5KHHA

Hcn2 cnbd in complex with inosine-3', 5'-cyclic monophosphate (cimp)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
194
Chain Sequence
SSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 64
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khhA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khhA02
4YRDA 1UIJA 4LULA 4F7ZA 3EO6A 1ZZ6A 2GU9A 2KXLA 4H7LA 1J3PA 2ZCWA 4MUVA 3MDPA 2EA7A 2WC2A 1ZRDA 1U12A 4BYYA 3EBRA 3UKNA 1IPJA 1WA4A 2OA2A 3WW3A 3ACLA 1LRHA 2ET7A 4X6QB 2BNNA 4QM9A 4WVZA 1Q43A 1J3QA 2XKPA 5KHKA 5FLHA 4CYDA 2WFPA 2K0GA 4IEWA 3O14A 1DZTA 2QNKA 3ES1A 3BALA 1XRUA 1XE8A 5E1RA 2I45A 1DGWA 2ZKLA 4FT8A 4FBFA 1VJ2A 2C0ZA 4XF4A 3H50A 1IPKA 2IXCA 1CAWA 4Q29A 3RYKA 3SCFA 4HVOA 4XEZA 1RC6A 1X8EA 5AVPA 1RUOA 3CO2A 1O5LA 2PYTA 4UXAA 2UYBA 1PMIA 1RGSA 1O3TA 5BPXA 1RTVA 5KHGA 4AXOA 2HJIA 1G6NA 3E6DA 4KL1A 5KHJA 1J58A 4NVPA 3I54A 4IEQA 2IXJA 4XETA 4MX3A 3OGJA 1EP0A 3PLQA 5FPZA 5JR7B 4HMZA 1SQ4A 3NW4A 4JV4A 4B29A 4TLFA 1FXZA 3OD0A 4META 2PTMA 2DCTA 4LUKA 2F4PA 4KWJA 5EZWA 3EQEA 3KGZA 3ELNA 1CAVA 4A2UA 2QVSB 4QGLA 1DZRA 2XLGA 4PIZA 2PFWA 3ROUA 3SXWA 4AQ6A 5I91A 1NE6A 2Z69A 2ATFA 4WBBA 3D0SA 4MZUA 1LB2A 1UD1A 4Q0VA 1UPIA 2BYVE 1O4TA 2GAUA 1RL3A 1UW8A 5J7MA 3CEWA 3FE5A 3E5QA 3IWZA 4HVRA 1UCXA 2PHDA 2Q1ZB 1UIKA 1ZZ8A 3VHRA 4LA2A 4E2GA 4EWEA 3I59B 3IIAA 3EHKA 3IBMA 5CVRA 5D1IA 3FX3A 3MPBA 1O7FA 4L11A 1ZVFA 1NXMA 1XE7A 4EWAA 2BEOA 3FZ3A 2XL7A 1VP6A 2PHLA 4YNIA 5CADA 1OD5A 4IEOA 3H3ZA 2PAEA 2O8QA 1OMIA 4IESA 2ETEA 4BIFA 4ZU7A 1HW5A 3DL3A 4X6RB 3LA3A 3RYPA 1CX4A 3GYDA 5I0RA 4R52A 2E9QA 2OYZA 4QXKA 3CF6E 1TQ5A 5FQ0B 1Y3TA 1LKNA 3CJXA 2EAAA 3KMHA 4RD7A 4E2SA 3H7JA 1J1LA 2QCSB 3SHRA 2ET1A 4AVBA 4HVQA 3RYRA 3H8UA 4I01A 3KCCA 2GZWA 1OI6A 1NE4A 3LZZA 1Q5OA 4KU7A 2MHFA 3GBFA 4DINB 2Q30A 3FFQA 4O9EA 4XFHA 1J59A 4UBGA 1GQHA 4XFGA 1ZZ9A 4LA3A 2IXKA 5BXXA 2H6CA 3QOPA 1LR5A 1EY2A 1SFNA 4KWKA 4MV2A 1CAUB 4FAGA 4MGIE 3U0ZA 1WGPA 3H1WA 3OF1A 3PVBB 2XLAA 4Z82A 1J3RA 3RZZA 1RUNA 4K8FA 3ZDSA 5JCTA 4HBNA 1JUHA 4J1WA 2B8MA 3NSTA 4XF9A 1YFUA 5BUVA 4XFFA 2N7GA 3DKWA 3EJKA 5JSRA 3H3UA 2D40A 3USSA 4XFAA 4N9HA 2D93A 2PA7A 4MH0E 4YARA 3HQXA 5T3NA 2VQAA 4HSLA 4IEXA 5I8TA 2IXHA 3HT1A 3LA2A 4XFIA 3BB6A 1FT9A 4MGYE 5I8SA 4IEVA 2FMYA 4L2NA 5FPXA 5FLJA 5C8WA 1EYBA 1PM7A 2BNOA 3BU7A 1ZZCA 1ZZ7A 1YLLA 5I93A 3S7IA 3LA7A 5J3UA 3U11A 5C6CA 1YUDA 3MYXA 4LLOA 4Q0UA 4IEUA 3H1MA 5JSOA 3E6CC 4PIXA 2XGXA 1VR3A 3B02A 4N9IA 5LEKA 5BV6A 3HIFA 5LRSA 4Q0QA 5E16A 2HKXA 2BGCA 3RNSA 2GC3A 2H0VA 3I7DA 2K9ZA 2B9UA 2V09A 3M3IA 2O1QA 3QACA 5LRRA 5LEJA 1ZRRA 4EV0A 4JVAA 2B5HA 5FCCA 3R6SA 4Z07A 3LOIA 5CU1A 5KHIA 2CAUA 4AQ2A 3NKTA 4R8HA 4Q0SA 3SCGA 2IC1A 5I0SA 1ZRFA 3D0JA 3D82A 1OFNA 1NZCA 3C3VA 4O9GA 2UY9A 1ZRCA 3IDCB 1ZNPA 4OFGA 5I0TA 4LTAA 4YSFA 3I59A 4YYOA 2XLFA 3CL1A 4I3PA 3S0MA 4J1XA 2P17A 1L3JA 2QDRA 2XL9A 3JZVA 2EVXA 2Q4SA 3KGLA 5JAXA 4I2OA 3E5UA 2PAKA 2MNGA 4I0AA 4I02A 1ZX5A 3HT2A 3DN7A 1QWRA 3PNAA 4HZFA 1QXJA 4WZCA 2D5HA 3NJZA 3E6BA 3H1YA 5K8SA 4IERA 1Q3EA 1O3RA 2H6BA 3FWEA 5FLIA 1CAWB 2UYAA 3NVCA 4IETA 1H1MA 1YFWA 2CAVA 2GC0A 3S7EA 4IEPA 5FQ0A 2IXLA 4MGZE 3L2HA 5JSPA 4P9GA 2OPKA 4XF0A 2CGPA 4HSJA 5KBFA 2PQQA 3UKVA 2FQPA 1Y9QA 4QGNA 4D7SA 2QJVA 3E5XA 1QY4A 3WW2A 1ZREA 2VECA 5EFUA 3FHIB 4QMAA 4LEJA 3ETQA 4PJYA 1YWKA 4QM8A 2MPFA 1CAUA 4Q0PA 4KWLA 4ORFA 4I09A 1YFXA 3WW4A 1YFYA 1X7NA 1O5UA 3E97A 1V70A 1X8MA 4ZU4A 2GC1A 1WLTA 4XF1A 2OZ6A 3LWCA 4FAHA 2UY8A 2Z2SB 3M70A 4F8AA 5HI0A 2CV6A 3IDBB 3H7YA 4GULA 1CAVB 5F1RA 4JTOA 1O3QA 4PIYA 4IEYA 1YHFA 3U10A 1EPZA 3RDIA 1DGRA 3OCPA 4QGMA 1FI2A 4OLLA 5FDBA 3ST7A 3FJSA 3NL1A 4UBHA 5BY5A 1NYWA 4XFCA 3BCWA 1CAXB 2XHKA 4EWDA 3TNQA 3G7DA 4AVCA 4HN0A 2GC2A 2IXIA 5KHHA 4HLTA 2Q0AA 3RPQA 5J48A 1CGPA 3WW1A 4JTNA 4EROA 5I8YA 3DV8A 1GQGA 2GH2A 2OZJA 4XFBA 1SEFA 3UKTA 2Y0OA 4AVAA 4KU8A 1I5ZA 4XF3A 1I6XA 1O3SA 4I0BA 3SCHA 1X82A 5I0UA 2XKOA 4ZU5A 3TNPB 1CAXA 4ONUA 4BHPA 4LUMA 3ES4A 3N4MA 4MGKE 1H1IA 3CLPA 3BPZA 3LAGA 2BNMA 3KSCA 4BH9A 1ZZBA 3SMHA 1QXRA 4E2QA 3OTFA 4D7TA 2VPVA 4HN1A 4IEZA 3MZHA 2D5FA 3H9AA 4QX5A 2PAMA
chains in the Genus database with same CATH superfamily
5B5EZ 2GU9A 4RFT0 4LFAO 3JB4C 4RN5A 1PMJX 5D8AA 1ULGA 2JIGA 4N53B 3VHPA 4BYYA 2TBVA 2DDUA 2BBVA 1LOAA 4FTBA 1IPJA 2YXLA 1DLLA 5A3UA 2QQKA 3AZYA 2NM1A 3KV9A 4CDWC 4CYDA 2C24A 2WFPA 2ZBJA 2OIGA 1NLQA 1GLHA 2DBNA 5FYZA 1R1BA 3CPWU 2VY0A 4JKLA 2FKXA 4N43A 3O1TA 4PA4A 2QKDA 3I2OA 5AVPA 1IXBA 2VXRA 3WQ1A 1ASJ2 2G9GA 4B4PA 2HWF2 1SLTA 1RTVA 5CA1B 4JGYA 5A7WB 4D7YA 2CNAA 3WNLA 4MX3A 3VKNA 3RMXA 5ANQA 3C8XA 5F2WA 1GMMA 4B3RO 4EKWA 1EFRG 3WDWA 4ES8A 2RMKB 1SETA 3D3AA 4CH6A 2WLLA 5JXHA 3OD0A 5JJJB 5KLVH 3THOA 4JZRA 1YQCA 2RR13 1TUBA 4LHLA 3ZYGA 1RIRA 1M57B 2AREA 4J7ZA 4KI5M 2R7EB 3PHMA 3K51A 2JDZA 3CBNA 1DGLA 3X2QC 4XACA 3K77A 2HH9A 3BOWA 2KQXA 4DUXA 3VL8A 3PIJA 3IWZA 5LCWL 1CP9A 4NTYA 3G6JB 2JX9A 2IH3C 4CDXA 1VBA3 4DV1B 4QE9A 4NTXA 2J1TA 1MS1A 4Y5SA 4DR1O 3LOBA 1RHI1 1XE7A 1VEWA 3NJYA 3FHAA 1IURA 5CADA 4ZY9A 1S0JA 4BW9A 4IL6Z 5CA3A 1VIWB 5FZ4A 1XQ8A 1HW5A 3LA3A 1LU2A 2QBXA 3OBTA 2OYZA 1UF2C 5JOZA 2WLIB 2ADEA 2PQSA 3BIWE 2ENRA 5KXDA 3QD6A 1XMOO 1XYOA 5IHRA 1NTKH 4EN8B 4BAYA 4KU7A 3AKSA 4PELA 3ABLB 3A2FA 3FD9A 2OT7A 4LA3A 3B01A 4EE2A 3M3OA 1RUF2 4PA9A 4A7YA 3S3XA 3CZUA 4DV4B 4UFJA 2WO2A 2WLPA 2XLAA 2KB1A 1XNDA 2A6XA 5B4NA 3DPRB 3KF3A 5LBBA 4RGKA 4P9OA 1SACA 4X64O 3H3UA 1W0KG 2DJVA 2VCMA 4R9BA 2WKKA 3JQWA 4DQAA 4JI6B 5APAA 3VBUB 3VBFA 4K40A 4EN7B 2PYLA 1QNYA 1ULFA 4ZI7B 3WNPA 1ZZ7A 3LA7A 5BNNA 5J3UA 2OWOA 4QXCA 1DP0A 2J7MA 1PGW1 1AX2A 4AGRA 3W7TA 1LAJA 3AG1C 2AC1A 3CC4V 1Y7BA 4IGPA 1GZWA 3HIFA 1NVPD 4X1IB 1V9U3 2HKXA 2GC3A 4W6XA 3LD8A 5LRRA 1S77D 4FFGA 4ZPIA 2A6VA 4B3MO 1VIBA 1O59A 3D6EA 1W6NB 1KS5A 2UY9A 4XE9A 3JB8A 1JOJA 3D3QA 1XSQA 2ATKC 5GZFA 4C1XA 4LF8O 4I50A 4J1XA 1D2DA 3JZVA 2UXBB 1C5IA 2NQYA 5CBFA 2A5ZA 3IZOA 4I0AA 1WW7A 1UX7A 1QXJA 3LF7A 5CKMA 1EZVH 5JWPA 5JIUA 4PDWA 3ON7A 1A32A 4EN6B 1AX0A 3AP5A 2Y6GA 2KR2A 4Q4W3 4B8EA 5C8CC 2IU3A 4YW1A 3UGHA 3H3LA 3WW2A 4NYKA 2ZM6O 1EZJA 4DK0A 4YW3A 4PJYA 3J4UH 4WCEV 2MPFA 2Z0AA 1CAUA 1SQXH 5JJEB 3JARB 4ZONA 3EB7A 4ORFA 2CU5A 2VCBA 4ZOLB 1CZTA 4A3ZA 2HKOA 3RBZA 5JQGA 1YFYA 1X8MA 3SH3A 4QNHB 4Y1XA 2CV6A 3Q8FA 3H7YA 4XW3A 2D3PA 1UKRA 3CJIA 1PX3A 3DGTA 5EXOA 2AEYA 4DR4O 4JYAB 5IE9A 1Z7S1 4M01A 3WP5A 3PJYA 1EPZA 2EIJB 5IFTA 1TME1 2R061 4AEDA 2E33A 1OSGA 1WWYA 4UF0A 3WY6A 3F2ZA 5J48A 1K5QA 1CGPA 4FPJA 2JVDA 2WYFA 2JE7A 1NS1A 3PUSA 2P7TC 4I0BA 5CA6A 3DCQA 3TNPB 1JMUB 3VGIA 1HJFA 4BHPA 5JH7A 5ABJA 5ACA3 4F6EA 1F5FA 5IJRA 1F51A 4XDJA 5DDJ3 2UURA 2YU1A 1QQCA 2VMFA 3OTFA 4FPFA 4NKGB 3RSJA 3H9AA 4QX5A 2Q9LA 3KQRA 4KG0A 3N3HA 1V6MA 1NR7A 2FCTA 3WQ0A 3AG2C 3VZMA 4MUVA 1VQ9V 4DRRA 2WJSA 1MABG 1JYVA 2LTNA 4BMEA 1ND2B 3LSEA 4NRQA 4FPPA 1WLEA 2ET7A 2RR12 3LSQA 3UKMA 2DCZA 4WZFA 4S2DA 1YIPA 4C8DA 1XL4A 3U4XA 1NH2D 3POGA 3CE2A 3GF6A 1HXS1 5E1RA 3ZKYA 5T5JA 1BGYH 1ZUQA 3JBG3 5IT9N 1CJDA 1YXWA 2OCCC 3RI9A 5FAXA 1VBA2 1WAZA 4AQTA 1CQ9A 4J7KA 2UYBA 3WDXA 2RVAA 3OMAB 1J58A 1QLEB 2WNVB 4LF9O 5DG2A 5DQ0A 3GB7C 3FKSG 4LH6A 1BEV1 4CZSA 1NCQB 2C1FA 3FLTA 5A7WA 1I94B 2DQ0A 1AL0G 2P37A 1MQTB 2QVSB 1DYOA 1WN7A 3RW0A 4UCUA 2BGOA 1KB9F 1S5LZ 2AW9A 2FB5A 4MZUA 2ZIMA 2VZUA 3ZFFC 2R1BA 4CUBA 1DG6A 4AVTA 4JQTA 4CS2A 1SZBA 3MD0A 3MO4A 3KB5A 3VHRA 2WIIB 4LBKA 5IVCA 2FL4A 1ZVFA 3LDBA 1W8ZA 1LHOA 2E26A 3OBRA 1Q6HA 4UCVA 4U3FH 4WVWA 5G05L 1W8TA 5CYYA 4WVMA 5F9TA 2ZGKA 5T55A 1SFYA 2VQEO 3O1VA 5I0RA 4OHWA 4U7OA 1TQ5A 5IVEA 3AXEA 3I97A 1LKNA 5LMUO 2QCSB 4HVQA 5CEHA 5H6RA 4L92A 3KHBA 2YDEA 1V9U2 1U5YA 1SFNA 1POQA 3APQA 3OEBA 3T1LA 4FIPC 1J3RA 4LO4B 2ITCC 4A4AA 3ZPYA 1HNZB 5LYJB 3AB0A 1JTZX 4NXNB 4UUJC 3HD8B 1VQ5V 2ZKNA 4YARA 4H7MA 4JGZC 5G04L 1P49A 3BB6A 3DF0A 3JD0A 3WV6A 4RGGA 1QIQA 1H8TC 4RS5C 3ABUA 1VBB1 3VKOA 1PM7A 2VVDA 1W2OA 3AK1A 5CB4B 4IEUA 4PA6A 1UQXA 4DR2O 4QPWA 1VR3A 3R4DB 4Q4W2 4L99A 1WP8A 5FP9A 1M56B 3WU2Z 4CPBA 2GMPA 1QVGU 4M3CF 3TN93 2LS6A 1R3KC 1IOAA 5I0SA 3O5SA 4AW7A 4JYCA 2W95A 5A6QA 5DUWA 3IDCB 4X1IA 3SKJE 4ASMB 4LWSB 3CX5F 4A7KA 3MIEA 5JOWA 4ASUG 3UJQA 1L3JA 2XL9A 4DNYA 4A6SA 1C57A 3K03A 1W6NA 2YV8A 1OUSA 2BOIA 2XJVA 3GHNA 4FM2A 4BIZA 1J95A 2RN9A 3E6BA 3G67A 1QMJA 4NXMO 3VBOB 4D6SA 2JS5A 5GALA 4X8AA 1PIV1 2G9FA 2BSKA 2C5DA 5KXCA 1GK9A 1GKBA 3K3NA 4P5HA 1HW7A 2ARHA 2VMGA 4PI2A 2QFEA 1I1EA 1IX9A 5B1AB 4IV3B 5ACA2 1JOPA 4QMAA 3JU9A 1NCRB 3SDLA 5DDJ2 4Q4Y2 1VQ6V 1VMFA 4TUYB 1K3IA 5E1AC 1UPSA 3JD71 5LW9A 4BJ0A 1CAVB 5FFOC 4JZ2A 5E89A 4JI5O 1CR7A 5FBJA 1IBLO 1R6TA 3NXSA 4DR6O 3AYDA 2P4KA 3ZHSA 1QU0A 2JDPA 1FOD2 3G7DA 2YU2A 4FFBB 2VL4A 3CU7A 1L7QA 3WX5A 5I8YA 3JBG2 2EAKA 1JMKC 2CGOA 1RUI1 1OJHA 4CEWC 1YJWV 4L87A 5DAWA 3G6BA 3WG7B 5DZEA 5HBAA 4E2QA 1JI6A 4DEQA 5C9AB 2PHRA 4D6QA 3ASOB 5GJ6A 2WC2A 3ZHUA 5D5QA 4Y22A 5A3MA 1CD3G 2WABA 1LRHA 1JJOA 3AG7A 3KM5A 1Q43A 4Q4X3 4YVWC 1JQ0A 2RS51 4WM8B 4V2WA 3B3QE 2E32A 3AKRA 1ND2A 4DO2A 1WNSA 2IBZH 4MT8A 3WNXA 3LFIA 4CCOA 2RNBA 3OGGA 3THDA 1H8VA 1E79G 3LEIA 3J81N 2UUBB 2IWGB 4DPNA 3WQ7A 1O4ZA 2WZ8A 1WKYA 2OVUA 1QH7A 5EBLC 1O3TA 2A9HA 3TB0A 3WNOA 4X1YA 5CNAA 2HJIA 2TUNA 5KHJA 4P9IA 3B94A 5EK0A 4E4EA 3LIHA 4XBNA 4CZZA 2J1VA 4Q6GA 3E2EA 5K9YA 5FPZA 2BZDA 4I4TB 4BDVB 1FXZA 4META 2NPIA 1LEDA 1WLWA 3VBSB 4YVSB 5FYIA 5D8AC 4AG4A 2RJ2A 4JDOA 2W9XA 2D97A 3KS7A 1NCQA 5K1XA 4XQDA 1UPIA 1XNRO 1X50A 1M5IA 3ZMSA 4QU1A 2DU1A 4GMP3 1X33A 4DXSA 3RZJA 4H13B 4UYBA 4O4IB 1HRV3 1O7FA 4RA0A 2EZOA 4CC5A 3N7JA 4YNIA 4GKJB 5LHHA 3OUIA 2JWPA 1GWLA 4N43C 2AACA 5L3EA 4X6RB 5EJ1B 4GAZA 5EIBC 3MICA 4IV1A 4D3WA 1LEMA 2A0LA 1S4CA 1D2SA 4AFMA 4JGYC 4XJUA 4RD7A 1N8RW 1XNBA 4QHZA 1PGL2 2I2SA 3POSA 4LHNA 3S5QA 3FFQA 1R3LC 5DN2A 3VV1A 3AMNA 5DECA 2OIIA 2IXKA 3WT3A 2XJTA 3OF1A 4LBLA 4FCAA 4RO2A 3SLIA 3TN92 1NI8A 1OCZB 4KFMA 3NSTA 4PHZA 1YFUA 1JX9A 4HK8A 1JZ7A 1N36O 1DQ0A 1PX4A 3ZYPA 4LPLA 4IEXA 3L75H 3Q8CA 1GM9A 4FO9A 4X66O 5LYJA 4MGYE 5I8SA 2Y4TA 3DECA 3BKZA 4Q4V1 5FLJA 1EAH1 3MW4A 2UXCO 2VUDA 1VBC1 5FO9B 2R9IA 5FY9A 4IE7A 3B8NA 3K06A 3JAWA 2XJRA 3B9CA 3U14A 2HFEC 3OUJA 4PBOA 1W9TA 5KXEA 4CCKA 5JOYA 3H42B 4E4ZA 1N0JA 4GX0A 3VBHB 4MVQA 2P4VA 1ZRFA 1NVPB 1GNZA 4UFMA 1FV2A 3RVZA 2P3KA 2XHBA 1S0VA 4RYDA 2A7AA 4YYOA 1J5EO 3GBGA 3K4AA 4EJRA 4CH4A 4DRXB 3K04A 1ZTEA 1UYXA 1GM8A 4J42A 4DRVA 4JI7O 1N1VA 1WA6X 2JG8B 3AYEA 1RXFA 3E5UA 2GP3A 5IJ9B 1ZX5A 2VRZA 4LWSA 5JIAA 4QQ2A 2EX3A 2UXNA 2K2SA 2VTFA 3UO2A 5FLIA 3KQ4B 3KV4A 4IDZA 3TOJA 4MVOA 2PHWA 3POIA 3VBFC 1SQPH 4P9GA 2VUJA 2YBPA 4E4HA 1ALYA 2Y33A 1MOFA 3BRCA 1ZREA 1VBE1 1COWG 1LNQA 1HB3A 4E27A 2QKCA 1XMQO 3MAQA 2D7FA 3VBRC 2IFRA 2P6HA 1VMJA 3MLLA 4BPZA 2NNUA 3ACGA 4OUEA 3VKLA 4AEKA 4N23A 5HI0A 2ZHLA 1NCRA 1AR71 4CA9A 3ABMB 2XAGA 3ZXEA 3LKJA 2NMNA 5LP6B 1VRH1 4GB31 1UZYA 4XIKA 4Q4X2 5CFDC 2GC2A 3OTOB 3M99B 3E8FA 1NQTA 1KDKA 5LWBA 1I5ZA 3SC7X 1D2QA 2ZS6B 2EILC 2IM9A 3L70H 4TZDA 1TAEA 2RDQA 2VO5A 2EIKC 4TOIA 1APNA 1AL21 2WL1A 1UMZA 2QQVA 3MW2A 1FS0G 5F7UA 3IM0A 1ENXA 3K9AA 1TVKB 4DS0A 4YJ3A 5J37A 4M00A 1GP4A 4XUQA 1XYNA 2VVEA 4JRLA 2EIMB 3SISA 2VTXJ 3K58A 1QEXA 2BNNA 3W5MA 4GALA 1SA0A 5C9AA 1JODA 4I0WB 4TWKA 5FLHA 2ZD9A 3ZX6A 3AMQA 2WYSA 2JGDB 4BZ4A 4GH4C 5FO7B 4BU2A 4URTA 1OLRA 3WD5A 1NH2B 1AYN1 4AEDC 5D5PA 5FZBA 1OOPB 1GTOA 2OS2A 4DR3O 1HRV2 1O8SA 2FZ1A 1R6NA 3JATB 4NAOA 1KJRA 3ZYJB 5KHGA 1W2AX 1JH5A 2AEZA 1Q6UA 4DZGA 2DVDA 5CN0A 2JRIA 1ULCA 3T2OA 4CS4A 4HT1T 3AG4C 5FPAA 4XDPA 1IG0A 5BYNA 2R041 4XAEA 4KWJA 3AVSA 5BNQA 3KGZA 3WB0A 3I4IA 4TV8A 4DV2O 2HBUA 2E5LO 2QWPB 1IBMB 1JS9A 4IIJA 2Z69A 1FFTB 4I4TA 2C9KA 3D0SA 4XHXA 2M6YA 3UM7A 2BFUS 2YIBD 2BV4A 1V6OA 1AR91 4YVSA 2CDYA 2VZOA 3K46A 1KD1W 2DYCA 3H1IH 1NXMA 1KC8W 1VP6A 3NMBA 3B8MA 2YPJA 2ZEZA 3CD6V 2HWD3 1W9FA 3HKBB 3IT8A 3RYPA 4O4IA 2E7QA 5CISA 1CX4A 3M3EA 2JB4A 2AHZA 5A32B 5A80A 2C4XA 1K7DA 1O8PA 3SJBC 4CCEA 2B9VA 2XWJB 4MADA 3IMMA 1RVF3 1YHQV 1AYM3 5BMVB 4G9SB 1AZDA 4ZHQA 2LW7A 3OGRA 4OHZA 3CRAA 4XFGA 3VD3A 1R64A 5FZ3A 2H6CA 1AX1A 2IH1C 3IFXA 5FREA 4LF6B 3H1WA 3PVBB 1SMVA 4DW0A 1K4CC 2ZT9B 3RZZA 1H2SB 3JCIA 3ZN4A 5A3WA 3RN4A 3QH6A 1NOVA 2B8MA 3VN4A 5C7GA 1XC6A 3DKWA 4ZXKA 1BHAA 5FJHA 4RR3B 2Q8DA 3CJHB 1Z78A 3KD4A 3W7SA 4PI0A 4GYCB 2DBIA 2DVFA 1M57C 2ZGMA 2MEV1 2H8PC 4LT5A 5DAVA 1V6JA 3HJRA 1OVPA 5FJKA 5C8WA 3OGVA 1QBZA 5DUUA 5BNPB 4N90A 3MYXA 4LOTA 3OPZA 4DB5A 3TGUH 1WW6A 1UMHA 1OD3A 1KGYA 5LRSA 2QA4V 4BLIA 2H0VA 1B06A 2B9UA 2O1QA 3QACA 3WCSA 2B5HA 3AP4A 3ZFGA 1LOFC 3FBYA 2PI5A 4ITCA 2EXHA 3PURA 5CAZA 5IDJA 2IC1A 1IKPA 1AB3A 4HETA 3UT0A 4MSVA 3HKEB 2XJQA 4K35A 5E6HA 1YITV 1DZQA 3FC0A 4QIWF 5LHGA 3MIHA 5I0DA 4XDOA 3ABLC 4EQVA 3I3MA 5KMGB 2GUZB 5H6QA 4BQ2A 1W8HA 2RS31 3ZSLA 4IERA 3J7AU 5FXVA 1WMFA 4A3XA 5A6ZA 1H2NA 1PMHX 1CAWB 4J6GA 4IETA 1N3OA 1GH6A 2CAVA 3WB2A 4Q1RA 1W06A 2JG8A 4LJHA 4LIVA 4PDRA 4MGZE 2X29A 2R063 3DPRC 2OPKA 4U2AA 3WXPA 4OX9O 1OLMA 3FHQA 1KBHA 4JI8B 1N3QA 2FDKA 1RUJ1 3VBUC 4COVA 3UQ8A 4J9YB 1X7NA 5FKCA 2GC1A 3ACIA 5EV7A 4FAHA 3RJ2X 2WPDG 2QQJA 4M0NA 3X29B 3IDBB 3AK2A 1PL0A 1GRJA 4DV0O 1RM1B 3AMMA 2QJ1A 4DYLA 5CBHA 1DGRA 2HWB1 1QDOA 2RDRA 4PJ0Z 2YXHA 3AZVA 1X9PA 4HN0A 2VW1A 1BQZA 3R0RA 1KXGA 3UKTA 1BYHA 4WBNB 1BSMA 3ZSMA 5FWJA 4QAWA 3HNYM 2VCAA 2DOSA 2CYFA 1UU4A 2LJ2A 2ZGSA 1JYIA 3F95A 1RUG1 1GP6A 3OY8B 4H7LA 4X89A 5JI9A 1QJX1 2VZSA 1G9FA 4XTPA 3SH4A 5CKQA 3I3DA 4DR5B 3NWKA 3N7MA 1TVKA 2RS11 4X1KB 2YS8A 3BVOA 4TV9B 3VZNA 4K3UA 4O4LA 1VF7A 2RDNA 4PBPA 2E3CA 2IXCA 2P6JA 1XNQB 4LOSA 3A21A 2XVKA 3OMIB 1K5JA 4A6OA 3RWNA 1Q8QA 3AYAA 3BOPA 2JGDA 1YIFA 3ZN6B 3CO2A 5IAXA 1JCHA 2JD4A 3STZC 2Y6JA 4UCTA 1QQP3 5C3PA 3J7LA 1JW6A 4MXWB 3ZRWB 5T54A 2EIJC 1O4YA 2RJKA 4XHBA 4WM7A 2LM3A 2HWD2 4NE9A 1OOPA 5HXMA 4E4DX 4AFBA 1PO13 3URFA 4JV4A 4B29A 4C91A 2FD8A 3VQVA 3EQEA 3NNFA 4MGQA 4YJ2B 4CP0A 3RZMA 1RVF2 1AYM2 2ATFA 4JHZA 5FMCA 3JYCA 1LB2A 1ONAA 4CDUA 1F4MA 2BYVE 3N35A 4I7ZB 1RSOB 2B4KA 3AP9A 1AF9A 4LR4A 2QE7G 4YM0A 4IL7A 2VNGA 3I59B 5AC91 1KFXL 3FX3A 4KGGA 1DHKB 1HB4A 1ND2C 3FB7C 3T1CA 3SH5A 1GZ9A 3QBQA 1ZBA3 5FZ7A 3WCRA 1IPSA 2O8QA 1LGCA 3OGSA 5FXXA 2HP8A 3I8TA 1OKQA 3VZKA 4FPEA 2ZX4A 1BS3A 2BP6A 1TE1B 5FQ0B 3CJXA 4YZ5A 3KCYA 4F6RA 2Y69B 1XNKA 4DXRA 1UWWA 5HFMA 3VBBA 1VBB3 4DV1O 2AGSA 4UBGA 4MS2A 2J1AA 1CEZA 1XJAA 4MG2A 4K0KB 1TNFA 4GT1A 4MGIE 1QLEC 3RYFA 1VQKV 4NB5A 2WNVC 1WJZA 5GZCA 3I55V 1RUNA 1VALA 1QR8A 2BERA 4C0HA 2GSMB 2DF7A 3MUY1 4OI1A 5C4WB 2ZX2A 5BMVA 1Q81W 2X7RB 3AC0A 1NCQC 1PO21 4QB2A 2WO1A 2PA7A 4P9WA 4GUNA 1MQTC 2BGPA 3HQXA 5T3NA 4YWAA 2GN7A 3TEWA 3P3NA 3RZLA 1W6OA 1UO9A 1FXKB 3NKGA 4JASA 1FYJA 4Y26A 4HXCA 1F23A 4RR3A 4JTCB 1H4HA 3CJHA 3OR6C 4WFAV 2VD7A 4DV4O 3U78A 3LDCA 2LP7A 4DV6B 4XDKA 5JOXA 1SQBH 3GVMA 2R062 5LY1A 5A33A 1C1LA 1NTMH 5E16A 5BNPA 1FPN1 1A6CA 4YXWG 1WPBA 4R9DA 5BZBA 1AVBA 2O8OA 4GQ7A 4CVUA 2IU0A 3H1LH 3JXSA 3J8F3 1E5IA 4YSFA 2OUJA 4FP3A 2EIBA 2XLFA 1ZLZA 2CL2A 3WDTA 4AVSA 5IT6A 1BHBA 1REDA 2PAKA 4EB6B 3HKEA 2FZ2A 3SJCC 2CHHA 4YZ4A 1LHWA 1C3HA 3MPPG 3LEGA 5F6KA 1LOCA 1AXKA 3SYOA 1YFWA 1RMU1 1UYZA 2GC0A 4FLYA 1WMDA 2D6NA 5C70A 2VW2A 5JSPA 4X62B 1DF5A 1N4CA 2R72A 1Y9QA 4CEYB 3TRSB 3KZIZ 2W1UA 1QY4A 1OCOB 4QJFB 2VECA 3DYMA 1K5SA 2UXBO 5LK7B 2Z4FA 4FPGA 2EJ7A 1RB8G 2ZX3A 1SRYA 2D6PA 2DVGA 3ZMOA 4XDQA 1QOOA 1D4M3 4F8AA 2W6IG 4GULA 3VKFC 1QKQA 2JECA 4IEYA 2Q6AA 1WBFA 3KT1A 3Q4HB 3OT7A 1W8UA 1M56C 2VC9A 2DFBA 2SBAA 4JI4B 4RSUA 1I7FA 4MGTA 1W6MA 5FUPA 1PKXA 1GYKA 2OZJA 2ZGOA 3CCMV 5FPLA 5IVYA 2Y6LA 2C2AA 2RS53 4ZU5A 2HWC3 1K9MW 2DVAA 1BMV1 1NJIW 2LGQA 4CDQB 5JZGB 4NHYA 4OMDA 5FPRA 4WBNA 2W52A 5FY0A 1QQP2 3HNMA 4JYAO 2WRAA 4FSJA 4YRDA 2PHTA 4F7ZA 1F31A 3VBOC 1AJQA 5C33A 1PO12 1T6GC 1I9RA 1RUD3 2H3OA 2RJZA 1WA4A 1KRIA 2VZ1A 1Q82W 4UW4A 4BQ3A 4OGQB 4ZXEA 5B1OA 2RMU2 3ZIAG 4WVZA 1HJGA 2XKPA 4Z92B 3JAKB 5B1AC 4IV3C 3SPHA 1RUH3 5SV8A 2Q7GA 1W9YA 1POV3 1XRUA 2CTRA 1NCRC 3D36A 3ALQA 3VD5A 4JKMA 3H50A 4QB6A 1VAVA 4X1KA 4Q8LA 2ZJCA 4PD4F 4ZIBA 2QWQB 2UU9B 4BIOA 4YZ2A 3ZYIB 5CA0A 1N34B 1PMIA 2VZTA 4YFWA 1ZBA2 2A3YA 2AUYA 3I54A 2Q73A 1R081 2LW8A 2R1DA 5CFCA 3APOA 3B4SA 1K34A 3OGJA 5DAQA 4AR2A 4GA9A 1ZBE1 4UB8Z 4GWJA 3HN3A 2ZGLA 5T5LA 1OC1A 2PLV1 5GW7A 4MTXA 5JVDA 3H1HH 1ENVA 2Y0IA 1JA8A 1FNYA 1BK1A 2HLEA 3E89A 3WG7C 1GKFA 2EBOA 2EF6A 5A1LA 1RUE1 3AM2A 5EJ3A 3CB2A 5J7MA 5FZ6A 1YYNA 4MW8A 1H2GA 2FDJA 3RYHB 3ZX7A 5B2GB 2XVGA 5C9AC 3ASOC 4EWEA 2HWE1 4CU8A 2WLKA 4QX0A 3MHZA 5L9VA 3VQXA 1I94O 3V0AA 5A1AA 3D3IA 3OYWB 2ETEA 5KAIZ 4WM8C 2YFZA 1HP8A 2ZXWB 3TAYA 2R071 4QXKA 4PV1B 1XBFA 2VULA 1LODA 2ZR2A 1QF3A 3W58A 4I01A 4F3JA 2MHFA 2WZEA 2A06H 1XI1A 2ZACA 4MVSA 2WA4A 1EAH3 1UL9A 1OFSA 4XFHA 2PYJA 3RMYA 2OT5A 4XAAA 1VBC3 1QNWA 5IWFA 4BCUA 3AJZA 4IE0A 4KWKA 4FAGA 4M4PA 4D6TH 1A78A 2B1GA 4GX2A 4LBJA 1ZSPA 3QO7A 4YW5A 1X36A 5KUMA 2E53A 1B35A 3J8F2 3NNLA 3LEMA 2DMXA 4YY3B 2D93A 3N2GB 1GANA 4UOJA 5I8TA 3ZFEA 5TSWA 3VBSC 5C4WA 4YVSC 1M9NA 3J7NA 4LF7B 1KKCA 4KBZA 3I3EA 2JJ1G 5A3OA 1LULA 3BU7A 3OR7C 1Q86W 1MZ5A 1R1ZA 2KG7B 3PMSA 3OPWA 1UZ0A 5JSOA 1HNZO 4NXNO 1S2BA 1URFA 5E8AA 3VB9A 4LKSA 5JXIA 3RNSA 1S5JA 2N04A 5A3PA 3WINE 1WP7A 1N47A 3JD4A 2FDFA 3C7HA 1UOGA 3BU0A 1PK6A 1GMGA 3CS5A 1ZNPA 4Q20A 4I55B 1VBE3 5T50A 2OQ7A 3JD1A 2XG3A 5IYDO 1SDDB 1D4M2 5JMCA 3RVHA 1MZ6A 4X64B 5GLUA 4MSWC 4A7ZA 1NX9A 1MNGA 1F5JA 1HNWB 4DW1A 2B46X 5LMNB 1ASJ1 4NHXA 3OGCC 4CH3A 4KP4A 1OCZC 2HWF1 3WG4A 1R1A3 5JCOA 3L2HA 5FMBA 3VL9A 2CWMA 4P2ZA 1JJ2U 3KT4A 4QKFA 2YI8A 3CRMA 2QJVA 4AQYB 3WG1A 1G6UA 2HWC2 3M7AA 2XAJA 2R30A 5FYSA 4Q0PA 4CXYA 3VDDA 1KKDA 4X9QA 2WLLB 4B3MB 4HPKA 2RM23 4P9JA 4L0PA 1V6LA 3BCCH 2ZR3A 5FWEA 4GMP0 4FZ1A 5KR7A 1TUBB 2X0LA 1PZ8A 1COV3 1YVWA 3WDYA 3D5OA 3T1HB 5DM6V 3CCSV 1RUD2 3OJBA 1XNTA 2P34A 2X6AA 3I5DA 3ML0A 3K2OA 1XILA 4RHV3 2HJFC 3NL1A 2FBEA 1W99A 1BCXA 1RP3B 1RUH2 3VBHC 1DF0A 2Q69A 1Y9MA 3USUA 4CDXB 4EROA 3R05A 1W3XA 5FYVA 1G9CA 1XXNA 2ORZA 3FLRA 1OPMA 1S2KA 3KHCA 2JKBA 3GM8A 2PHXA 3MLKA 1YC61 3LAGA 3O12A 4K8ZA 2XWBB 2XQXA 3ZMVA 5DAPA 2JG8C 4HN1A 3UT5A 1EN5A 2B42B 4LULA 1GZCA 4QXBA 1ULPA 4H33A 1MR5A 4BR6A 1E57A 3ZHVA 4LKEA 1RUF1 4TSVA 3OUSA 5FBZA 1BE3H 1J3QA 2JDKA 5KHKA 4LKFA 3WP3A 3DTUB 2UUAB 2E63A 2H94A 1CPNA 1GN4A 4YGCA 4DOUA 3CCJV 2X05A 5IYZA 2JXAA 4LBMA 2QGNA 4Y1VA 3CC7V 1LGNA 5FPOA 4XEZA 5J36A 3P5BA 5K0UA 2YBSA 1VQ7V 5BPXA 4RQEA 3ABMC 2ETNA 2A6WA 4W65A 4R4ZA 5FP3A 5LP6C 2YFUA 3GWKC 5LA1A 4KHPB 2Q5ZA 5JR7B 2XAHA 5BNNB 1H2LA 4AAXA 3M2MA 5JMOA 2W6JG 4ZBMA 4K6BA 1Z2GA 4BWOA 1YQ6A 1U97A 1LR1A 2UUBO 4RUEA 3JSNA 2HG5C 1N0NA 1QHTA 4LH7A 5HFLA 3RWRD 1OCRB 2ZGNA 1VF5B 4Q27A 3WFVA 3F5WC 2WSUA 1UCXA 2PHDA 1YQ2A 2ZGPA 1YIJV 2ZHKA 2EIMC 2WA3A 3IBMA 1KQRA 5IK4A 4XBQA 2BQPA 3PUHA 2A75A 4XZPA 3UGFA 2GH8A 2QKAA 5H2FZ 1ST8A 3RYHA 4IESA 4ZU7A 2XR4A 4R7CA 3TJTA 1NXD1 4MTFA 5HV0A 4K8RB 3WUCA 1XU2A 3KWVA 3O1RA 4UV9A 3GJAA 1FX5A 4PDWB 4MTGA 3B00A 2EAAA 4QX2A 3GGLA 2A3QA 5BNOA 4LKDA 5C5TA 2NN4A 2KSDA 4YZ1A 4YHHB 3OAAG 1OOPC 1YRZA 5DMYA 1EUUA 1OA2A 2XONA 4O9EA 4QB1A 1GQHA 3G6EV 2ZAAA 3E1F1 2ZDIA 4AEJA 1CAUB 5H9PA 2QWRB 3PDQA 1MS0A 5DN6G 4BE3A 1PGSA 5JQGB 5FZ8A 3L2YA 4ICGA 1THZA 1W59A 1V6NA 1XREA 3FB8C 3RGBA 1H8EG 3I3BA 1C1FA 1RFYA 5BUVA 4CDUC 1NKGA 3CJIB 2PUSA 3POJA 1AI7A 3HB3B 4QPIA 2YC4A 4OUSA 3CC2V 4UF0B 2W08A 5IY5B 3LSUA 2VZQA 2C9AA 5JXGA 1LHVA 2ZQMA 3TEZA 3MBWA 5I93A 1H0BA 3S7IA 4R6ZA 2VOVA 3BY6A 4RQFA 2WT2A 3U07A 5JH7B 2G19A 1R1A2 5ABJB 3KT7A 4YG6A 1XPWA 2LW1A 4AF9A 5F39A 3WP4A 3AG3B 4C90A 2KG7A 3FAVA 1CXZB 5F3CA 3L9DA 2DCYA 4YW6A 3CMEV 1H8HG 3CCUV 2CAUA 5J2TB 2CTVA 3V56A 3VQYA 1TEIA 2WN3A 1YJKA 2YICA 1TUEB 3VDBA 2RR11 2D6MA 2RM22 2E7AA 3CYOA 1ORQC 2WQ4A 4CCDA 3TWIA 1SQVH 1COV2 4XXAA 5T5PA 5AFBA 5JAXA 2WNOA 3A0BZ 5CMUA 1RITA 1A3KA 4I55A 4O2AB 2VCCA 4RHV2 1UXZA 2H6BA 2WO3A 1VBA1 1PNFA 2PELA 4PLNA 2I07B 1KEXA 2C6SA 4NR1A 4QT6A 1IVSA 3KLSA 5DZFA 2JDMA 1JZ3A 5EYYA 4GX1A 4D7SA 5C8YB 4RR3C 3ZLIA 3J80N 2YEVA 5EFUA 2ARXA 3FHIB 4FLTA 4MXVA 4MVRA 3HAGA 3SNMA 2R16A 2VVFA 3ABZA 2WZR3 3BIEA 4D8MA 5BNPC 2UY8A 2R9AA 2DWRA 4DUVA 1M1KW 1F4AA 3GCXA 4JTOA 2UUCB 3THTA 2ZGTA 2VZVA 2XNDG 1MEC3 1RUG3 3ITQA 3LEKA 3ETDA 3OCPA 3FX7A 4OLLA 2ZZJA 3K48A 4P08A 4UBHA 3JQXA 5F6LB 3PUAA 5FPUA 3CEIA 3ZM8A 3CSXA 2BCCH 3FLPA 3DGEA 4X8NA 2O0OA 4LFCB 1MS5A 1OLME 1I5PA 1SEFA 3V65A 3GWOA 4QE7A 4B4RA 3ZJZA 2JKXA 2IJHA 3V64A 2XXZA 3VZLA 4CCLA 3E22A 3GJBA 5JXJA 1RUC3 4WVMB 1ZZBA 3C7FA 2Q8VA 2XAFA 3POWA 2W3JA 2WNUA 3ILRA 4FPOB 2WBKA 2F1MA 2ZCEA 2VGDA 3DXRA 3OMNB 1BBT2 2VMCA 2CH7A 5FYMA 2P22C 4AFAA 2IW5A 3OTOO 5L7OA 1WCUA 1U12A 2D44A 5GZDA 1SLIA 1E5HA 4BQ5A 1V9U1 1KD7A 4UAPA 2Q5TA 4GD4A 2NYYA 3ETEA 1K5MB 3W7WA 3ZRSA 3BUCA 2B1IA 3CZJA 2QM8A 3LPGA 5A70A 4OHVA 3BALA 4CP2A 3L71H 1BVP1 4A41A 1FJGB 2Q8EA 2F4VB 1JUIA 5HV4A 4DY5A 5LA2A 4HVOA 2VMEA 3ME2A 1BVVA 4AGVA 4FMTA 5AFEA 3QH7A 3TEYA 2B5UA 1F4HA 5FZ1A 1RM1C 4COZA 4CDWA 2N74A 2VNRA 2BDRA 1NKDA 4EZ4A 1E5SA 3O0WA 1JN2P 5FXZA 4GIQA 4Y1ZA 4ZZ5A 1UKGA 1SKVA 1FFXA 2PTMA 3MLJA 1AR63 4Q4W1 1DGSA 2OTJV 2HVKC 1QJY3 2XPJA 2VBPA 1MS8A 2P90A 4GCZA 3NRUA 1DGWX 2PY5A 4JF3A 3MHHC 4DUZB 4F4LA 2Q1FA 1LOGA 3M4FA 4XUTA 3K0DA 2VQUA 4B3TB 1OCCB 5LA9A 4KGQA 1OURA 2WSVA 2JK5C 3I3QA 2P3IA 3LB9A 4MLOA 3APBA 2W1SA 3PIGA 1B6QA 2HVJC 4ZS3A 5ERLA 1IBMO 1T2XA 1MSDA 3SQOA 1D5AA 2DVBA 1FPOA 2Q4PA 5FZFA 5KC6A 2BSKB 3HBKA 5EBMC 3CIHA 2CK3G 3ZMTA 2EIDA 2Q67A 1REEA 2IUWA 1J1LA 2ET1A 1K4DC 4OZOA 5ACA1 5HCFA 3LZZA 4P00B 5DDJ1 1BZKA 1JYNA 4CCNA 4DINB 2VBDA 4Q4Y1 5FZDA 2VR4A 4WF9V 2ILMA 2D6OX 1YI2V 4QKNA 4B1MA 5IVJA 4DK1A 4XJ9A 4AFDA 2QKSA 1GV9A 2YBKA 2CTWA 4BWAA 5H9CA 3JUUA 1FOD1 1OVSA 3IJ4A 5IW0A 4M0HA 1JOBA 4NIDA 3ZRVA 1FT9A 2OYQA 2GN3A 5ANNA 1UAIA 5EC1C 2SLIA 3WEZA 3JBG1 2PHFA 4LF6O 4LLOA 4Q0UA 4KXRA 3T1MA 3E6CC 1LU1A 4V1PA 2P06A 4CUAA 1MA1A 1VMGA 1ND3A 3EXAA 1PVC3 3C7OA 1HNXB 5LEJA 5FY8A 2GMEA 5F32A 3MV01 3N2KB 1QOSA 1JYTA 4AQ2A 3QLQA 1D4VB 4PF5A 4Q0SA 1WUVA 1LUWA 2LUWA 3W20A 4JI2O 5EPAA 2E6VA 3MIDA 2WZR2 3WR0A 4Y22B 1CIWA 3CL1A 5C3RA 4GZRB 3RZHA 5L3CA 2IJJA 2Y69C 5J2TA 5JI7A 2Q4SA 4I2OA 1MEC2 1RUG2 4WZCA 4U3JA 1W8NA 3NJZA 1KECA 5A9GA 2YG0A 5EHDA 2JB8A 3KV6A 4TTGA 5C4WC 3K75B 3JD3A 1QOTA 3PUQA 5LATA 4O2AA 2MW2B 5IJ0A 2O57A 1JU4A 2D3OW 3MDSA 4X1YB 1AJPA 3AFGA 1RUC2 1ZM1A 3T2QA 3LDEA 1PZ7A 2DE0X 2BTOA 1JFFA 4KWLA 3RI8A 4AHXA 2ZHMA 4QX3A 1FXKC 4AQSA 3DC5A 5C8YA 2CTQA 2NLJC 1Y9GA 3N7KA 1OZ0A 2OZ6A 4CXXA 2RE9A 2EINB 3SITA 4JI0B 4PIYA 3ZCCA 1AI5A 3A0KA 4E2LA 1C8M3 4XFCA 4BK5A 3TNQA 4AVCA 2XT9A 4AK3A 5KHHA 4HANA 4JI8O 1H4GA 2P2KA 1U5XA 4XFBA 1YQ8A 2I74A 5I0UA 5C3QA 3ACFA 2WFF3 3WF0A 1XDCA 3ES4A 2XMLA 4HKWA 2X53S 4NHLA 3KSCA 1XEQA 1Q6IA 1ENQA 3MFCA 4DFSA 3CQOA 4IEZA 5JCOC 5A3TA 4QQHA 2QQMA 2PAMA 4LBQB 4IV1B 1UNBA 4GWNA 1VQNV 4OHXA 2KXLA 1XHZA 1PGL1 3DKQA 5FNVA 3MDPA 4IT5A 2X6BA 3WF4A 4FZ0A 2OA2A 4JI1B 2YUEA 1AR62 1Y4WA 4X6QB 2A7WA 5DEDA 2YYOA 4CEYC 4XJ8A 1QJY2 2VUAA 2XBO3 1OCOC 3TN91 3JASB 1H9PA 2W39A 3N9OA 3LDRA 3BTAA 4FT8A 2ZKLA 1OF3A 4W6WA 1UYYA 4Q29A 5M0TA 1ZL8A 4H14A 1K5MA 2QQWA 3MUZ1 2K1EA 3AKQA 1SC5B 2JG9B 1IZ3A 4LIUA 1S0FA 4KH9A 2ZGQA 5FZCA 4KL1A 4OI2A 4LQRA 2ARAA 1NUKA 4DR5O 5HPOA 5LASA 4XETA 4PF1A 5C93A 2FCVA 3WG2A 4FPYA 3IAQA 1UZZA 3ZPOA 4FXGB 4UWDA 4Y5TA 3JAWB 4NN0A 2IJKA 2DCTA 2VZ3A 4LUKA 4JC1A 3ZYBA 1XNQO 2G4IA 4PIZA 1ULOA 4UT5A 3ROUA 2ERFA 4FJCC 4EN0A 5FY5A 4B7KA 4X65O 4CDQC 5JZGC 3GALA 1WLDA 2W1WA 4LF5B 1DYPA 1UOJA 2B9ZA 2W87A 1Q8OA 4Z2AA 2Q1ZB 1DQ4A 4DEVA 1UFIA 5KX5B 4E8CA 2HJDA 5LGNA 5LBEA 5L3BA 4TQDA 3J7MA 1IBKB 4YW4A 2AZ5A 5A2QN 2WLJA 2JGUA 3ZR6A 2PAEA 3S57A 5LOVB 4Z1VA 3ZFFA 1JOYA 3DL3A 3O0VA 2EICA 2BUKA 4LNUA 1OQ1A 2VZPA 2ZZQA 2A6ZA 3H1JH 2R6QA 5FUIA 3NV3A 1G1XB 4E2SA 4UVAA 3H7JA 2V4VA 1SF9A 4Y4YA 3KCCA 2YXSA 1VQPV 1WBLA 1XQNA 1N1SA 2VNVA 3LFMA 2ZEWA 3H8OA 2E5LB 1GNHA 1PVC2 4P9XA 1S5HC 1WGPA 3I2HA 4WVVA 1V54C 5JJNB 1AVMA 4XOGA 2QQPA 3ZXDA 1UN1A 3UV9A 3TXSA 4K8FA 3ENRA 3IKWA 1Y74B 3T4VA 4J1WA 3T1YB 4PDLA 1IGOA 4G28B 5GTIZ 3ILFA 5FZGA 2K46A 4Q4X1 1GWMA 1UYPA 4X8PA 4PLOA 4QPYA 4WFBV 2R0FA 3FN9A 2Y60A 3PN1A 1PZ9A 3A0RA 4L2NA 1QJU3 4BLJA 4W8JA 4K0KO 1LESA 1YLLA 1JZ8A 4LHKA 2GSYA 3M3QA 3W9AA 4N9IA 2Q0OC 1PNKA 3ZHTA 1I08A 2XUMA 5F2VO 4WFHA 5J2UA 5H5NA 4RQPB 2WLHA 1IDSA 1Y43B 1H8TA 1Q8IA 4RS5A 1POV0 4YJ3B 1OT5A 3SYCA 4NROA 3AEIA 4XPVA 3D82A 2ZXWC 1TZOA 1NZCA 4CP1A 2VOXA 3C3VA 1URXA 3LUTB 1NQJA 3NV4A 1Y6XA 5GKAC 5C3SA 2ZNJA 1AROP 3PMEA 4I3PA 3S0MA 2F95B 3N2KA 1TMF3 1GUIA 3UNPA 4DV6O 4OQ8A 1SA0B 1H30A 4NRMA 1YXBA 4LORA 1HV1A 5SV5A 2QDNA 4Y1YA 1HR0B 4RWUA 1C8M2 2BTQA 3PJQA 4DUYB 4GMP1 3ZR5A 1REFA 2R0HA 1DYKA 1HRI3 1UJWB 3N9PA 2JEXA 1HRV1 1RPRA 3F7VC 3CMAV 2J1SA 4YGBA 5F2SA 4QGNA 1VBD3 5JPMB 3INAA 2WFF2 1QHDA 4XCBA 1ZA4A 4XJZA 4EFEA 4Y4RA 5EYXA 1CONA 1W8FA 2R70A 2QQIA 4HL0A 3WNNA 3E97A 4XCAA 3FB5C 2W46A 3ZMNA 4TV8B 1X4TA 1DQ6A 1BHGA 2GV9A 3VD7A 4IIJB 3K5LA 2WWJA 4XQ4A 1SS3A 2XBO2 5BR8B 4CP9A 2D3SA 5F5CA 4NMIA 3GZUC 4JTNA 2GH2A 1S0EA 4KU8A 3IC7A 3F5TA 4RAIA 3H8RA 1I6XA 2L9LA 3IAPA 2JDYA 3N4MA 3VKMA 4NUBA 4P9LA 3CLPA 1BLZA 4K8XA 2BNMA 1OUXA 4OX9B 4DXTA 2DUPA 1GU3A 3FUQA 4KWUA 2AZ2A 3WG3A 4DV3B 3LSSA 1AR83 4EZHA 2QE3A 3B40A 4NTWA 4JI4O 4IGOA 2F43G 4CEWA 3ACLA 3VZOA 1OF4A 4LBQA 4ZHQB 5LB6A 3VDAA 4NIHA 1AR5A 2Y0PA 4IUGA 4ZZ8A 5J9PC 2ZINA 3MI8A 1WW4A 1FXVA 4R50A 4XF4A 4JKKA 1JPXA 1ZYBA 2LQTA 2DYRB 1R093 5GLTA 5DPNA 4W50A 1F35A 3K59A 1G8MA 3JASA 3IN9A 1JZ2A 1RGSA 1S0DA 4BA6A 4BQXA 2LROA 4YVWA 1G6NA 2JDIG 1OHFA 5IVVA 1JZ5A 4CS3A 2IZWA 5DABA 3T08A 1QXPA 3AX4A 2JDAA 4IQPA 1EP0A 3TETA 3DC6A 5F3EA 5GONB 1Z5WA 4H37A 1FATA 2JG9A 3GNEA 1HN0A 4CDXC 2Z79A 3I56V 2GNMA 2IFWA 4CUGA 5EZWA 4GJYA 4A2UA 2GBOA 2WS93 2UU9O 5I91A 3LSDA 3ZFGB 1N34O 3GDBA 1GAXA 3M8LA 4O2BA 2V4AA 2QQNA 2HR3A 1XNAA 2YXYA 1XYPA 4LA2A 5ITZB 1LHUA 1G8WA 5CVRA 1FMD3 3M8AA 2OKXA 1EPWA 5FY1A 1IS3A 3THCA 2W0XA 5JLVA 1XNCA 3H3ZA 1AJOA 4XURA 4QQPA 3QCWA 5KX5A 4E8DA 1QNMA 2KM2A 3POBA 3RYIA 4OYUA 1X59A 1QJU2 1JZ4A 3MIFA 3TK1A 2XUEA 2JIJA 1XBLA 5LOVA 2VE1A 3T3YA 4NJ4A 2V5DA 1DK1A 1ZRIA 3FMGA 1V55B 5GLZA 2FDIA 2QZ2A 2DCJA 3IGAC 1DDLA 3QOPA 3ZXJA 2P1BA 4EN9B 5JCTA 5BNNC 3C2UA 3W7XA 4FOWA 4BM8A 1DTOA 4JRAA 4OPAA 3LNMB 2EXJA 3NV1A 3USSA 2EJRA 4ISQA 2VQAA 1JU3A 1TMF2 1A8MA 3HT1A 1Y74A 4WFFA 1LENA 1Q8VA 1Q8SA 1CX1A 2XAQA 2E76B 5F37A 4XZUG 5FTTC 1SCSA 4AWDA 4WFGA 3RFRA 3DXTA 3RZKA 1K42A 1OCRC 1WPXA 1ZZCA 2GNDA 2VJXA 4UI9L 3CCRV 1HRI2 1AJKA 1F15A 5CBGA 5LGTA 2XGXA 5F5QA 3DEMA 3WF2A 1W8WA 5LEKA 3AZWA 4X20A 1VBD2 2B39A 2BVVA 4YY3O 5LY2A 3THPA 2E74B 3LOIA 1N33B 4M3CA 1SFPA 2WSSG 2G38A 4JYYA 2ZKOA 1FV3A 1W04A 2DCKA 3D0JA 4LF7O 2WT1A 4PDWC 4CUCA 4I0XA 4MHRA 5FZOB 1WD3A 4RQPA 2QDRA 3HKDA 1UU5A 3KGLA 4L8QA 5CIRA 4IGQA 1K12A 1UY4A 1EN4A 5IK7A 5T5OA 4O4LB 4YG0A 3WUDA 1J1TA 3FWEA 4HYOA 1DGRN 4TSFG 2WT0A 3BI3A 1Z0HA 3ZHQA 4CBCA 5FZHA 4K7JA 3WSOA 4XF0A 4QHOA 1K45A 5KXBA 5FYTA 3CJIC 2HWD1 3VHNA 2RDSA 5EZYA 4DUWA 1GBGA 1K73W 3SJQC 3ETQA 3R4UA 4WM7B 3JD2A 3Q8EA 5IWAB 4Y1UA 4YIOA 5IY5C 4QPGB 1NA1B 1E1QG 4LBNA 3V0BA 3PL0A 5T52A 3HOBA 5IYCO 2ODMA 1ND3C 1HNWO 1HB1A 4YM1A 1V70A 5DG1A 2VMHA 1WLTA 2QZ3A 1AR82 1RVF1 5EYPA 1AYM1 2CUGA 5LMNO 1K92A 4BQWA 4AVVA 4JV5B 2AXTZ 2HBTA 3HR9A 5EBWC 5ABJC 1RHI3 1LCLA 3TBDA 4HK9A 3LPFA 5L3FA 4CDUB 3BHPA 5BY5A 1NYWA 3AG3C 3R66A 3OE7G 4AQYO 3RRDA 2IXIA 4R8CA 3VBRA 1QJEA 4HLTA 3RPQA 1NY72 1KU9A 5F5IA 5L36A 4K20A 3WW1A 2V4DA 1GQGA 2A79B 4JQRA 2Y0OA 2F23A 3RVYA 3PJSK 4W4LA 1R092 1X82A 1QDCA 4ONUA 2BOCC 3ZYHA 1VAKA 2N05A 1GQPA 1H6XA 1N32B 3KF5A 4K1YA 4QXHA 1W6QB 3T1HO 2E75B 1M06G 4D7TA 1GN3A 5CFDA 4LITA 2ADDA 1UIJA 2WR9A 4HNAB 3RZGA 2HLDG 1J3PA 2X5IB 3RQ0A 4XJWA 3K4DA 2AYHA 4F6RB 3FYIB 2GNBA 4KG8A 3SR2C 2VMIA 1RJ7A 1GO3F 1NR1A 4TQFA 3E8BA 2ZX0A 1NZIA 3QTCA 2WS92 2EZPA 2WLMA 3RYFB 1U0AA 2JS3A 5KA5A 3OSDA 1IKQA 5LK5A 1TA8A 2C0ZA 2HYXA 3IPVA 4DV7O 4AGGA 3RYKA 2RJLA 3SCFA 1S3JA 4DR7O 3PVEA 1RUOA 2JDNA 1FMD2 1SQFA 3U37A 4AXOA 1DLBA 4FPHA 3MF9A 1W6OB 1O91A 4GH4A 3T0BA 2HEWF 3O1OA 4Z2WA 4Y33A 1UMIA 2UUAO 5FYUA 2YI9A 1CVNA 1HV0A 1E5RA 4B3NA 2WQZC 1NLSA 1NT2B 5A33B 4AQ6A 4DY3A 5GONA 4D6RA 2ZE8A 3EYPA 4NIGA 2DW4A 4YW2A 1O4TA 4YIPA 5FKBA 4BQ4A 3GXUA 2P5BA 2PN5A 4KHPO 5FO8B 1ULDA 4LFBB 1ZZ8A 4Q4Y3 2D98A 3SPJA 3BGAA 4L11A 4DIQA 1YQ5A 4QDRA 4EWAA 2BEOA 2QTOA 3GZTB 1GSLA 3P32A 4FFIA 2Y8KA 1K5MC 4F83A 5ITZA 4P9YA 4J25A 1SPPA 1PNMA 4B3SB 2K9PA 1P4RA 1HWYA 4I9QA 3NV2A 4L9BA 1NZ6A 1AJNA 1AXYA 1FOD3 4N53A 3R65A 1ROPA 4OI4A 1DFQA 1Q5OA 4NRPA 2RV9A 3LDKA 2YC2A 1GP5A 1HDJA 1Z7S3 2JE8A 2VQFO 4GKKB 1TME3 2RDCA 3U0ZA 3ZXKA 4IE5A 3BA9A 4Q26A 1YJNV 4RGAA 3ASIA 2VWKA 3M3CA 3EHBB 5JPNB 5JVVA 2D40A 1IG3A 5DAXA 5CA1A 1SBDA 5LHIA 2UXDB 3OGIB 2V73A 4YHHO 1BKZA 2XOKG 1W6MB 3C7EA 3CDZB 1KDMA 3K4ZA 4BOWA 4Y24A 2UXXA 1OCCC 2BNOA 4AI8A 1YUDA 1UZVA 2CGNA 1ACCA 2D6KA 2LRPA 3JCUZ 4LO5B 1FAYA 4NWVA 1QQP1 2QWNB 4UV8A 3G80A 2HEVF 3FL7A 3I7DA 2HHHB 2K9ZA 2V09A 4LF4B 3A0HZ 1PO11 3AMHA 3NKTA 2FMLA 1HXS3 3WNMA 2TNFA 5KUKA 1FD9A 2RMU1 2L6LA 4P02B 2ZMKA 3C3SA 1L8DA 4BXSV 2QM4A 4N8MA 2YGLA 1TNRA 2ADQB 4GWMA 4K1ZA 1L7RA 3AP7A 1RHI2 2QTSA 1LOFA 1S0GA 2EXKA 3DN7A 5FK7A 4TYSA 3POEA 4Q5OA 5FZOA 1O3RA 4AHWA 4FLUA 2DN9A 1OA4A 3GCWA 2VM9A 2WLIA 3S7EA 5LGUA 1BEV3 2IXLA 1IQDC 2JJ2G 1JBCA 1JR9A 3E83A 3GZAA 1ZBA1 4NIIA 2IJIA 3AZXA 5L73A 5CA0B 5L3GA 3E5XA 1BMFG 1MVQA 2VQTA 1V6KA 1BQPA 5CFCB 3NAPB 4QM8A 3A8TA 1DQ2A 2W1QA 4KMQA 2XTAA 4BQYA 4OXSA 4L8JA 2X09A 1BL8A 1L0LH 4CU9A 1ZAUA 4CTEA 1QR9A 2JD9A 3HWJA 3L74H 1PD3A 5EJZB 3M70A 3DPRA 4UFLA 3BYWA 5JVDB 1H1AA 4XUOA 2R49A 1CESA 1SBEA 2YMZA 4FOYA 3PVNA 4J11A 4QPGA 1NA1A 1H9WA 1WZXA 1YHFA 1GM7A 3RDIA 1YZBA 1QJFA 3N7LA 3B7MA 1L1FA 1YO8A 3ST7A 3VBUA 4JAUA 5BXZA 4AEMA 3ZYFA 4ZI7A 4COUA 5A7PA 3KVBA 4DV5B 3BAAA 2YC0A 4AOCA 1O3SA 2QSAA 3ETPA 3V0AB 2RHPA 5FZEA 4JI3B 1US6A 1PGW2 4BH9A 1V0AA 4XABA 2UUCO 1W6PB 4JTDB 5K7PA 1KJLA 3MZHA 3STLC 2D5FA 5FMOS 2BE3A 1SHWB 2Y64A 2ZCWA 5EP9A 5FK8A 3DSQA 3VLBB 4LFCO 1W6QA 4J7JA 3AVRA 3OBAA 4UFIA 4FFHA 5AG2A 1BZWA 1NAEA 4KQ7A 4HNAA 2X5IA 4IEWA 3B69A 3O14A 1DZTA 1VQMV 1XE8A 1YF2A 1VJ2A 3J8F1 4PDMA 1WA8B 1K8AW 3ZN1A 1B35B 3K5NA 1S2EA 3RWKX 5B4XA 1I3HA 3I49A 5FR3A 2C26A 2QDOA 4N7IA 2EINC 1I5YA 3ZFEB 4Z8BA 3H9VA 4G4FA 4KBBA 2Q8CA 2P67A 3SGIA 3MW3A 3NNGA 2ZE6A 3JARA 2XJUA 4ZOLA 3ZSEA 4H3WA 4UVCA 2F4PA 3HPNA 3W59A 3ELNA 1FJGO 4QGLA 2F4VO 1S0CA 1YDXA 1NE6A 1G86A 2PI4A 3CXHF 1V9PA 4AYUA 3M1HA 3OOXA 4FFFA 4D0QA 2UWBA 3UK9A 1DF4A 1Z7S2 4S2GA 3FE5A 1TME2 1PL4A 1PK6B 1EN6A 4IV1C 4UCOA 3I2FA 1D4M1 2DWDC 1UIKA 2OXBA 4E2GA 1BXHA 1PIV3 2CTPA 3RG0A 1V6IA 4YLZA 5JR2A 2XL7A 4JI6O 3LIGA 3OB8A 3EXUA 3KKYA 1YNAA 3GZEA 1XOUA 1B3QA 2FHRA 1WCSA 3ZHRA 4C0BA 2DFCA 4PT6A 3ZDVA 4J9ZB 3HQUA 3GYDA 2OQ6A 3DUIA 3N36A 4R52A 4DUZO 1HLCA 1CPYA 4BK4A 2BFUL 3JD73 4B3TO 3T2MA 3K0GA 4GKYA 5LA6B 3KVAA 2HWC1 3HPLC 1HX6A 3HEIA 4OHYA 4BMBA 2GZWA 2DV9A 3T4ZA 1AR4A 2JG9C 4EFBA 2WWUA 4FOQA 1VB2A 3P1IA 3O65A 3ZXAC 2BBAA 1OQDA 4JX0A 3VDDB 3O7OA 3DXUA 1Q7YW 4HPKB 1EV11 1HXS2 1RUD1 1MG1A 5JUVA 3EJKA 2ZA9A 3I2KA 3A0NA 1D0HA 3OBZA 2A3XA 4XFAA 4N9HA 4MH0E 1RUI3 4K21A 1RUH1 4OUMA 1POV1 2GNTA 1GOGA 3K79A 2W94A 1YJ9V 4IEVA 4W4KA 2WNVA 3USUB 3E8GA 1EYBA 2GP5A 1VP7A 1OV9A 1ODMA 4RFRB 2NMOA 2BPA2 5F3IA 3S3WA 3LDDA 1BEV2 3B02A 2Y26A 3NNMA 1MQTA 3ILNA 1YCIA 4QPJA 3LGRA 1QVFU 5FRAA 5FCCA 3Q8AA 4I5SA 4DXZA 2QQLA 3UT5B 3PTYA 5A6XA 1JZ6A 3G4SV 5C71A 4R8HA 3SCGA 5EC2C 2DURA 1QCEA 4FOVA 4YM3A 3UJOA 4I3GA 1RJ8A 1HB2A 3KG2A 2EVXA 3ZSKA 4FTEA 3T30A 2JE9A 1DCSA 3AP6A 1YSCA 2JDUA 1WB7A 2OIEA 3K3OA 3S30A 5F3GA 3HT2A 5L9RA 2W91A 1WCQA 1H2KA 2ZOEB 2V5YA 1STMA 1HNXO 3K5MA 1NU1H 5IATA 3EMRA 4FQZA 4NWWA 5IYZB 3NR7A 2XOMA 3ASNC 2VNOA 1P7GA 2XVLA 3NNJA 5K0UB 3E8HA 4FVVA 5KBFA 4OZXA 1PP9H 2ZXQA 1T5EA 2GDSA 4OVEA 4AI3A 1HDKA 1W90A 2DQ3A 1BJQA 2IVIB 1YWKA 4D94A 1RPOA 2LALA 4XBLA 4I09A 1MZFA 3I2DA 4IE6A 3IDEA 1YFXA 3WVJA 3OEHG 1CIYA 2L35A 2P3YA 4UFZA 4I9WA 2J1UA 1V54B 3NAPA 4NPMA 1SLLA 3BODA 5KC5A 3B93A 4HAMA 1JYCA 3B2EE 3AJYA 1GICA 4PCRA 2NP0A 5FY7A 1ZWIC 4LFAB 3T0AA 2AENA 1CAXB 2XHKA 4EWDA 1E1RG 4RQPC 4O4HB 2Q8OA 5FPBA 2VW0A 2F93B 2G1MA 5GLVA 4AVAA 1DU3D 4LE4A 5FP7A 5CB4A 4XC9A 1O9GA 1VBB2 4ARXA 4V2VA 3AKTA 1Q90D 2ZIOA 1AI6A 4UW3A 3TEXA 4LUMA 2Y34A 1US3A 1GWKA 1FXHA 3SMHA 4JI0O 1QXRA 5EQUA 3P30A 1KQSU 2VPVA 2P6CA 3IDAA 3N9QA 2J22A 3OUHA 1X9TA 1A34A 5FOJB 4OULA 2Y6HA 1PV0A 1PVXA 3UCSC 5BNOB 2ZNIA 5E88A 4NHMA 1W6PA 4TXWA 1VQ4V 5HCHA 4FVMA 3UESA 3K5OA 4QM9A 2KA3A 2XJPA 3H01A 2VU9A 1NBMG 3L73H 1LTEA 2K0GA 4B3RB 1DIWA 2B45X 3HNBM 4XTMA 2QNKA 2I45A 1DGWA 4QQLA 4COWA 3VBOA 4Q4V3 1J84A 2WLQA 3WDUA 3ZMUA 1SBFA 2FTKA 3U4SA 1MS4A 4TLGA 2PYTA 1PIV2 1G9DA 4QPIB 4H55A 4AHYA 1XUQA 4MOAA 1WA8A 4JI1O 4IV3A 3NJXA 4IEQA 5B66Z 1S0IA 5LZ6A 3AXDA 4FQ4A 1OPOA 4TUYA 4QD2A 1SQ4A 3LNNA 3OD4A 4DR1B 3OW2U 1R1A1 2VMDA 1O9HA 1AP6A 2XB6C 2DTWA 1F2NA 3W21A 3WF3A 1UPGA 1S0BA 3JD72 5B3SB 1CAVA 4NPLA 3MFAA 1DZRA 2F66C 2CWSA 1N1TA 4JCKA 1CN1A 5HCAA 3FAVB 1UD1A 4Q0VA 3ZO0B 2E51A 1AI4A 1OHHG 2RM21 3E5QA 4HVRA 4FFBA 1XMOB 2WN2A 4LHSA 1COV1 1W39A 3MEPA 2ZGRA 2Y6FA 3VD4A 5AVAA 1OA3A 3FZ3A 4OI0A 1NQDA 2PHLA 2PF4E 4RHV1 1F8VA 3RJRA 4IEOA 2X10A 1OMIA 2R32A 1S55A 1RUI2 4Q2FA 4BIFA 4G2KA 3OEEG 4JDMA 4ATEA 5A7NA 2DYSB 4AL9A 5FY4A 1W8OA 4LF5O 3BVCA 4BISA 2DYRC 4MVTA 4ATFA 4P5YA 5A3LA 5FMOL 3ZXFA 4M4RA 1MPXA 1FKAO 1AR73 2YEVB 4UXNA 2FCUA 2GMMA 5LBCA 1EY2A 1VRH3 4WM8A 4GB33 1IBKO 1DBNA 5FZ9A 3ZKUA 5LA6A 4Z82A 3AFKA 1HN1A 2VUCA 2VQ0A 2RS52 3ZDSA 1W9SA 1D7PM 1G4YB 3E35A 1VE0A 2N7GA 5J1XA 4G3YC 2Y38A 1OXCA 2WAOA 4MVUA 3HBZA 1IS4A 3O9OA 1AL23 4XMAA 3LA2A 1OH3A 3ZFGC 1D0GA 2FMYA 4K9SA 2KD7A 5C3OA 3OUFA 2B7YA 1W3VA 3ZEDA 2OTLV 4QDQA 4DXWA 4AFCA 4LF8B 1G9AA 2QR4A 5IAVA 4GLXA 2OPWA 2AR6A 4N7UA 2FDGA 5B1BB 4XUNA 3T1YO 3WOGA 3E22B 3F7YC 5DZGA 4QGPA 1W28A 2BGCA 2WQ8A 5HCBA 3LE0A 3VBSA 4FLWA 1YI9A 4EV0A 1BBT1 4N53C 2WNUB 3R6SA 4Z07A 4ARYA 4I30A 5KHIA 3NO8A 3DXRB 2GHYA 3O1MA 4YM2A 4LBQD 2WLNA 1OFNA 2CH7B 3JCZA 2DUOA 4O9GA 5L7OB 3AK0A 1VF6A 1AYN3 3CWBH 4C7UA 2ZM6B 2M7WA 2Z5WA 4CRQA 2P17A 2FMDA 1HIXA 3MGUA 3ABKB 5FP8A 4ET7A 1V55C 5JDBA 1QWRA 2J1EA 4Q1PA 3H1YA 5B1NA 4CU6A 1SQGA 5IVFA 3S5AA 2UYAA 1W0JG 2OX0A 4LXLA 1CZVA 3UETA 4DR4B 3WB1A 5A7QA 4M3CE 2CGPA 2Q68A 4FLXA 2PQQA 2R043 5FXWA 1QJZA 4CDWB 3POYA 3N9MA 1QLNA 3N9LA 3SYPA 4XBFA 4B4QA 4Y3OA 4J41A 4J10A 4FLZA 4S2FA 1HR0O 2DU0A 4XIOA 1FFXB 3I2JA 2ITDC 4DUYO 4JI2B 4XVHA 1AR93 2GTSA 4MW3A 2FYUH 2CSGA 1LHNA 3QVNA 4XXPA 2XDVA 3VQWA 4QGMA 1EM1A 4Y5Z0 2JDHA 4NOTA 5FYBA 4KUMA 2JJ6A 3B77A 4D69A 4FFKA 3SEEA 2W68A 3ZRXA 4QWNA 3A23A 1SLAA 4Q4V2 1FAFA 1EAH2 4FP2A 2DUQA 1VBC2 4QX7A 4TWTA 1CAXA 3CP1A 4PQQA 4O4HA 4GXLA 3J9SA 3BPZA 5IYYA 4RUFA 1EBOA 1P7BA 3X2QB 3C90A 2FDHA 2YZ4A 2YSUB 1AXZA 1WCDJ 4UFHA 5FZIA 5A6YA 1AUYA 3VBHA 3M7MX 3NQHA 3EO6A 1ZZ6A 1W0NA 2WZPP 5BR8O 1KP3A 2G9ZA 3EBRA 2H0BA 3QO8A 4Z1MG 1IS5A 5EIBD 4DRXA 1PPJH 2GDFA 4LF9B 4JAVA 1Y66A 4B7EA 1JYXA 2W47A 2MEV3 4UW5A 4Y20B 2BWCA 5IJ9A 5J98B 4WM7C 3HMYA 3K57A 3K08A 4QPGC 1NA1C 2WO7A 5FZKA 4H0LB 1IPKA 4YGEA 3FBMA 5FMDA 4SLIA 4LO6B 1B04A 4DV3O 3Q8BA 1R73A 4OPHA 4A45A 1X8EA 4O4JB 4GKJO 4HKOA 4S2HA 4N21A 3WHUA 3E6DA 3H0OA 4NVPA 4AE2A 3BA8A 4MTOA 1VPHA 2IXJA 1UX6A 1C28A 3AKPA 1VBE2 1GOFA 3DYOA 3H1KH 1VARA 4TLFA 5FLXN 5FIXA 5IYBO 3ORJA 4E4SA 1RYYA 1VQ8V 1ND3B 1YI7A 4IHJB 3B09A 2VH9A 2VQEB 4GX5A 5LP6A 1AR72 1RXGA 3T4DA 1P8JA 2GAUA 1KMIZ 1KITA 1RL3A 1VRH2 2WZR1 5LMUB 4GB32 2RS33 2V7QG 3CKHA 3T4HB 3MIBA 3VDCA 5HXVA 2X5IC 4TN7A 3UGGA 3AG1B 5D1IA 3MPBA 5IVBA 5ISLA 2QEXV 3HN1A 1MEC1 2UWAA 2ZE7A 3IAYA 3PUIA 5EWSA 3W5NA 4U3JB 2F6BA 4MO3M 1AL22 5FUNA 3RT3C 1LGBA 2KKWA 3SPCA 1RUJ3 3B5LB 2E9QA 2A3WA 3CF6E 1IXMA 5LBFA 1Y3TA 5H9RA 3KMHA 2XASA 2RCVA 3SYAA 1H38A 5IJ0B 1S72V 3JSLA 4ISRA 4CU7A 1RUC1 1VQLV 1LOEA 1JVMA 1SZXA 1U5IA 4YPJA 2AHYA 1LR5A 4DO0A 1VAMA 2HWB3 1JFFB 1CPMA 3ABTA 3TXQA 4X65B 2QWOB 2EIEA 4DR2B 3ZN0A 2QQOA 3HKCB 4FPCA 3MV11 4O61A 1LNSA 3GBWA 1MS3A 4XQWA 1HQLA 1SQQH 5C8CB 3BTYA 1AYN2 4LCUC 2VTXA 1Y76B 3ZXGA 3JATA 2RG4A 4FXKB 1JHNA 2RMU3 4ZS2A 4CSWA 2UU8A 2D3RA 1L0NH 1EUTA 1UU6A 3BPSA 1W9WA 1OBNA 1W03A 1IS6A 3U11A 4NHKA 3H8XA 1F4NA 3WNKA 4GWIA 5GM0A 1QJX3 3FYEB 4LK6A 4P9PA 1H6YA 1JYWA 2WUHA 4Q8KA 2R042 4Q0QA 2E7TA 5IFPA 4NXMB 2RS13 2EALA 1YTFD 2E31A 1IHMA 3WP6A 4SBVA 4CC6A 5H9QA 2BRTA 4AAPA 5FNVB 1AR61 4B08A 1OQEA 4LTAA 4TT3G 2V72A 1XL6A 1QJY1 1KUQA 1YEWA 1AR92 2P4EA 4WV8A 1BK0A 2MNGA 1GOHA 1K33A 4HONA 2GTAA 3PNAA 4HZFA 3HKBA 2D5HA 4CH5A 3PU8A 5GZEA 3AG2B 5CKNA 3C3TA 3WQBA 2ZGUA 1N33O 5A32A 1ZL8B 1SZTA 1N1YA 4JI5B 4IEPA 3ZIWA 1IBLB 1FYUA 1UOBA 1XB9A 4DR6B 2A71A 4A5UB 5FZ0A 2CE4A 3CRQA 4LEJA 3I2IA 2VXJA 4LNVA 2PHUA 4LBOA 2ZE5A 3VZJA 1VMHA 4YFZA 2CDPA 3HVDA 1W2NA 1O5UA 2OCCB 1LJ7A 4XF1A 1L7LA 2Z2SB 4UFKA 4OQ9A 1K3EA 3D8CA 1YJLA 5AC93 1O3QA 1WMXA 4NAMA 5CG9A 1HQWA 1FI2A 3KV5A 1GZTA 3FJSA 1ULEA 3QG5A 2MEV2 3BN6A 3G71V 2HEPA 1MMMA 3PVOA 4JYBA 3DV8A 1C5HA 5IWAO 2DTYA 3SCHA 1US2A 4ZKTB 2YIDA 2XKOA 4LR3A 4MGKE 1H1IA 2BW8A 4CCMA 1XU1A 5L19A 2JEUA 3ZFFB 4JV5O 2WWSA 3SKVA 1JXNA 3P3PA 3QO5A 2PZSA 5BY1A 2VOTA 4LNUB 1SERA 3D36C 2ZAHA 3AZZA 1K97A 3AMPA 1S76D 2EA7A 5D2AA 1ZRDA 2D43A 3CCVV 2AZ0A 3K3WA 5FL7G 1PO23 1PVC1 1PNLA 2JICA 4E9KA 3CCLV 2ZHNA 2PXJA 1OKOA 5KMGA 3ES1A 2LFSA 5CFCC 2GUZA 3NAPC 4HFSA 1N32O 1R3JC 3ATGA 2VBBA 3LQCA 3ZMZA 1WMEA 1CAWA 2RS32 4FLVA 1RC6A 4XMIA 1P84F 5E79Z 4Y20A 1F7YA 1NLRA 3J26N 4COYA 4UXAA 1R3IC 1XNRB 4QX8A 1XOYA 2NN8A 1LUVA 3LCPA 5TISZ 1PM9A 1FPN3 1QGLA 1UZWA 4FI9A 3PLQA 3UYJA 4O4JA 4UVBA 1PM4A 3UL2A 4FPKA 4IGGA 1RUJ2 2Y48A 3Q9OA 4HKLA 3ZIXA 3OG2A 1ENRA 5D21A 3ZYRA 4YGDA 2CY6A 4P14A 1IQAA 2WDBA 3VUOA 4JGZB 5J2UB 1KFUL 1CWPA 4H2AA 2ARBA 4WBBA 1H8TB 1GN6A 4RS5B 3A7QA 3OFNG 3DYPA 1UW8A 1SG3A 3CEWA 2HWB2 4KNCA 4IHJA 1C4RA 4QQOA 1S1AA 2Z42A 1LOBA 1RMU3 3EHKA 3ACHA 4AI1A 5CB7A 4BQ1A 1KP2A 5C5UA 1C8M1 3O0XA 2BWAA 3AL5A 1EV13 2BTQB 4JAAA 2BTVC 1QU7A 2QQUA 2WNEA 3K9SA 3ICXA 4O7XA 1WB8A 5FYCA 2J42A 1N36B 1NTZH 3OEAA 2Y6KA 2VG9A 3OY8A 4QKBA 4BXFA 4FPLA 5A3NA 2F4LA 2WFF1 1WD4A 2X8KA 3SHRA 2X6CA 1B35C 3AL6A 2J1RA 5KA6A 4X66B 4LFBO 3H8UA 1NE4A 2W2IA 2Q30A 1QJX2 1Z5VA 1AILA 1GN2A 3L72H 4TV9A 3ZFEC 2ZPXA 3CNAA 2UXCB 4MV2A 2ADPA 4JZGA 2RS12 3ZSJA 3ZBHA 5LXTB 2RQ6A 1V00A 4QHBA 1J83A 3CCEV 2WWWA 4B3SO 1JUHA 2ES3A 4XF9A 4XFFA 1ZA7A 5CBLA 3N9NA 1W05A 3ZN6A 4IW3A 2XBO1 2A70A 4MHUA 2AH2A 3HKCA 4CPBD 4MXWA 3ZRWA 4CP9B 1UY2A 1VQOV 5C8CA 1O6UA 1J5EB 4GKKO 4NPRA 1UY1A 2D6LX 3A22A 1Y76A 3CXCU 1PK6C 5C6CA 1MSWD 1H2MA 3MHSC 4LO8A 4JI7B 2BOJA 5GLWA 5A7OA 4INDA 5DUVA 1G7YA 3H1MA 4PIXA 1G9BA 5EIYB 2HYKA 2VOKA 3I2GA 4AI2A 1KYOF 3VOUA 5BV6A 2EXIA 4YJ2A 1N3PA 1HQNA 1M4WA 2ZEXA 3M3IA 3HR0A 3KZ4C 1ZRRA 1SCRA 4JVAA 4ASKA 4YZ3A 5CU1A 1XSRA 3ETGA 1RSOA 2UXDO 3QF7A 1BCCH 3E86A 2AGAA 4QPKA 3WF1A 4OFGA 3IMNA 3I59A 3AYCA 4BB3A 4CEWB 2OW4A 4A42A 3BTXA 1OH4A 5AC92 3SJAC 1XMQB 2ZX1A 3T2TA 4ZHNA 5FOBB 4I02A 1AP5A 1R083 5K8SA 2YROA 2HHHO 1UY0A 4NIAA 3AK3A 3VDDC 1VRBA 5F8PA 4LF4O 4XDLA 2XHNA 4PQ9A 1H1MA 2YGMA 1ZBE3 5IUQA 3BFRA 2W0FC 3EFFK 3QNEA 5FQ0A 4ZKIA 1TG7A 3UKVA 1FNZA 1B09A 2FQPA 2PLV3 2GALA 4YVWB 4GJZA 5K4LA 1ZX3A 4QX1A 2YPDA 3CRCA 1RUE3 1DQ1A 2OCHA 3WZ1A 4ZU4A 3CRRA 3R4SA 2ZMLA 1W0PA 2XQRA 4IE4A 1PHMA 3JALB 2HWE3 5F1RA 2Q1MA 2WAMA 5DXDA 2BJSA 1Q8PA 1PO22 5IK8A 2CAZC 2D2CB 1VF6C 1DQ5A 1T6BX 2ZEYA 3WHTA 1M4UA 4EEQA 1FXKA 4R9AA 4O2BB 4IYHA 2Q0AA 4LLFA 2R073 1ODNA 1UY3A 4OMCA 4XF3A 3RYCB 2BVBA 2PGGA 3NJVA 4ABMA 5D8AB 3FB6C 2NR5A 1NG0A 4NO4A 4QKDA 1QJU1 1AHSA 1UOFA 3RYIB 1A8DA 4PA3A 1FPN2 2TEPA 4XILA 2R9RB 5FZAA 3T2PA 4DR3B 2YY1A 3UKNA 3BABA 2QTWB 2LGWA 3OM3B 3WW3A 5IK5A 2YHJA 4DV5O 5A1FA 5K0UC 3ZS8C 4XYXA 3IB3A 2NLRA 3PU3A 4N43B 1MACA 4PLMA 1TGOA 4JI3O 4EB6A 2V1DA 2F17A 4U36A 4FBFA 3JAMN 4JGYB 2Y4UA 2XJSA 5FZMA 4ASLA 4DV2B 3D4KA 1BT8A 3VHOA 1TMF1 5GTHZ 3FUOA 3C7GA 1O5LA 1RMU2 2Z5UA 4CEYA 3ASNB 4UW6A 2VAUA 1U96A 2VOWA 4EYUA 3EVKA 2BOBC 4XJAA 4LP8A 5FV3A 1EV12 1MVEA 1HRI1 4HMZA 4WFEA 5DUXA 3NW4A 4JTAB 3GHMA 1I0HA 1KS4A 4JHTA 4QDSA 1VBD1 2P3JA 3FFZA 4X20B 2XLGA 3POFA 5A7SA 4FK5C 2PFWA 1WCKA 3SXWA 4J80A 1TVGA 1M93A 4YW7A 3Q4HA 3TYJA 4M3CB 5J96B 1D5NA 4PDVA 4UCRA 4AI9A 4JGZA 4AI0A 4I0XB 1WLCA 3IIAA 1ASJ3 4DV7B 4CE8A 3O1SA 1F9KA 2HWF3 5BNOC 2VWJA 3O1PA 3HKDB 4DR7B 1BQ0A 2NZ9A 3U75A 5L3DA 4X88A 1CZSA 5LBQA 2EIGA 1UXXX 2UWCA 3B9IA 1OD5A 3IIIA 2A6YA 2QUOA 4LE3A 4R9CA 3BEHA 4CDQA 5JZGA 5LA0A 4K3AA 3ZXLA 2ZDIC 2OUHA 3W7UA 4PA7A 1BMV2 3CHXA 2P5OA 1GNYA 4UCSA 4G27B 2YIAA 3KCXA 4JGSA 3HQRA 4LO7A 4BW5A 1GFF2 1Y4MA 1RINA 1CJPA 1SESA 4AVBA 1SLCA 3RYRA 1OI6A 3GBFA 5EZYB 4H44B 1W0OA 4QPIC 1J59A 1LECA 5FP4A 1MS9A 1ZZ9A 1R6KA 2ORXA 2A73B 5BXXA 4IYIA 4FM0A 3JAKA 1Y67A 4LBEC 2Q7EA 5F5AA 3V0BB 1AR81 2MK3A 2YUAA 1SDWA 4HBNA 3VBFB 1PNGA 5H9SA 5EYPB 3OPTA 1BBT3 5JSRA 2JIZG 3U1XA 3SYQA 5B3SC 5LXTA 1W2TA 1W2UA 4W6YA 4HSLA 2IXHA 1NY71 4XFIA 1VB4A 2WAAA 4URAA 5KAFZ 1ENSA 3VBRB 1HKDA 4CCJA 5FPXA 4JPRA 1GZWB 3RS6A 1R091 3O1UA 1R082 3CMGA 4X62O