5KHHA

Hcn2 cnbd in complex with inosine-3', 5'-cyclic monophosphate (cimp)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
195
structure length
194
Chain Sequence
SSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 64
structure length 194
sequence length 195
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khhA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khhA02
3E6CC 2ZKLA 1ZRDA 3EO6A 4XF4A 3OTFA 1DGRA 1VP6A 2C0ZA 4J1XA 4LA3A 2GU9A 2ET7A 3H9AA 2P17A 4Q0QA 4YARA 1CAVA 4EWEA 3RPQA 4HBNA 4XETA 1XE8A 4HVOA 4MGZE 1Y3TA 3M3IA 1PM7A 4N9HA 4UBGA 1I6XA 1ZNPA 4KWJA 4WZCA 2D5HA 4KU8A 1ZRFA 2XLAA 1YFXA 3G7DA 3ES4A 4XFIA 2F4PA 4E2QA 4IEXA 3HIFA 1J3QA 4L11A 4I01A 3H3UA 2BNNA 4XF9A 4KWLA 4I3PA 4D7SA 1DZRA 1ZVFA 4IEZA 2OPKA 3DN7A 4IEOA 4E2GA 5FLHA 5FLJA 3CJXA 4L2NA 1SFNA 5JSRA 1WA4A 1O3RA 3QOPA 4R8HA 1QXJA 1LKNA 2QCSB 1DZTA 3IIAA 3MPBA 5J3UA 2Z2SB 4KU7A 1CGPA 1O3TA 3H7YA 2H0VA 3NL1A 4HLTA 2CAUA 5CADA 4XFCA 5I91A 4KL1A 3CL1A 4XFFA 2WC2A 4MUVA 3WW4A 1FI2A 2PAKA 4LUKA 2FQPA 2EAAA 1OFNA 2PAMA 1FXZA 4QXKA 1YFWA 3QACA 3RYPA 3EQEA 4Z07A 3U0ZA 3ETQA 3S0MA 3BPZA 1CAVB 2VECA 1VR3A 4IEUA 3I59A 2EA7A 1SQ4A 3HT2A 3H1YA 2BYVE 2MPFA 2K0GA 5BPXA 4AXOA 4BHPA 2Q4SA 4XF1A 1L3JA 1OMIA 3FZ3A 3HT1A 1RC6A 3RDIA 4HN1A 4FAHA 1XE7A 1ZZ7A 2XKOA 5LEKA 3MYXA 2PFWA 4HSLA 5LRSA 2GC2A 5I93A 3N4MA 4IEVA 4BIFA 3SCHA 5KBFA 1YHFA 2Z69A 3C3VA 4E2SA 1ZZ8A 3U10A 2DCTA 3E5QA 3H8UA 4TLFA 1RGSA 5I0UA 5BUVA 3VHRA 3RZZA 5I0RA 3HQXA 2PHLA 4Q0VA 4EWDA 1SEFA 2B8MA 5EZWA 4Q0SA 3WW3A 4I02A 3E97A 4FT8A 3E6BA 1PMIA 2IXCA 5AVPA 1IPJA 2B9UA 3IWZA 1U12A 3IDBB 4IEYA 4HSJA 4JV4A 4JVAA 4N9IA 4EWAA 1LRHA 1X7NA 4P9GA 2Q30A 4WBBA 4XF0A 1H1IA 2PHDA 1RTVA 3LWCA 2H6CA 1NZCA 4META 4ONUA 1EP0A 5BV6A 3NKTA 2GZWA 2PA7A 3UKNA 5JSPA 2O8QA 3H7JA 5I8SA 2HJIA 1TQ5A 4KWKA 4QX5A 3LA3A 2FMYA 4LEJA 5I8TA 3CO2A 4QM9A 5E1RA 5KHGA 4EV0A 4PIXA 4XFHA 3I7DA 4QGLA 4HVRA 1X82A 3LA2A 2O1QA 1ZZCA 4AQ2A 4EROA 5KHKA 2XL9A 5FQ0B 3UKVA 4YYOA 5JSOA 4IEWA 4AQ6A 1RUOA 1ZZ6A 1CAWB 1OD5A 3SXWA 1H1MA 4O9GA 3TNQA 2QJVA 2QNKA 1J58A 1ZRCA 3U11A 2IXIA 2UY9A 1Y9QA 1WLTA 4OLLA 2D5FA 2CAVA 4WVZA 4Q0UA 2I45A 2BNMA 4A2UA 4R52A 3H1WA 5BY5A 2OA2A 1X8MA 3NW4A 3S7IA 2PTMA 3IDCB 4LULA 2Q1ZB 1V70A 1NE6A 2GC1A 1Q3EA 2GC3A 1HW5A 1Q5OA 1O5LA 3USSA 5J48A 2BNOA 1YFYA 4LLOA 2GC0A 1QXRA 4Z82A 4BYYA 3SCGA 2XL7A 4MX3A 5FPXA 3FHIB 1OI6A 3I54A 4PJYA 1ZX5A 5FPZA 3GBFA 2VQAA 2XKPA 4AVBA 2Y0OA 1JUHA 2BEOA 4IESA 3EHKA 3DL3A 2Q0AA 2XHKA 5KHJA 1EPZA 3OF1A 1UIJA 1CAUA 2D40A 3SMHA 1FT9A 4X6QB 4HN0A 4XFGA 2V09A 3LAGA 5LRRA 2HKXA 4GULA 4QM8A 4ORFA 3CEWA 1QWRA 4K8FA 4O9EA 5LEJA 1O3SA 1EYBA 2PQQA 5KHHA 3D82A 2GAUA 5JR7B 3GYDA 4LUMA 3FE5A 4QGNA 1RL3A 3WW2A 1CAUB 1J59A 4IETA 2XGXA 2XLFA 1GQGA 2GH2A 3FJSA 5C8WA 4AVAA 5FCCA 3MZHA 4UBHA 2OZ6A 4F7ZA 1UD1A 4F8AA 5K8SA 5E16A 5D1IA 5HI0A 4AVCA 3WW1A 1EY2A 5C6CA 3ZDSA 4I09A 4MH0E 4LA2A 3OD0A 1UPIA 3BALA 3LA7A 3OGJA 1YUDA 3CF6E 4XFBA 2MHFA 5KHIA 3H50A 4Q0PA 5CU1A 5JCTA 2EVXA 1XRUA 3FWEA 1G6NA 1ZZ9A 2QVSB 2IXJA 3KSCA 2QDRA 4XEZA 3MDPA 1O4TA 4UXAA 3KMHA 3E5UA 4NVPA 2PYTA 3D0SA 4PIZA 4MV2A 4I2OA 4ZU7A 4YSFA 4FAGA 4J1WA 1YLLA 4HZFA 5J7MA 2OZJA 1CAWA 2N7GA 1RUNA 1YWKA 4PIYA 3BB6A 4CYDA 3EBRA 5CVRA 3FFQA 1I5ZA 4HMZA 2H6BA 1ZRRA 2UYAA 3JZVA 2MNGA 1LR5A 3BU7A 2VPVA 4Q29A 4IEQA 3I59B 2E9QA 3E5XA 4B29A 4IEPA 1J1LA 4ZU4A 3RNSA 4JTOA 1DGWA 1O3QA 1CAXB 5FLIA 1X8EA 1ZREA 2UYBA 3RYRA 4I0AA 5EFUA 2IXKA 4QGMA 3H3ZA 1UIKA 5BXXA 1NYWA 3KCCA 3RYKA 2B5HA 4RD7A 3NSTA 3R6SA 2CGPA 1GQHA 3B02A 5FQ0A 4H7LA 4FBFA 3NVCA 1UCXA 3H1MA 4MGKE 3DKWA 2D93A 3PNAA 2ETEA 1IPKA 1CAXA 3LZZA 2ATFA 3DV8A 3TNPB 5I0SA 1CX4A 1O7FA 3EJKA 4OFGA 1YFUA 3LOIA 2KXLA 4XF3A 4I0BA 4LTAA 3O14A 3S7EA 4BH9A 5I8YA 1O5UA 1LB2A 5T3NA 1QY4A 3FX3A 4MGIE 2UY8A 4MZUA 3ACLA 1Q43A 1J3PA 1UW8A 3BCWA 3OCPA 3E6DA 3ES1A 2IXLA 3NJZA 3KGZA 3KGLA 2OYZA 5F1RA 3ELNA 2ZCWA 3M70A 3SCFA 4DINB 2XLGA 3PVBB 4HVQA 3D0JA 4YRDA 3L2HA 2ET1A 2WFPA 4IERA 2IC1A 3ST7A 1J3RA 3PLQA 5I0TA 2BGCA 4XFAA 1NXMA 3ROUA 1VJ2A 1ZZBA 4MGYE 4YNIA 5JAXA 2IXHA 4JTNA 4QMAA 4ZU5A 5FDBA 1NE4A 2PAEA 4D7TA 3UKTA 3IBMA 2K9ZA 3CLPA 3SHRA 1WGPA 2CV6A 4X6RB
chains in the Genus database with same CATH superfamily
2RS11 1B35A 2ZKLA 3WR0A 1RUI3 5G05L 4GB31 1S1AA 2A1XA 4ZHNA 4YARA 4GALA 3CJIB 3SYOA 3AP9A 1HV1A 1PO13 4QU2A 3AYDA 4I4TA 1Q8SA 2V4VA 2VULA 4BQWA 3ES4A 2Q8CA 3MV01 1J1TA 1DGSA 2VZQA 5KWRA 3PIJA 4KQ7A 3H3UA 3ZN6A 2VQFB 2WR9A 1QJEA 5T5PA 4JV5O 1OF4A 1O3RA 4J9YB 1YI2V 2NLJC 2FHRA 2ARAA 1WP8A 4CP2A 2DBIA 3QTCA 1VAKA 4HETA 3AM2A 1LOGA 5CADA 4KL1A 3CL1A 3VZMA 1NT0A 2PAKA 4UCTA 2WIIB 5APAA 3RMXA 3ETQA 1X50A 3BPZA 1OOPA 4UT5A 3VQYA 1ULGA 2EIJC 5K0UC 2Q4SA 5I93A 3N4MA 1ONAA 2WNUA 2ZGOA 5FY5A 3U10A 4K21A 4XPVA 3I2OA 1TVKB 3I2JA 1AX1A 1PMIA 2CNAA 4WVVA 2QTOA 3T1LA 4DB5A 5L7OC 4CDXC 4B4PA 2RS31 4AEDC 4KWKA 3EVKA 2JECA 4Q27A 5EV7A 3I7DA 5LATA 2BVBA 5IAVA 1X82A 1SZXA 1DYPA 5C4WB 2VZOA 3KWVA 3NAPB 4X62O 1QJU2 3SPJA 3RVYA 3POBA 3CSXA 1TNRA 4ICGA 3ZCCA 4O9GA 3THOA 4B3TB 3I49A 3A22A 2XBO1 4D6RA 3VKMA 4OPHA 1OCCB 3GZTB 3Q8EA 3B09A 2OT7A 1UKGA 4N7UA 5D8AA 2BNOA 4WFFA 3VZKA 2NN4A 3I54A 5CB7A 5H9QA 2LTNA 1R6NA 3I2IA 4QPGA 2RMU1 1H8TA 3PUAA 5JJJB 3MF9A 4QGPA 3WG7C 3F2ZA 1F4AA 1PGW1 4I9WA 5A7NA 3WVJA 3MAQA 2ZMKA 5FP7A 1DTOA 3SH5A 4A7KA 3BA9A 5LEJA 1S5JA 2VMGA 3D82A 1H8TB 1MS3A 2GMMA 2WT2A 5GJ6A 5EJ3A 4F4LA 1RL3A 1DF5A 3VDDA 4EN0A 3T09A 4K8XA 3FLRA 4WV8A 4Y22B 5D1IA 4WFHA 1R1A1 5HI0A 1AL21 2EBOA 1UNBA 1URXA 1BS3A 5FK7A 1QHTA 4JGYB 4YG0A 2ILMA 4ZKTB 2QKAA 1FMD1 2JVDA 2MHFA 3K3WA 1RMU1 1XRUA 1KFUL 3K79A 3ZFEB 5EP9A 4Y1XA 1REDA 1RUG2 2ETNA 1QJX1 1H1AA 1K3EA 1GWMA 1AJOA 5DQ0A 1C8NA 3MIBA 3HR0A 4ZHQB 4AEMA 2OZJA 1GN3A 1QNMA 1XMOB 5SV8A 3JASA 1SLIA 4CDXA 4IV1C 4DRXA 4IE7A 4XUOA 2G19A 2ADDA 5ACA1 4JZGA 4C0BA 2PN5A 1C3HA 3POSA 4NIHA 1H2NA 1MZFA 5JJEB 3E5XA 2OT5A 3ZR5A 1NY72 2DCJA 3LGRA 2JRIA 5KXDA 1BMV2 3LDEA 1X8EA 1VQ5V 2GHYA 5HV4A 3IN9A 1OFSA 2RM23 4MVOA 4DR3O 5BXXA 3KCCA 2EJ7A 2Y38A 4I9QA 1MEC1 1CJDA 2PQSA 2AW9A 4Y20A 3VDAA 1S0CA 1RVF1 3ZYFA 4LF5O 4FPLA 3CBNA 3PUSA 1YFUA 1JUIA 2CDOA 1YXBA 4LQRA 3S7EA 4BH9A 4LORA 4ZOLA 1VB4A 4WZFA 3WG3A 4MGIE 5FZIA 2R041 3X2QC 1J3PA 4Y4YA 2KG7A 3LDDA 3KGLA 1U97A 4L0PA 2QUOA 3JCIA 5FKCA 1I3HA 2AYHA 2WFPA 1KKCA 3UV9A 2RJKA 3T4VA 2RMU2 1Y76A 1V6IA 1PD3A 4JTNA 1UY0A 4H37A 2W87A 1QU7A 1FS0G 1JFFA 2PAEA 4MO3M 3SH4A 2QWOB 4MW3A 2CV6A 4B4RA 1QCEA 1TMF2 2EJRA 1DGRA 4XBLA 2DF7A 1JODA 2QM7A 1CAVA 2QQKA 1LHWA 2ZHLA 1URFA 2D6LX 4UVAA 1HRI3 3MHZA 5FP8A 1N47A 4N7IA 1XL4A 3HKBB 3RI8A 4DV2B 2B4KA 3VBRC 4YGBA 2AREA 4PDWB 1RUH3 1JYIA 4LH7A 1KS5A 2PHTA 3A0HZ 5BXZA 4RHV1 2X8KA 4JQTA 3TN92 2DQ3A 5FYZA 2ZZJA 1ASJ1 2VC9A 4PD4F 3KHCA 1AX0A 2WZ8A 3MIEA 2PLV1 5FLHA 3N9MA 1VBD1 4LE4A 5L9VA 3JBG3 3DGEA 3B01A 2HWD1 4BZ4A 5DN2A 3DKQA 3VBUB 1QXJA 1QF3A 4K1ZA 5DDJ3 2PUSA 5JVDA 1FD9A 3H7YA 2BDRA 3U14A 2JG8A 4FCAA 1FAFA 4LIVA 1VBC3 4XFFA 2WC2A 5C5TA 3WW4A 3MW4A 2JDPA 3PUHA 4YGDA 4NXMB 1YFWA 1AR93 5FZBA 2H3OA 3A0NA 4QXCA 4IV1B 1XNQB 4K1YA 5L3BA 2ZE5A 1V54B 4DV5O 1AF9A 3ORJA 4QD2A 2K0GA 4XCAA 1DU3D 3DTUB 3HKCB 4ABMA 2TBVA 3W7UA 1PVC1 5FFOC 4LP8A 2QKDA 1NY71 3ASNC 3S3WA 2VCMA 4QQ2A 2DFBA 3WEZA 1H2KA 1AVBA 1F7YA 3RZZA 1PNKA 1RIRA 2QQPA 1W6PB 4I02A 4K0KO 1W8TA 3JD2A 4JVAA 4LF6B 3AB0A 5IVBA 1GAXA 3LSEA 2Q30A 4XF0A 4GT1A 4L8QA 4LHNA 4FTEA 3GZUC 4HK8A 4META 1EN4A 5EWSA 5JSPA 4LF4O 2ZEZA 1IG3A 4XILA 1JZ7A 1EM1A 3CO2A 3K4AA 2JJ1G 5KAIZ 2GSYA 3GCWA 1BL8A 3HQUA 4CTEA 1VBA2 3R05A 4RAIA 2DTYA 4R4ZA 3O1VA 5BNQA 3K0GA 2P6CA 3IMNA 1OH3A 3THCA 4U3FH 3VBUA 2UY9A 1MSWD 1Y9QA 4E27A 2EXHA 2YXSA 1RUD1 1EN6A 3NO8A 3RZMA 3CD6V 5BNOA 2YC4A 4LBJA 4QDRA 1LULA 2ZGNA 1W9SA 2UXDB 4IV1A 3RQ0A 4RS5B 3BI3A 4K20A 2Y0OA 3S5AA 1G9DA 2P3YA 4XTMA 5IK8A 5LB6A 2Y33A 4XACA 4AGVA 4FIPC 4F6EA 1W3VA 5FY7A 1TME2 2LW8A 4OMCA 1QWRA 4CXWA 1NTKH 4O9EA 1EYBA 5H9RA 1MS0A 1WMDA 3K77A 1W2OA 5K9YA 1XE0A 1IS5A 2EILC 1W0NA 2GAUA 4A6OA 4ISRA 3GYDA 1KYOF 4CPBA 4JZ2A 1CAUB 2YG0A 1N3QA 1K92A 2HJDA 4DV4O 2X53S 4E8DA 4IE6A 1QJU1 4H3WA 1JOYA 1ZWIC 1SESA 4F7ZA 3E22B 1HP8A 4CCLA 3K46A 1HXS1 4N21A 2JB8A 3T1HB 2JE7A 5C6CA 3ZSKA 3SLIA 3ZKUA 2ZT9B 4I09A 1M1KW 4P5HA 3VHPA 5DUXA 1ST8A 2R071 2DTWA 2ZMLA 4LNUA 4X66O 2BCCH 3WP5A 5FPUA 1HWYA 1S77D 1NTMH 3RZLA 5FZ1A 3VGIA 4DEQA 4WM8C 5DZFA 1AI5A 2JE9A 4M3CB 3D0SA 3RYHA 3BFRA 3VBRB 1K5MB 4G9SB 1RUNA 1YWKA 2HJFC 5GONB 4NWWA 3K2OA 1BMFG 4JGZC 3ZMVA 1WD4A 1US2A 1XI1A 1F4HA 4M0NA 1V55B 5KXEA 4HAMA 5JVVA 5IFTA 1Q8OA 1U5ZA 2W95A 4YGCA 2WRAA 1NJIW 1J5EO 2JS5A 3OE7G 4OX9B 3BA8A 1W0PA 5FY9A 3H3ZA 3AMHA 1X36A 4YGEA 1GQHA 3FHQA 1MMMA 4UW4A 2RDSA 2ZXWC 5GLUA 2ZIMA 4DUZB 4H7LA 1JZ6A 2ZAHA 1BEV3 3E83A 2QE3A 4V2WA 3LZZA 2ZD9A 4MHRA 3EJKA 4H0LB 2R49A 3POFA 5H5NA 5L19A 1W6NB 4CUAA 1V54C 3H1JH 3VDCA 1NG0A 4BIUA 1HB4A 5LYJB 4QXHA 2DW4A 1UW8A 3N9NA 5L7OA 5LW9A 1QVFU 1V6NA 3D0JA 4L87A 5CFDA 3JD4A 2Y60A 4J7JA 2R32A 1A34A 4DV0B 1SCRA 2A70A 2RCVA 4LHLA 4UF0B 1ENQA 1POV1 4WFAV 3MLKA 4LE3A 4TUYA 4DIQA 4RA0A 4HKLA 1IDSA 5FP4A 4LA3A 2PELA 4YW2A 4DR2B 3RYHB 4YJ2B 2V7QG 2JDUA 4IYHA 1XNQO 5LBBA 2VZSA 1IGOA 4RUFA 5F39A 1ASJ2 2D5HA 5BNPC 3JSNA 1M93A 2D43A 2XLAA 2EIJB 3MD0A 3GBGA 3ETDA 2RDNA 2J1SA 5FL7G 2GALA 4P9YA 3CWBH 3IC9A 2X7RB 4YVWC 2BE3A 3WZ1A 5FNVB 1PV0A 1Z78A 2XJTA 4LT5A 4I4TB 2P7TC 3UO3A 4N43A 5BR8B 4AQYO 2Q9LA 4FFBB 2RVAA 2XUMA 2B39A 4EEQA 2R072 2RS51 2OS2A 3WY6A 1AR72 3QBQA 4R9BA 1IOAA 3CMGA 4D7YA 1QQP2 2XWJB 3KS7A 2E33A 4MUVA 1PNLA 2UUCB 4K7JA 3VZNA 3ZXEA 3NNJA 5FZ3A 5A6QA 3U0ZA 4EE2A 2QTWB 2D6KA 1AB3A 2VMEA 2EF6A 2VUJA 4JX0A 4A5UB 5F2SA 4GIQA 4YW3A 5LEKA 3LB9A 2BGOA 4HSLA 1OLME 3RI9A 1LGNA 3PUIA 1YHFA 4B3NA 2VNVA 1QXPA 1GN2A 4LBEC 3E2EA 4Q0SA 1K5SA 4FQZA 1G9CA 3WHTA 3KF3A 2VG9A 2LJ2A 1Q8PA 3WV6A 3LWCA 1RUJ3 1NZCA 2ZZQA 5FBZA 4ZOLB 3GHNA 3E8GA 1TQ5A 4QX7A 4TV8A 3RYCB 3LA3A 2BFUL 4OI0A 4U7OA 1IVSA 2OX0A 2J1TA 5FZ7A 1TEIA 4XFHA 1LCLA 3LSSA 1WLWA 1LECA 2O1QA 4EFBA 1RUC3 3H42B 3AG7A 1KS4A 5FOJB 1H6XA 5JSOA 1HNXO 5J09A 1RUE1 3ZVXA 5JI7A 2AZ2A 2Q7EA 1ZZ6A 3UGHA 5GZCA 1H1MA 1VBB2 1GZTA 5FJKA 1WB8A 5HXVA 3K5OA 1DBNA 4YM2A 2P5OA 1DQ4A 2O0OA 4XJZA 4CU6A 3MFAA 4QKNA 3D3IA 3IJ4A 4OLLA 1LODA 1WMXA 1FNYA 3LDBA 2BNMA 1QOOA 1COV1 4YW6A 5KUMA 4AFMA 5L3CA 2P3IA 3VBHB 2NLRA 3L70H 1UX7A 1WB7A 5L73A 3OGVA 4DUWA 2FZ2A 1PNGA 2GC3A 2W1UA 5J48A 4D6QA 1SLCA 2P4EA 2X5IB 2WSSG 4Z82A 3ZSJA 2XL7A 3FHIB 1OI6A 2V73A 5LA0A 1TMF3 1PM9A 2VQAA 5F6KA 1AILA 1JUHA 2BEOA 2ZAAA 2DFCA 3Q8CA 3POYA 3ZX7A 1CAUA 4HN0A 1GQPA 4LK6A 4A7YA 2IH3C 2AGSA 3AZXA 5EIYB 5L3FA 4CH5A 2IUWA 4EB6B 1PHMA 4IETA 5FYIA 1PMHX 4PDWA 3T0BA 2CTQA 3AP7A 5C8WA 1DF4A 1XPWA 1HB1A 4IQPA 4CDQB 1DQ1A 3INAA 4WM8A 3WW1A 4LCUC 4NRPA 3H50A 3USUB 1XNAA 5CU1A 5HCBA 1JZ8A 5I0DA 2B5UA 2EVXA 1XQ8A 5GLWA 4PQ9A 1SC5B 1R73A 2VRZA 3KSCA 1VIWB 1CD3G 1O4TA 2UXDO 4AHYA 1NT2B 1KGYA 5LP6C 2ENRA 4ZU7A 4J1WA 3ZJZA 5H9CA 1W6PA 4PT6A 4AFAA 3APBA 5A1FA 3EBRA 1I5ZA 1JMUB 3F5TA 2WBKA 3MV11 4QQPA 2Q8VA 2X0LA 1DG6A 4FSJA 2AEYA 1XC6A 4FLVA 2ZDIA 3I2DA 5B5EZ 3ITQA 1SLBA 5A3OA 1MZ5A 1D2QA 2I2SA 3HN3A 1OPMA 5BNNA 2IXKA 2ZHNA 4UCUA 1TUEB 4O7XA 1NR7A 3PVOA 3ZFFB 2RE9A 1XSRA 3B02A 1TZOA 2IU3A 3PNAA 1EUUA 1W04A 1HN1A 4URTA 1OPOA 1KD1W 1RFYA 2RR13 2LM3A 4DR3B 5IFPA 3MO4A 2BTQA 4LTAA 3O14A 2D6PA 2BOIA 1HW7A 3ZRSA 1QY4A 3TXSA 4LXLA 3AG4B 1UZWA 4JGZB 3BGAA 4UF0A 3J26N 2EALA 1OLQA 4TUYB 4I55B 3B93A 1HNWO 4WVMB 2Q0OC 3M70A 1G4YB 1OT5A 1MQTC 2EULA 3AYEA 2DJVA 2A6YA 2HWE3 5A9GA 5LHGA 2VZRA 2WYSA 3ETEA 2FMLA 2UXBO 4KHPB 2A6ZA 5FUNA 4HANA 5BMVA 3W7WA 3UGFA 2VCAA 1SQVH 5GLZA 5T50A 1Y74A 1ZBA1 3WDTA 1O4YA 1N36O 4Y1YA 2ZIOA 2WFF1 3WQ1A 5EK0A 4MW8A 4KI5M 4W4LA 4ASLA 3BABA 2ET7A 5HCAA 3FN9A 1LUVA 2GTAA 4XBNA 1S0IA 2ZS6B 1W3XA 1ZNPA 4NPMA 3VUOA 5IVFA 3OGGA 5IATA 4JI4B 1F35A 4GJYA 2P90A 1W2TA 3VQWA 1W6NA 3QO5A 1ENVA 4UFMA 3WDUA 3IGAC 1FYJA 1BJQA 1HV0A 2WT0A 3TEYA 1NLRA 1OQ1A 2HFEC 4O4IA 2DVBA 4IV3B 4QDSA 2H8PC 4NRQA 1K7DA 4LC1A 2FL4A 1CONA 5FWJA 2I74A 3ZN6B 4I5SA 5DUWA 2YGLA 3JQWA 1FXVA 4RGGA 3ABLC 5F37A 2Q73A 1VPHA 3TEXA 1K5JA 3G71V 4XZPA 1FI2A 1SFYA 5A3PA 3FAVA 2QDNA 3LSUA 2W47A 4LBLA 2K9PA 2BQPA 5A3WA 4Z07A 2BW8A 2DUOA 1M56C 1RJ7A 2A06H 4W8JA 4YJ2A 5KC6A 4BXFA 3FZ3A 5LHIA 4Q1RA 2LGWA 2ZGLA 3U37A 1QU0A 4LITA 5J2UB 1N1TA 5LY2A 4QE9A 4YM3A 2VTFA 5LWBA 3A0RA 1CZTA 4NHMA 5HFLA 1OLMA 4WFGA 3J8F2 2B8MA 3WW3A 4LBMA 2OWOA 1U5XA 4FI9A 1AYN2 3KV5A 1K9MW 2Z3YA 1KECA 4J42A 1BBT3 2VZ3A 4UW3A 5LZ6A 1NQDA 2WLQA 2VGDA 3P6BA 3T30A 3SEEA 1DIWA 4D0QA 1YNAA 2VOTA 1W2NA 1X4TA 2W52A 2ADPA 2WQZC 2EIMC 3AG1B 3SPGA 1ZBA2 3VBHA 3HKEA 1W9FA 1OKQA 1K8AW 3LIHA 4BXSV 3QF7A 1A6CA 5C3QA 5C7GA 5IVYA 5H9PA 3JU9A 5A33B 1Z7S3 2OA2A 2AR6A 5J98B 3M3EA 3MF6A 4DV0O 5KMGA 3B3QE 3BRCA 3JB4C 2RN9A 4LLOA 3QO7A 2FZ1A 2UWBA 5FPXA 4PJYA 4PA3A 2QQIA 4KUMA 5EYPB 4UFIA 5IWAB 1V0AA 1Y67A 5IY5B 4QX3A 5BNOB 2AEZA 1XNRB 4DR7O 4TTGA 1YQ5A 1Y74B 1LNQA 1EZJA 4E9KA 5KMGB 2V09A 5FPRA 3H1KH 3LAGA 4X20B 4XFGA 5IW0A 2WN3A 3ML0A 1K5MC 3H8OA 4HNAA 3AX4A 4XTPA 3IAYA 4TV9A 3AG4C 1XYPA 2VZ1A 1YI9A 1CQ9A 3FE5A 4HPKA 2R72A 1N36B 2C24A 2F93B 3LUTB 4LFAB 4NRMA 4YY3O 1L1FA 4NAMA 2UU9B 2C6SA 3O65A 3ASOC 4JGYC 1TUBA 3VL9A 1XBLA 2GDSA 3SPCA 1M56B 4XFBA 3MDSA 1MEC2 1ZBE3 4HT1T 5F3IA 2V4AA 3AP5A 3I56V 3WNKA 3O5SA 2DOSA 1H8HG 3SYCA 2Y4TA 4MG2A 3NRUA 4BISA 4KG8A 2WAMA 3MDPA 4O4HA 5BYNA 4QWNA 1YCIA 3KV4A 1YLLA 4HZFA 1STMA 1SQFA 2P3KA 2W6JG 4IIJA 2ZEYA 4RGAA 2W91A 1JTZX 4EZ4A 1H6YA 5JLVA 4JI7O 3VBFB 1R091 3HNMA 4ZY9A 2E9QA 4WCEV 4MVSA 1AR62 3CRMA 4UFZA 1ODMA 2WSUA 3CB2A 2OXBA 1QJY1 2ZE7A 3CJIC 3K5NA 2C9AA 4IE0A 1P84F 3VBOB 3AK0A 2XJSA 4NXNB 2CWSA 1WJZA 4K8ZA 2UXCO 3NVCA 5F3CA 2Q1FA 3DKWA 4CXYA 4QPGB 1FJGB 3B5LB 3VD5A 5LHHA 1CX4A 3JD73 3AK3A 5LY1A 4WM7B 5CFCB 4XF3A 2ZGKA 5I8YA 4B8EA 2D6OX 4A3ZA 3VBSA 1AR73 2RHPA 4M3CA 4MVMA 2BSKA 2Q67A 2QQJA 2PGGA 2YFUA 4Y20B 2EILB 2CSGA 3WCSA 2JK5C 3W7SA 5JPMB 1OA3A 1N34B 3NJZA 4Q4V2 3SCFA 3WFVA 5A7WA 1P7BA 3JCUZ 3CCJV 2W08A 3N7KA 1N0JA 3KV9A 1RHI3 4LK7A 3ZX6A 3IC7A 3CX5F 4MGYE 1TVKA 3FB8C 5T52A 1QOTA 3JD3A 4AL9A 2BRTA 1ZL8B 4MT8A 3HKEB 3UKTA 4CP0A 4YHHO 1VQ7V 3GGLA 1WGPA 4DV1O 1KJLA 5FMOL 2GUZB 2N74A 3FMGA 5EC2C 4BAYA 2UXCB 3OBRA 4PJ0Z 3WP3A 2VTXA 1UZ0A 4MXWA 3HPNA 4D8MA 4UBGA 1PM7A 2XT9A 4H55A 4COVA 1C8M1 1VQ6V 4QT6A 1PGL1 1S2BA 1OURA 1Q6UA 1VAVA 4CVUA 1SETA 2YEVA 4E2GA 1W6QB 5L7OB 4XUTA 4NPRA 4QJFB 2A75A 1AYM1 4JV5B 1REEA 1TME3 4AEDB 1DZTA 2HEPA 1BVP1 2WS92 3FC0A 1GFF2 1A3KA 2H0VA 4KMQA 5IK4A 1BT8A 5FNVA 3CHXA 2NR5A 3T4ZA 1IKPA 1PO23 1RUF2 5FZGA 1GMGA 4WM7A 1W9YA 3AEIA 4QPJA 4Q20A 3RZJA 5FKBA 3TGUH 3EHBB 3RYIB 2BYVE 2MPFA 1FOD2 4CA9A 4O4LA 4C1WA 1OMIA 5DAPA 1UU6A 1SBEA 4Z2WA 2YXLA 4X8AA 2XKOA 4NIDA 2PFWA 4XBFA 5B1NA 1WA8A 3ZHTA 1VQPV 4FFKA 1S0FA 4CH3A 5IYCO 2CTPA 3C3VA 1E57A 2OCCB 5I0UA 5BUVA 4AVSA 3M8AA 2WKKA 4NHXA 1SEFA 3I4IA 1YJ9V 2IXCA 1IPJA 3K9AA 3LQCA 2UXNA 4EWAA 4P9GA 4RL7A 2BTQB 3DPRB 3CDZB 4D3WA 4P5YA 4GX2A 2VVFA 4DO2A 2DUPA 2X6CA 2W68A 3B8NA 2CAZC 4LEJA 4FVVA 3WNOA 5F9TA 4CDUB 3AFGA 2WZEA 3LDCA 2P6JA 5AFEA 2ITCC 5EZYB 4YYOA 3RZKA 4TLGA 1HNZB 3BKZA 1R3JC 1RUOA 3OEAA 2QWPB 4B3TO 2YBKA 4PBPA 3QH7A 1I7FA 1J58A 3CMEV 4BMBA 5EYXA 3VBFC 2GH8A 4AFDA 2VM9A 4WVZA 1FOD3 1XNTA 5DUUA 2I45A 4FLZA 1J95A 3W9AA 1MVEA 3U4XA 4KG0A 1QJY2 3NW4A 4I55A 3FB7C 1XOUA 1V70A 2BERA 2R70A 1NE6A 1DQ6A 1GYKA 3USSA 1FPOA 2LRPA 3BOWA 5JZGA 3BODA 2WZPP 3ZPOA 5C8YA 3FBMA 2JEXA 5JZGC 4JI1B 3HQRA 3ZN5A 1ZA7A 4CU9A 1JCHA 1BQ0A 3AG1C 4QM8A 3D36C 3W5NA 1AR82 1L7QA 2QQOA 1ND2B 1D4M3 4DUYB 4HL0A 5D5QA 1HQWA 4G4FA 1WN7A 2YC0A 2C9KA 1PGW2 5JIAA 2WNUC 2XHNA 4UBHA 2OZ6A 4TYSA 5CAZA 3TOJA 4XUNA 5FZ0A 4UCVA 5A6XA 3HKDB 2HWC3 3R66A 1UPIA 3CF6E 4IIJB 5FZ4A 2WLLB 2JX9A 2JICA 3SQOA 4UW6A 4Q4V3 1UY2A 4UXAA 3GM8A 2Q69A 2ZNIA 4DUXA 4Q4W2 5CKNA 2UUBB 4LF7O 2KA3A 2E75B 3WNNA 1RHI2 1AXKA 3KT4A 3ACGA 3ECQA 4DUVA 2WQ4A 1ODNA 4EZHA 1EZVH 3AVRA 4RQPC 2VPVA 4XAEA 1VQNV 3MBWA 5B1OA 3SJAC 4O4LB 1MA1A 4JI4O 2F95B 3K3NA 4G3YC 4G28B 5L36A 4K3AA 5B66Z 1DLBA 1UQXA 2XWBB 3FHAA 3RN4A 4Y33A 4ITCA 2QSAA 5FRAA 5IK7A 4I0AA 4AI1A 4RFT0 1F5FA 1GP5A 2ZXWB 2JDIG 1VBE3 1JW6A 4JI8B 5JCOA 1P49A 2GV9A 1IKQA 3C7EA 2DQ0A 4CDUC 1K42A 2D93A 4M00A 3J8F3 3ZMSA 3V0BA 4ZZ8A 3RFRA 1Y9GA 3LOIA 2PHUA 3T4HB 3KM5A 4COWA 5LGNA 2R042 3WG1A 4PDLA 2IU0A 4FVMA 2VWKA 5BY1A 4XJ9A 5DDJ2 3ES1A 1V6KA 5H2FZ 1HNWB 1XDCA 1XNKA 2GUZA 4FLWA 3UQ8A 4OI4A 2YV8A 4BQ4A 4AYUA 4YRDA 1IXBA 4CDWA 3UNPA 3AP6A 3ST7A 1DGWX 2ATKC 4MVZA 4PA4A 4YZ1A 3AMNA 4B7KA 4XOGA 3E6CC 4ASMB 5C8CA 2W0FC 1N3OA 1WCKA 1H2SB 1IBLB 2DURA 4Q0QA 4EWEA 3RPQA 2GMPA 5E79Z 1MABG 2WINB 1B09A 1DLCA 4XVHA 4WZCA 1YFXA 2YU1A 1QH6A 1DQ5A 4CC6A 4E2QA 1JU3A 1C5HA 1J3QA 2Y6KA 1BBT2 4I0XB 4KWLA 5FZOA 1V6OA 2VMHA 4H7MA 1DZRA 4CCKA 2LUWA 1QJX2 4QPIC 1AJKA 3KQRA 1PO22 1UZVA 2EXJA 1GOHA 4LF9O 3SH3A 3OR7C 3MLJA 3S30A 5LMUB 1RJ8A 3BTAA 3IIAA 3LDRA 4QPIA 1DLLA 1S4CA 1CGPA 2XJPA 4DMIA 3OEBA 2QQWA 3RYIA 1AJNA 2YSUB 1N34O 3HKCA 2VQEO 2PLV2 2LQTA 4UFHA 3UK9A 1FXKB 4UV8A 2WNEA 4O4JB 3WNMA 2YI9A 3O1RA 4XZUG 4DR6B 4IEUA 1CZSA 4DO0A 1QKQA 2OUJA 4ZBMA 1MVQA 2ZINA 4CZZA 3ABKC 3OGSA 4AI8A 1F2NA 3CKHA 5DZGA 1I94O 3O1OA 3POWA 3UESA 2ZGTA 3LFMA 4IEVA 3A2FA 4BQYA 2ZX3A 3LFIA 1W0KG 3UJQA 2E51A 4AVVA 4FFHA 4CUCA 1DYKA 4O4IB 4IV3A 3IDBB 4HSJA 2ZE8A 2B1IA 2ERFA 4UUJC 3WSOA 1QQP1 5IJ9B 4NTXA 5I8SA 2Y4UA 5FZ9A 1K34A 3FYEB 2QTSA 1RUG3 5K4LA 5C70A 4EV0A 5TISZ 4KH9A 1NCRC 5JUVA 1MQTA 4BOWA 5FO9B 3PMSA 4YZ4A 5IJ9A 4NHLA 3B94A 2WO7A 2KD7A 1JOJA 2XTAA 2LALA 3N9PA 4YZ3A 2OCCC 2A3QA 2ZA9A 1NU1H 2ZDIC 4X65B 1WLTA 5LBEA 1JXNA 4S2HA 3BAAA 1I08A 3ZEDA 5FZLA 2Z79A 2JS3A 3CE2A 4R4XA 4IW3A 4LF8O 2XONA 2HYKA 3TK1A 3EXAA 3CC7V 2A6VA 1OA2A 5FXVA 5C9AC 3RWKX 3DGTA 3AG2B 2VH9A 5EIBC 1ZX5A 2Q7HA 2B7YA 1ZL8A 3HBKA 4Q5OA 4C7UA 2D40A 1M9NA 2UUAO 2WLIB 3B8MA 3V0AB 3OMAB 2PQQA 2XHBA 4DR1B 3T2TA 1XMQB 5FPVA 1W6OB 1GM8A 3KF5A 3QD6A 5AC91 2HEYF 2GH2A 4TZDA 4TOIA 2N05A 4BW9A 3HVDA 5B4XA 1OKOA 3ABZA 5K8SA 3L2YA 2FBEA 1EY2A 3X29B 5JDBA 4DV2O 1PVC2 1F4MA 3VN4A 1QHDA 4E4DX 5K7PA 1YITV 2VY0A 3IAPA 3ZSEA 5FBJA 3KG2A 2LFSA 5JZGB 4ZKIA 3BY6A 4LBNA 4WM7C 2FCVA 4MLOA 1HDKA 4FAGA 1BVVA 4L97A 1CAWA 4GKKO 2ADEA 4UCSA 4BB3A 4S2FA 1C28A 4X1IA 2L35A 1XYNA 1KB9F 5CYYA 3JZVA 2RDCA 4UB6Z 5FYCA 3WB1A 4MSWC 4OZOA 3VDDC 2HWB2 1FFXB 2DYSB 2P2KA 2XPJA 1V9U2 2AC1A 5JJNB 2B5HA 2X5IA 2X09A 1PZ9A 4KNCA 1JZ4A 1EV11 4Y1UA 5GLTA 2G9FA 2ETEA 1UZZA 1O7FA 1MS4A 4X1YA 5CNAA 2ZHMA 3ZFFA 4GH4C 5GZEA 1O91A 3ZHRA 1LB2A 1ULFA 1MS5A 1SLTA 1F31A 3NNFA 4IE5A 1I9RA 3JALB 3CCRV 4PI0A 5LA2A 3I3DA 1YJWV 2RQ6A 1T5EA 2IJJA 4FZ0A 2XLGA 4HVQA 1FAYA 3JAWB 1E5SA 1NQJA 3Q8BA 1HR0B 4YNIA 3IPVA 4JYCA 3DXRB 5HV0A 2IXHA 1PIV3 4NE9A 1LEMA 4DV7O 4PQQA 5K0UB 1N33B 4Q4X1 3SHRA 2R063 2P67A 4X6RB 4UB8Z 1GN6A 1S76D 2CHHA 4UV9A 1NKDA 2WNVA 2GNDA 3V56A 3OAAG 4JHZA 3ZMTA 4XETA 1XE8A 4MGZE 2ITDC 5LMNO 3ABMC 2IVIB 4EN7B 1ND3C 5FMDA 5LMNB 5EBWC 5IVCA 1B35B 1V9U3 2FCUA 4L9BA 3NR7A 2RJZA 3ZXAC 2PYJA 3CJIA 4FOWA 5FZHA 2E7QA 3SYPA 3R4SA 3G80A 4Y24A 1AYN1 2HLDG 1S2KA 3CJXA 3CC2V 1F51A 4PI2A 3R0RA 4BMEA 1K73W 4R8HA 3Q4HA 5B1BB 2FDJA 3IKWA 2Z2SB 2CUGA 3UT5A 4JC1A 3A0KA 2F4VB 1JU4A 4YJ3A 3OW2U 1Z0HA 3WUCA 4QPGC 4YG6A 1FYUA 3IMMA 2LW7A 5HCFA 2E53A 4BPZA 4EB6A 2VMCA 4X66B 1OHFA 5D5PA 4W50A 2X6BA 3P30A 1XB9A 2ARHA 2LROA 3AVSA 3ZHVA 5FO7B 1HN0A 5ITZB 4BHPA 1PL4A 4RUEA 1RC6A 1NQTA 4HN1A 1DQ0A 2WWUA 1W8UA 4A3XA 5KXBA 3S5QA 1XHXA 2QGNA 3P3NA 5IJ0A 3KKYA 1S0VA 1UAIA 2DCTA 1RGSA 4TLFA 2Z5WA 4LR3A 4B7EA 2PHLA 4TV8B 4B3SO 4OHZA 1JYXA 2DWEC 4COUA 3E97A 2QWNB 5FLXN 4D6TH 4IEYA 2F4LA 3ZKYA 3MIHA 2PZSA 2VBBA 1A32A 4RN5A 4YM1A 2QZ3A 2K46A 2PA7A 3H7JA 2GBOA 3WHUA 2FMYA 2VOVA 1C1FA 5A6YA 1UU5A 4GMP1 4M4PA 1FFXA 2ZM6O 1YO8A 4HVRA 1O9HA 3TWIA 1GKBA 5T5OA 2D3OW 4XYXA 1W0JG 1UFIA 2A7AA 1FX5A 1QNWA 1BE3H 4AQ6A 1SG3A 1FPN1 3JUUA 4OCTA 4NPLA 1UYYA 5F7UA 1YVWA 1ZRCA 5LP6A 2QBXA 1UWWA 3ZBHA 1E79G 3D6EA 4LO8A 4A45A 2JIJA 3PL0A 4MTGA 5IWFA 2F4VO 2R0FA 1W90A 4A2UA 3L72H 3N2KA 4R52A 3H1WA 2ZX2A 3D36A 3C7HA 4DXRA 1B6QA 4LULA 4V2VA 3OUFA 4XIOA 3WNLA 1HW5A 5H6RA 1QXRA 1DCSA 2WLIA 1ALYA 2W2IA 3NMBA 5ABJA 4Q4X2 4RQEA 1XL6A 4TN7A 1PX3A 2NMOA 2WZR2 4NHYA 2B45X 3PU3A 3MFCA 1OCCC 1NVPD 4LF6O 1IURA 3OF1A 4DV6B 2ZKNA 4K0KB 2WWSA 4B3MO 3AKPA 3NJVA 4CDUA 4MGTA 1W8ZA 3OPZA 2HKXA 4Y3OA 3H1HH 4KWUA 5JXGA 4DY5A 4XJUA 5ABJB 2YYOA 2EZOA 4K8FA 5DPNA 2W9XA 4Y26A 2BTVC 1GTOA 1AR81 3WB0A 5FZ8A 3USUA 2Q8DA 4CP9A 3DC5A 1FXKA 1VMFA 2GMEA 1WUVA 2WQ8A 1Z5WA 1QLEB 3ASIA 1YJLA 4LBQA 5DAWA 2UXBB 5JIUA 1WD3A 4RQPA 5C9AB 1GUIA 3OGJA 4FM0A 4F6RB 2UU8A 1V9U1 3L73H 3IAQA 5JQGA 4DW0A 5LA6B 1GK9A 2IXJA 3IZOA 4F83A 1TUBB 3UGGA 4YSFA 2A3YA 5G04L 3ATGA 3HOBA 4J11A 4MHUA 3VDBA 2WLKA 2YB7A 3KVAA 5LOVB 1S0BA 2CGNA 4UCOA 4TQDA 2J22A 2LW1A 1LOCA 3I8TA 4LFCO 2W1SA 4GZ9A 1O3QA 5DEDA 5FJHA 3JSLA 2VL4A 5F8PA 3TEZA 3HN1A 2IM9A 3F5WC 5CA3A 4FPPA 3GZAA 1VBA3 4JKKA 5EZYA 4LO7A 1H2GA 4IGGA 2X6AA 3M7AA 5E89A 2VUDA 2ATFA 3T0DA 3OTOB 4MTOA 1M4WA 2D3RA 4CS3A 1FFTB 2HWE2 2X05A 3TRSB 2KXLA 2ZQMA 1I5XA 4R6ZA 3FX3A 1UYXA 1YIPA 3ACLA 4JQRA 4LFCB 3WT3A 3KGZA 1CR7A 4MVTA 2JENA 2EINB 1LNSA 2NP0A 4J7ZA 5E88A 3K3OA 1NVPB 5A32A 4PA9A 4IERA 1XNDA 4P00B 1JZ5A 2HWF1 1J3RA 2BGCA 2JE8A 4YFZA 2XOMA 3ZO0B 4D7TA 1CP9A 3CLPA 3ZFGC 4A4AA 1NZ6A 4BQ2A 3WLUA 3GDBA 2P17A 1KU9A 1FXKC 3OMNB 1SF9A 4P2ZA 3TJTA 1JYNA 1L7LA 2Q5ZA 4U3JA 2DVAA 1ZA4A 5FYMA 3RRDA 3OG2A 1GKFA 1C1LA 1OUXA 1WWYA 2BWCA 1L8DA 1SZTA 1GNZA 1ZVFA 4IEZA 4EN8B 2XASA 1WA6X 3CNAA 5A7OA 3ZN0A 4LJHA 5JSRA 3ASOB 4XQDA 2IWGB 2WFF2 3ENRA 3QOPA 3AZWA 1JHNA 4ARYA 5FZMA 3KLSA 4DV3O 1O3TA 4RR3A 2JKBA 4L99A 4YWAA 2QEXV 3ALQA 2CAUA 4DK0A 3ZRVA 2BVVA 2JGDB 3VKLA 1H38A 3O1TA 2ZMNA 1CPYA 1NH2B 1GNHA 2RV9A 4BLIA 2XXZA 3AMPA 3O9OA 5E8AA 2HWC2 3THTA 4B1LA 1R64A 4PBOA 5LCWL 1ZZ7A 4QB6A 2JDZA 5AG2A 2XMLA 4GX0A 4IL7A 3G67A 4CH4A 4BCUA 4GD4A 1LAJA 1ZX3A 2FB5A 1KC8W 3M3CA 3H8UA 2C5DA 2Z42A 2M6YA 4TV9B 4LHKA 3LEMA 3N9QA 1GBGA 5EZWA 1VBB3 1AR63 3WNPA 1MZEA 1ULOA 2PXJA 1RSOA 3AK2A 4ASUG 1EP0A 3ON7A 1OOPC 5CA6A 4CRQA 3B4SA 2MEV3 4X64B 2C26A 3EB7A 1S3JA 4FQ4A 4LF7B 5IK5A 4DRVA 1N32B 4DXWA 4CEYA 4ARXA 4CDWC 4Z2AA 5L3EA 3U75A 1K45A 5A33A 3BTXA 2UWAA 4O65A 4CEWA 4FLTA 3N27A 5EBMC 3K06A 3U1XA 1BHAA 2XAFA 4JGSA 3DCQA 2OTJV 1G9FA 1KDMA 3M4FA 4MSVA 1HRV1 3AXEA 1DYOA 2VUCA 4KBZA 1VAMA 2D5FA 3WG7B 3FUOA 1J83A 2QE7G 2HWB1 3CJHA 5FR3A 4Y1ZA 5AC92 3AZZA 2GC0A 4JI5B 2BBAA 2XG3A 4BYYA 3ZYHA 2WLPA 1R3LC 5FYHA 2XKPA 2ZGMA 4IESA 5JWPA 4R9AA 1Y66A 5BMVB 3DL3A 5GM0A 5KHJA 1FT9A 4JAUA 4ZZ5A 4EN9B 4C8DA 2WA3A 4JRAA 3GF6A 3HJRA 4JTDB 5TSWA 2VJXA 1XOYA 1PL0A 2XAGA 3OTOO 5FPLA 1RMU2 2A79B 1SQBH 3D4KA 2GNMA 3GWOA 4Q4Y1 1HRV3 3O0WA 1BHBA 2WDBA 3K51A 4XQ4A 1QMJA 4YVWA 1J59A 4X65O 2RNBA 2YIDA 3HMYA 5FCCA 1AR83 4LBQD 3ZDSA 4Q2FA 4MH0E 4CCOA 2WS91 4GX5A 4DRXB 4UFKA 1HNZO 1IBMO 1PZ7A 3ETPA 1DZQA 2SBAA 1RUF3 1JOPA 1Q56A 1D5NA 4XEZA 3E5UA 2MEV1 4DV7B 4FZ1A 3EFFK 1YEWA 1OLRA 3UYJA 4GH4B 4AF9A 1QR8A 1RITA 1IBKB 4TSFG 3BOPA 2J1RA 5CG8A 1VBB1 3LD8A 4MGSA 1HQNA 4XBQA 4E2LA 4MOAA 1YHQV 2YEVB 4QU1A 1M57C 4MGQA 4ZONA 2Y69B 4BIZA 4UCRA 1MNGA 2D6MA 5CA1B 1GWLA 4PA7A 2RDQA 2JJ6A 1XJAA 1UCXA 3H1MA 2KKWA 2R1BA 3ZLIA 4YW4A 4AEJA 4R9DA 4OFGA 3T4DA 4M3CE 1AVMA 2YHJA 3MW3A 1W6MA 4QX0A 1W28A 1O59A 3J8F1 4XXAA 1Q82W 1QIQA 3O1UA 1IS3A 1ZM1A 2WAOA 4AQTA 3SGIA 5HPOA 4WFEA 2W1WA 4DS0A 2RMKB 4X1IB 2YGMA 4XDPA 4W4ZA 4JI3B 1NZIA 2WYFA 3J80N 4EJRA 1DFQA 2IC1A 1H8EG 2YMZA 3T1HO 1AL0G 1NE4A 1X59A 3WP6A 1LGCA 4YXWG 4FO9A 3PU8A 1ZRDA 3OMIB 1S0EA 3VD7A 1KDKA 2EAKA 3J7HA 4HVOA 4XMIA 1QH7A 5ITZA 3J7NA 2ARXA 3RJ2X 3ZYRA 3CRRA 3HIFA 1EN5A 1DGRN 2BNNA 4JI0B 3W58A 3BVCA 4I3PA 5LXTB 3D3AA 1WW5A 3AMMA 2HWF3 1ULPA 3CEIA 2H94A 1X9PA 4OPAA 1MS9A 1UU4A 3ZMOA 1UL9A 3T1YB 3IT8A 5FYYA 2RS12 4FPJA 5LA6A 1DK1A 1AI4A 2CL2A 1D4M1 2YZ4A 1LESA 5A7SA 3DXRA 4XFCA 5F3EA 5I91A 3CP1A 1W05A 5IVJA 3GB7C 3LSQA 3J7AU 3R65A 2EAAA 4BK5A 1FXZA 2CDPA 3OBAA 3RYPA 4J6GA 1YC61 2WO2A 1PNFA 3S0MA 3B9IA 1MACA 3NWKA 5JOYA 2UURA 1UMZA 1YQ8A 1L3JA 2A0LA 2XR4A 4JYAB 2VNRA 1DP0A 4YG3A 1SDDB 4HZ3A 1N4CA 4QKDA 1HR0O 1W8HA 2HEWF 1UO9A 4JF3A 4NIIA 5DAQA 1YSCA 2W46A 1FOD1 4Q0VA 4OUEA 4MVQA 3TXQA 3STLC 3H01A 4QQLA 2O14A 3VOUA 5FYBA 4GWNA 5EJ1B 1ULEA 4FPEA 2GN3A 1PX4A 1VMHA 2LP7A 1OXCA 4FPOB 4I30A 1XILA 2WPDG 3NKTA 1EUTA 5E1RA 5LGTA 4Q6GA 3SPHA 1NA1C 2JDHA 3I2GA 3ZYGA 4R9CA 1YTFD 4QGLA 4B08A 3RMYA 2E63A 4CUGA 2VAUA 2YBPA 4RFRB 3RG0A 4QPKA 5FQ0B 1F8VA 4YW1A 4RSUA 3VD4A 5F5CA 1OD5A 2JDMA 1CESA 1PGSA 4CS2A 1VQ8V 4NXMO 5CEHA 1B06A 2A9HA 2VCBA 2NNUA 4AI2A 2AENA 3JARA 4RGKA 5FY8A 3VZLA 1L0NH 1Q8VA 4YZ5A 1RUC2 1AHSA 2NYYA 1S5HC 1E5IA 2XBO2 5DN6G 5HFMA 2XVKA 2OQ7A 4DUYO 1F23A 4DR6O 4GKKB 4C0HA 1D4VB 3CS5A 1UYZA 2GC1A 3JYCA 1YIFA 1W59A 4JYYA 1VE0A 1JMKC 3MIDA 3C7OA 1Y76B 4DQAA 4OYUA 3I2KA 4QAWA 5IVVA 2XHKA 4FTSA 3GCXA 2VTXJ 1EPZA 2QWRB 2FYUH 4FLUA 4DR4B 4XJAA 2ZR3A 1SLAA 2C2AA 3FBYA 4CCCA 3I3QA 4ORFA 2WO1A 3JXSA 1QEXA 3JBG2 4CCNA 1GM9A 1ZBE2 4QGNA 4OHWA 3AP4A 1VBC2 1S0JA 3CCUV 3VHNA 4FFFA 1BKZA 5DXDA 4G2KA 2GDFA 1I5YA 3J7LA 3WINE 5FV3A 4F8AA 2EXKA 2ZABA 4AVCA 3KQ4B 3WX5A 3RYCA 3FB6C 2OQ6A 3BALA 4D94A 1Y7BA 4IHJA 4NOTA 1K97A 1HRV2 1ULCA 4NR1A 3ZMZA 4X62B 2WNVC 2ORZA 4GMP3 4X8NA 3IDEA 2HKOA 1C8M3 4RS5A 4PHZA 4NVPA 2PYTA 4PIZA 1XU1A 1W99A 1UY3A 3OEEG 2OIGA 3FLPA 5CA1A 1RUJ2 1Z7S2 2H6BA 3I97A 1LR5A 3AJZA 2EINC 1BHGA 4IEPA 4H33A 4JTOA 1MOFA 1OJHA 5CISA 1M4UA 1VQ4V 3LOBA 5DUVA 3SYAA 3K59A 4OZXA 1UY4A 1B3QA 3MIGA 1UIKA 4BA6A 3NSTA 4A41A 1TE1B 1AL22 2E32A 1RUF1 3L9JT 1ZTEA 2B9VA 4U3JB 4DR1O 2X29A 5CZKA 1SDWA 4OMDA 4BLJA 4ATEA 2WS93 4MVRA 5T3NA 2JG9A 4LIUA 1X9TA 2HWD2 1SMVA 1QQP3 2IXLA 2V5DA 4CC5A 3CJHB 5B3SC 3KB5A 1OC1A 2DUQA 3PVBB 3KVBA 2QQLA 4N90A 4NN0A 3SJQC 4CEYB 1QJY3 4Q4Y3 3W59A 1I1EA 3AZVA 1F9KA 3D5OA 1AYN3 3MUZ1 4FXKB 5CIRA 3J81N 3O1PA 4PDWC 4LFAO 1YJNV 1O9GA 3CZUA 3LIGA 1VP6A 2GU9A 2ODMA 3OUHA 5AVAA 1N1YA 1JH5A 4P9JA 1V6JA 3V65A 3WQ0A 4GJZA 5F3GA 3G7DA 2F4PA 1D2SA 1M5IA 3DYMA 4NTYA 1HX6A 2R061 3M8LA 4Q4X3 4PDRA 2HWB3 5AFBA 3GJBA 4DV1B 3GXUA 3A21A 3P3PA 2K2SA 2C4XA 3KHBA 4LF9B 4IEOA 2BV4A 5FLJA 5C9AA 1YF2A 2A7WA 1VF6A 4YIPA 5F32A 3VKNA 4IL6Z 4LHSA 5FY1A 2QCSB 2P34A 5J3UA 2DYCA 1IZ3A 2E74B 1NLSA 2OKXA 3THPA 1W6OA 4N53B 3ZYJB 3VQVA 3FKSG 2D44A 1W39A 3VBFA 4IV3C 2VZUA 4ZXEA 1CAVB 4MVUA 4K40A 1FJGO 5DMYA 3CCEV 3JALA 2P4KA 4XF1A 3I5DA 3HT1A 4N8MA 1LU2A 1XE7A 3POEA 4WVMA 5IAXA 1Q81W 3E8FA 1AR61 4C91A 3ZDVA 2FDIA 1RVF2 3VHRA 1Z7S1 3GBWA 1LHVA 4BM8A 2G4IA 4IE4A 1UMIA 4IDZA 5AVPA 4DXSA 3MEPA 5FO8B 1I5PA 2Y48A 1IPSA 1OCOC 3HNYM 4WF9V 5FWEA 2PHDA 1QJFA 2AXTZ 1TNFA 5EHDA 3UKNA 1G9BA 1JYTA 5BR8O 4OHYA 2JD4A 2PI4A 5KHGA 1H8TC 4XCBA 3PTRB 1H8VA 3SNMA 2DCYA 1V6MA 1BMV1 4EROA 3UKVA 5JMCA 4IEWA 4QKFA 2P6HA 2IW5A 4QNHB 1BEV2 1BBT1 4P9IA 4CDXB 1VBE1 2X5IC 5B4NA 2QJVA 1ENRA 2Y34A 1SKVA 3ILFA 5L9BA 1GRJA 4FOVA 2BPA2 2CH7B 1RPOA 5ANNA 4Q0UA 3TBDA 4CBCA 5BY5A 1X8MA 3ZN4A 4JI7B 2VQTA 1BZKA 3EXUA 4Y5TA 2VR4A 4NYKA 4ZI7B 1Q5OA 4NROA 5LK7B 3L74H 4TQFA 1XSQA 2Z5UA 2QQUA 4CS4A 4MX3A 3OBTA 1S2EA 4OUSA 3EHKA 3DYPA 3O1MA 1QDCA 3WNXA 1V6LA 5C3OA 3ZRWA 1UOBA 1UMHA 4W6YA 4AEDA 2XDVA 3BIWE 5ABJC 3CEWA 2JEUA 4WFBV 4PLOA 2CDYA 1C57A 3THDA 2W0XA 2OW4A 2HWC1 4HG6B 1LOEA 1GZ9A 5JR7B 2Z4FA 3UT0A 1E1QG 2CWMA 4BWAA 4OUMA 3WB2A 2XVLA 2XGXA 1SPPB 4UW5A 3K48A 1LJ7A 4XURA 2JG9C 2X10A 1ND2A 5A6ZA 3RBZA 1YUDA 2ZJCA 3L71H 2E5LB 2VMIA 2EZPA 1KEXA 1H4GA 2QR4A 2CK3G 2Y6LA 1Y6XA 4YHHB 1VRH2 2JWPA 4JI5O 3SJCC 1NAEA 3ACIA 1VBA1 2IJIA 1POQA 1R1ZA 4CSWA 1JYVA 3QG5A 2P5BA 4NKGB 1CIYA 1L7RA 2BOBC 4EN6B 1VF5B 1C8M2 3BU7A 5LA1A 4GKXA 1HB2A 3CU7A 2DVDA 1YQ6A 4GH4A 3HPLC 2QQMA 2YXHA 1R6KA 1NH2D 2Y6HA 1ZREA 1XEQA 4QHZA 3FLTA 5LOVA 5EFUA 4TWKA 5H6QA 4K9SA 4JDNA 5J2TB 3R6SA 4NB5A 4QHBA 4QE7A 1K4CC 4D6SA 1PP9H 4BIOA 4ISQA 1YRZA 4XUPA 4MGKE 2E3CA 3NV3A 1ENSA 3TNPB 4E4HA 1GP6A 2R6QA 1UZYA 4YW7A 2WL1A 4D69A 3K5MA 3OB8A 1G8MA 4JAVA 4F3JA 1MS8A 2R9RB 3T3YA 4RO2A 3BTYA 4H2AA 4M4RA 2PMWB 2ZXQA 5LK5A 3ABLB 2HWF2 5CBGA 5IT6A 4YW5A 3L2HA 3VD9A 4B3SB 1YTFB 3T1YO 3OGIB 4KGQA 2VQ0A 4AAXA 1OA4A 4HYOA 2VVDA 1Q6IA 4DFSA 5K1XA 1OCRB 5KXCA 3KD4A 3ZM8A 5JOZA 1H9WA 1D0GA 3JARB 3X2QB 1KBHA 3H9AA 4LMFA 1HJGA 1GZWB 1AR5A 1AI6A 2YICA 3RWRD 2HYXA 1JBCA 1D0HA 3M3IA 4FFGA 1UF2C 4HXCA 1ZRFA 4Q8LA 3H8XA 1YYNA 2N04A 4LWSB 2YPDA 5FYSA 4AGRA 2HH9A 3VKOA 4KBBA 4ZXKA 4P9WA 1H4HA 2PF4E 1UY1A 3CCLV 1OZ0A 1AYM3 2HEVF 4GCZA 4JI3O 3W20A 1FPN3 3RZHA 4HLTA 3MLLA 3ZXJA 2NN8A 3BCCH 3JAKA 3L9DA 1IBMB 4AFCA 5FREA 5JXIA 5B1AC 2FQPA 2Y6FA 2PAMA 3OR6C 3TCUA 1PPJH 1V9PA 3EQEA 4BE3A 4J25A 1OVSA 2LGQA 1GR3A 1VR3A 3VBSB 2WNOA 1OUSA 1PNMA 5JPNB 2HP8A 3E89A 2IH1C 2AZ0A 3FFZA 4CP1A 3P32A 2W92A 2GC2A 4GZRB 5A7WB 5FYVA 1GLHA 4K3UA 2J1UA 5KBFA 1H30A 3SYQA 3OYWB 5DZEA 1NA1A 1VMGA 1JQ0A 1COV3 4CEWC 3E6BA 1LHOA 3QVNA 1P7GA 2GSMB 2VW2A 1IQAA 1RHI1 1U12A 2QM8A 3H3LA 4C1XA 4X9QA 1X7NA 2AUYA 2V1DA 4WBBA 3T1MA 1XUQA 3JCZA 4GKYA 1RTVA 1RINA 5CA0B 2OIIA 2H6CA 4ONUA 5C4WA 3O12A 3J7MA 3C3TA 1WMEA 4Q4V1 1AR71 4S2DA 1BLZA 3ZRXA 3C90A 2VZPA 1G8WA 1VLNA 4CDWB 3F7VC 3PJYA 1QGLA 4Y5Z0 4O4HB 1SFPA 4YLZA 4INDA 1NLQA 1AR1B 1VQMV 1GOGA 2NMNA 3N3HA 4IGQA 1RUJ1 2W1QA 4QKBA 5CB4A 5A3TA 1E1RG 2RM22 3N7JA 1OCRC 2FD8A 4DV4B 5FK8A 1N3PA 3N7MA 4EKWA 5GZDA 2ARCA 2RJLA 3S7IA 1R093 2PTMA 3RYFA 3S6PA 2WLMA 3DUIA 2GNBA 2UUAB 4DR4O 3A0BZ 1ENXA 3SCGA 5FXXA 1ZUQA 1SQQH 3GBFA 3ZHQA 4AVBA 2CU5A 4DXTA 2XUEA 3VBHC 4I50B 5CBLA 5LRRA 3RGBA 5JI9A 5L3GA 3RS6A 1ZBE1 3SJBC 1GZWA 1PIV1 3WQ7A 4AI3A 5DAXA 1NR1A 4LO6B 1LOFC 2JD9A 1AZDA 4RS5C 3IFXA 2DDUA 1RUE2 5LGUA 1R1A2 3M2MA 1WCSA 4FPCA 1UD1A 1XMQO 3B40A 5E16A 1N1VA 3UM7A 3UL2A 4DPNA 2EIBA 2JIGA 1QOSA 3O0VA 4W6WA 3SPIA 4QQOA 5FIXA 3ZFGA 3KMHA 1K5QA 2CTRA 1EV13 5EYPA 2JEMA 3VBOC 4YPJA 2N7GA 2XJVA 4PIYA 4RYDA 2DYSC 3VL8A 2KSDA 4HMZA 5A3MA 1EFRG 3LF7A 4HK9A 4HNAB 1OSGA 3JAWA 2VNGA 2ES3A 1D2DA 3V0AA 1DDLA 2IJHA 4ZU4A 2UWCA 2YIAA 1LUWA 1VQKV 1CAXB 4XMAA 2UYBA 1PM4A 2DMXA 4CP9B 2B9ZA 4V1PA 4LR4A 2Q8OA 1YQ2A 3OYWA 2HBTA 5FQ0A 1LTEA 4FBFA 1NS1A 2RS32 4RQPB 1OD3A 3DV8A 2Y8KA 3K4ZA 3W21A 1NCQA 2ZGPA 1KUQA 1WLEA 1DQ2A 3VKFC 1SCSA 1BGYH 3S57A 3BU0A 1X33A 4P30A 1IS4A 2UY8A 4MZUA 3FD9A 3BCWA 1WBLA 5J37A 5AC93 1TME1 4ZPIA 1LEDA 2KM2A 3OY8B 1GANA 2GN7A 1D7PM 4AQYB 1PVXA 1W8FA 1AUYA 2PY5A 3WF4A 3V64A 4QMAA 5FMOS 2JB4A 5CBFA 3ABKB 3WU2Z 3AKTA 4EQVA 5E1AC 1SRYA 2YI8A 4PDVA 4H44B 3ZS8C 4AW7A 3T08A 4QX2A 4E4ZA 4XAAA 1E5HA 3OUIA 4ZHQA 3MI8A 3QNEA 2VS0A 4LFBB 2SLIA 2JIZG 1Y3TA 1E5RA 2VXRA 1WP7A 5LASA 4KU8A 4LOSA 1G6UA 1JZ2A 5ACA2 1EV12 5C8CB 2KB1A 2XAJA 2VQUA 3ACFA 4IEXA 2HR3A 2HHHO 2YUAA 2ZX4A 4JTCB 4NWVA 4L11A 1OCZB 3DECA 3RT3C 2EIEA 4DEVA 4GWMA 4YVSA 2OPKA 4DZGA 3I2FA 3K75B 1UXXX 2B1GA 2OYQA 2WJSA 2G9ZA 4FPFA 3CCQV 3NJYA 4KU7A 4FJCC 1UX6A 2CY6A 3NL1A 1OCOB 2W5FA 4FM1A 3ASNB 1HQLA 4J7KA 5A80A 4YVWB 3OJBA 5F2WA 1MSDA 4FFBA 3JD71 3DXUA 5T5LA 1W6MB 5A3LA 4QPIB 1ORQC 5FAXA 1RUG1 2VECA 4LF8B 1T6GC 2EA7A 4FPKA 1MG1A 3Q8AA 4AXOA 3SKVA 2BOCC 1M90W 4PA6A 1KMIZ 1TA8A 3B7MA 4UWDA 1N33O 4XE9A 4CCEA 4XDKA 3A4UA 2Z69A 1KXGA 1ZZ8A 2JKXA 1O8SA 4Q8KA 3AK1A 3HQXA 4P9PA 2ID4A 4NJ4A 2JGUA 4BWOA 3JATA 2DE0X 1W9TA 2B9UA 3IWZA 4HKWA 2HWE1 1LRHA 1SQGA 5ANQA 4LPLA 2XH6A 3E22A 3PMEA 2A3XA 3ILRA 3ETGA 4AI9A 4JGZA 2WA4A 3U78A 3HKBA 3APQA 2UUBO 1GNYA 3NXSA 5I8TA 3Q9OA 3BEHA 1O8PA 3FAVB 3OSDA 2A6XA 1FV3A 4L8JA 3STZC 5LBFA 2WSVA 3K08A 5A3NA 3B77A 2A6WA 3LNNA 3C7FA 3MHHC 1CAWB 2VW1A 3FL7A 2OCHA 4KXRA 3VBBA 2G1MA 1ACCA 4AGGA 3DXTA 4A44A 5IJ0B 3M3QA 2BFUS 2F1MA 5A7QA 2EIMB 4ATFA 3MICA 3IDCB 2Q1ZB 5IYDO 1SQPH 1SQXH 5A32B 1PVC3 2WLJA 2RJ2A 4WVWA 2GTSA 4DR7B 5FUIA 3OOXA 1XREA 3LCPA 3T0AA 1UIJA 3VDDB 2JG8C 3AFKA 1W0OA 3G6EV 5LMUO 1AJPA 1US6A 1SS3A 1JVMA 5D2AA 4LUMA 3SITA 4PLNA 3JD72 2J1EA 4RR3C 1GQGA 3G6JB 2E26A 1OHHG 2TNFA 1K33A 3FUQA 3LPGA 2DBNA 4LO5B 1ASJ3 1QDOA 4Q4Y2 2WO3A 3SC7X 4Q0PA 1XNBA 5JCTA 5FZEA 4GXLA 4AFBA 2IFWA 3RVZA 1N32O 1SPPA 3KZ4C 1MQTB 1ZZ9A 2QVSB 5DG2A 4I2OA 2BSKB 4TT3G 1Z2GA 1HRI1 3BYWA 5EXOA 4B4QA 4JZRA 4ASKA 4CYDA 3OUSA 1C5IA 4GLXA 3G6BA 3HEIA 4JTAB 3F95A 3IDAA 4JHTA 1J1LA 3ILNA 4JKMA 2HLEA 1H2LA 1Q86W 1GM7A 3ZXKA 3RYRA 3QLQA 4AG4A 2YC2A 2JXAA 5FP9A 1QNYA 3CCMV 1GU3A 4LOTA 5FY0A 5A70A 1WMFA 1NA1B 5C8YB 2EX3A 4J41A 2VMDA 3OD4A 1RUE3 2L9LA 2AH2A 4J80A 4KGGA 1F5JA 4CDQC 1JX9A 1KFXL 3QO8A 1EAH2 2HBUA 3RSJA 2YS8A 1G7YA 3UETA 3WG2A 1RVF3 3BUCA 4P08A 3CCVV 3ZFFC 1SZBA 3ZOIA 1MEC3 1NXD1 5F1RA 3SKJE 3WDVA 5IT9N 1GO3F 5CFCC 3H8RA 4UOJA 4XFAA 1NXMA 2GNTA 3VB9A 3MW2A 1RP3B 4ZU5A 3HKDA 3PJSK 3LNMB 3WXPA 1NUKA 4BK4A 2VVEA 3IBMA 4QDQA 4M0HA 3OTFA 4K6BA 1V55C 3O7OA 3KT7A 5ISLA 1G1XB 1VEWA 2NM1A 2J42A 3VZJA 2VZVA 4EFEA 4JCKA 3MPPG 3URFA 4KWJA 3RW0A 1JHJA 4JASA 2YXYA 1PGL2 1QJX3 2R062 4AE2A 3MHSC 5J96B 1ZBA3 3J4UH 4XDOA 4I7ZB 5JR2A 4PELA 1HJFA 2JDAA 4D7SA 2OTLV 2KR2A 4W65A 3HB3B 2WLNA 4DY3A 3RZGA 2RS53 4L2NA 3POIA 2DCZA 4BQXA 3ME2A 2BBVA 1Y4WA 3MPBA 3CPWU 4ET7A 1FXHA 2CTVA 2IVJA 3U07A 3JASB 3CRAA 5FXWA 3WG4A 4M3CF 4GQ7A 4QXKA 2MEV2 1QR9A 2LFRA 2RR11 3VBUC 2DVGA 3IM0A 2RDRA 1MZ6A 3K04A 4FP3A 4LF5B 3T2OA 2XOKG 4A7ZA 3HT2A 2QQVA 3H1YA 4KFMA 1BK0A 4N53A 4E4SA 3RDIA 3K03A 1OCZC 3HWJA 4CXXA 5T5JA 4AK3A 3SCHA 3LDKA 5CMUA 1KD7A 4CUBA 3CYOA 4I0XA 5I0RA 2A3WA 4PV1B 4EWDA 4OULA 3R4UA 1U0AA 5EQUA 3PN1A 1VQ9V 2R1DA 4JV4A 4UVCA 1R3IC 5J2UA 1LU1A 2D3PA 1HLCA 1W9WA 3OFNG 4COZA 2YIBD 1CWPA 3CQOA 5E6HA 2HJIA 2UXXA 5F2VO 2VW0A 4PDMA 1R092 1ROPA 3M1HA 2HVKC 1R1BA 2K1EA 3OPWA 3LA2A 3ZIXA 2AHYA 1PO21 3C2UA 2VBPA 4IYIA 4JI8O 2P37A 1Z5VA 2XL9A 2YUEA 1MPXA 4FLYA 5FZOB 1US3A 1HRI2 2V72A 2RS33 4SBVA 1NI8A 2QNKA 3N2GA 1T2XA 1Q8QA 2AZ5A 2G9GA 5BNPA 1BYHA 2WLHA 1M06G 1PK6B 3SEPA 5FZ6A 2VZTA 5JH7B 3JATB 5CN0A 1ZAUA 4BQ3A 2A71A 4WBNA 1Q3EA 1CZVA 1AXZA 5KAFZ 3E35A 2AHZA 2Y0IA 2QM4A 4P9OA 1OBNA 5F5AA 2ZE6A 3CCSV 2Q68A 4X6QB 3NV1A 3AJYA 5L9RA 1K12A 2ZR2A 1COV2 1KP3A 3IB3A 2XVGA 4GULA 3F7YC 4Q26A 5FYUA 1SACA 4A42A 1NOVA 5KHHA 1K3IA 3LSDA 4CEWB 2YIBA 4JPRA 2PHXA 1YI7A 2RR12 4TSVA 1AXYA 2XLFA 1SA0B 1I94B 1Q8IA 4DUZO 2VOWA 3MZHA 3CRQA 4N53C 1SBDA 4PLMA 2CE4A 1Q7YW 2O8OA 2VOXA 5L3DA 2R7EB 3ZSLA 1F15A 2QWQB 1RUC1 4CU8A 3OM3B 4OGQB 1OQEA 4AVTA 4QB1A 1WA8B 4XC9A 4DRRA 2FCTA 4XW3A 2WNUB 1VBD2 4NHKA 4JAAA 3GWKC 2Y26A 1PO11 4UI9L 1J84A 4RQFA 1JR9A 1QLEC 3KCXA 4YM0A 3BB6A 4AZZA 4UFJA 5CFDB 2ZGRA 4W6XA 3OY8A 5JQGB 2RS13 2ZEXA 1ZRRA 5CFDC 1VALA 4Q4W1 1AJQA 2F23A 4R7CA 5ERLA 2E76B 5FLIA 5J1XA 3ZN1A 3H9VA 4QGMA 2DCKA 4GWJA 2XB6C 3LPFA 5FXZA 1WPXA 5C71A 3C3SA 1V00A 3MGUA 3POJA 2XJRA 5I0SA 3O1SA 2I07B 5IYYA 1GN4A 1CX1A 4DW1A 4ES8A 5JOWA 2DYRB 4I0BA 4LF4B 2VU9A 5IYZA 3WUDA 2TUNA 4NTWA 5C8CC 1GSLA 3ZFEC 2R30A 5D21A 4YZ2A 3E8BA 3OCPA 3U4SA 2JDKA 5KLVH 3ELNA 1WLDA 3NAPC 3K4DA 4X88A 5B2GB 3AMQA 4I3GA 2ZOEB 3RJRA 1W2UA 5I0TA 4FPGA 1OVPA 3ROUA 1ZZBA 5IDJA 2Y64A 3D8CA 4B1MA 5FDBA 3WF3A 2F17A 3ZXGA 3BIEA 2VQFO 3ZHSA 4XDJA 2DV9A 1KRIA 2K9ZA 3PTYA 4AR2A 3ZYIB 3ZFEA 3N2GB 4XF4A 2C0ZA 1GV9A 1KKDA 1LOAA 2D2CB 4HBNA 1RPRA 4GB32 1UYPA 1RUI2 5JH7A 4N9HA 3IIIA 4K35A 1Y43B 4OX9O 3K9SA 5C5UA 4P02B 1YZBA 3H1IH 3DF0A 3PUQA 2QKSA 5C33A 3CRCA 5EBLC 3TB0A 3LEKA 3P5BA 4I01A 3KZIZ 4DV3B 1POV3 3POGA 3ZIAG 4XJWA 5JOXA 5IUQA 4FOQA 3B2EE 3DEMA 2V4DA 4XDQA 4G27B 1SFNA 4J9ZB 1XNCA 2OPWA 2NZ9A 5DDJ1 1S5LZ 1BK1A 2WT1A 1JJOA 2QDOA 4LWSA 1FMD2 4B3MB 5FZFA 4LNVA 4DV6O 3GHMA 1A78A 1PK6C 1XYOA 2EICA 5LXTA 4FXGB 4Y1VA 2IBZH 3KT1A 5B1AB 2A73B 5GONA 4LUKA 1SLLA 1RXFA 3PVNA 1U5YA 4ZI7A 3AC0A 1TAEA 1RUH1 2FDKA 3WD5A 3WP4A 1WAZA 1HNXB 4QQHA 5BPXA 2BTOA 2VCCA 1U96A 2YFZA 3I3EA 4IHJB 2VNOA 2VOKA 3S3XA 3MYXA 1U5IA 1S72V 4QPYA 3VZOA 2ORXA 1WLCA 3GNEA 3M7MX 1Q90D 3WDYA 2F43G 1Y4MA 5J9PC 3E5QA 4NO4A 3WF2A 4R8CA 3NJXA 4KHPO 2W3JA 3ABMB 4LBKA 2BGPA 2QFEA 5FUPA 4UYBA 4CCMA 4N9IA 2FDGA 2Q6AA 3OGCC 1H1IA 3Q4HB 2WN2A 2EIKB 3W7TA 5A3UA 5BV6A 4Y22A 2GZWA 2R043 2O8QA 4MXWB 1KQSU 1VARA 2DYRC 1BQZA 1VMJA 1ND3A 1W8OA 5SV5A 4U7NA 4MADA 1ZZCA 3K57A 2HHHB 4QB2A 1R6TA 2BU9A 1JN2P 3QH6A 5FTTC 3MUY1 3ZMUA 3CMAV 1OQDA 4OHVA 3SXWA 2Y0PA 2JDYA 1QJU3 1O6UA 2DWDC 5M0TA 4YIOA 1WKYA 5IY5C 4RR3B 1OV9A 1HKDA 2KQXA 1BXHA 3AZYA 1JOBA 4AOCA 3EMRA 5HCHA 5FPZA 1VP7A 5FP3A 4DOUA 5K0UA 1JZ3A 5GKAC 3SMHA 3LEGA 2WFF3 2D7FA 5GZGA 1LOBA 1ZRIA 1RMU3 2XAHA 5C3PA 4OXSA 5A2QN 4P9LA 1S0GA 1VF6C 3TETA 4QXBA 4PF1A 1R1A3 5FOBB 3TAYA 1BQPA 5GW7A 3FX7A 2PHFA 5IVEA 4A6SA 3N9LA 4P14A 3UO2A 4AVAA 3PDQA 2BUKA 1EAH1 1ULDA 3I55V 1CJPA 3RWNA 3M99B 5CKQA 1G86A 3WDXA 3HBZA 5CBHA 4LA2A 2NPIA 3LA7A 2QJ1A 1AR92 1VIBA 3OT7A 3JQXA 1ND2C 1G6NA 1P8JA 5IWAO 1CEZA 4GKJB 1C4RA 1F4NA 4MYEA 2QDRA 3E1F1 1QJZA 4FM2A 5FPOA 5JCOC 3NAPA 4NAOA 2IZWA 4LO4B 5CKMA 2VE1A 3MIFA 4MV2A 1B04A 5IHRA 5LYJA 1UOFA 3AKSA 3BPSA 3FFQA 1S0DA 1GMMA 4LH6A 2PHRA 4LBOA 3NKGA 4DXZA 1CXZB 2A5ZA 1IX9A 1JI6A 3ZFGB 1VF7A 3RNSA 5DM6V 1AX2A 3UCSC 2EIDA 4DR5B 4JDMA 5HXMA 4XABA 3WCRA 1J5EB 3FYIB 1NYWA 4GUNA 2CGPA 1NTZH 4RD7A 2VUAA 2J7MA 3VV1A 4C90A 2Q5TA 1KJRA 3AL6A 4OQ8A 2VBDA 3OBZA 4I50A 4DV5B 3AKRA 5KC5A 2WWWA 4X20A 3WOGA 3HR9A 2G38A 1G9AA 1VBC1 2CYFA 3JAMN 4R50A 1PMJX 2VQEB 1H0BA 3RVHA 2ZCWA 3V0BB 2HWD3 3W7XA 5A1AA 1AP5A 1T6BX 2ET1A 2E7TA 1VJ2A 5BZBA 2ADQB 4P9XA 5KR7A 3K58A 3ABTA 1IS6A 3VBSC 1HDJA 4RHV3 4F6RA 4JDOA 1LGBA 2NQYA 4IUGA 4GA9A 1FV2A 4TXWA 2ZKOA 4NXNO 2IFRA 3ZR6A 1TMF1 2WWJA 1K5MA 3ABUA 1HB3A 4EYUA 4XFIA 2Y6GA 4X1YB 3A7QA 4X8PA 2D98A 2CTWA 2XJQA 1N8RW 2DN9A 4Y4RA 4QX1A 1FPN2 2E31A 1VQOV 1NCQC 2WZR3 4LLFA 1WW4A 2MW2B 4X64O 1I0HA 2DU0A 1WA4A 2W39A 3SR2C 5T54A 2V5YA 3NV2A 5F5QA 3HAGA 4M01A 4K8RB 4CPBD 2P3JA 3OPTA 4CE8A 4NIGA 1NKGA 2CGOA 4N43B 2E5LO 1OFNA 3DYOA 4AWDA 2P1BA 3QACA 2QZ2A 3AL5A 1SQ4A 2BP6A 3APOA 1XU2A 4I0WB 5GALA 2MK3A 4GB33 1CPMA 4BJ0A 1R3KC 2YROA 2Q8EA 1RUI1 1A8MA 2R9AA 1KP2A 2ZGSA 3EYPA 3K0DA 5H9SA 1DF0A 5BNPB 1WPBA 1PK6A 2ZNJA 1EPWA 3ZPYA 4JI2O 4OQ9A 1MR5A 4FPYA 4MTFA 3NNMA 1UN1A 3ZYPA 1TG7A 5FY4A 3A23A 1VRH1 4O2BB 2ZTNA 4O2AB 4QX5A 4QIWF 5FZAA 4OHXA 3GZEA 5FZDA 4BR6A 4DNYA 4QM9A 2H0BA 5FZCA 5LL6Y 4ZS2A 4XDLA 3SISA 4PIXA 4AI0A 2ZEWA 4JI6B 2B42B 4FPHA 5JXHA 1HXS2 4UXNA 5D8AC 2BJSA 3FB5C 4BQ5A 4O2AA 4XJ8A 1PO12 1AL23 4YVSB 3TYJA 1ZLZA 1W6QA 4FTBA 1LENA 3N9OA 4AHWA 3TEWA 5DG1A 3TNQA 1VRH3 1LHUA 3CXCU 3VQXA 5BNNC 2IXIA 4FP2A 2UU9O 2WNVB 4JYAO 5C3RA 3CZJA 5JXJA 2VWJA 1UXZA 5FMBA 3VHOA 2ZX1A 5EIBD 5LBQA 1THZA 3AYAA 4Y5SA 3L75H 1JYWA 4MTXA 1O5LA 1RSOB 3A8TA 3GVMA 3TN93 2RMU3 4FK5C 3CXHF 3SDLA 3JD0A 3NQHA 4UVBA 2Q4PA 4HPKB 4ZS3A 1BZWA 4Z8BA 4H14A 1GWKA 3NNLA 1NCQB 4NMIA 4MXVA 1HIXA 5C93A 4LFBO 2YDEA 2JG9B 2OIEA 2PHWA 1REFA 4YJ3B 4HOOA 4JGYA 1IXMA 2DVFA 5J36A 5BNOC 4JI0O 4LNUB 2ZHKA 3JB8A 3WW2A 5GTHZ 4U2AA 2XBO3 4E4EA 3FJSA 3VBOA 2FTKA 3T2MA 4YFWA 1AROP 3HNBM 3H1LH 1P4RA 4KP4A 2WZR1 4FOYA 3B69A 5K1PA 4AAPA 5KUKA 5FMCA 5KHIA 3PHMA 1SA0A 1IBLO 3FWEA 5EPAA 5CFCA 1AR4A 1VBE2 5JVDB 1M57B 5IYZB 1BEV1 4WM8B 5GLVA 3I3MA 5J7MA 2ZGQA 3I3BA 4BW5A 3ZRWB 2EXIA 3WDWA 1ZYBA 5FPAA 2Y6JA 3N7LA 2RS52 3WF0A 1H9PA 1W2AX 1WBFA 1FKAO 4XXPA 2WABA 4CU7A 2J1AA 4IEQA 4CH6A 4MS2A 2LO1A 3N35A 4JI2B 1DGWA 1RYYA 4AHXA 4QPWA 1K4DC 1ND3B 4S2GA 2JDNA 4IT5A 1LR1A 1AP6A 1JS9A 1B35C 1W06A 2E6VA 1KITA 4IGOA 1Q6HA 4Z92B 3AYCA 3M3OA 1YJKA 3GALA 3HD8B 3AG3B 1YIJV 4N43C 5KA5A 3AG3C 1UOGA 2L6LA 2YY1A 4SLIA 3P1IA 5JMOA 5CG9A 1D4M2 4H13B 1XMOO 2YBSA 1O5UA 2R073 2BWAA 3BTZA 3OEHG 4FLXA 3PJQA 1HXS3 1Q43A 5LA9A 1UJWB 3O0XA 1PIV2 3ZIWA 1PKXA 2OYZA 4GWIA 4DINB 1CVNA 3Q8FA 1LHNA 4O61A 4JKLA 3WF1A 2DU1A 2QA4V 3PLQA 1IBKO 1FNZA 4W4KA 2D97A 3BN6A 1ZSPA 5FYTA 5IJRA 3JAKB 2WUHA 2FMDA 2BZDA 1YXWA 5KX5B 2E7AA 3D3QA 2WLLA 4XUQA 5CB4B 3EO6A 1LOFA 4J1XA 3ZXFA 5B3SB 1XQNA 4UAPA 4AHCA 2P06A 1WCDJ 4XHBA 3K5LA 5EJZB 1JPXA 1I6XA 4LKDA 2W94A 3WQBA 4U36A 3G4SV 3NV4A 3BHPA 5F6LB 4NUBA 2VO5A 4B3RB 2LS6A 4N23A 4XF9A 2ZM6B 1R083 1RUD3 2EIGA 3ZXDA 3DN7A 1W03A 5A1LA 4AILC 3LKJA 2FDHA 1EAH3 3C8XA 1AI7A 4PCRA 1WCUA 2P4VA 2GP3A 5BNNB 4JRLA 2J1VA 4O4JA 4JYBA 1LKNA 1FATA 4JI1O 1W2BU 2W6IG 3E86A 3T2QA 1R081 1CPNA 1AYM2 2YPJA 3ZHUA 2EIKC 1WW7A 1GZCA 5DECA 1GH6A 3QCWA 3ZXLA 1JA8A 1H2MA 4E8CA 2PYLA 3I59A 5IYBO 2OVUA 2Z0AA 3PIGA 4FAHA 4J10A 3OUJA 5LRSA 5LP6B 2HG5C 1UOJA 4XHXA 4BIFA 4E2SA 1BSMA 1QBZA 3AKQA 1OOPB 2Q1MA 2VMFA 4BU2A 3IPVB 4CZSA 4X1KB 1NCRB 3N2KB 1SBFA 3N36A 4IXLA 1QVGU 4FT8A 2WAAA 1GOFA 4IGPA 3RYFB 1NX9A 2D6NA 4QX8A 1CN1A 2Q7GA 1COWG 3OGRA 1WNSA 3ZYBA 2AACA 2VXJA 3J9SA 5LBCA 2IJKA 4LBQB 1DGLA 4GYCB 1OF3A 2JG8B 1RUD2 1SHWB 1R082 4ES9A 2JJ2G 5B1BC 2B46X 2ZACA 2R9IA 5KA6A 2KG7B 1AR91 5FZKA 3ZSMA 5C3SA 4GKJO 4B3RO 4AQ2A 1BCCH 5CA0A 2M7WA 3DPRC 2XJUA 5KHKA 5T55A 4GX1A 1CIWA 4LKEA 1WZXA 1XBFA 1VB2A 2RG4A 1RB8G 1NBMG 1D5AA 3NNGA 1KQRA 3DC6A 3DSQA 1RM1B 4LKSA 2QQNA 3U11A 3JBG1 1RM1C 1DHKB 1VBD3 4CCJA 1IHMA 4OI1A 2PLV3 2CAVA 3UT5B 4ZIBA 3B00A 1SERA 4L92A 2FDFA 3E8HA 2XNDG 4RWUA 4PF5A 1GP4A 3ACHA 4TWTA 2P22C 3AXDA 1YFYA 4O2BA 3BVOA 4HKOA 2VD7A 2Q0AA 2ZPXA 4HFSA 3PVEA 1YDXA 1YQCA