5KHKA

Hcn2 cnbd in complex with 2-aminopurine riboside-3', 5'-cyclic monophosphate (2-nh2-cpump)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
200
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 64
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khkA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khkA02
1LR5A 4FBFA 3UKNA 3H1YA 1YFXA 5FDBA 1DGRA 1ZZ9A 2MNGA 1L3JA 4J1WA 1EPZA 1DGWA 3UKVA 3M3IA 4E2QA 2PTMA 1O4TA 4MZUA 1FI2A 4WBBA 3H3ZA 1O3QA 1RTVA 4IEQA 2QNKA 5J7MA 4I01A 2QJVA 1YFUA 2B5HA 1CAVB 4XF9A 2CAVA 3CJXA 4BH9A 3HT1A 4IEYA 5JAXA 4IERA 4Z82A 3DL3A 1Y9QA 2FMYA 1O5UA 4CYDA 1VR3A 1ZRDA 2O8QA 2Z69A 4XFIA 1NXMA 4BIFA 3USSA 1ZZBA 4YYOA 3E6BA 2GZWA 1DZRA 2HJIA 4HZFA 2PQQA 1O3RA 3EJKA 3RNSA 3NSTA 4WZCA 1QWRA 2Y0OA 3KMHA 2ETEA 3M70A 1OD5A 3WW2A 4FAHA 3H3UA 1RUOA 1PMIA 3HIFA 4BYYA 2DCTA 2IXKA 4XETA 5I8SA 4IEPA 1YFYA 2EA7A 3D82A 3IWZA 3E5UA 2XL9A 5FPXA 1WLTA 4KU8A 3RDIA 4Z07A 4R52A 3WW1A 2IXLA 4F7ZA 4YARA 3U10A 2I45A 2ATFA 1VP6A 2XLGA 4JTOA 3MPBA 4Q0UA 5HI0A 3BB6A 2B9UA 2VQAA 3I7DA 2PYTA 4QGMA 5JSPA 3EO6A 1V70A 1J59A 1ZRCA 3VHRA 4Q0QA 5FQ0B 3FWEA 2BGCA 3R6SA 1NE6A 1OFNA 4GULA 3TNQA 1EY2A 3CEWA 4META 3FZ3A 1NZCA 3MDPA 2XLFA 3H7JA 1LRHA 4XF3A 2IXHA 4KL1A 4HMZA 5FLIA 2VPVA 5KHIA 5FQ0A 2D5HA 2CAUA 4BHPA 2IXJA 5JCTA 3GYDA 2XKPA 4MGZE 4ORFA 1CAUB 2OZ6A 1ZRRA 1CAXA 3RYRA 3WW3A 2IXCA 4AQ2A 4MH0E 4ZU4A 4LUKA 1GQGA 3SHRA 4MUVA 1YFWA 1J58A 1GQHA 3H7YA 4OLLA 4LULA 3BPZA 4EWEA 5F1RA 3ELNA 3KSCA 3IDBB 5EZWA 3CF6E 4IEXA 4LA3A 3CLPA 1CAUA 4R8HA 3E6CC 3E97A 3H8UA 3QACA 4H7LA 3ETQA 2GC1A 5D1IA 3SCFA 4HSJA 4I09A 1Q3EA 1I6XA 3DKWA 2XKOA 1XE8A 2ZKLA 3FHIB 4UXAA 4IESA 4ZU5A 3OTFA 2CGPA 2KXLA 4O9EA 4KWJA 5KHKA 1I5ZA 3H1MA 3PLQA 4XF1A 5I8YA 5LEKA 4HLTA 4IEZA 1YUDA 5BPXA 4EWAA 2UY8A 4XFBA 5FLJA 2IXIA 1VJ2A 3NKTA 3ACLA 4HVOA 2BYVE 4PIZA 2H6CA 2IC1A 4ONUA 2XL7A 5KHHA 4YSFA 3TNPB 5FCCA 1EP0A 4IETA 5E16A 3EQEA 5LEJA 5BXXA 4KWLA 4MGIE 1IPJA 4Q29A 4IEOA 2UY9A 4HVQA 1CGPA 1NYWA 3KCCA 4QM8A 1O7FA 3HQXA 2D5FA 3EHKA 2VECA 1UCXA 4X6RB 1XRUA 5JSRA 1X8MA 2CV6A 4I0AA 5E1RA 1OMIA 4MGYE 3N4MA 1XE7A 1WGPA 3NL1A 3DN7A 2Q0AA 5J48A 2MPFA 4QMAA 4EV0A 2OPKA 4FAGA 4HN0A 3U0ZA 3SCHA 5KBFA 2OZJA 2UYAA 3FJSA 3LA3A 1RGSA 4YRDA 1J1LA 3H1WA 1ZRFA 4AQ6A 4I3PA 4Q0PA 4I2OA 3HT2A 4HSLA 2XGXA 5KHGA 3LOIA 1U12A 1UIJA 4XF4A 2XHKA 5C6CA 3ZDSA 1Q43A 1RL3A 2D40A 4MGKE 4MX3A 3BALA 2GC3A 3OD0A 1CAXB 2F4PA 3FE5A 1H1IA 1YLLA 2Q1ZB 3EBRA 3G7DA 2WFPA 3H50A 3KGLA 4N9IA 4AVBA 4KU7A 1H1MA 1RUNA 3RPQA 3E6DA 3NVCA 1QXJA 2QCSB 1J3PA 2V09A 4K8FA 4XFGA 5I91A 4PIYA 5I0RA 2BNOA 2E9QA 3ES4A 5J3UA 4LA2A 1EYBA 5BV6A 2P17A 2HKXA 2OA2A 3C3VA 1Q5OA 3LA7A 2WC2A 1CAWB 3GBFA 3KGZA 2K9ZA 2EVXA 3RZZA 4LUMA 3IIAA 4P9GA 2BNMA 2EAAA 3JZVA 3QOPA 4QXKA 2C0ZA 2Q4SA 4B29A 1Y3TA 2FQPA 2BEOA 3D0SA 2GU9A 4ZU7A 5BY5A 4F8AA 4N9HA 1QY4A 1QXRA 5FPZA 1SEFA 3OF1A 1G6NA 1ZNPA 1HW5A 1ZZ6A 3I54A 4I02A 1CAWA 4JTNA 3ROUA 4QM9A 4HBNA 1WA4A 3BCWA 3E5XA 2PHDA 3NJZA 4XFAA 3E5QA 3LA2A 5CU1A 5I0UA 3OCPA 1IPKA 5FLHA 4L11A 4DINB 3OGJA 5LRRA 1LKNA 1JUHA 3MZHA 2PA7A 2GAUA 2B8MA 3D0JA 4UBGA 4XFHA 1O5LA 1O3TA 1LB2A 2PAEA 1UW8A 1DZTA 1J3QA 1TQ5A 4PIXA 4QGLA 4UBHA 5CVRA 3RYPA 2ET7A 4LTAA 1OI6A 4PJYA 4XEZA 4FT8A 5BUVA 1UIKA 1RC6A 5JR7B 4IEVA 4Q0SA 1UD1A 1J3RA 5JSOA 4AXOA 3O14A 1FT9A 2GC2A 3IBMA 3L2HA 2OYZA 1ZZ8A 3SMHA 4IEWA 1CAVA 4RD7A 4J1XA 4QGNA 3S7IA 1SFNA 1ZZ7A 4JVAA 4E2GA 5CADA 2GH2A 4AVAA 2PFWA 3WW4A 4A2UA 4JV4A 4LLOA 4HVRA 5LRSA 3MYXA 4EROA 3I59B 1ZREA 1YHFA 3B02A 1FXZA 4HN1A 4OFGA 4TLFA 4YNIA 2H0VA 3H9AA 3SCGA 5KHJA 1X7NA 3IDCB 3CO2A 3LWCA 5I93A 4D7TA 5I8TA 3BU7A 1PM7A 3NW4A 1X82A 2QVSB 4X6QB 5T3NA 1NE4A 2O1QA 2Z2SB 4E2SA 3LAGA 3ES1A 4KWKA 3I59A 2N7GA 3DV8A 2H6BA 2BNNA 4EWDA 4O9GA 1YWKA 1ZX5A 2K0GA 4Q0VA 4I0BA 5EFUA 1X8EA 1ZZCA 3FX3A 4MV2A 3PNAA 3S7EA 2GC0A 3S0MA 3RYKA 1SQ4A 1CX4A 4IEUA 3FFQA 4XF0A 5AVPA 3ST7A 4XFCA 4L2NA 4NVPA 2ET1A 5I0TA 4XFFA 5K8SA 2ZCWA 4WVZA 2XLAA 2PAKA 3SXWA 4QX5A 2D93A 1UPIA 4AVCA 2UYBA 5C8WA 1O3SA 3PVBB 1ZVFA 2QDRA 2PHLA 4D7SA 3U11A 2Q30A 3UKTA 4LEJA 2MHFA 3LZZA 3CL1A 2PAMA 5I0SA
chains in the Genus database with same CATH superfamily
3K04A 1SQFA 5EYYA 1QQP1 5A7OA 5A6XA 1NXD1 4BQXA 1BYHA 3O65A 4B3MB 3ZX7A 4U3FH 3MPPG 2ZE5A 5IYYA 4JTAB 4YW3A 4O4IA 3S30A 3BOPA 1QH7A 3AK0A 2X53S 5FPRA 4LBQB 4LITA 3J81N 2GTSA 2HVKC 4NTXA 2HJIA 1I94O 4HZFA 4E4SA 2Z42A 1W9SA 4A6SA 1SC5B 5K0UC 1CEZA 5FWJA 5KUKA 3ZDVA 3WW2A 1DQ5A 2ARXA 2H3OA 1QMJA 1XXNA 4NRMA 2HWC2 4WCEV 1NTKH 3KG2A 4CCMA 2EILC 2XMLA 1GZ9A 4CP2A 4QB2A 1WLTA 3PU3A 4ASKA 4UW6A 2IXLA 3PHMA 4IV1B 2Y6JA 1PO21 2Q0OC 4NKGB 2BU9A 2EAKA 1QKQA 1VBB1 2V4AA 5EBWC 2WS93 1RUH3 2A9HA 1W03A 2DCKA 4AFDA 3IDEA 5FPVA 2Q9LA 4MS2A 1IOAA 1UYPA 2E26A 3ZSEA 1QQP2 1BVP1 3ETEA 5KHIA 1N8RW 4KHPB 2AH2A 1RUE1 2C6SA 1CONA 2QQUA 4UXNA 3JD71 5FXWA 1HIXA 3LEIA 1R3KC 3AVRA 4JGYC 4FPOB 1COV3 1S0CA 1ENSA 1Y74A 2JS5A 2ES3A 2W08A 2XWJB 2ZGKA 5IUQA 2ARHA 1OA2A 4LA3A 3I3DA 2Y26A 5J98B 1SLCA 1W9TA 3KF5A 4H7LA 4DV1O 4JI8O 2DUPA 3QBQA 1QOOA 3ZXEA 2Z3YA 1K33A 4NPLA 4DR2B 3PLQA 3POEA 4JQTA 5KX5B 2VW1A 1X9TA 1VEWA 2E74B 5C9AA 5IVJA 3GVMA 3CQOA 1M90W 4YSFA 2JDYA 1JOJA 4YHHB 1YIPA 1H38A 1LHWA 1R081 4GB32 3ABLB 4QQ2A 4IEOA 3VDDC 1OCZC 3ACIA 4FO9A 2BOCC 3OGSA 4JI4O 4D6RA 3GZUC 5LMNB 5EV7A 3POBA 5GM0A 2NN8A 4R8CA 2CV6A 1EUTA 2VWJA 2Q73A 3N7JA 4GX2A 4PF5A 4DR7B 3VHNA 1U5YA 4B3TB 3HKEB 5IT9N 2OZJA 2WLPA 3UV9A 2WDBA 1J1LA 1R093 2C26A 3O1UA 1CESA 3WG7C 1CZSA 2D44A 1RUJ1 4EFEA 3KV4A 1XOUA 3JXSA 2XHNA 2F4PA 3KT4A 1AP6A 1Y74B 3CCUV 2Q1ZB 4FFFA 1Z7S2 3CRMA 1FXKC 1JJOA 4UB8Z 4FLYA 1H1MA 3AKTA 2HEVF 3NVCA 1QXJA 4J6GA 4BOWA 2X6AA 1CR7A 1YQ6A 4OUEA 1EYBA 1V9U1 3AKQA 1DLLA 2EXKA 2A75A 3SQOA 2PHFA 4PJ0Z 1LHVA 4Q27A 2YG0A 2KD7A 3E1F1 2K9ZA 3RVYA 2BNMA 4YY3B 1AYN3 3VBUA 1F23A 4FTEA 1QCEA 3ML0A 5CFDC 3I2KA 4FFIA 5C9AB 3KCXA 4QIWF 1HW5A 1RUD1 2ZGNA 2P06A 5F8PA 4QM9A 3BCWA 1N0NA 4B8EA 5EC1C 2JENA 4AWDA 1AI4A 3KCYA 1FJGB 4FFKA 2V5YA 3JSLA 1AB3A 1R1BA 1O3TA 1SERA 2EIGA 1DZTA 1TQ5A 5K9YA 2X6CA 4QGLA 2VZTA 3AG1C 4U7NA 2GMEA 1UU6A 2RV9A 3N9LA 4XUNA 1RJ8A 2ZNJA 4BB3A 1PGL2 5DN2A 4H44B 5JXJA 2VH9A 4S2GA 5IYDO 1RHI3 1PMHX 3OAAG 1F5JA 5LP6A 4AVAA 1NCRA 4BQ5A 3RZJA 1Q6UA 3SPGA 1CPYA 4I55A 3R0RA 3GM8A 2H0VA 2XT9A 4ZI7B 2CTPA 2RJLA 1HXS3 2WR9A 1QOSA 1YQ8A 4CUAA 5GTHZ 1A8MA 1VBD1 2ZX0A 4XYXA 3O0XA 5LHIA 2VNOA 1KP3A 1XHXA 2W1QA 1PHMA 4MYEA 4K1YA 4IE6A 3S0MA 4PA7A 1SA0A 2RN9A 3MO4A 4YM3A 1J1TA 4LKSA 2Q8OA 2F23A 4L2NA 4P2ZA 2SBAA 3RVZA 1FXVA 5A3OA 2XLAA 3RWKX 3VBUB 1UPGA 5E88A 5FY1A 1RUD2 3OW2U 2D93A 3DTUB 1WJZA 2Q8VA 1ZBA2 3R4UA 3UT0A 3ZHRA 4KMQA 2YXSA 4L0PA 2P3KA 1UKRA 1V6IA 1NZIA 2Y0IA 5TSWA 1GZWA 4PA6A 3K4ZA 3WDWA 3P3PA 1O9GA 3H3ZA 2FD8A 4CEWA 2ZDIA 2IU0A 3IPVA 1O91A 1GOGA 2OIIA 5A33A 2AHZA 3C3SA 2FZ2A 1ENRA 1MZ5A 2D6OX 5CKNA 3ABMB 4BIFA 3E6BA 1AXYA 4I55B 4LR3A 4JZRA 3EJKA 2XDVA 2F93B 3RI8A 4D8MA 5C3SA 1OUXA 1D5NA 4JI1B 2UUCO 5IAVA 2HEPA 1RMU3 4NTYA 3QD6A 1UXXX 1MPXA 3J7MA 1QEXA 2W46A 5FWEA 1VQ6V 1IS3A 4DXZA 5FUNA 1SA0B 1N1VA 2VQAA 4KGGA 2RVAA 2XJTA 3VHRA 1KBHA 3H1HH 3A8TA 4ISQA 5B1OA 3ZM8A 4QX7A 3WG4A 1S2KA 4RR3A 1BQZA 4GJYA 4DFSA 3CEWA 2YU2A 3PJQA 5C93A 3Q8EA 5B2GB 4L87A 2QR4A 4J11A 1MS9A 4URAA 2XKPA 1GZWB 1J95A 2JE8A 2XR4A 1ALYA 2R0FA 1AR73 5FZ3A 1VBA1 1K9MW 4CEWB 1S3JA 4A44A 4FPHA 4LULA 4EWEA 1SMVA 2VO5A 5ACA3 3IDBB 5F3IA 4IEXA 5A33B 3MLLA 2HG5C 4R6ZA 2RG4A 1UZZA 3BN6A 4LBNA 1C4RA 3HD8B 5FY8A 2GC1A 4CDXC 3RZKA 2AGAA 2CGPA 4JRLA 3ZMTA 3E8GA 2W9XA 3VOUA 5LCWL 2DYRC 3HQUA 5HV0A 4K3UA 1V00A 3OOXA 2UY8A 5DEDA 4BK4A 5KA5A 3TN93 1N0JA 4BZ4A 1LGBA 2BYVE 4XHXA 3CJIB 4MLOA 2YC2A 2HWD1 4EZ4A 4JGZA 3PUSA 3K3WA 4IGQA 2UY9A 5L7OA 3T1YB 4BW9A 1G7YA 2WRAA 1WUVA 3ZN4A 1O7FA 2VECA 3CPWU 1FOD2 3M99B 1TME3 4EN0A 4A4AA 4MXWA 1RXGA 2B5UA 4LF8O 4UW3A 5JVDB 2YPDA 2R1DA 4EFBA 4E27A 2RMU1 3CXCU 1TMF3 3AYAA 1OZ0A 5EPAA 1HN1A 1Y66A 1F51A 1U12A 2KG7A 1HQLA 3ZDSA 1RUC2 3BEHA 3VD4A 4CDWA 1SPPB 3QF7A 3H01A 3VBBA 2LALA 3EB7A 3AYDA 2VUDA 3VBSA 4Z8BA 4JQRA 1K4CC 4NIDA 2A5ZA 3JD1A 2PY5A 1GWKA 5H5NA 2TEPA 1V54B 4MADA 2IH1C 1G6UA 5BV6A 1QJY3 4GJZA 2JEXA 3BCCH 4R7CA 1XNDA 4PBOA 2PHTA 3K5MA 1OCRC 4BMBA 4Q4W3 2F43G 3ASOB 3DXRA 1GZCA 5FO8B 2NYYA 1KU9A 4CC6A 5DAXA 2HWD2 1QY4A 3DSQA 4MTXA 4C90A 3SPIA 1T2XA 1D5AA 4G2KA 3LIHA 3OCPA 4L11A 1QU7A 2W91A 3OGJA 3SYOA 3FHQA 4Y4YA 3J9SA 3A23A 5IVYA 1ASJ1 4FSJA 3RYHA 4R4XA 3K2OA 1AX0A 4J9YB 5DUXA 4MXWB 1J3RA 5JSOA 2RMU2 3IC9A 4DB5A 2OT5A 5KAFZ 4C1WA 5IFPA 4A5UB 4GXLA 3TAYA 3D8CA 2WABA 4H13B 5KUMA 2EIJC 1BGYH 2JDMA 2VBDA 4QQHA 4FXKB 2KG7B 4AL9A 4CDWB 1H0BA 1IG0A 1FXZA 1YO8A 4D6TH 3G80A 4DR3B 3SCGA 2VVEA 4MVQA 1YJNV 4AI8A 5DZGA 4AK3A 5LBBA 2VGDA 1NE4A 5A6YA 1B35A 3ECQA 4NPRA 3VBSB 4JCKA 1S5LZ 4LFBO 1N1TA 4I0BA 2AXTZ 4MV2A 2DVFA 5EZYB 1Z0HA 1K34A 4FTBA 2GP5A 1N36B 4DR4B 3VBRB 2EJRA 2R061 4WFGA 4XVHA 4JI2B 3AFGA 1O59A 5BNNA 1N34B 1O3SA 4PDMA 1XQNA 2JEUA 3U11A 4OHVA 5E6HA 5JOYA 4FPPA 5I0SA 2QGNA 2XH6A 3ORJA 1YFXA 1UMZA 5IY5C 4AHYA 1EPZA 2IUWA 4E2QA 2PTMA 2DWRA 3RYFA 3LNMB 3UCSC 1KB9F 4A3XA 1HRV3 4LKDA 1ZM1A 1O3QA 2F95B 2VM9A 4HPKB 1UOBA 5B1BB 1KECA 4UAPA 3HMYA 4ASUG 4X64B 4S2DA 4BU2A 2VOVA 2Q6AA 4GKJO 1X59A 4IHJA 1O5UA 4CYDA 4TV9A 4BA6A 2QKDA 3T4VA 3C7EA 1A34A 2GZWA 3WDVA 3N2KB 1O3RA 3VDCA 3B2EE 4IDZA 2WSSG 3RFRA 3K3OA 4FAHA 2ATKC 3OPTA 1YTFD 4J7JA 4NTWA 1B35B 2YBSA 1UQXA 4FM2A 2LRPA 1W8FA 4GKKB 1YFYA 2VL4A 3APBA 1HNXB 2G9FA 2MEV1 4HKLA 3CJHA 1OD3A 1HN0A 4FXGB 1N3QA 4O2AB 2VNGA 4RA0A 4EN6B 4I4TA 4DUZO 3D3QA 3H1IH 4K8RB 5J96B 1AL21 3I56V 3MF9A 5CG9A 2UXDB 3B09A 4CCDA 4FFHA 1JH5A 4LF6B 2CDPA 5L3BA 1LRHA 1FNYA 5FYSA 5FLIA 1SFYA 1GMGA 1RXFA 4ZZ8A 4LWSB 5IT6A 3KS7A 1C1LA 2J1AA 3RYFB 1E1QG 3BUCA 5JPNB 1UJWB 2DTYA 4CP9A 2R9IA 2EINC 2ZX3A 2E53A 4NIGA 4OYUA 3CC4V 4J41A 2XUMA 3M8LA 3O1TA 3SLIA 3ZFGC 2EF6A 3ZOIA 4IHJB 1LOGA 3MIFA 5CNAA 4I09A 1W8NA 2HHHB 3AJYA 3ZFFA 3HEIA 3OTFA 2QQOA 1E5HA 4DEVA 2CH7A 4NWWA 1FV3A 4CUGA 3H1MA 1K92A 5IW0A 2QQMA 4WVWA 2WLQA 5JZGB 3I2GA 2QM4A 1R1ZA 2BFUS 2CY6A 2IFWA 4Q4Y2 3S57A 3C7FA 1XOYA 2A70A 3OBAA 3GZAA 2ZQMA 2WO7A 3WDXA 4DRXB 1IPJA 3ZRWB 2UXBO 4BWAA 1VRH1 3HN1A 1RUG2 4RS5A 4I4TB 3VGIA 2ARAA 2RJZA 5A3NA 1LU1A 1QJX2 3FB5C 3UKMA 4X1KA 2R041 1XE7A 2A3XA 4YGCA 4CP1A 3BTYA 2A0LA 2UWCA 1UKGA 4HK8A 2RE9A 4LF9O 3T30A 3H1WA 2SLIA 2D3SA 2EALA 3BTZA 3ZR5A 1ND2C 1BCCH 2QTOA 2DUQA 3WP4A 3WNMA 4AQSA 2IFRA 4RQPC 3UGHA 1R6NA 4DV0O 1VQ8V 1H2NA 2QE7G 3R4DB 3ICXA 4QHBA 3JBG2 2X5IA 1PV0A 3T1MA 3OBTA 4COYA 3INAA 3G6BA 1AR91 4DNYA 1JQ0A 5FUIA 1XILA 1OQEA 3EVKA 1Q5OA 1NY72 3KGZA 1VMJA 2WNEA 4LFCO 1JZ8A 3IMNA 3QOPA 4GALA 2BEOA 3J7AU 1JYCA 4ZU7A 5J09A 1FFXB 1TVKA 4QPYA 1WA4A 3VBHC 5EK0A 4NRPA 4DW1A 2VE1A 4CUBA 2UURA 3GDBA 4AF9A 1DGSA 1LKNA 3CCVV 4RS5B 3ZXKA 1NVPD 3RN4A 2JD4A 1J3QA 2PAEA 4PIXA 5CVRA 3DGEA 1GN6A 1I5XA 1RC6A 4GH4B 2CTVA 5A32A 5FPOA 2PHXA 5FYZA 3QO7A 4J1XA 3CC7V 1IBKB 4BQ1A 1L8DA 4KUMA 3BI3A 3T4ZA 4XBQA 2ZGSA 4XZPA 2WLJA 4Y5Z0 3HKBA 4F3JA 1AR1B 1PIV1 5JDBA 3IDCB 3LWCA 4DYLA 2Y0PA 1E1RG 2HWC3 4IL6Z 4OVEA 1LOFC 3E8HA 4XC9A 4XTMA 3WF0A 4KWKA 3AMQA 3WF2A 2W2IA 5T50A 3OJBA 3UK9A 1HNWB 5EFUA 4PDWC 2YGMA 4E9KA 3FX3A 4FM0A 4J10A 2G4IA 4WV8A 3OR7C 1BEV2 1QJEA 5LBFA 3DYOA 4O7XA 2BVVA 3WINE 4NXNB 4QX3A 3AG3C 1DQ2A 5LL6Y 1C28A 4OZOA 3DPRB 2UYBA 1QQP3 1TVKB 1FPN1 2CE4A 4PT6A 4LBEC 3CRCA 1E5SA 4LF7O 5DDJ2 1XNBA 3UKNA 1L1FA 2MNGA 4A41A 1DGWA 3NNGA 1JZ7A 4I0XA 2XOMA 2WLNA 3QNEA 2QZ2A 2ZEYA 2AUYA 4BR6A 3LIGA 1BHGA 3WG3A 4OMDA 3IAPA 2QNKA 5B3SB 2QJVA 1R3IC 1WPXA 5A32B 5FY0A 5A70A 2DU1A 2BSKA 5FZ8A 4XJWA 2OS2A 1W6OB 4ISRA 3FUOA 4FFGA 4RN5A 1GM8A 3OYWA 4JAUA 4AI3A 2VCMA 3HKBB 4XCAA 1H30A 2VQTA 1M9NA 1KKCA 1POV0 3BY6A 4WFAV 2ZGQA 5JOXA 2C4XA 1OD5A 4ATEA 1PMIA 4H33A 1BBT2 2VVFA 4YW4A 4XJ9A 2C1FA 4GB33 5C8YA 1ULOA 4BDVB 4C0BA 4F7ZA 3U10A 5JOWA 4Q0UA 4XZUG 2GNDA 3POSA 2XVKA 5CKQA 4MW8A 2NQYA 3EO6A 4DV6O 3E89A 1J59A 3AK3A 2Q1MA 3I2DA 1KQSU 5C3QA 3AK1A 2A3QA 5DM6V 5KXEA 1YCIA 2MK3A 2AHYA 3VZKA 4F83A 4GUNA 4QXBA 2WO1A 3VHPA 5KC6A 4I0XB 2O0OA 4IE5A 1Q90D 1B09A 5FP4A 1KITA 1Z7S3 1P7GA 4NUBA 4R50A 2WT1A 4Q4X1 1R1A2 4F6RA 5T5JA 4ZPIA 4FFBB 3IJ4A 5FY4A 2E63A 3HAGA 2AZ0A 4EQVA 1VLNA 4AHCA 1VAMA 3OYWB 1B6QA 5FUPA 1S72V 5HCHA 2JRIA 4WFBV 3GWOA 2VJXA 5LW9A 3ZHTA 5FZLA 2D3OW 3SGIA 5BPXA 4XFBA 2UUBB 3ZVXA 4DUXA 2VNRA 4IV1C 3T0AA 2OCCB 2IC1A 5F5IA 4UUJC 4W4KA 1AR62 4PD4F 5C8YB 1SRYA 2QQWA 1NOVA 3SJCC 3JUUA 1I5YA 4NJ4A 2FYUH 1JR9A 1LECA 3AX4A 4CUCA 4YJ2B 3KCCA 5FLXN 4C8DA 2DW4A 3K06A 3VUOA 3N7MA 2OT7A 2X29A 2AR6A 1AJQA 4JPRA 2AZ2A 3M4FA 5FP7A 3BGAA 2FTKA 1AYM1 2ETNA 2VW2A 3T4HB 1FYUA 5A1FA 2ZE7A 2L9LA 2IVJA 3OUHA 2IJJA 1OCCC 4D3WA 2XJVA 2XHBA 5C7GA 5T54A 3POFA 1UIJA 1YITV 1TA8A 4P9XA 4Q4X2 2W6JG 1XEQA 4OI0A 3E8BA 3PVEA 1COWG 2K1EA 4F6RB 5GLVA 1OQDA 3PDQA 4YM2A 4FPCA 4AW7A 1PNFA 2GMPA 3ZCCA 4CCJA 3IN9A 2P4KA 2RQ6A 2XJRA 2P3IA 1KGYA 1TGOA 4U3JA 1YTFB 5GLZA 3DYMA 2HKXA 2OW4A 4LO7A 1OFSA 4LXLA 4CDUA 4LBJA 1RUD3 1W6MA 3LEGA 3JZVA 2Q4SA 2WT0A 1ZBA3 3JAKB 5IK8A 3ABLC 4N9HA 3H8OA 2JG8A 3BIWE 1S2BA 1W0OA 1JYTA 2VR4A 4OPAA 1Q8OA 1WA8A 2OIEA 1GP5A 4AGGA 2ERFA 2YDEA 3WQ0A 3ZKYA 4ZHQA 1BMFG 3ASNB 1N3OA 4TXWA 2KA3A 1MSWD 3M2MA 1MMMA 5DZFA 3ZJZA 1OV9A 2RCVA 2R9RB 3AEIA 1VBE2 2Z0AA 2P6JA 5T55A 1EN5A 4XABA 4FT8A 1BE3H 4IEVA 3CRRA 4P9IA 2PYLA 2JICA 1UYZA 4LNVA 3ZXGA 3K03A 1ACCA 4N7UA 5CEHA 4B3NA 3JD0A 1IG3A 4A2UA 4GQ7A 2BWCA 5GONB 1ODNA 4IGOA 1EM1A 1FPOA 2PHUA 1EFRG 4LHSA 1SLTA 1W28A 4EN8B 3H1KH 3OBRA 3BFRA 2HWF2 1IBLO 1I94B 3KWVA 2BQPA 1PZ7A 1G4YB 1W39A 1YQ2A 3P32A 4TSFG 3EXUA 2W5FA 2JIZG 3HVDA 1OCZB 3WDUA 2VQEO 4CDUB 2HH9A 1W6MB 1VQ7V 2IH3C 1CPMA 1LU2A 2WS91 1RUH1 4PLOA 1S0VA 5DMYA 4UOJA 1NU1H 2ZKNA 4XQWA 4UFLA 2CGOA 4A45A 2MHFA 5FR3A 5LY1A 4ZHQB 4ZIBA 3WG7B 3ZXLA 4FBFA 1QGLA 4AHWA 3WQBA 3QO5A 1COV1 3A21A 3THCA 1NQDA 4FOYA 1RTVA 1R6KA 5J7MA 4YIPA 1RITA 2RS52 5I0DA 2ZEWA 2LW1A 5C5TA 3PVNA 1DFQA 3TXQA 3M3EA 1GO3F 5TISZ 3RYIA 4AI2A 2P5BA 3PMSA 5CB7A 3DCQA 4HT1T 4DUWA 5FZKA 1JN2P 4E4HA 1Y67A 4JGSA 1EV12 1QDOA 2H0BA 4JI8B 3B3QE 5F3GA 4ZOLA 3HIFA 5CFDB 3UGFA 2D3PA 2FCTA 1LR1A 3WB0A 3K4AA 1NLRA 2HWE1 4N8MA 2D6KA 3VBUC 5LK7B 5FP8A 4R52A 1M06G 1D0HA 4CS4A 5A3PA 4CVUA 1FOD3 4L92A 3BOWA 3RG0A 3AG1B 3T08A 2DF7A 4LE4A 1NVPB 1VMGA 2KSDA 4LF5O 2IXHA 4JI4B 4QQLA 2P3YA 4YJ3B 1RUC3 5FQ0A 4OI1A 1IPSA 2D5HA 1YSCA 1G8WA 4XDKA 4GX0A 3ALQA 3LSSA 1YJ9V 4YGBA 5JMCA 1Z78A 5LP6C 4COUA 1NCRC 3ABMC 1NI8A 2AREA 2B45X 4YZ1A 1AJPA 4DRRA 1CAUA 4LP8A 4JI6O 1F7YA 1Z2GA 4G9SB 4MVRA 4PHZA 1WLWA 4BQ2A 5LA0A 1OURA 2DCYA 4YVSA 4M0NA 3RYIB 5IK5A 3UO2A 3L72H 2R30A 1UAIA 5A7WA 3OTOO 3OGGA 2WJSA 1A32A 4FZ1A 4UCUA 2KQXA 1OHHG 2HWD3 1AYN1 1YI7A 4EE2A 5F2WA 1QHTA 5L9RA 4XUTA 4XXAA 2QM8A 1PGW2 5FLJA 4WBNA 1WCKA 1N1SA 2HWE2 5IVCA 2AENA 4R9DA 3IC7A 3SYAA 1MG1A 2WNVA 3T4DA 5E16A 4N23A 3WB2A 3QG5A 2XBO2 3A0NA 4X8PA 1WCSA 3ZMOA 3OUSA 1AROP 3VB9A 1X8MA 2RMU3 2DN9A 1S0EA 1OJHA 2IZWA 5FZAA 5C4WA 2VZOA 4UI9L 3TB0A 2YFUA 3LEKA 2BOIA 3SCHA 1RHI1 1ULCA 2CYFA 5FPUA 1RGSA 2RDCA 4QPGA 4CEWC 1MQTA 2ZDIC 3GJBA 4Q1RA 2VD7A 4XDJA 5E1AC 4XQDA 3TRSB 3ON7A 2ADPA 4MT8A 4PV1B 2E51A 2BW8A 3FYEB 3WF3A 4FTSA 4Q26A 3IM0A 4LBMA 2NR5A 1KS5A 1W2AX 3E35A 3EXAA 3ZN6B 4JDNA 1MZEA 1EPWA 3LA7A 2PHRA 2WC2A 5HCBA 4P9GA 4BXFA 1APNA 2R72A 3NJVA 3RZLA 4P00B 2J1VA 1XQ8A 4WBNB 5AC92 4PF1A 2HLDG 3ZSJA 4I02A 2QFEA 3M3QA 4XFAA 2WNVB 5I0UA 3SKVA 5HXMA 2ZHLA 1AI7A 2ZXWB 4RR3C 1ENQA 2ILMA 5LATA 4IE4A 4PJYA 4ASMB 4P5YA 1JZ5A 2J22A 1ZZ8A 1YC61 1S5JA 3K0DA 4Q20A 1MQTB 3RJRA 1EUUA 4BMEA 3O1RA 1PO12 1F9KA 4HVRA 3OFNG 4JTDB 1SZBA 2DU0A 3D36A 2BTVC 4QWNA 2YI8A 2M7WA 1JOPA 4I3GA 3W7UA 2EIMC 1V54C 4RGAA 3DECA 2O1QA 3UO3A 1XU1A 1RIRA 4UW5A 5L36A 1BHAA 4N43A 1QDCA 5FRAA 3AZXA 4QD2A 3ASOC 3S7EA 3ZRXA 2ADEA 1GUIA 5LGNA 2OQ7A 2UUCB 2KB1A 4QHZA 2GHYA 5FZ1A 4OQ8A 2XUEA 3VBOA 3ST7A 3LDEA 2VU9A 1ND3A 4NIAA 2JDNA 3I2FA 1XI1A 2D97A 1FX5A 3R05A 5EWSA 4JGZC 3H8XA 3DXTA 3GNEA 1US6A 5L7OC 1YI2V 1JW6A 3BA8A 2HEYF 4NHLA 1ST8A 1RVF2 2VXRA 3LZZA 3CEIA 5FL7G 5JIAA 5L3DA 5LASA 1WP8A 1AR71 2HYXA 1O4TA 1QR9A 2CUGA 2XVGA 1JVMA 4WBBA 3NWKA 2ZXQA 3WNNA 4XQ4A 2JE9A 4PA9A 3VKLA 5EXOA 5ACA1 1NS1A 3NXSA 3J4UH 5DG1A 3KV6A 4CDWC 3NNJA 2BOBC 1WLDA 4BH9A 4FPYA 2V4DA 1N3PA 1EN4A 3DL3A 2A7AA 4WM7A 2Z69A 3ABKC 3USSA 1F2NA 1J5EO 5SV5A 3VBSC 3ZMUA 4ET7A 1UN1A 1AR4A 1ZA7A 1OCRB 3AG2B 4Q4Y3 4AEDA 4W50A 3AB0A 4V1PA 3TN91 3AP5A 3O5SA 1YXBA 3BA9A 3ETDA 4UFKA 3CC2V 3I3MA 3A4UA 3BTAA 4Q4V2 1RUG3 4MGSA 2M6YA 2ATFA 1QJX3 4PDRA 3VBOB 5CFCA 2HBUA 1TE1B 5ERLA 2DVGA 5ITZA 1V70A 4AGRA 1TME1 2TBVA 1LOAA 5C3RA 1F35A 5BNOA 1EAH2 3G6EV 2XLFA 4WF9V 4DXSA 1TMF1 1WLCA 1WPBA 4LE3A 1UX7A 4LBQD 4QDSA 2EIJB 5LB6A 1OHFA 1NA1A 3GYDA 3EYPA 1N33B 4DY3A 3K4DA 4LF8B 1BXHA 1STMA 3O0VA 3THPA 3PUAA 5FAXA 1HRI2 4PLMA 4PA3A 3JBG3 5F1RA 1G9FA 1YXWA 1Z5VA 3VLBB 1QU0A 1MVEA 2ZGTA 4AEKA 4WM7B 2RHPA 5T5PA 4TQFA 2YIDA 5A3UA 1XE8A 2VUJA 1W6NA 4E2LA 1B35C 3CB2A 5KHKA 1F15A 1C8M2 1QH6A 1SBFA 2ZMKA 5I8YA 4LBKA 2WNOA 3U78A 2A3WA 3L70H 3V64A 5IWAO 1VJ2A 3HNBM 1DP0A 3HWJA 3URFA 3DYPA 1SQQH 5C5UA 5ISLA 5GLWA 5G04L 2IJHA 5IJ9B 1C57A 1ULGA 2EXHA 3BPSA 5BNNC 4NAOA 2DCJA 1N1YA 5CFCB 4N21A 1FNZA 5ITZB 5L9VA 2RDQA 4HOOA 2WUHA 1I1EA 3ETPA 4P5HA 3MIEA 5BNOB 4EV0A 4X88A 2JE7A 3AJZA 2I07B 2A3YA 3GGLA 4GMP3 1UXZA 1JYVA 2XGXA 1GH6A 4DW0A 3AFKA 4X89A 2BRTA 1RL3A 1XREA 1MZ6A 2W1UA 3ZFEA 4JRAA 1VB2A 4LJHA 1WW6A 5IK4A 2X0LA 3HNYM 3G7DA 5FZ0A 1WB7A 3QO8A 3UT5A 2D2CB 2FMDA 4W8JA 2ZGUA 4AGVA 5IYZA 1XMOB 4K8FA 2E7QA 5L3EA 4DR5O 1XJAA 4PIYA 1W6NB 1BEV3 3I3QA 3O1SA 1AJKA 4L8JA 2EVXA 4XDOA 1JFFA 2XJUA 4MVSA 3LSDA 4P9YA 4W65A 1LHOA 1NQTA 1CAWA 3ITQA 5DDJ3 3I55V 1LULA 1PNMA 2YYOA 3CZUA 4GX5A 2VTXA 3LSQA 1QLNA 2W87A 4DV3O 4X1IA 5FJHA 1PZ9A 2LJ2A 1OA4A 4JX0A 5A6ZA 2ZS6B 3OMNB 1HNZB 4LPLA 2YICA 3O14A 5JIUA 1SHWB 3T2TA 3LQCA 2OYQA 5EYXA 3CCQV 1M93A 3WG2A 2JEMA 5LXTA 5A1AA 5H9SA 1PNKA 3IDAA 4IXLA 3N27A 4G27B 3CKHA 1LTEA 4LLOA 4GX1A 3I59B 2DFBA 3POGA 4KBBA 5DZEA 1YHFA 4Q6GA 4IE7A 2R16A 4QX1A 3BTXA 4RGKA 2D6NA 3TK1A 3ZFFC 1BBT3 2WWWA 2O14A 5KXBA 5KXDA 3UT5B 3V0AA 4K40A 3SC7X 1ZX5A 5A6QA 3WV6A 1PPJH 2OUJA 3M7MX 4UF0A 1W9FA 3RYKA 4ICGA 4P9WA 4CCLA 1F4HA 2XQXA 1PD3A 3WP6A 1JFFB 4P08A 3RYCA 4Y1XA 2WYSA 1EZJA 4RS5C 5CAZA 5JH7B 1POQA 4MSWC 2ZGMA 4DUZB 1BL8A 2VMDA 1WWYA 3TETA 3IB3A 3H1YA 1ZZ9A 2VMCA 3GJAA 5LMNO 1R1A3 4OX9O 4X1IB 2DQ3A 4RQPB 4UCVA 4COVA 1RP3B 3ZX6A 1WMXA 5BNPA 4Y22A 2CHHA 5KXCA 2B5HA 4FPGA 5L3CA 3I2HA 1OUSA 5LXTB 2QQLA 5FNVA 1WA6X 2WWJA 3WOGA 3AZWA 5FMOS 1PVC2 4BQ3A 2A71A 1S2EA 2YPJA 4M3CA 5B66Z 2X5IC 4M3CE 4C0HA 1W6QA 2WO2A 3M70A 3QCWA 1AR63 2YBKA 3ZIWA 2C5DA 4XETA 5F6KA 3V0AB 4G4FA 3ZN5A 1IX9A 2VQ0A 2JWPA 3WQ1A 3NAPA 1Q82W 3OEHG 1WNSA 2DDUA 1LEDA 2KM2A 2HJDA 3BB6A 3KV5A 3ZHUA 3RJ2X 3LOBA 3MFCA 2J1UA 4Q0QA 2JGUA 2ZGOA 3ATGA 1H2LA 2RMKB 3R6SA 4Y1YA 1UY1A 4X20B 2UXBB 2DVAA 3H7JA 4EJRA 4YIOA 1KC8W 1CJDA 2B9ZA 5B3SC 2IXJA 5IYBO 1VIBA 1XDCA 2J1EA 2ZX1A 4X1YA 4IYIA 4TWTA 4AQ2A 1LNSA 2V1DA 4LF9B 2IU3A 3SEPA 4AVVA 4MUVA 5BNPB 4Y22B 3H7YA 4OLLA 4PQ9A 4EB6B 1K42A 3ELNA 3CF6E 4UCSA 1U96A 1FATA 4R8HA 4QX0A 1ZUQA 3H0OA 5FNVB 2RM22 3T0BA 3U4XA 4UXAA 4YW5A 4DV0B 3T3YA 4LLFA 1HQWA 5LY2A 3FYIB 4AI0A 1WCDJ 3OEBA 1OLQA 2PHWA 1OBNA 1W6QB 2DWDC 3ABTA 3C3TA 3K77A 5FBJA 3KF3A 3N2GB 3TNPB 5IDJA 4NPMA 1EP0A 3SH4A 2XAHA 3JASA 4LFCB 4IETA 3NAPB 1VBE3 4OGQB 4LOSA 2O8OA 5LEJA 5BXXA 4Q29A 4AAPA 2Q5TA 4I50A 2YC4A 3OY8A 4AR2A 4QM8A 3AP4A 4LF4O 4CRQA 4XURA 1HLCA 1U0AA 4LMFA 1WGPA 1VQOV 5FZGA 4LNUB 5H9QA 3OMIB 4FAGA 5BMVA 3OM3B 4GA9A 3T2QA 5FFOC 3RZHA 5A3TA 5LZ6A 1ZRFA 3HT2A 4BCUA 2VG9A 5KHGA 1JMUB 3SYCA 2D40A 3THDA 1SDWA 2F4VB 3ZO0B 1H2SB 5B5EZ 2HWC1 1I08A 2HWF3 1HR0O 2WFPA 2Y33A 4AVBA 2W6IG 3AM2A 2YEVA 1FXHA 1FD9A 4X8NA 1DQ4A 3PUIA 5EP9A 3VDAA 1RUI1 5J3UA 4LA2A 3ACHA 4CPBD 4H14A 4YW6A 2OCCC 3AZYA 2P37A 4C91A 4I9QA 4LUMA 1IHMA 5BYNA 1LOBA 4JI1O 3D0SA 5K7PA 2LFSA 2Y69C 2OUHA 4OUSA 3ZYJB 2A6WA 4KQ7A 4PQQA 2RS12 3E5QA 3JASB 2DTWA 4DINB 3MZHA 3CWBH 4BIZA 4IUGA 3WCRA 1VQNV 4NROA 2JDPA 2RS53 1YIFA 5EJ1B 4LF7B 4DR1O 3U14A 2YY1A 3SMHA 4IEWA 1WKYA 1UU4A 5JJJB 4I5SA 3BABA 3FL7A 4BQ4A 4FPEA 2XAGA 1CZVA 2LUWA 5FBZA 2QWQB 1FFTB 5DAVA 2G38A 1EV13 4TLFA 2FMLA 1D4M2 2VOXA 2E75B 4GZRB 2Z2SB 2QQJA 3GHNA 3ZR6A 1TAEA 2YEVB 4QB1A 4EYUA 3M1HA 2BNNA 1FKAO 1RUI2 4GB31 1SFPA 1YWKA 5EC2C 3CIHA 1WMFA 1AR82 2D6MA 4JI3O 3RZGA 3LF7A 2UU9O 2YU1A 4QU1A 2DYSB 4WVZA 1YHQV 2R072 3ASNC 5CBHA 5HV4A 1CP9A 1D4VB 3PU8A 4RFRB 4N7IA 1V6MA 3ZYHA 2PHLA 1HQNA 3JD4A 3TCUA 1OCCB 3CL1A 4FIPC 3NQHA 4DOUA 5FDBA 3T1YO 2KR2A 4J1WA 4O4IB 2WPDG 1XHZA 2J1TA 4JI0B 1UF2C 3SPCA 2OTLV 1Z7S1 2ZTNA 4QXHA 2HJFC 3WP3A 4I01A 1YFUA 1LODA 3IT8A 4BAYA 1XUQA 1PNLA 4IEYA 1KUQA 1UZWA 3Q8BA 4AEJA 4YYOA 2PN5A 5KR7A 2OXBA 4RAIA 1RUF2 3D6EA 3B93A 3JARA 1BK1A 2Y0OA 2HWE3 3EHBB 5FPBA 3HJRA 4CDUC 3D82A 2XBO3 2Q67A 2XL9A 1XYPA 4Z07A 1M4UA 2VBPA 2Y6KA 2JG8C 1O8PA 4JI7O 3F5TA 4FJCC 1UFIA 4FVVA 5FZ7A 3W5MA 1AI5A 1PGL1 2DJVA 4QQPA 1PX3A 1IBMO 3SDLA 3I2OA 2ZIOA 3B4SA 3NMBA 3W7SA 3K51A 4YGDA 4BLIA 4TZDA 1JYWA 3WHUA 3U07A 5C3OA 2EX3A 2E33A 4J42A 2VPVA 2R1BA 2QKCA 3VQWA 3LDDA 3FBMA 1W0NA 2VUAA 1Q8PA 4ORFA 1XC6A 1LNQA 3RYRA 1E5IA 5T52A 4Q8LA 1Q81W 5T5LA 3WNOA 4B3SB 3USUA 2HBTA 4URTA 2EIKB 1J84A 4G3YC 1AP5A 2ZOEB 3CLPA 3TOJA 3OG2A 4CDQA 1UWWA 5H6QA 4H37A 3SCFA 2LROA 3LSEA 3Q8FA 1H2GA 1DYOA 1A78A 3M7AA 4IT5A 5CG8A 4NWVA 5BY1A 4JV5O 1Y76A 4DR3O 1I5ZA 1NR7A 3JARB 2WQ4A 4P9PA 5AC93 1ZBA1 3B8NA 1YUDA 2QDNA 4Z2AA 4J9ZB 1BS3A 2BE3A 4KWLA 4BM8A 3D5OA 1S55A 4JZGA 4DR4O 3GWKC 1NYWA 4TT3G 2VWKA 4B08A 1W59A 2WA3A 4JI2O 5E1RA 2UUAO 3WQ7A 4KGQA 4QPIA 1M57B 1W99A 2MPFA 2HLEA 2PQSA 4OHWA 4ASLA 1PO13 2UYAA 3GHMA 5F5CA 3R65A 2QDOA 1XMQO 2QQNA 2BWAA 1GP6A 1XBFA 2DWEC 4CH3A 4E4ZA 3N7KA 5DXDA 3CMEV 2ZABA 3TEYA 3RWRD 3USUB 1BQPA 3W59A 1CVNA 3ILFA 2NLRA 4Y24A 2W3JA 4I7ZB 3QLQA 4X64O 1GRJA 4QQOA 1GWMA 4DS0A 3X2QC 4CDQB 2E76B 2AW9A 3NNMA 1L7QA 1C8NA 4X65B 2NN4A 5GKAC 2EIDA 1A3KA 3CCLV 2D6LX 3P6BA 1Y76B 5J2UA 1XNTA 2RS32 1IBLB 3I3BA 3W20A 4AOCA 4IIJA 2VCBA 1D2QA 4O4LA 1JOBA 4Z2WA 1Q56A 3NO8A 1UY2A 4X9QA 3HPLC 1SLIA 3NJXA 3N3HA 3TWIA 1RVF3 3HBZA 1D0GA 5D2AA 4P02B 3MW3A 4UWDA 2PHDA 1UYXA 3OEAA 4NHXA 5FYYA 1IPKA 1SDDB 2HFEC 2UU8A 3D0JA 3AL5A 1Q6HA 4MGTA 4ZBMA 5A80A 2ZD9A 4AQYO 2Q1FA 3QH6A 1OI6A 1YQ5A 3CCRV 1UO9A 3ZRVA 1BZKA 2MW2B 2VC9A 3PIJA 1D2SA 5LP6B 2YXHA 3JCZA 1NCRB 4AXOA 3APOA 2OYZA 1D2DA 4CBCA 2CDYA 4JC1A 5H2FZ 4TYSA 1JI6A 3CDZB 2PFWA 3WW4A 2V7QG 4PCRA 1AR5A 4JKKA 5AFEA 5HBAA 1IVSA 2ZGPA 4DXRA 2ITCC 5EJZB 4B1LA 1X7NA 2C24A 3SYQA 4YVSC 4DY5A 4HXCA 1X82A 3MF6A 1KFXL 4CPBA 3AMMA 4O2BA 4Q4V3 1LOEA 4YZ5A 3WUDA 2H6BA 3FLRA 4N53A 4O9GA 2HHHO 4WZFA 4NOTA 5CBLA 4ZZ5A 1EZVH 1HJGA 4H2AA 3MHHC 2VMFA 1FOD1 4RHV1 1XSQA 5FJKA 1K3EA 1QNYA 2ET1A 4IIJB 2K9PA 2WNVC 1FV2A 5FPAA 1EAH3 2ZXWC 2YB7A 3VV1A 1SQXH 5IVEA 2VZQA 4S2HA 5JWPA 2DBNA 2WKKA 4FLZA 1RUC1 5C4WC 1LR5A 2JJ6A 4CU7A 1DGRA 3IPVB 4LC1A 4MVUA 4V2VA 1HRI3 3ETGA 4M00A 4LF5B 3ME2A 4QPGC 4X8AA 1MQTC 2FBEA 3ZHQA 1R73A 4B3RO 3KZ4C 4XF9A 2YC0A 3HR0A 2CAVA 3M8AA 1GNYA 2WFF1 1DF4A 4DRVA 2WAAA 1VP7A 2RNBA 3APQA 5FYMA 4XHBA 4A7ZA 2B1IA 1C8M3 3WDTA 3FB8C 4JHTA 4IL7A 2PLV1 3BHPA 2Q8CA 1OKQA 1S77D 4NXMO 4JI6B 3DKQA 1SG3A 5DPNA 2R0HA 2IXKA 1MABG 4Y1UA 4O2BB 1NLSA 4J25A 3OTOB 4N53B 3AZVA 4CEYA 4KBZA 4RHV2 5H6RA 4FP2A 4RO2A 3WW1A 4LBOA 4RR3B 3KB5A 2BJSA 1GANA 1PL4A 2UXXA 3K46A 1DZQA 4QE9A 1AX2A 1XNRO 3LFIA 1OFNA 3TNQA 1M4WA 3KT1A 4JTCB 3RVHA 4D6QA 3U75A 4XF3A 3B8MA 5IJ0A 3N35A 5FZCA 3Q4HA 1SLAA 1WB8A 2OVUA 1AHSA 1ENXA 4IE0A 2JIGA 2OZ6A 1GQGA 2EIMB 1YFWA 2HP8A 3WVJA 2G9GA 5BR8O 2WFF2 3GBGA 4LH6A 3KSCA 5LGTA 2AYHA 3D36C 3AG2C 2PLV2 1QHDA 2XJQA 4YG0A 3FHIB 3VD7A 3B40A 4ZU5A 2VVDA 2R70A 1C5IA 2EBOA 3FB6C 1NKDA 4N43C 3ZKUA 4UCRA 2IVIB 1WCQA 3ZBHA 3SEEA 3K79A 1BT8A 4LFAO 3UNPA 4JGZB 5LA9A 3NKTA 1YJLA 3ACLA 5DECA 1H2KA 2WZR1 5L7OB 3VBOC 4XTPA 1ND3C 1JZ3A 4JF3A 1G86A 1DYKA 1F31A 1PX4A 2PYJA 3OE7G 4IW3A 4DV5B 2DOSA 2QSAA 2ZM6B 4GWJA 2UXCB 3THTA 2ZHMA 5DABA 1K5MA 1OH4A 4IQPA 4NXNO 4XUPA 1HB4A 4MGYE 2QQIA 3Q8AA 2FDJA 3U0ZA 5IJ0B 1F4NA 1ZAUA 3Q4HB 4I3PA 1VMHA 5J2TA 3ABKB 4OI4A 1Y4WA 1VQ9V 1KYOF 4B7KA 3GALA 3FE5A 2Y64A 4WM7C 4TN7A 3D3AA 1Q8VA 4YW1A 4AHZA 1RFYA 2W52A 4HKOA 3KGLA 4N9IA 4KU7A 2JDZA 2ZE6A 5KA6A 4AEDC 5JXHA 1MS5A 1FYJA 5B4XA 3DXRB 1BMV2 4YPJA 2N74A 5JXIA 3HKCA 4HK9A 2VOWA 3ES4A 3ZYRA 2WLLA 1UY3A 1W3XA 5IVBA 4BPZA 5A7NA 3K58A 2OA2A 5GZFA 4JYCA 1NH2D 2VZVA 3RZZA 5HCFA 2QWRB 3WNKA 4JDOA 3LUTB 3V65A 2WZR2 4FOVA 1GN2A 1IXMA 4SLIA 5DG2A 4CC5A 3JQWA 2ZNIA 4HNAA 5CFCC 2G9ZA 1ZZ6A 3RYHB 2IWGB 2I2SA 5HFMA 1XYOA 3JD3A 5FP3A 3K9SA 3KVAA 1MEC2 4XAAA 5BNOC 2YROA 2YXYA 1K5MB 2ZGRA 4E4DX 1O4YA 1KJRA 2OQ6A 1SQPH 4Q0SA 2HWB2 4OUMA 3JALA 1NA1C 1FT9A 1K4DC 5LBEA 4JDMA 4WFEA 3BKZA 1W9YA 4AFBA 2ZHNA 1TNFA 1PVC3 4JVAA 3CSXA 5CADA 3KV9A 1QJFA 2TUNA 5G05L 2R6QA 2YHJA 4WM8A 3LDKA 1XNKA 5EQUA 1IDSA 4Q4Y1 1D7PM 2Y6GA 1PM7A 4DR6O 1DIWA 2CDOA 3V56A 2HR3A 3VD5A 4Q8KA 1J5EB 3FMGA 4QX8A 4K21A 3CRQA 4Q0VA 3WG1A 1RUG1 3JCIA 2LS6A 3O1MA 5BNNB 2WLLB 2YMZA 1QJX1 1BCXA 4BXSV 5AVPA 5APAA 4QNHB 5F37A 4NR1A 2ITDC 4XFFA 3OPZA 4UFJA 1SBDA 1VQ4V 3IZOA 2ZINA 5JI9A 4YZ3A 1KRIA 4FOQA 3CXHF 1W04A 2B7YA 3G6JB 4HNAB 2VNVA 4CZZA 2Y4TA 3WLUA 4KP4A 4D7SA 1QF3A 5A3MA 2C2AA 4LEJA 2ZCEA 4RL7A 4DIQA 1LUVA 3ZXAC 1UY4A 5F2SA 3J7HA 1CQ9A 4K0KO 3FAVA 2XVLA 4TV9B 3B00A 3JBG1 4Y20A 4A7YA 4PDVA 3TGUH 4MTFA 2RM23 5FZHA 4IERA 1VR3A 1K5QA 4XFIA 3ZFEC 3LFMA 5AFBA 1NY71 1NXMA 1W8HA 2LTNA 1P8JA 2X8KA 4WM8B 5T5OA 1AL0G 3NNFA 1M56C 1OA3A 3CJHB 2XB6C 1THZA 2VW0A 1N4CA 3CCMV 1ZBE1 1VBC2 1SKVA 2E3CA 5I8SA 1LGCA 5M0TA 1VAKA 4B4PA 3A7QA 1MVQA 3IWZA 1XYNA 1W6PA 4LK6A 1MS3A 1PMJX 2D98A 1GLHA 3WT3A 5AG2A 5IWAB 3KQ4B 3LDRA 3MPBA 5GLTA 1AX1A 2PYTA 3O0WA 3PJSK 4PA4A 1YJKA 3L74H 3B01A 2NM1A 1KEXA 3JB8A 4AILC 2RJKA 2CGNA 4GMP1 1WAZA 2DCZA 4CP9B 3IGAC 3O1OA 2VQFO 1GOHA 4DK1A 2D43A 3TXSA 1TEIA 1OF3A 4Y20B 3ZFFB 1G9DA 1HWYA 3E22A 5EZWA 2CH7B 4CCCA 1WZXA 1HP8A 4AI1A 4TTGA 4K6BA 2P3JA 3E97A 3H8UA 3QACA 5FYUA 3VKFC 1CXZB 1BEV1 3P30A 4K35A 1HV0A 1JZ6A 4AHXA 4B1MA 4GCZA 4A42A 1ZBE2 5LEKA 4HLTA 3POIA 3S3WA 1BHBA 1G9CA 3UQ8A 2JS3A 3DF0A 4CCEA 4DR5B 2RS13 4M0HA 2VCCA 2ZR3A 1QLEB 5J36A 5DDJ1 5FCCA 5FYCA 3AXEA 2JVDA 3RZMA 5KX5A 1W6PB 1S1AA 1UU5A 1W3VA 4X1KB 1T5EA 3AL6A 4EEQA 1W9WA 2QE3A 2LGWA 2DQ0A 3HQXA 2Z4FA 1XRUA 1JBCA 1AXZA 5JUVA 1L0NH 2W94A 4UV8A 5FY9A 3K0GA 3ASIA 4YRDA 4DV3B 5LOVA 2WSVA 5BNPC 4MSVA 1D4M3 2NZ9A 3MUZ1 4OXSA 3HKEA 2LO1A 2X5IB 3K48A 2CTRA 2GNBA 3WEZA 5FXZA 1YLLA 1BBT1 2B42B 2ZPXA 1RUI3 2P22C 3E22B 4CH4A 2WA4A 2D7FA 3TYJA 4Y1VA 1AR83 1I3HA 4XFGA 2R49A 4TSVA 2EICA 1Y7BA 5FOJB 2GN7A 3RT3C 3WF1A 3C3VA 3A22A 2R073 2FDFA 4XMAA 1YF2A 3T1HB 2FQPA 3NAPC 2CK3G 1RM1C 2EJ7A 2F1MA 4OZXA 4BE3A 1NR1A 3MBWA 3CP1A 1IXBA 1ZNPA 5A7SA 4NE9A 4G28B 2DUOA 2WNUC 3E5XA 3C7OA 3IKWA 4ITCA 3LA2A 2PGGA 3CE2A 1YZBA 2GTAA 5K1PA 1R1A1 2GV9A 2N04A 2LP7A 5F39A 2O57A 4DMIA 4XEZA 1PO22 3TJTA 5DUUA 4CH5A 3W21A 3IBMA 1VQ5V 3NV3A 1VBB2 4XAEA 4J80A 1F4AA 4D69A 3FKSG 2AGSA 4QHOA 4ZKIA 4OX9B 5LOVB 1IQDC 3MI8A 4YG3A 1RUF3 3LPFA 5LRSA 1LESA 3ZMNA 4EROA 1V55B 3B02A 1RUE2 1MR5A 1K7DA 1K3IA 4UVCA 1YVWA 5JR2A 3JATA 3JD72 4DV2O 1GNZA 4X6QB 1AR61 2OKXA 4FLUA 3VBFA 4ZI7A 3KT7A 4FLTA 3JAWA 5A7PA 4V2WA 4ES8A 4IEUA 4XFCA 2XPJA 5I0TA 1UOFA 2VRZA 4XMIA 2A6YA 2BGOA 2PAKA 3E83A 3SXWA 4B4RA 4AVCA 1NT2B 4I30A 5FP9A 1OPMA 1WN7A 1BKZA 3O9OA 1W8TA 4QT6A 4DUYB 3BAAA 2DE0X 1R082 3B7MA 3S5QA 2W92A 3AP9A 2BSKB 1XBLA 1FI2A 2JECA 4IEQA 3ILRA 2GMMA 3WY6A 5A2QN 2C9AA 4LHNA 1Y9QA 1ZRDA 4YZ2A 4XW3A 2DYCA 1HDJA 3AXDA 2LM3A 3PN1A 3KKYA 5C70A 2ZMLA 3MIHA 3QTCA 3HPNA 1CWPA 1RUJ2 3BVCA 4F6EA 3JATB 1S0JA 3LPGA 1GN3A 4DV4O 2ID4A 4BQWA 2Y69B 3VBFB 2AC1A 4CS2A 3GCXA 1LGNA 1NH2B 1NX9A 2DYSC 1UMHA 3PTYA 3K5NA 1VBE1 3PTRB 4KU8A 3JAWB 5FREA 1Q7YW 4YARA 5H9CA 1GV9A 3CX5F 1KP2A 1GZTA 3J8F1 5HI0A 4E8CA 4LK7A 2WQZC 3LKJA 5JSPA 1V9U2 4FM1A 1XNQO 2BGCA 3NR7A 4GULA 1XNCA 4META 4FZ0A 2L35A 3MDPA 4YVWA 1LUWA 5EJ3A 2WAOA 4D6SA 1QIQA 4LF4B 1POV3 2WINB 3VD9A 4Q1PA 4BHPA 4GWNA 2ARCA 2QQVA 4ZHNA 4AAXA 1N32O 5EIYB 2Q8EA 4BISA 2HWF1 2JB8A 1X9PA 2FDHA 4OPHA 3OEEG 4NIIA 5J9PC 4L9BA 5JOZA 5D1IA 3U37A 1OCOB 1Q3EA 2A06H 4CXWA 2RS33 5B4NA 5FZEA 4FMTA 2WN2A 4YZ4A 1HR0B 4GWIA 3BYWA 4XF1A 1I9RA 1B3QA 3C90A 5L3GA 5ABJA 3EMRA 4QDQA 3I5DA 4LIVA 1NTMH 2IXIA 1IKPA 3H42B 2H6CA 5CIRA 4ONUA 3F2ZA 2ODMA 1JZ2A 1NCQA 3J8F2 1VF5B 1VBD2 2A79B 4QKBA 4QPWA 1V6OA 3WU2Z 1WW7A 4KH9A 1XL4A 4INDA 2QUOA 3STZC 3IAYA 3CJIA 3VL9A 1SQBH 2RS51 1OMIA 1SESA 2YIAA 3NNLA 3DN7A 2Q0AA 3N9QA 1UX6A 1W90A 4YVWB 5CBGA 5KBFA 5EBMC 2WBKA 3FJSA 1C5HA 2NLJC 1CIWA 3ZIXA 1SQVH 4HONA 2EIKC 4X62O 1PGSA 1O8SA 5JVDA 2E7TA 1DF5A 4DR1B 4MGKE 3SYPA 1EV11 5D5QA 1H1IA 3EBRA 4U3JB 3WCSA 1W2OA 3H50A 1SPPA 2DV9A 1V0AA 4MO3M 2QKSA 1VMFA 2Y60A 4HL0A 2E9QA 2P17A 2EXJA 2JG8B 1QJU1 4Y5TA 1CD3G 4N90A 2ZE8A 1WA8B 1HW7A 2FKXA 4XUQA 4ES9A 5CA6A 5ABJB 2QQKA 5BY5A 1L0LH 5LBCA 4Y3OA 5LK5A 5FYIA 2W39A 3K5OA 3NKGA 4JI3B 4XDLA 2UU9B 1IS5A 5F3CA 1AVBA 1NCQB 5D21A 1G9AA 1NTZH 1C3HA 1H6XA 1NUKA 2VTFA 1M57C 4PI0A 4CCKA 3BIEA 4UBGA 4XFHA 2R7EB 4Y33A 4AQTA 2XWBB 3AG4B 3W7WA 4JYBA 2E5LO 1YDXA 4DZGA 3U4SA 5BUVA 1GOFA 2J7MA 2JXAA 1MS1A 5HFLA 4XBFA 2Q7HA 2X05A 3R4SA 1CIYA 4XDQA 1M5IA 1U5ZA 4WVVA 1V6JA 3DC5A 1SFNA 2A1XA 1O6UA 2WWSA 4H7MA 5A1LA 1N33O 4DV1B 2VBBA 1YI9A 5DUWA 1GP4A 3R66A 5L19A 3T2MA 1ZREA 2Q5ZA 1ZTEA 4CDQC 4JKMA 4YFWA 3Q9OA 1PGW1 4OFGA 4JYAO 1W05A 4LHKA 3CO2A 1VBA2 3JD2A 2C9KA 1A8DA 4W4ZA 2BFUL 3ES1A 4RHV3 2XBO1 2YV8A 2WT2A 4FPKA 3AKPA 1QJU2 2QWOB 2GH8A 3LDBA 3D3IA 3OT7A 4CH6A 2VMIA 5FY5A 1CX4A 3FFQA 5B1AB 3POWA 5IYCO 1ONAA 4RSUA 3OSDA 1I5PA 2W0FC 2GBOA 2Q68A 4COWA 3HQRA 2QTSA 5EZYA 4QX5A 1UPIA 1I0HA 4JI5O 4P9LA 5C8WA 3CCSV 1ZVFA 1ZX3A 3SITA 3I2JA 3VL8A 4JI7B 1KD1W 1N47A 3VBRA 3RW0A 2PF4E 1SLLA 1OQ1A 4QPJA 4QPIC 5KAIZ 5KLVH 1IBMB 2AZ5A 3ZLIA 1LENA 4LO5B 1L3JA 2ZIMA 1H4GA 2CTQA 2YIBD 2WFF3 5FK7A 1VQPV 4AG4A 4Y26A 1JODA 2DURA 5E79Z 3WHTA 1XPWA 4XDPA 5JJNB 1HX6A 1NJIW 2PLV3 3X2QB 2W68A 3HT1A 2FDKA 5E89A 4HPKA 1ZZBA 4IYHA 4ZOLB 4CE8A 2JG9A 1HV1A 5AC91 3LNNA 4LO4B 1RUOA 2NNUA 3N2KA 2DCTA 4P14A 1XMOO 4JV5B 3HNMA 2P1BA 2ZBJA 3SPHA 1JJ2U 5BZBA 5CA1A 1BVVA 3I97A 4MVTA 2W47A 2FCUA 3ZXFA 2FB5A 4O2AA 1QVFU 5FQ0B 4ZKTB 3NJYA 4R9AA 4MHUA 5LWBA 4P9JA 3KD4A 1PO11 3T1LA 4A3ZA 5CYYA 3GB7C 1CPNA 3C7HA 2UUAB 3SJAC 5FY7A 4W4LA 2VZRA 4FPJA 1AF9A 1RPOA 1CAUB 5DAQA 3MW4A 3WW3A 2IXCA 1HNZO 4ZU4A 1RINA 1P7BA 1ASJ2 4GAZA 4YVSB 5JCOA 5IVFA 1R3JC 1XMQB 2QKAA 3BPZA 5F6LB 4LWSA 3G4SV 5A7WB 1TG7A 3N7LA 3ZYBA 3F95A 3B94A 3GZEA 4DPNA 4QGPA 1LOCA 4PLNA 2WZR3 2JG9B 4N53C 3AK2A 1ZWIC 2UWAA 4IEZA 5KMGA 3MHSC 5EIBC 1EBOA 1RVF1 5GZGA 2I74A 2RDSA 2A73B 5F2VO 1EN6A 2FCVA 3L73H 3SJQC 2Q7GA 1MEC3 5J1XA 5FZBA 5JZGA 5C4WB 3KM5A 5CA1B 2EIBA 1CGPA 4DV7O 5LMUO 3H1LH 4FLXA 5FMBA 3WR0A 2HWB3 3N9OA 4QPGB 4DRXA 5FZIA 1YYNA 1DGLA 2VULA 4PI2A 3ZRWA 4QMAA 2R062 3V0BA 1W8OA 1QNMA 1NQJA 3RQ0A 1OSGA 2BUKA 4CCOA 4AQYB 3LA3A 3CD6V 2EXIA 4AQ6A 4Q0PA 1W2NA 5J37A 1PZ8A 1Q43A 4FLWA 1DTOA 4E8DA 3BALA 1GM7A 2E32A 1UPSA 3STLC 2XJPA 3OPWA 3SH3A 3CZJA 2BZDA 4X66O 2GDFA 4L97A 4Q4V1 4K8XA 1RUNA 2P34A 2L6LA 4KG8A 4NHYA 5B1NA 5SV8A 2QCSB 3ZMVA 2Z79A 3W9AA 3B5LB 5I0RA 2JGDA 3C2UA 1ULDA 1SF9A 4BW5A 3IAQA 3OMAB 4HANA 4CEYC 2XXZA 4QXKA 4B29A 5KMGB 1EAH1 1PM4A 3SNMA 1V6NA 5AVAA 2VS0A 2LFRA 2P7TC 3ROUA 2R9AA 3P1IA 1GQPA 1KDKA 5FLHA 3ZYGA 2JK5C 5A3WA 5H9RA 2MEV2 1JUHA 1FFXA 1O5LA 3ZXDA 1VF6A 1HRI1 3RYPA 3CMGA 4IGPA 4FI9A 1UIKA 5KC5A 2XAQA 5JR7B 1UZ0A 3K57A 4FPFA 1AL22 2PI5A 3V0BB 3G71V 1GYKA 1JX9A 1CAVA 1U5XA 3QVNA 2XJSA 3G67A 3S7IA 1ZZ7A 2K46A 1S0DA 3MDSA 2YSUB 3AMPA 1C8M1 3T0DA 4GH4A 1DU3D 4JV4A 3MYXA 4N43B 1ULPA 2WSUA 4B3RB 2BTOA 1K8AW 1ODMA 5KHJA 1VBC3 3VN4A 4D7TA 2ADDA 2JKBA 2P67A 4PELA 1JXNA 5T3NA 2UWBA 3ENRA 1IURA 2BP6A 4LCUC 3SKJE 4ZS3A 4C7UA 1ND3B 5HXVA 4NXMB 1PK6A 2P4VA 1X8EA 2GC0A 3DEMA 4H55A 2JGDB 4XJUA 5FZFA 1OC1A 5DQ0A 4LQRA 3AYCA 5LBQA 2PUSA 4HFSA 1IS6A 4GYCB 3AVSA 4TUYA 2JJ1G 4FPLA 5FIXA 3S3XA 4YW2A 4MVMA 4FLVA 2XASA 1K5MC 3ZYIB 3UKTA 3DGTA 5CA0A 3DC6A 1NG0A 1DGWX 3DPRA 1XNRB 4ABMA 1H8TA 1JHJA 1VRH2 1WBLA 3UETA 3A0KA 5H9PA 1OXCA 2QJ1A 3MAQA 4UCTA 1UOJA 4YLZA 2QZ3A 2R042 1CAVB 3O7OA 4M4PA 4XIKA 2IJKA 4MW3A 4MG2A 4AEDB 4ZXEA 2O8QA 1DQ1A 3AKSA 2A6VA 1ZBE3 1QR8A 3AMHA 4QKNA 5BR8B 2OTJV 2F4VO 4IV3A 2B46X 1W2UA 5LA6A 4QU2A 1LCLA 4DXTA 3OBZA 1W6OA 2ETEA 2IM9A 3MIDA 1JU3A 5LGUA 3HN3A 1SACA 1JHNA 4ZXKA 1FAFA 3WFVA 2CTWA 2B1GA 3LSUA 1PK6B 1WBFA 2JB4A 1WLEA 2VY0A 1GR3A 2JD9A 4LFAB 2J1SA 1P4RA 1AR92 3B9IA 4JTOA 5C8CA 1PP9H 2ZR2A 2W1SA 4AEMA 4QGMA 2Y4UA 5GZCA 1WW5A 1AUYA 2F17A 4TUYB 2GN3A 3FN9A 1R3LC 5FXVA 5JMOA 4BK5A 4XJ8A 3CRAA 3VZOA 1OH3A 5GALA 1AJOA 1NA1B 3N9PA 4B3MO 1NZCA 1GKFA 3THOA 3TEXA 3OR6C 4RWUA 1W0JG 1W2BU 1SETA 1JU4A 2Z5UA 2YIBA 3SISA 5CA0B 1HB2A 5JCTA 3AP7A 3FX7A 1H8TB 1ZRRA 1CAXA 3KVBA 4LUKA 4QAWA 3VQXA 4XUOA 5JXGA 2RR11 4WM8C 1LHUA 4DK0A 1E57A 4LFBB 3OUIA 4D7YA 1DDLA 2XKOA 2ZKLA 1MNGA 1NT0A 4KWUA 1IZ3A 2KXLA 4FFBA 4IV3B 5LA6B 5IFTA 3JCUZ 2NPIA 1PIV2 2XAJA 1JPXA 2ZJCA 1OOPA 2WYFA 5CISA 3ZN1A 2RJ2A 1W0PA 1MA1A 2BPA2 1T6GC 5D8AA 5JQGA 4OI2A 2WIIB 4MGIE 5C8CB 3BU0A 3BODA 1V9PA 1PO23 5ANQA 1E5RA 3PUHA 1VAVA 1FMD1 4K7JA 4KHPO 1VBB3 4I0AA 4Q2FA 3K5LA 3NL1A 3ZMZA 2Y38A 4OHYA 3ZEDA 2GNMA 4YJ2A 4GIQA 4HN0A 1PVC1 4UFIA 2KKWA 2VMEA 4GKJB 4K1ZA 4NIHA 3ZFEB 2JKXA 1RSOA 1KXGA 4CU8A 1FPN2 1RUE3 1FS0G 1HDKA 2X09A 4XF4A 4JI0O 2DVBA 1DQ0A 3JD73 3FUQA 3OD0A 1CAXB 5IYZB 1M56B 2RR12 2WLHA 1O4ZA 4CZSA 2BDRA 4DR2O 4XJAA 3WX5A 3F7YC 2ADQB 3ZS8C 1K12A 2PXJA 3CHXA 1OPOA 5K0UA 3CCJV 4BLJA 3VHOA 1J3PA 2V09A 3C7GA 3JQXA 1NZ6A 2YBPA 4DR6B 2Y6HA 3T2OA 5JI7A 1VF7A 5JLVA 1QLEC 3VQVA 1GMMA 3WDYA 4YHHO 2QWPB 1CAWB 5FPLA 3IIAA 2EAAA 4AFMA 3WP5A 2YZ4A 2Y34A 2ZAAA 3MICA 4P9OA 1GTOA 5FPZA 4ZY9A 1F5FA 1OOPB 3I54A 2ARBA 1YQCA 1OVSA 1ULEA 3JAKA 3U1XA 5D8AB 5JQGB 1R083 4DR7O 1H8EG 4B3TO 1FMD2 2GAUA 1LJ7A 5E8AA 5IK7A 1K73W 3ILNA 3MIBA 5GLUA 1E79G 1ZSPA 3POYA 1SCSA 1UD1A 1YNAA 4NMIA 5GZDA 3VQYA 2RM21 2Y6FA 2B9VA 4JGYA 4QGNA 4K0KB 4CU6A 4RGGA 1RSOB 3FHAA 3BRCA 4DQAA 2FHRA 3HBKA 1AJNA 1RUJ3 4LORA 1SCRA 4B3SO 4FQ4A 3AZZA 3H9AA 3AYEA 4UF0B 1NKGA 3J7NA 3VD3A 2ZKOA 5GONA 5FZDA 1S0IA 3B9CA 5K0UB 3DV8A 2GDSA 4YY3O 4DO2A 1XE0A 2WNUA 4Z1VA 1BJQA 3RYCB 3CS5A 3PNAA 4NRQA 1GICA 3ZSLA 4JYYA 4EZHA 1V9U3 1GSLA 3VZJA 4LO8A 4XF0A 1G9BA 4UFZA 2EILB 1FJGO 1UMIA 1X50A 4RYDA 3UJQA 5DN6G 2D6PA 5FZOA 4BWOA 3VDDA 3PVBB 3VKNA 3CCEV 3MHZA 4YM1A 3LCPA 2VUCA 1K5JA 5IATA 2P4EA 3OGRA 3W7XA 2Y6LA 1H1AA 3OGVA 2ZZJA 4AVTA 1Q86W 3PIGA 3WB1A 1XB9A 1J83A 2VQFB 5BNQA 1V55C 4KXRA 4M3CB 3CJXA 2AEYA 4JGYB 5ANNA 1AYM2 5JAXA 4Z82A 1TNRA 3UESA 3OD4A 3N9MA 3FC0A 3SH5A 4B4QA 3SJBC 1DZRA 4ARYA 1FXKA 4QKDA 4A6OA 5FYHA 5IHRA 4YWAA 2IJIA 5GZEA 1UNBA 3KMHA 1G1XB 5FZ4A 3JYCA 1RM1B 2RS11 4SBVA 3A2FA 4BYYA 3AP6A 3J8F3 3P3NA 1VBD3 2P6HA 4X65O 2EA7A 4CXYA 3VZLA 2WNUB 2EULA 1DCSA 2TNFA 5FPXA 2I45A 4L99A 1OVPA 1AILA 5CFDA 4FP3A 2QBXA 3K3NA 1Q8QA 5IWFA 2B9UA 4XPVA 3OGIB 4UCOA 2V72A 3O1VA 1Z5WA 4W6WA 3AC0A 3QH7A 5FZOB 1DF0A 3VDDB 1EY2A 5C9AC 3A0HZ 4MOAA 1KKDA 4M4RA 2HVJC 4X1YB 3CNAA 2J42A 2X10A 1DGRN 2FZ1A 4HMZA 3CYOA 3AG7A 3RGBA 4O65A 2Y48A 1D4M1 5CBFA 2XG3A 1S0FA 5K4LA 4YJ3A 2FDGA 1J58A 5FO7B 3I4IA 2GP3A 1AZDA 4YM0A 4OHXA 3MGUA 1AR81 2OCHA 5CA3A 3ETQA 3PVOA 3O1PA 1ORQC 3T09A 1I6XA 5EIBD 4HG6B 4IESA 1FXKB 2VMGA 4KWJA 2R071 3VBFC 2NP0A 3MLJA 3A0RA 3RSJA 2CWMA 3A0BZ 4R4ZA 4BQYA 5HCAA 1W2TA 2V73A 3HOBA 4LOTA 5JPMB 4I50B 2YUEA 2GALA 4HVOA 4PIZA 4OCTA 4BIUA 5KHHA 4HETA 3OY8B 4K8ZA 3KQRA 3TEZA 5F5QA 2VCAA 5BMVB 1GKBA 4X6RB 1ZYBA 2J1RA 4MGQA 1PM9A 2VZ3A 3F7VC 2F4LA 3ZHSA 4LT5A 1LEMA 2WS92 1RUH2 4A7KA 2WZ8A 4LO6B 1SZTA 2DFCA 3I49A 1R64A 1RUF1 2BOJA 2D3RA 3LOIA 2XHKA 2YGLA 2DBIA 5LA1A 1KJLA 4MX3A 1BSMA 2WLKA 1VBA3 1CZTA 1R091 4AFAA 1KQRA 4AZZA 1OCOC 1ULFA 1ENVA 1COV2 3JAMN 1BK0A 1QJU3 4J7KA 5DAPA 3FB7C 5GW7A 3ACGA 3I3EA 1TVGA 2JX9A 1M1KW 5C71A 4DV2B 4YGEA 1HKDA 2JDKA 4D0QA 2FDIA 3GBFA 5L3FA 3FLPA 1REFA 2IBZH 1PKXA 2Q8DA 1SS3A 2E31A 4K3AA 4DV6B 1Q8IA 2VZUA 3ZN6A 4R9BA 5DUVA 2BBVA 4YG6A 4EN7B 4U7OA 4JTNA 2ZX2A 3WNXA 2VQUA 3NJZA 1IQAA 3ZSMA 3K08A 1TZOA 2VZSA 2PA7A 2B8MA 2UXNA 1QBZA 3GZTB 3I8TA 4YVWC 4UBHA 4NO4A 3KHCA 2Q7EA 3GBWA 3RWNA 3LDCA 3OUJA 4Q5OA 1W8ZA 4MHRA 1FAYA 4FOWA 4AFCA 4AYUA 4RD7A 2PELA 1NBMG 1F8VA 2CU5A 2GH2A 3UYJA 1DLCA 3MD0A 1R092 1QJZA 3RBZA 1KFUL 1ZRIA 4ZONA 1SBEA 1H9PA 4HN1A 2LGQA 2EZPA 3LEMA 5FMDA 4CP0A 1VQKV 3KLSA 3BVOA 4CDXA 2G19A 2QVSB 1REDA 1B04A 4B7EA 5IAXA 3I2IA 4GD4A 1BLZA 1WCUA 1CJPA 4JAVA 1HXS1 5ABJC 4ZS2A 2VMHA 4DV4B 4XXPA 4TLGA 2XTAA 4M01A 3WZ1A 1K45A 5LYJA 1NCQC 1NLQA 2ZCWA 3MV01 4KFMA 1H6YA 1S4CA 1AYN2 5FMCA 5CKMA 3CJIC 3AG4C 3L9JT 4AE2A 2QTWB 4DV5O 1POV1 3MEPA 2B39A 2ZM6O 2PAMA 1XNQB 2UXCO 1U97A 5F5AA 5EYPA 1JTZX 4RFT0 3PMEA 3UKVA 1ASJ3 3M3IA 2GSYA 1B06A 4XCBA 3K75B 4COZA 5IVVA 2VXJA 1GFF2 3DXUA 2GUZA 3FLTA 1XL6A 2XNDG 2WL1A 2YS8A 3CMAV 3OGCC 2FMYA 4LR4A 1N32B 4UV9A 1VRBA 1VQLV 2RS31 1RHI2 2ZA9A 2PQQA 5LHGA 1GU3A 2LQTA 5FKBA 4LH7A 2R32A 1QWRA 4QKFA 3N36A 1OLMA 5D5PA 1JYNA 3L2YA 4CDXB 3IMMA 2A6ZA 5K1XA 2OWOA 1OLME 3H3UA 1JYIA 5FZ9A 1HXS2 3B69A 5B1AC 2DYRB 3ACFA 2BBAA 4CU9A 1N36O 1IKQA 4XBNA 1RJ7A 3J80N 1C1FA 1N34O 1Q8SA 3RDIA 1AXKA 3LE0A 1RMU1 3WF4A 1VP6A 2Q69A 1K97A 4MXVA 1XU2A 4UT5A 4U2AA 4UVBA 3I7DA 5LYJB 5EHDA 1BZWA 1WW4A 2JIJA 1UY0A 3WNLA 1JYXA 2ZEXA 4O4HA 1ZRCA 5GJ6A 2Y8KA 3HKDA 2R063 2PI4A 4D94A 4GKYA 4NN0A 1JOYA 3FZ3A 4NYKA 4OMCA 2X6BA 4WVMA 2QQPA 4I9WA 4C1XA 4S2FA 3ZPOA 1GM9A 4KL1A 2BERA 1GWLA 5L73A 4XIOA 3M3OA 1GN4A 3CBNA 4PBPA 4QE7A 1GBGA 1SZXA 3OB8A 2CAUA 5EYPB 1JMKC 4NB5A 2A6XA 4LKEA 3RMYA 3NRUA 4LKFA 1ZA4A 4TQDA 3DUIA 3SHRA 2HYKA 1UZVA 3PJYA 2GUZB 4OHZA 1ZL8A 4X62B 1PVXA 4UVAA 3H3LA 3E6CC 3MW2A 2VTXJ 1BQ0A 2ORZA 1OT5A 3K59A 4QX2A 3J7LA 3DKWA 1WD3A 4AVSA 4GKKO 3W58A 4GMP0 4PDLA 1HNXO 1UOGA 1W8WA 2YFZA 2VQEB 4XILA 1MACA 2F66C 2IW5A 2VAUA 3F5WC 4EWAA 4XE9A 3VKOA 5JJEB 1I7FA 1ZLZA 3J26N 3VDBA 2XL7A 2PZSA 1DG6A 4FVMA 1RMU2 3N9NA 2UXDO 2MEV3 3S6PA 1RYYA 4QXCA 4QPIB 2YUAA 3MV11 3VKMA 4LF6O 3ZRSA 2HEWF 2YI9A 4F4LA 2D5FA 3EHKA 1UCXA 2ZZQA 3VBRC 4O4HB 5JSRA 5CB4A 1AL23 4NHMA 3HKDB 5IJ9A 4MVZA 3N4MA 1W0KG 3P5BA 5GTIZ 1V6LA 4LIUA 4WVMB 1DLBA 5FYTA 5A9GA 2V4VA 2ZEZA 4UFHA 1X33A 2E5LB 3LGRA 3AKRA 4HSLA 3H9VA 3HR9A 5FMOL 2CNAA 4MTOA 3CU7A 4LHLA 4ARXA 2BV4A 1H4HA 2H94A 4HKWA 4XACA 3L9DA 1AR72 3FD9A 5B1BC 3GXUA 4CA9A 1ZL8B 1Y43B 3RRDA 1S0GA 5FTTC 5C33A 5J2UB 3RPQA 3B77A 3E6DA 4MTGA 4QDRA 1UL9A 2JG9C 5ACA2 5FZ6A 4JYAB 2XAFA 4O4LB 2WLMA 1XNAA 3PL0A 1VARA 1GNHA 3ZMSA 1URFA 2CSGA 3HB3B 1SQGA 1W8UA 4HYOA 2OX0A 2GNTA 2C0ZA 2GU9A 4XBLA 1QJY1 4F8AA 4DXWA 4QB6A 1K5SA 1SEFA 3OF1A 1G6NA 2ENRA 3TN92 2JDIG 3C8XA 3M3CA 4Q4W1 4HBNA 4JKLA 4CSWA 1SLBA 5CU1A 4HAMA 3SPJA 1HJFA 5CZKA 2HKOA 4K9SA 3H1JH 2GSMB 4Z1MG 1LB2A 4JI5B 1VRH3 5LHHA 4Z92B 3WNPA 4J7ZA 3KHBA 5IE9A 2ET7A 4LTAA 5CB4B 2K2SA 4P30A 3ZN0A 3H8RA 3OUFA 2RDRA 3UM7A 2R043 2JDHA 5IY5B 4XOGA 1TME2 3VZMA 2A7WA 1DHKB 3ZYPA 3PURA 2WAMA 4FK5C 4E2GA 1CN1A 4LBLA 4CCNA 4JAAA 5JVVA 5JCOC 1KMIZ 1TMF2 5FZMA 1US3A 2DMXA 2OIGA 4YNIA 3ZFGA 1VE0A 4RUEA 4EN9B 3BU7A 3L75H 1YJWV 3MUY1 4E2SA 3LAGA 1OF4A 3I59A 3NV4A 1LHNA 2AACA 1YRZA 1H2MA 2W0XA 1T6BX 4EWDA 1AR93 1ZZCA 4K20A 2PMWB 2ORXA 3T2PA 5FO9B 2LW7A 3EFFK 2E7AA 5FK8A 2ZX4A 1QJY2 5K8SA 5JZGC 5CN0A 4Q4W2 1JUIA 4AI9A 1S76D 1VB4A 2XONA 3WUCA 2CAZC 2G1MA 5FXXA 2W95A 4BIOA 3FBYA 4TOIA 5JH7A 3TBDA 1IBKO 2EIEA 2EZOA 4MZUA 3ZHVA 1KD7A 2ZMNA 3L71H 3GF6A 4NHKA 1LAJA 4YW7A 4E4EA 1ND2A 2NMNA 1IGOA 4QPKA 2WQ8A 5F3EA 1BMV1 2WN3A 5A7QA 3RI9A 1HRV1 4OQ9A 5C3PA 4RQPA 2BVBA 4YFZA 4DEQA 4KNCA 2EINB 1DQ6A 4OULA 3POJA 3RS6A 3RNSA 3NSTA 3NV1A 1HNWO 3ZFGB 1PIV3 4WZCA 1WD4A 4CEYB 3E8FA 1QQCA 4IEPA 1IS4A 5F9TA 4TV8A 2X7RB 1MEC1 4UYBA 3E5UA 4Y4RA 1VQMV 5IJRA 1DK1A 2LW8A 1R6TA 2JJ2G 4GZ9A 2ZHKA 1O9HA 3T1HO 2XLGA 1Q6IA 1H8VA 1H9WA 2HWB1 3SR2C 3VBHA 1WMEA 1P49A 3JSNA 2CL2A 2VZPA 3FWEA 4L8QA 4XJZA 4EKWA 1NE6A 1JCHA 1P84F 1VF6C 1XSRA 4DV7B 5LMUB 1A6CA 1X36A 1FPN3 4UB6Z 1JA8A 4GLXA 3Q8CA 4H3WA 2AEZA 1TUBA 1AVMA 2H8PC 4Y1ZA 4X20A 2XQRA 4W6XA 2E6VA 2RR13 1REEA 4MGZE 2QM7A 3IFXA 2W1WA 1DYPA 4MH0E 2Z5WA 1Y6XA 3ZSKA 4GWMA 1GQHA 4GH4C 1HRV2 1ND2B 4UW4A 3UJOA 4UFMA 4RQEA 2BCCH 1CX1A 4O4JA 1ROPA 4O61A 3S5AA 3GCWA 1TUEB 4HSJA 2VOKA 3D4KA 1LOFA 1JS9A 4EB6A 1JZ4A 4O9EA 4X66B 1X4TA 4TWKA 2P6CA 4DUVA 4PDWA 1PK6C 1UZYA 3E2EA 5FYBA 3UGGA 1OKOA 3UL2A 2P90A 2BTQA 4CTEA 2B4KA 4TV8B 1OLRA 1GAXA 1RPRA 1FMD3 2ZACA 4R9CA 4DO0A 2ZAHA 3K9AA 4QJFB 3EQEA 4RQFA 3MIGA 1MSDA 3N2GA 3JU9A 5A3LA 4HVQA 1L7RA 3W5NA 2BGPA 3VBHB 3TEWA 1Y4MA 4CS3A 2WZPP 3O12A 5J2TB 5HPOA 3KZIZ 1DBNA 5FKCA 5J48A 3DPRC 2OPKA 1U5IA 2CWSA 1G8MA 5F32A 1H8TC 4I0WB 1H