAC 1OUXA 2ARCA 3I3EA 3LKJA 5B66Z 5FZFA 1I1EA 3KSCA 3D3QA 2Q6AA 2WN3A 3JQWA 4IEOA 1M57C 5A7PA 4Z1VA 4OCTA 3VKLA 4AFBA 4E8DA 1ZX5A 2XPJA 1AR5A 2WWJA 2XJUA 1IBLB 4LITA 4UFMA 2FYUH 5E6HA 5KXBA 2ARHA 1YFWA 4Y1VA 3MIFA 5D21A 4IERA 2LW1A 1UD1A 1W6NA 3TWIA 2RHPA 5T5PA 1HB1A 2B1GA 4J10A 1ST8A 2E7TA 1AILA 1E5IA 2M6YA 1ZA7A 3DV8A 4Z1MG 3MIBA 3ZFEB 1MZEA 1QJY3 2QWQB 3JB4C 1CX1A 5J2UA 2LFRA 4P2ZA 4LNUA 1TUBB 1UIJA 2OZJA 5LA0A 1IVSA 4Y22B 1T5EA 4LKFA 2YPJA 2C9AA 1NVPD 4FLTA 1GKBA 4CVUA 2WNVB 5BNPA 3ZFGA 3I2JA 3IZOA 1W0PA 5F8PA 2KB1A 2JKBA 1MNGA 3JATA 1FJGB 3IN9A 1YC61 3TNPB 4DV0B 4Q1RA 2HWB1 1AYM2 4NN0A 1CWPA 2C2AA 1ZZ9A 2WS92 4WFGA 2DOSA 1O3RA 3C2UA 3APQA 4Q4Y1 2ERFA 4BMEA 4Q4W1 1G6UA 5C9AA 4DV7B 1AHSA 4NB5A 3RGBA 4O7XA 2J1AA 3VKFC 2WPDG 3QH7A 1OKOA 2VW2A 1O9HA 2RS52 5K1XA 4BA6A 1FATA 4HN1A 4NO4A 3S57A 5A3NA 1PGW2 1NE6A 5JJJB 5LCWL 2V09A 4DV6O 4KP4A 3DPRC 5GZFA 1WN7A 5CG9A 2Z69A 4P9IA 3VBRA 4ZI7B 1OCCC 1CGPA 3WX5A 3POSA 1QVGU 1D4VB 4Q4V2 2X05A 1QXJA 1YHQV 3AMPA 1R093 1AR91 4YZ4A 3SPHA 2XGXA 4ASUG 1N32O 4IEQA 1K5MA 3DGTA 3NNLA 4CPBA 3AVRA 5FQ0B 3WB2A 3OBRA 1RINA 1W6MB 1XMOO 2J1UA 4ABMA 1DIWA 3KT1A 2QKCA 4TLFA 1E5HA 5JAXA 3GGLA 3IPVA 4BQ1A 2Y64A 2ILMA 3ZXKA 4MVOA 4NTWA 1N33O 3GZEA 4AI3A 1GQHA 4QHOA 1MEC1 1VQPV 5IHRA 2NNUA 3AJYA 2BTQA 2PYTA 3H1LH 4O4LA 3JARA 5L3BA 4I0AA 1WBLA 1F23A 1PO22 4NJ4A 4L0PA 2A71A 4LT5A 1S0IA 2YEVB 3DUIA 3OPTA