5KHKA

Hcn2 cnbd in complex with 2-aminopurine riboside-3', 5'-cyclic monophosphate (2-nh2-cpump)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 64
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khkA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khkA02
4I0AA 3RYKA 1DGRA 3DV8A 1J3RA 2PAKA 5KHIA 2BGCA 4LULA 1LR5A 3H1MA 3E5XA 3HT1A 3PLQA 4UBGA 3KSCA 5FLIA 2I45A 3KGZA 4LA3A 1X7NA 5BPXA 1CAWA 2BNOA 4IEZA 4H7LA 5FLJA 2MPFA 1OMIA 5I91A 1SQ4A 2ZCWA 3CEWA 2Y0OA 4ORFA 2GU9A 2PAMA 4BHPA 4XFIA 4F8AA 1FI2A 3H7YA 4Q0VA 2O8QA 4KWJA 4HLTA 3WW4A 1NXMA 4ZU5A 3HT2A 4HMZA 4KL1A 4XFCA 3RPQA 3H9AA 2CV6A 3H3ZA 2VECA 4F7ZA 2IXHA 5I0TA 1YUDA 4JVAA 4Q29A 4A2UA 4WVZA 4FT8A 2H6CA 1DZTA 4UBHA 4K8FA 1ZNPA 3BPZA 2N7GA 3H1YA 5FDBA 3H50A 5JCTA 5I93A 2HKXA 3E97A 2Q4SA 3FFQA 3BALA 2PHDA 3WW2A 1TQ5A 2GH2A 3UKTA 3NVCA 3IDCB 1RTVA 3SHRA 4J1WA 5I8TA 4N9HA 3O14A 2CGPA 2FMYA 4MH0E 4CYDA 1I6XA 4E2QA 1J58A 1I5ZA 1YFWA 1OI6A 3E6DA 2PA7A 2WC2A 4OFGA 4IEVA 3S7EA 3ACLA 2OPKA 5JAXA 3G7DA 1O3RA 1YFUA 3S7IA 1VJ2A 4XF3A 3CL1A 3LA2A 4D7SA 5FPXA 4IESA 4MGKE 3QOPA 4FBFA 3HQXA 4YRDA 4RD7A 2B9UA 2XKPA 2ETEA 4XEZA 1O7FA 3UKNA 2XKOA 2Z2SB 3TNPB 3MDPA 5EFUA 2XLAA 3ES1A 4IEOA 4WZCA 1Y3TA 1ZZ9A 3H7JA 4LA2A 2Q30A 1ZX5A 2IXJA 5JR7B 3SCGA 4AQ6A 1CAXB 4XFHA 4WBBA 5JSOA 2VQAA 3EQEA 2P17A 2ZKLA 4PJYA 1CAUB 5BV6A 1NZCA 4I0BA 2GZWA 2K0GA 1L3JA 1U12A 4XFFA 3R6SA 4IERA 4EWAA 3FX3A 5T3NA 2XHKA 2PTMA 4MGIE 1OFNA 4HN1A 1NYWA 5FPZA 1CAWB 1J3PA 1Q43A 2D5HA 1H1MA 3ROUA 1ZRCA 5KHKA 5C8WA 3H3UA 4QXKA 3MPBA 1Q3EA 3BU7A 5KHHA 4YSFA 3NSTA 3E5QA 3EO6A 4R52A 2XLFA 4YNIA 4E2SA 3IBMA 4XF4A 5E1RA 2XLGA 2BNNA 1CAVB 3MYXA 2ET7A 2IXIA 3LZZA 3SCHA 1RUOA 5I0SA 4HN0A 1ZZ7A 3UKVA 2XL9A 1G6NA 4ONUA 5J48A 5HI0A 1X8MA 2FQPA 1QXRA 1WLTA 5LRRA 4B29A 4LUMA 5I0UA 4XF9A 5FLHA 3ELNA 2V09A 3D0JA 2HJIA 2F4PA 4IEWA 4LLOA 1XRUA 3B02A 1XE7A 1O5LA 4Q0SA 5BXXA 2E9QA 4OLLA 2IXKA 2PYTA 4AQ2A 4AVAA 2GC0A 4EWDA 2XGXA 3HIFA 3I59B 3ST7A 5FCCA 4PIXA 2EAAA 4D7TA 3QACA 3DN7A 4QMAA 2EVXA 4HSJA 4Q0QA 3RDIA 1ZZBA 4HVRA 5C6CA 3I7DA 3C3VA 3RNSA 4PIYA 1WGPA 3LWCA 3NL1A 5JSRA 3E5UA 2BYVE 2D93A 1H1IA 1YLLA 1XE8A 4GULA 5LEKA 5K8SA 2PAEA 1CAUA 2OZJA 1QXJA 4R8HA 1UPIA 1Q5OA 1CX4A 3RYRA 3EJKA 1CAXA 3SCFA 1V70A 4IEQA 4X6RB 4META 3TNQA 2B5HA 1GQGA 5FQ0B 3GBFA 1ZRFA 2QCSB 4NVPA 4MGZE 4LUKA 4XFAA 1PMIA 2UY8A 5CU1A 1FXZA 1YHFA 1VP6A 3LOIA 1O5UA 1HW5A 1LB2A 5E16A 3E6CC 1YFYA 1JUHA 3ES4A 3I59A 5I8SA 4XF0A 5I8YA 4QGLA 3I54A 3IWZA 4X6QB 4XFBA 3OF1A 1J3QA 3PNAA 3U10A 1YFXA 1UD1A 3CLPA 3CO2A 3S0MA 1ZRDA 2QNKA 4QX5A 4ZU7A 5LEJA 4AVBA 3BB6A 1O4TA 2QDRA 5CADA 3FWEA 2DCTA 2IC1A 3D82A 4EWEA 4QGNA 1LRHA 4BYYA 2EA7A 3OD0A 3FJSA 5F1RA 1DZRA 2KXLA 1ZREA 2CAUA 2WFPA 3BCWA 1O3TA 2MHFA 4HZFA 2QJVA 3EBRA 3FE5A 3IDBB 2Q1ZB 4Z07A 5AVPA 1UIJA 3MZHA 4EV0A 3USSA 5J3UA 3SMHA 1EY2A 3EHKA 2ATFA 4HVOA 3WW3A 2GC2A 3OGJA 3H1WA 2GAUA 5KHJA 4HBNA 5EZWA 1ZRRA 3DL3A 5BY5A 4LEJA 4BIFA 3PVBB 4MV2A 1CGPA 2ET1A 2CAVA 4L2NA 2OYZA 4EROA 3FHIB 2BEOA 3OTFA 1SEFA 3RZZA 4PIZA 1ZZ6A 1SFNA 2B8MA 2D5FA 3M3IA 4IEYA 3LA3A 4DINB 3CJXA 2H6BA 4MUVA 5FQ0A 4MGYE 3L2HA 1DGWA 1X8EA 3ETQA 1VR3A 1IPJA 4FAHA 4I3PA 1RGSA 3KGLA 3JZVA 1GQHA 4KWKA 4MX3A 2IXCA 2UYAA 3LA7A 4E2GA 4HVQA 1OD5A 1UIKA 2Z69A 1NE4A 5CVRA 2OA2A 1LKNA 4Q0PA 1EP0A 2MNGA 3U0ZA 1QWRA 2PQQA 4KU8A 4IETA 1ZVFA 2OZ6A 2UYBA 1IPKA 3FZ3A 4J1XA 1RC6A 1RL3A 4YARA 3H8UA 3ZDSA 4JTOA 2PHLA 4ZU4A 4P9GA 3WW1A 2GC1A 1RUNA 5I0RA 1X82A 4QM9A 2BNMA 4I09A 3U11A 3CF6E 4IEPA 4I01A 3KCCA 4O9GA 4N9IA 4Q0UA 1O3SA 4BH9A 1ZZCA 5KBFA 1ZZ8A 3D0SA 2VPVA 4QGMA 4I2OA 5BUVA 2XL7A 5KHGA 1EYBA 4L11A 3VHRA 3RYPA 1J1LA 3NW4A 2D40A 3NKTA 4O9EA 1QY4A 4MZUA 1O3QA 4IEXA 4HSLA 3LAGA 2UY9A 3M70A 3NJZA 2H0VA 1WA4A 4TLFA 4YYOA 1NE6A 1J59A 5LRSA 4FAGA 1PM7A 4AVCA 1UCXA 4LTAA 3GYDA 3OCPA 2IXLA 3N4MA 4KU7A 5J7MA 4Z82A 3E6BA 4XF1A 2PFWA 2QVSB 1CAVA 4XFGA 2Q0AA 4XETA 4I02A 4JV4A 3DKWA 2C0ZA 3KMHA 2GC3A 3IIAA 3SXWA 4IEUA 1YWKA 2K9ZA 4KWLA 1EPZA 4AXOA 5D1IA 5JSPA 1Y9QA 1UW8A 1FT9A 4QM8A 2O1QA 4JTNA 4UXAA
chains in the Genus database with same CATH superfamily
1FFTB 4TSVA 5FRAA 2JDKA 3WX5A 4TLGA 5C8CB 5C8YA 4JQRA 5FY9A 1MNGA 1QJX1 3H8RA 2ZMLA 1R6TA 1G8MA 3KSCA 5A6YA 2VQTA 1K4CC 3J4UH 3AMPA 5A3LA 5FWJA 5FYHA 4IEZA 2RQ6A 4JAVA 2JX9A 2QBXA 1OCCC 5AFEA 1YO8A 1OA4A 3HKBB 4KWJA 3WW4A 1MQTB 1ZRIA 2Y34A 3VL8A 4PDWB 4URTA 3DECA 4QE9A 4DNYA 4B7EA 3ME2A 3VBUC 1BE3H 2H6CA 4QQ2A 4TWTA 5C70A 1AYN2 1GMGA 2NPIA 4O2BB 5FREA 5LA1A 3B00A 3FFQA 3ZKYA 5LZ6A 3WW2A 3JB8A 2SLIA 4FM1A 1AR62 1G1XB 5IJ0A 4NXNO 1I6XA 2IVJA 4E2QA 1W8TA 2EXKA 3ZYFA 4OFGA 1AJKA 1K92A 4YIPA 5FZHA 3M2MA 5JAXA 1IKPA 2WA4A 3T4DA 3CL1A 2CL2A 2Y6GA 4JI8O 1PO22 1SF9A 1HB3A 1NLSA 1HN1A 4D94A 2AW9A 1QF3A 1N3OA 4Q4Y2 2Q8OA 4AVVA 4LWSA 2XLAA 1L0LH 2Q30A 4PHZA 4XW3A 2XUMA 5JSOA 4YGEA 4RYDA 2WZPP 5HXMA 1VMHA 1EAH3 3CCSV 4MOAA 3CZUA 3FX3A 1GO3F 2FHRA 4AEJA 4JI2O 1UN1A 4LKFA 1BBT3 4GQ7A 4YW4A 1N0NA 4KBZA 4NO4A 4FQ4A 2XLFA 3CMEV 2ZEWA 3PU3A 4TUYA 5L3DA 4DW0A 1W90A 5L3GA 1N4CA 2KA3A 3ZMSA 3HKDA 3CRMA 1RUOA 1KBHA 4DXZA 1EN4A 3JD73 2ZGQA 4ARXA 5IE9A 5LP6B 4B29A 5I0UA 1IPSA 1GP6A 1HJGA 1QMJA 2IJKA 5BNQA 2VNVA 1W8FA 1XE7A 5GTIZ 2FTKA 2A0LA 1CONA 1DQ0A 3I2FA 2XGXA 4H55A 3VBFB 3JAWA 2E5LO 3N2KB 2P3KA 4X1KB 3J7AU 2XJRA 4XDJA 4QMAA 3SQOA 2F43G 4FJCC 3GBGA 4HVRA 4EFBA 3E8BA 1M06G 2WFF2 1W0PA 2WBKA 4CCOA 5CAZA 2CK3G 1VEWA 5LGTA 2RVAA 3AXDA 3B3QE 2BBAA 1S0IA 2WDBA 5JMOA 4DUXA 3JALA 2Y48A 2CTWA 1CX4A 2ATKC 2RR11 1ZLZA 4Z8BA 4NUBA 1HNZO 1K34A 2VZ1A 4ASMB 5FQ0B 4FIPC 1FMD1 3I5DA 3FC0A 5JOXA 5CU1A 3ZYGA 1QKQA 5B5EZ 3EYPA 1QJX2 3CZJA 5LMNB 1HW5A 2GMEA 1RUH1 3W59A 1NQTA 2W5FA 2WO1A 3HOBA 4TQDA 3LB9A 2JK5C 3L9DA 5BNOA 4XAAA 2LS6A 4QPIB 1DHKB 3JSNA 3S0MA 1CN1A 5IAXA 3RWKX 2R1DA 2H94A 3WR0A 2RMU2 1UO9A 1GRJA 2VZOA 3JCUZ 5IWAB 3I4IA 1TNRA 2DUQA 3D3IA 4LQRA 3BCWA 5FUPA 1GZWA 2WKKA 1UAIA 2YU2A 4AOCA 1OOPA 5F3CA 3ABMB 1LENA 4KMQA 4XCBA 1NA1C 1M4UA 1K45A 2V5YA 5LYJA 2OYZA 1ENXA 3Q8BA 1UMHA 1BCXA 3PURA 4ARYA 2VO5A 3FMGA 1T6BX 3TEYA 2MEV1 3BTAA 4LH6A 1DGWA 1HB1A 3IGAC 1SQQH 2KD7A 5IK8A 5EV7A 4FAHA 4OUEA 1DBNA 2BGOA 1C3HA 4GD4A 5EP9A 1E79G 2J1EA 2V4AA 1Q81W 3U0ZA 1GZWB 3MPPG 1JYVA 2PF4E 3KT4A 4RS5C 4DR6O 5LBCA 2RMU3 1NQDA 3BPSA 1HXS2 4LNUB 4DV3O 2HWE2 1R1ZA 2JIGA 4AQSA 2WS91 5EPAA 3T2TA 4P9GA 2LGWA 4XABA 3I3MA 4NOTA 5IVVA 4DV0O 1ZBA1 4BM8A 3LCPA 1HLCA 4BWOA 3VBHB 1UOGA 2OX0A 4U3JB 3AJZA 4CPBD 1TVGA 2B9VA 4Q0UA 3VN4A 2JDAA 4K9SA 1ULEA 5KBFA 1RYYA 4IE0A 3ABKC 2Z5UA 4CCLA 4JZ2A 2WFF1 4EE2A 3I2HA 4HSLA 5EIBC 5FY1A 2OTJV 1ULCA 3HR0A 5CA0A 5A33A 2IJIA 2WLNA 2A6WA 1JYNA 4OPAA 1ZUQA 2E51A 4I02A 4JV4A 4JYYA 2JIJA 1UYYA 4P5YA 4FMTA 5A3NA 4AXOA 5JSPA 4JYCA 5LBEA 4DV1B 4GWJA 4UXAA 1J3RA 3UO3A 1U5YA 3T4VA 2ZNJA 3HT1A 3HNYM 1DLBA 4PJ0Z 1W2AX 4OI2A 3KGZA 3Q8AA 5DUUA 1WB7A 5FLJA 3CJIB 1OCZB 1S0DA 4S2FA 1IBMB 4DOUA 3F5WC 2Y0OA 2RR12 2E7TA 2YZ4A 4F8AA 4MW3A 4O4JB 3HT2A 2NP0A 1W06A 4QPWA 1HW7A 3T1YB 4QB2A 1RM1B 4CS3A 4X8NA 1W3XA 3JSLA 4Q29A 2P1BA 2QQKA 4Y4YA 1H8HG 3MF9A 4J41A 1QOSA 2N7GA 5ISLA 3PDQA 1RFYA 5CMUA 4UF0B 4MGQA 3SHRA 1RTVA 1VIBA 1US2A 1DYKA 2RDNA 3CXCU 4UW4A 2E7QA 3E6DA 4FOVA 4AQTA 4JI7O 4D7SA 5ABJA 1W03A 4O4HB 3WNNA 4XYXA 1JJOA 4PD4F 4FBFA 4XUTA 4YRDA 2J1UA 4V2VA 1AX2A 3UKNA 4DV7O 3ZKUA 3JAKB 3AG2B 3OAAG 2WZR2 4NROA 4LKDA 1KU9A 5EC2C 2IXJA 3LDRA 4PDLA 4BQ2A 4I7ZB 3KWVA 3FUOA 4GWIA 3POWA 5GKAC 2GZWA 1FJGO 1K42A 2MEV2 4RWUA 2DWEC 1G4YB 5IYZA 1JTZX 1ZRCA 5C8WA 3BU7A 4AWDA 3NSTA 4C8DA 4P9OA 5CBGA 2QKSA 2VE1A 4KWUA 2RDRA 3SPHA 2DOSA 1YJKA 3WF0A 1S77D 2AEZA 2W2IA 2BZDA 4NE9A 1G6NA 2HVKC 1X8MA 2FQPA 2QQWA 1TG7A 4DR6B 1BEV3 3ZYPA 2V09A 2HJIA 3ZN5A 1SQPH 1ZBA2 3GGLA 2PI4A 2ZX4A 1S0CA 4DV3B 5BXXA 1F5JA 3ZYJB 4J11A 1JZ2A 4ASUG 3RGBA 4BIUA 3INAA 1ENVA 2QTWB 3LDDA 1CIWA 3ZRVA 2OCCC 1RUI1 2DFBA 5L9BA 4PQQA 3D36A 1ZZBA 1AI6A 3OSDA 5LBQA 5CG8A 5A1LA 5CFCA 1ROPA 1YEWA 5JSRA 4L92A 3L71H 4O4LA 5JVDA 1VQ7V 5JXJA 4EN9B 3BAAA 4R8HA 4R7CA 3TN93 5B1AB 4A5UB 3LGRA 4LOTA 3WNXA 4LMFA 4CU8A 4AI3A 1OOPB 2ILMA 3HR9A 5FZEA 3UGFA 1R3IC 2ERFA 4YW2A 5KMGA 5A1AA 3HQUA 3CCLV 1QNYA 4Q4W1 2XONA 3K3NA 5FKCA 4QQOA 2BGPA 5B3SC 2HEPA 1QR9A 3ZXEA 3RYFA 4XDQA 4X6QB 5GONA 1XBLA 3UETA 2VOWA 5HFMA 5G05L 4JI0B 3OG2A 5H9QA 2DCTA 4AEKA 3THDA 4GXLA 4JI1B 2QM7A 4DV4B 5A9GA 2MHFA 2ZGPA 2F23A 2P3JA 1KJLA 4L0PA 4OHVA 5DDJ3 1RP3B 4ZZ5A 4HVOA 2HH9A 4D6TH 5LASA 4ISQA 1E57A 1XNRB 2OPWA 4BJ0A 3U1XA 4FPJA 1JOJA 2R49A 4DV2O 2IU0A 4CDUB 1YIPA 4X62O 3HNBM 4N43B 4DZGA 1F7YA 5BNNB 4CBCA 4QGPA 1K5JA 4M4RA 3L2HA 1S72V 1IBLO 2VUJA 3L9JT 1X8EA 1XSQA 4I3PA 1ZYBA 3VBFA 2D6MA 3WHUA 1CXZB 4HVQA 1RUG3 1SCRA 1X33A 3DC5A 1QDOA 1KQRA 4JC1A 3T1HB 3CXHF 4DV7B 5EBLC 4KU8A 5ANQA 4YVSA 5EK0A 1ZVFA 1Q8SA 3KV9A 5BR8B 2EIJB 1AYM2 1NKGA 4LWSB 4K0KO 2LW8A 3WW1A 2WSSG 3G6JB 3B93A 3VKFC 3M1HA 4JI8B 4FLXA 4AVSA 5FWEA 3O1MA 1PIV1 1OQEA 4DXRA 3JCZA 4HFSA 1HRV1 3Q9OA 4AFBA 4LFCO 5DMYA 5AVAA 5LA2A 3RMXA 1DF4A 1U5IA 2Y38A 5ABJB 5DPNA 1YTFB 3DGTA 5IY5B 2RJLA 1Z0HA 2PHXA 2BRTA 3LEMA 3OPTA 1JPXA 4XETA 5E1AC 3W7WA 5HCFA 1NZ6A 3EB7A 1Y9QA 3W5NA 4OVEA 2A73B 2C24A 2JDHA 5LXTB 4XJWA 1YITV 2QEXV 1BHGA 2E3CA 1JUIA 1RMU3 4H3WA 1X36A 1GICA 1D0HA 4XFIA 1A8MA 4MHRA 4AI9A 3O1SA 3HKCB 1QR8A 4O2BA 3VDDB 2EXJA 4XUPA 2EF6A 1ENQA 5J2UA 3DSQA 1EV11 4JI4B 1YQ5A 1W8ZA 1JYXA 4MVQA 1QVFU 1DQ6A 3N9MA 1S0EA 5A3PA 4LCUC 1WBLA 5T5LA 2VZUA 2W92A 2WLLA 3NVCA 3PVEA 4IL6Z 4Y22A 3ZXDA 1KC8W 4B3TB 1N36O 1F4NA 4IW3A 3S57A 4HT1T 4TYSA 4DS0A 1VF6A 1LNQA 1E1RG 4MGKE 3O12A 4O4JA 5FYIA 3A0NA 4RD7A 2EIMC 4RO2A 4QAWA 1ULFA 3TN91 4I55B 5FUNA 1AILA 3RVZA 1SS3A 4WZCA 1Y3TA 3ASOB 1IQAA 2PHTA 4KG0A 1AL21 4DR1O 3VBHA 5BXZA 2DJVA 4PBPA 2DW4A 1H8TC 3ML0A 3CD6V 2BTVC 3ZOIA 2KG7B 1RITA 4Y20A 5FPZA 1NY72 1LODA 2ZACA 1I5YA 2O57A 2X29A 1EN6A 2ZKOA 4PA6A 2XQRA 4LF4B 4OHYA 1M93A 4LHKA 2P7TC 3AVSA 2RS52 1OLMA 3VGIA 1OHFA 3H3LA 5E1RA 1K5MB 3KQ4B 3Q4HB 2ET7A 3ZS8C 1X9PA 1GMMA 1F35A 3WF3A 1ZZ7A 3I2JA 1RXFA 1DU3D 4YVWA 5GLVA 3AZVA 1Y76B 4G28B 3WB1A 2L6LA 1GNZA 1GAXA 4O4LB 3ZMUA 2YXLA 3D0JA 4U3JA 5KXBA 4LO7A 2YBSA 2WFF3 1PMHX 2G9ZA 4IT5A 4YW3A 1O5LA 2Y8KA 3E89A 3GHNA 2BTOA 5T55A 3M7MX 5FZLA 1BXHA 5A3MA 2GC0A 1EUTA 5BY1A 3RN4A 4ZPIA 4IHJA 3CCEV 2XB6C 4D7TA 1RUD3 2YXHA 5CFDB 2EIKB 2DYSB 3AP6A 1R091 1VQLV 4IV1C 4FXKB 3MFAA 1H8EG 3O1PA 3ILFA 1VAMA 3UGGA 4GULA 2UWBA 1M56C 2PHRA 4UFHA 1T2XA 1N34O 3K5NA 1BHBA 3E1F1 4BWAA 3DXRB 1POV1 3RZJA 4IEQA 1SERA 2R6QA 1GQGA 3JBG3 2ZGKA 4NRPA 1FXZA 5LMUO 1SKVA 4ATEA 5I8SA 4P2ZA 1QJY3 2XOMA 5C9AA 5A7NA 1ND3A 3TK1A 4EJRA 4B1LA 3CO2A 4MG2A 2VTFA 1TAEA 2VOTA 3VKLA 2QDRA 1FPN2 4OXSA 4QGNA 4KH9A 3W7TA 2V7QG 3FJSA 3ZHUA 5CBFA 1I9RA 1CJDA 3A7QA 3O9OA 2F93B 3QBQA 2Q1ZB 2A7WA 1UIJA 2YXSA 4JKKA 4YY3O 4X1KA 3EHKA 4NHYA 4WM7C 4HBNA 4BIFA 4MV2A 2LJ2A 4K3UA 4COYA 4EROA 1XHXA 3CJHB 1L7RA 3VD3A 3FHIB 3NV2A 3WHTA 1G7YA 1EFRG 3NR7A 4QT6A 1UZZA 1V6OA 4NHMA 5FQ0A 4HOOA 1V9U3 1Q6HA 2ZINA 3JATA 4LF9B 4JAUA 1IPJA 1OV9A 2GNMA 3JZVA 4AI2A 2JIZG 2XWJB 1GOGA 3C7FA 1W6QA 1QNWA 1GM8A 3BVOA 4KP4A 3MGUA 4YFZA 3U07A 1C5IA 4CPBA 1OZ0A 4GWMA 4Q2FA 3ZDSA 3O1TA 4IV3A 3MUY1 5FO7B 3I3EA 1Q7YW 5EZYA 4YHHO 1X82A 1IG0A 1CESA 4XILA 1IBKB 4XACA 2DWDC 5LGUA 1ULGA 3ZRXA 1DF5A 1AXZA 3RFRA 3WNKA 3JD4A 1N47A 3WB2A 1V9U1 4ZHNA 2GP5A 5CNAA 2D6LX 4PV1B 4WZFA 4PDVA 5JH7A 1VRH1 3ETPA 2ITDC 4FFGA 1LUWA 1VBB2 3VQXA 1VBE2 1O3QA 3A0KA 3OUIA 2UXBO 2RDQA 5EJZB 4OHZA 1JQ0A 5FO8B 1M4WA 3EVKA 3CCUV 1ZA7A 1XSRA 2MW2B 1XYPA 5JXHA 3SH5A 1WPXA 3UCSC 3IMMA 2GC3A 3B40A 1UPSA 3BKZA 3KG2A 4WFHA 5JZGA 5HCHA 4I0AA 4XMAA 1MOFA 4DR2B 3I56V 1MS1A 4BQWA 4NKGB 4QHOA 4DO0A 4MTXA 1H9WA 3AYAA 1A8DA 4QE7A 3ZRWB 3QH6A 1YVWA 2MPFA 2P6CA 4ZOLB 4KQ7A 1ZSPA 2H3OA 1YCIA 1AJOA 3OUFA 3G67A 5CA1A 4R9AA 3E22A 1OFSA 3VBOC 2CE4A 1SLCA 2YB7A 2OIEA 4PA3A 3AP5A 4J7KA 3W7UA 1ZNPA 4D6RA 4CDWB 3H1YA 3OMNB 2HLEA 3ILRA 3SJQC 4D8MA 3IDAA 4IQPA 3AKPA 5LB6A 1PNMA 4NB5A 4I0XB 1SC5B 3B94A 4RQPC 4QDSA 1OXCA 3JQWA 2W46A 3WSOA 4CDQC 5FMBA 1UXXX 1H8TA 4IEVA 2OPKA 3ZR6A 2PI5A 1XMOO 1WN7A 1GWKA 4LIVA 5J36A 4WFAV 3WG7B 4RR3A 1AR91 1V6MA 1E5SA 4BMBA 4JASA 1IXBA 4CU6A 4CCDA 1XILA 5JQGB 3QCWA 3MW2A 2AACA 3IKWA 5J98B 3CHXA 2P17A 4B3SB 4JV5B 1FXKC 1GWMA 3BCCH 3MDSA 4BIOA 1IS3A 2JRIA 5H6QA 4QPIA 5CISA 2ZZJA 1TNFA 4ZOLA 3VLBB 4X20B 2VCCA 5A6ZA 1DCSA 2D5HA 1QJFA 3W20A 3WQ7A 2WA3A 3ROUA 2JE7A 1TZOA 3K03A 1WCDJ 4RGAA 4O4HA 5JLVA 1L8DA 2Q8VA 4L9BA 1BVVA 4NAOA 3SEEA 2P4VA 2N05A 1AR61 2IZWA 5HV0A 2CTVA 3N9NA 1P49A 4JF3A 3WG3A 5I0SA 1CZTA 3T30A 5DQ0A 2PLV2 3WV6A 3BIWE 3AG3C 2D3RA 3TOJA 4Q4Y1 3Q8CA 3WB0A 5GALA 2VUDA 3F7VC 3Q8EA 3TEWA 2PXJA 1QNMA 4F6RA 3AG4B 1UY3A 5C3OA 3QLQA 2JEUA 2QTSA 1AR72 3QACA 1ORQC 1MVQA 1W6NA 1LOAA 5L3BA 4Y33A 2XJQA 5C6CA 4M3CF 4EB6B 5EIYB 1QHTA 4ZHQA 2EBOA 3KS7A 3OYWA 4RS5A 3ASNB 1COWG 2VBPA 1PVC3 2WAMA 3LSEA 3DF0A 5LP6A 5K8SA 3AP7A 2YG0A 2A3YA 3VBOA 2ADQB 1X9TA 4A6OA 2ODMA 4HNAB 5D8AC 3TNQA 1BBT2 1HV1A 5CB7A 2UUAO 1AF9A 1W6OA 5FXVA 1B04A 1MQTC 3AJYA 3FUQA 1CX1A 3BGAA 1P8JA 1JUHA 1AJNA 4YJ2A 2R073 4X9QA 1FD9A 3UESA 3POGA 3NNLA 3CLPA 3MHZA 3U78A 3FAVB 3T2MA 1RUJ2 3GM8A 5LK5A 4YM2A 2ZX0A 3MF6A 1CPMA 3N9PA 1K5SA 3K9AA 4DRRA 1COV2 3UT0A 1YQ2A 1KECA 2Y60A 3M99B 3T0AA 1KITA 3AFKA 4K6BA 3USSA 1SETA 2B39A 1ZRRA 3H1LH 3DL3A 4GKJO 1JBCA 2ET1A 3NV3A 3L73H 1OLQA 1MZEA 1OSGA 4M3CA 1ZZ6A 3BTXA 4EYUA 1OPMA 4NXNB 3M8AA 1B35A 4CH5A 4P02B 1WUVA 2XUEA 1QGLA 3BYWA 2IVIB 1WNSA 1JX9A 1FAFA 3K04A 1NTZH 4W4ZA 2UU8A 1HWYA 4K7JA 1OF4A 1MA1A 1FNZA 4LF8O 3E86A 4HKOA 1WCKA 1Y74A 3UNPA 1FKAO 3CCRV 1EUUA 4WVWA 1P7BA 1VBA1 5FOBB 4FPFA 5JPMB 3ORJA 1A34A 2W47A 2WZR3 2GC1A 4EEQA 5LP6C 4I09A 2C9AA 2CGOA 5IJ0B 2OKXA 3CDZB 3JU9A 3AL6A 4O9GA 2CHHA 4V2WA 2YIAA 5LY2A 5CFCC 5LW9A 2E33A 4GB33 3DEMA 5IDJA 3NJYA 3UYJA 5HBAA 2WNVB 4QKDA 1M9NA 4MSVA 3LAGA 5B2GB 1NS1A 3B8NA 3POJA 3ABUA 3ZXFA 4YYOA 3OJBA 3X2QB 4KU7A 1QQP3 4Z82A 1G9CA 4XJ8A 1XUQA 3VKMA 2NQYA 3Q4HA 3ASIA 1YC61 1XU2A 2YICA 5D1IA 4DRVA 4XTPA 2O1QA 3ZLIA 4MSWC 4XJAA 5JIAA 4NR1A 3RYKA 5EBWC 1SLIA 1XC6A 3ZX6A 3J7LA 1K3EA 4DK1A 4R9CA 2VS0A 1C57A 3THTA 4QJFB 5FY0A 4W6YA 2KB1A 1LTEA 3KT1A 5EYYA 5B1NA 3A22A 4Q0VA 4ZU5A 2WIIB 4Y24A 4XFCA 4FTSA 1OCRB 4F7ZA 2IXHA 3V56A 3J80N 1KQSU 1I08A 2ZIMA 3R0RA 2E76B 1JMKC 1C1FA 2Q4SA 1VQNV 2GSYA 4BXFA 4UVAA 1NCRA 1VAKA 3NXSA 4QNHB 4RN5A 2VMCA 3ZN6A 2JB4A 2W1WA 1O8PA 5GLZA 2WC2A 1UY0A 1SA0B 4YJ3B 2WT0A 5DDJ1 4DB5A 1VALA 3QOPA 1RXGA 1GFF2 2XKPA 2Q7GA 3V0BB 2WN2A 2Z2SB 1AI4A 4NAMA 5EJ1B 2E32A 4IEOA 5BR8O 2X5IA 3BOWA 4AQ6A 3K48A 1HXS1 4DXSA 4JI5O 4BR6A 3EQEA 4NN0A 2ZKLA 1WCQA 1NZCA 4I0BA 1NCQB 1R6KA 2VOVA 2VMHA 1LOEA 1VQKV 5AFBA 1QJU3 4MADA 1W2NA 3VBRB 4DEVA 1W6NB 1R64A 4YSFA 4LF7O 3JD71 1BL8A 2YHJA 2JEMA 2I2SA 4LBLA 4MGTA 1CAVB 4K20A 1DGRN 2AREA 4JI6O 3H8XA 2VAUA 4KGGA 4HN0A 4U7NA 4L87A 3T4ZA 2AZ2A 4JQTA 4OYUA 2YY1A 2BOIA 3ELNA 2WLKA 4B4PA 4M3CE 1HXS3 3ZSKA 2F4PA 2K46A 3AG7A 1UY2A 1AL0G 2HHHO 4S2HA 1OHHG 1GN3A 2BFUS 3KLSA 4HONA 3OY8B 4AFDA 5FMOS 2WT1A 5KAIZ 1Q8IA 4ZS2A 3A23A 2CU5A 4CS2A 4LF8B 3E5UA 3VD4A 4I9QA 3K5LA 4QX7A 2VWKA 2PAEA 2PQSA 5JI9A 4XBNA 1I5XA 2A6XA 3MW3A 5L3CA 4JI4O 4META 2D6KA 3SYOA 4MS2A 3SLIA 4PELA 3SGIA 4GUNA 4MGZE 4B3NA 5FP8A 2ZGUA 4W6WA 2UY8A 3POFA 1VP6A 1SZBA 1IZ3A 3CCMV 1R1A1 3LEGA 3ES4A 1E5HA 4CH3A 1XNDA 2EAKA 4XF0A 3P3PA 3AL5A 3TJTA 1TMF2 4CDUA 1SDWA 2QNKA 4K8XA 2QZ3A 2R062 1JXNA 2RM21 4CDWA 4QXHA 5A32A 2WFPA 2UWAA 4ABMA 3UM7A 1DQ2A 4IV1A 4COVA 2VTXA 3OGJA 5EHDA 1JYIA 3Q8FA 5BY5A 2Y69B 3F7YC 4UB6Z 1DIWA 1UYZA 2CAVA 2BTQA 3M3CA 4L2NA 3OTFA 1TME3 2DV9A 1BT8A 4DUYB 4BZ4A 5F6LB 4DV6B 3VDBA 3AFGA 4LF4O 3RZGA 4RGGA 2JXAA 2V73A 1FYJA 5K9YA 1J95A 1GQHA 5FNVA 1SRYA 2R0HA 1OD5A 4QX3A 3GVMA 1NE4A 1AR73 2M7WA 4IV1B 3T0BA 4G2KA 1V54C 1S5HC 3BY6A 2GMMA 3ZSEA 5GZEA 4YXWG 1M56B 2YMZA 4YZ1A 1V9U2 5F32A 3FBMA 1CWPA 2IH3C 1R081 5FZ3A 2ZQMA 3A2FA 4M0HA 3ZSJA 1PZ9A 4ZU4A 1QOOA 4FPKA 4QX0A 2ZPXA 3ZMZA 3UK9A 3CC7V 1REDA 2E5LB 4X64B 3KCCA 5KAFZ 4CCCA 4N9IA 2AUYA 4ZI7A 5F2VO 2WLHA 2HP8A 4TV9B 1PM4A 3I3DA 4ZONA 3RQ0A 1QQCA 4LF7B 2FL4A 4XUNA 5KHGA 1TA8A 1VBD2 4L11A 2EXHA 2Q8CA 4IEXA 4P9PA 1BMV2 3S3WA 3NJZA 2HWB3 3K5OA 2X6AA 1IURA 4LC1A 1BMFG 4L97A 2C0ZA 4KHPO 2XVGA 1YWKA 2P3YA 1RVF3 2DTWA 1WPBA 4XUOA 1OH3A 3NV4A 4DR5B 1AR82 4OMDA 4I4TA 3E5XA 2YGLA 3OB8A 2AENA 4Q4X1 1X7NA 1XHZA 2GH8A 3LOBA 1OMIA 3OW2U 1NCRC 2EZPA 2R071 2R16A 2GU9A 3K5MA 4X89A 3JBG2 1VBD3 3LEKA 3I8TA 2Q1FA 2JJ1G 1R3LC 5DN6G 3A8TA 5CKNA 4WM7A 3H9AA 2Q9LA 5DECA 1W59A 1HQWA 1XNCA 2Q8DA 3TETA 1DZTA 1MS5A 2QA4V 4A3ZA 2FDGA 1RSOA 3RYCA 4YJ3A 4AW7A 4LBQB 1RPRA 4OMCA 3CPWU 4Q1PA 3BOPA 4P9IA 4F3JA 4J1WA 3O14A 2CGPA 3IFXA 1PNLA 4DQAA 1URFA 3PUQA 1X59A 4WM8C 5KXCA 1KKDA 1ASJ2 4J9YB 1RHI2 1LOBA 3ZHTA 1I5PA 2IWGB 5LWBA 2PYJA 3A21A 1CEZA 2BJSA 4FFFA 3MDPA 2Q0OC 4J9ZB 3LDCA 3MW4A 1QQP1 4HL0A 4C1WA 5A3OA 1H6YA 4P5HA 2VQAA 4OI1A 1Y67A 4FLYA 1VBE3 3QO7A 4FFHA 2HYKA 3OGCC 2D98A 1U12A 3GBWA 2N04A 2XOKG 4H2AA 3CKHA 5BNPC 3PHMA 4BQ1A 3VHNA 2EIJC 2CTQA 4JGYB 2ZBJA 3K4ZA 4E2LA 2RS32 2YSUB 1VB2A 2F4VO 5FY4A 4DR4B 1S4CA 4HPKB 3TEXA 5BMVA 1D0GA 1F23A 2HEYF 2R061 5L9RA 2XTAA 1JVMA 2AHZA 2WAAA 4BQ3A 3IBMA 3FFZA 3MI8A 4WV8A 1VQ9V 4MVMA 2VW2A 2IXIA 3VD5A 1H2SB 2JKXA 1ZTEA 1MSDA 5DAVA 4YVWB 4X1IB 1MABG 1D2SA 3TN92 1AR1B 2GUZB 1Y4WA 2R7EB 4OLLA 1GKFA 4AI8A 1MACA 4LFAO 2FBEA 2GTAA 2EAAA 4JDOA 2YDEA 5ACA3 3RS6A 5J37A 1AYN1 5K1PA 3ENRA 3WQ0A 1F15A 3C3VA 1HRI3 5IK5A 4UV8A 2QWRB 3FL7A 4AFAA 3C3SA 3PUAA 5LEKA 2WNUB 3VDCA 3TYJA 2V5DA 3L72H 1Y7BA 1AR83 2YI9A 3EJKA 3BTYA 1XXNA 1IDSA 2NN4A 1U0AA 5LL6Y 1ZRFA 4LUKA 2VUAA 4CDXB 3CIHA 1MMMA 4J6GA 3K4DA 3TXQA 3SJCC 2E74B 4BPZA 4BA6A 4FPEA 5IW0A 1E5IA 2HWF3 3WUDA 2P37A 3I54A 2MK3A 1BQZA 1WMEA 5LY1A 1UD1A 3CRQA 1XMOB 4X8PA 4RR3B 1OQDA 4GX2A 2A3WA 2DMXA 1LHNA 3C7EA 1QLEB 4MXWA 2P22C 2W9XA 2YFUA 4BYYA 3ZIWA 4XC9A 5JVVA 3ZFFC 1ZREA 3D5OA 3KD4A 2DBNA 1V6NA 1KDMA 3QD6A 3K3WA 2WLIB 2GAUA 1WJZA 1SQXH 1GU3A 4LEJA 2HLDG 4W4LA 4XXPA 2DDUA 5F9TA 4EKWA 1SQBH 2OUHA 3GCWA 1I1EA 1JHJA 2GALA 4X8AA 4UFKA 4PIZA 5IJ9B 1SFNA 3WDYA 2D5FA 3LA3A 2DU0A 1ZWIC 1D5NA 5IVFA 2A1XA 3POSA 3WXPA 3JD2A 2A71A 3THPA 2HHHB 3DXUA 3LPFA 2XR4A 4XJZA 4BLJA 2WWJA 3LF7A 1UKGA 4NHLA 3J8F3 4QPGC 1Z7S3 3D3AA 1XE0A 2X6BA 2IXCA 3MICA 3ZCCA 3VDAA 3VBSC 4H7MA 2L35A 4JHZA 2WLPA 1XJAA 4OUMA 4GAZA 4AGRA 3S5QA 3JCIA 1FXHA 3FZ3A 3OUSA 1G9FA 4DR1B 2D6PA 1LOFA 4FPOB 4XHXA 5DZEA 3SKVA 1HB4A 4B1MA 4EB6A 5FKBA 2EILB 3MFCA 1RMU2 2XASA 4D3WA 2ADEA 3KZIZ 3AVRA 4Y26A 1QOTA 1FOD1 1VB4A 1R092 2XJPA 4DR3O 4BISA 2HWC2 4UT5A 2VPVA 1L0NH 5CKQA 4W65A 2VGDA 4LKSA 1D4M1 3VBRA 4BW5A 1REFA 2EIKC 4AZZA 3LDEA 5H9SA 5DUVA 4LHSA 1KRIA 4CCKA 4HAMA 3T08A 5FPBA 4DRXB 1PM7A 1B35C 5IUQA 4GCZA 3N4MA 1DYPA 5LK7B 2XJUA 4S2GA 1GANA 1JA8A 1DK1A 3VBUA 4YVSC 1WMFA 4DV4O 2ZM6B 1EPZA 5B1BB 3HVDA 2C9KA 2V4VA 5JIUA 3EMRA 3OTOO 1AB3A 4JTCB 3GHMA 1XB9A 2Y6FA 1DGWX 1C1LA 5BPXA 4Q8LA 3H01A 3RI8A 3CYOA 2Z4FA 1BZKA 1JCHA 1FI2A 3SYCA 3BA8A 1K9MW 2Y6KA 2ZT9B 2Q5ZA 2GDFA 3P32A 1HNZB 3ITQA 2X5IC 2WNEA 3VHOA 5CBLA 4FT8A 4OZOA 3OGRA 1D7PM 4U2AA 4HK8A 1MS9A 1NVPD 1LGNA 2FCVA 2WLQA 3BALA 3R4UA 3N35A 4DUYO 3QVNA 4CYDA 1HNWB 3HD8B 1OI6A 4LBKA 5ACA1 3DXTA 4ES8A 3OGIB 3CX5F 2YEVA 2CWSA 4E4EA 2WR9A 4NPRA 3NAPB 4YW5A 1PNFA 2PYLA 3P30A 2LFSA 1KUQA 2JS3A 3E22B 5LMUB 1JH5A 4UV9A 3WOGA 3ES1A 5CB4B 1W2TA 1YSCA 2OTLV 3I49A 4JDNA 3TXSA 2HWB2 3PN1A 4FPHA 3K79A 1PK6C 4K0KB 3IN9A 2CDOA 4QHBA 4RSUA 2LUWA 2K0GA 2K2SA 5FZ8A 4IERA 1W0JG 4D6QA 2P90A 5T3NA 5FZAA 4X88A 2DCJA 3K0GA 5K0UA 1AX0A 1GR3A 3I2OA 1CVNA 1LOFC 4MYEA 1GN2A 1B09A 4Z2WA 2WS93 4YZ4A 3N2GB 4UAPA 2OIIA 4QB6A 4X66O 1FATA 4N7UA 1HIXA 5C4WA 4B3RB 4R50A 4NIGA 1VQ4V 3FD9A 5HI0A 2ZTNA 1QXRA 2PZSA 4LBMA 4K8ZA 1DZQA 3H1JH 1IS4A 1S55A 4FTBA 4OI4A 4Y4RA 3ZVXA 2IXKA 1OCOC 1UWWA 4OQ9A 3ST7A 1R73A 4CUAA 4CA9A 4OHXA 4BQXA 2UXDB 2DVGA 3JB4C 4NIDA 1IKQA 1H1AA 4HSJA 4XDKA 2PLV1 4YWAA 1MEC2 1DQ5A 2EINB 5A32B 3W7XA 5FBJA 3ZPOA 3APBA 3T3YA 1CAUA 5FNVB 2ZE8A 3MIDA 2P67A 2IFWA 3N9LA 2NMOA 4SBVA 2W52A 4DY3A 4RAIA 3SCFA 3NMBA 3NNMA 1PKXA 3DUIA 1YI9A 1RHI3 2VZRA 1C8M1 1ODMA 5BMVB 1XU1A 2NR5A 4QHZA 1XNQO 5I8YA 2Y26A 1MEC3 4RS5B 2PY5A 1MR5A 1NCQC 1BK0A 1DGSA 3OF1A 4KGQA 1YFXA 4RA0A 3RYHA 2MEV3 2PLV3 3BHPA 3KKYA 2ZXWC 3GZEA 4IE7A 4RFRB 1HRV3 2ZZQA 1SBEA 2HWD1 1NOVA 1HKDA 3AYEA 3D8CA 2VUCA 4FPPA 5F1RA 3CC2V 4CUBA 4Y22B 3PJQA 1MS0A 1W0OA 2JWPA 1HP8A 1PX3A 2W95A 3WF1A 3WW3A 5IFTA 4H0LB 1ND2B 4KFMA 1QJY2 3HPNA 2XQXA 1W3VA 1KYOF 2RS31 2VZQA 1N33B 2GHYA 3M3IA 3POIA 4CEWA 3BIEA 3TWIA 2BERA 1RSOB 3BUCA 2N74A 4CXYA 1VR3A 2WL1A 4MX3A 4LBJA 5FOJB 4IE4A 2RS11 2OA2A 2BBVA 2VY0A 4UCVA 5HV4A 1FPN3 2WO2A 1N8RW 3VQVA 1MSWD 1QWRA 1TME2 4Z1VA 1JZ3A 4J7ZA 1J1TA 4NTXA 2UYBA 4P00B 4YARA 3KB5A 1JMUB 1M57C 2ZGSA 1YXBA 4XHBA 3AG3B 4K8RB 4DUWA 4I01A 1OVPA 2R0FA 2TNFA 2R041 4ZIBA 2A5ZA 5JXIA 5CN0A 1H8TB 1ZZ8A 1VF6C 3D0SA 2FKXA 1I7FA 2P34A 5T54A 4N8MA 3M3QA 4RL7A 1GOFA 5A3UA 1SA0A 3KM5A 4LTAA 2QQIA 2F1MA 2ZEXA 2KKWA 4PCRA 2JDZA 2CTRA 5DAXA 4IGOA 4DFSA 2OQ6A 5C9AB 4W6XA 1UW8A 2VOKA 4BW9A 1RUE1 3SNMA 5FZMA 2Y69C 4E8DA 4RUFA 5LHHA 1JZ8A 3HWJA 4RHV3 4EZHA 4LP8A 2BW8A 2BU9A 4LT5A 4JPRA 5EYPB 5A3WA 1HV0A 1RUG1 4NXMO 1L7QA 2CNAA 2XJTA 2ZS6B 2YROA 1V0AA 1KEXA 3BPZA 2RNBA 5CFDA 3NQHA 2R32A 3H50A 5I93A 5CA1B 1LHWA 2HKXA 5FY5A 4C91A 2F66C 4BQ4A 2AYHA 4QD2A 2WSUA 1YI2V 1NZIA 5I8TA 3WINE 5FYMA 2AXTZ 3AX4A 4LBNA 4NWWA 1J58A 2QM8A 3F2ZA 3OEHG 1RB8G 2Q69A 4IE5A 4XDLA 2CSGA 1R3JC 4XIKA 1NA1A 2LROA 2DU1A 2ETEA 1KMIZ 1H4GA 4M01A 1OJHA 5A7QA 2W6IG 1TME1 1L7LA 1C8M2 3AKSA 4PJYA 3WFVA 5J2TB 4DXWA 3VKOA 3WLUA 2WWUA 4ZKIA 4F83A 1OCCB 4BDVB 2C5DA 4TTGA 4XQ4A 4UCTA 5FO9B 3N2KA 1FPN1 1YYNA 3MPBA 3AEIA 3P5BA 2VCMA 4E2SA 5LGNA 3VBHC 5CB4A 2XLGA 4IDZA 5CFCB 4NHXA 3UJOA 5IT6A 4YW7A 3WG2A 4D0QA 1FV2A 1GZTA 4QB1A 3UKVA 2NZ9A 4LBQA 4FP2A 1WLTA 3SPIA 3ZIXA 5HXVA 3OFNG 2P4KA 5FTTC 4WCEV 5D2AA 4CEYC 2R043 2E9QA 4I50B 5E88A 4AVAA 4GH4A 1LGCA 3AKQA 2A9HA 3LIGA 5EXOA 1W05A 4P08A 1MZFA 5T5JA 3FX7A 1BCCH 2GTSA 3SDLA 4QKBA 1TUEB 2ADPA 3NL1A 1S3JA 4NTWA 5IHRA 5LA9A 1H1IA 1JODA 4CC5A 1JHNA 5IVBA 2RS13 2JGDA 1NCQA 2B46X 2EZOA 1OLRA 3J7NA 4C1XA 2PMWB 3I3BA 1AI7A 3BRCA 3JD72 1N3PA 2EIMB 5GM0A 1UOBA 1NLQA 3QG5A 5KUKA 2PGGA 3W21A 3WU2Z 4FK5C 4FFKA 4DUZB 4AEDB 1W6OB 2XHBA 1UNBA 1OH4A 5LATA 3P3NA 1SACA 1JYTA 1ULDA 5FUIA 1SCSA 2FDKA 1ND3B 3MLKA 4AFMA 3ZYHA 2ARAA 3FWEA 5CYYA 1URXA 3AKRA 1PNKA 2VZVA 1CPYA 2FYUH 4KI5M 1DZRA 3GNEA 2CAUA 4OZXA 2WS92 1S2KA 3N7JA 3IDBB 4PA4A 3MZHA 1ZA4A 1THZA 4JV5O 5JXGA 3O1RA 2J7MA 2ZOEB 3ZFGB 4UOJA 3CRAA 1PO23 2WT2A 2VD7A 4A45A 2DTYA 4GH4C 1GK9A 5IWFA 2PHUA 3RZHA 4RHV1 5LHIA 2H6BA 3H9VA 3ZFEA 3SISA 4C90A 5FZIA 2R70A 3J8F2 4J7JA 4LF5B 3QNEA 2UXDO 1PZ8A 3LA7A 3CRRA 5CVRA 4YZ2A 3PUHA 2DYRC 3I3QA 2DFCA 3ZHRA 2Y64A 1UF2C 1CP9A 2YPDA 5IVYA 4GZRB 1Q6UA 3MHSC 1NH2D 2QWPB 4K35A 4A44A 2RHPA 1W6PA 2VWJA 4Q1RA 3RBZA 1GN6A 4JAAA 1DF0A 3RWNA 5KX5A 3H0OA 3CU7A 5E6HA 1QU0A 2HVJC 3WNPA 1F51A 2HG5C 2DUOA 5I0RA 3JQXA 2A70A 4GMP1 2XJSA 2KSDA 4XPVA 4IEPA 4DV5B 1G9AA 1AR4A 3ACGA 1HNXB 1F2NA 5LMNO 3HAGA 1SQFA 4BH9A 1ZZCA 3KV4A 1O6UA 2J1VA 1OVSA 2RV9A 1FYUA 1V6IA 1XQ8A 1W6PB 4JI6B 5A7WA 3NNJA 4AHWA 4Z92B 2IXLA 2UUBB 1JN2P 4Q4X2 1J5EB 2QZ2A 2VBDA 3TAYA 4YGBA 2JG9C 2WNVA 2PFWA 4QX8A 4XFGA 2WQZC 3RW0A 5C4WB 4KWLA 2UXCB 3K58A 3IJ4A 2QR4A 1KP3A 3ZXAC 5CA6A 3L70H 1ODNA 2P5OA 3OR7C 4E4DX 5DABA 1NUKA 4OI0A 5IVCA 2XAJA 3ZFEC 4XTMA 5L3EA 5B3SB 4PLNA 1N33O 3CEWA 3K4AA 3VBFC 2HYXA 1GZ9A 1AHSA 1UMZA 3R4DB 4WF9V 1N34B 3JAKA 1VMFA 1WCSA 3ZSLA 3WUCA 5FPUA 2GN3A 3PTYA 4CP1A 1OUSA 3IZOA 4OQ8A 2BSKA 2EIBA 5JCTA 3ABKB 2VH9A 3A4UA 1RUI2 4FZ1A 1FXVA 3UKTA 4LJHA 1KDKA 2FMYA 4UFLA 4XJ9A 5FR3A 1UMIA 1YFWA 3TGUH 2PA7A 3S7EA 1SG3A 1Q86W 5JMCA 2OT7A 2C2AA 2XVLA 4UVCA 1XMQO 3GALA 4JRLA 1HR0B 2ZKNA 3RSJA 2DCKA 5BNOB 1Y43B 2XKOA 4AAPA 4YPJA 1W2UA 1QDCA 3OUJA 1EAH1 3WNMA 3CMGA 1BS3A 3MIFA 1B6QA 3CJIC 2F17A 5DAPA 1QLNA 2PTMA 1OFNA 4HN1A 1CQ9A 1AR93 1VQMV 5FYTA 5ANNA 1XDCA 4CXWA 3ZXLA 5J96B 5AC91 4DR3B 1RM1C 4E27A 2WO3A 1KFXL 1RINA 3V0AB 1WP8A 1Y9MA 1VBD1 1H38A 1ASJ3 5FMOL 3ACIA 2FZ1A 2IM9A 1US3A 3JATB 2JD4A 1AYM1 4NRQA 1V6LA 3MV11 5LRRA 1ASJ1 3POEA 3NRUA 4KBBA 4I3GA 2ZCEA 3T0DA 1JI6A 2ZM6O 5ABJC 5JPNB 2JG8B 3RT3C 5IVEA 1VBA2 3PMEA 4TZDA 4C0HA 2A7AA 3HIFA 2R063 4I5SA 4JKMA 2R72A 2FDHA 4OX9O 1ZL8B 1BK1A 4Q4W3 3AG2C 3D3QA 4Q0QA 2X09A 3BN6A 3HKDB 2OWOA 4AQYO 4PIYA 2ITCC 4RQPB 4UFIA 4N43A 5FZCA 3PL0A 1XE8A 2QE7G 1OURA 4CH6A 1QCEA 4MVRA 4LE4A 4A7YA 3DYMA 1TGOA 1FMD2 5B66Z 2WLMA 1VLNA 1QXJA 4ICGA 2UXBB 4QPYA 5FZDA 2AZ5A 4XVHA 4PI2A 2FD8A 1VF7A 3GBFA 4P14A 1AJPA 2I74A 1I3HA 4XFAA 5I0DA 4NYKA 4LF6O 2ZMNA 4GX0A 2WYFA 1E5RA 3VDDC 4UCOA 2UXCO 1YRZA 3E2EA 4DR2O 2ZDIC 3WF4A 1UZWA 1HNWO 4P9WA 4FVVA 4IYIA 2W39A 5D5QA 4FP3A 4OULA 3MIBA 1XNAA 5LYJB 1GNHA 3IIIA 4Q27A 4CVUA 5D8AA 4CCJA 4ZU7A 5CA0B 1YIFA 3PJSK 2LQTA 2XAFA 3D82A 3B01A 4HKWA 2HR3A 2LRPA 2RJKA 3D6EA 2Y4UA 3HKEB 5A7PA 4DO2A 4RGKA 2QKCA 5AVPA 3LKJA 5ERLA 2HWE3 2UURA 2EICA 4A42A 2Z5WA 1NXD1 3HPLC 3O1OA 2M6YA 4BK5A 3JARA 2B8MA 3KF5A 1AROP 4W8JA 1PGL1 4MVOA 1K8AW 1D2DA 2LW1A 2VRZA 2KM2A 2IH1C 3OM3B 4GX5A 5JZGB 1RMU1 4WM8A 1PVC1 2D2CB 1UIKA 3S30A 4YFWA 4KUMA 1EP0A 4ZKTB 2DN9A 2QJ1A 4X65B 3NAPA 4IETA 3DYOA 2OZ6A 1LR1A 2WN3A 5C7GA 1S1AA 2QFEA 3O7OA 5APAA 4WFFA 5DM6V 2JEXA 2ORXA 1IX9A 3V65A 5D8AB 1W8UA 4FPYA 4FFIA 3ALQA 3IMNA 4P9LA 5FP9A 2A3QA 1SMVA 4R4XA 3LSUA 4MO3M 1WD3A 4I2OA 4LR4A 1CIYA 4XE9A 3NW4A 1H4HA 4FXGB 4UF0A 2WZR1 1GZCA 3ZMNA 5GLWA 1NE6A 1J59A 1Q90D 5BYNA 4CH4A 1DTOA 5K0UC 2H0BA 1H6XA 2WPDG 4TUYB 2DYCA 2VXJA 1BQPA 3WG7C 4QPIC 4A6SA 2R9AA 4QKNA 4RQPA 5LA6B 4DR4O 4XZUG 1UPGA 4MVZA 1BKZA 2IBZH 4XDPA 4XXAA 5SV8A 2V1DA 3QO8A 5G04L 3UT5B 2IU3A 3CNAA 1XNBA 2WJSA 1U97A 1AP5A 4LA3A 3ZX7A 1ZBE2 4AQYB 4FFBB 5KXDA 2OCCB 4X62B 1EN5A 1SESA 1ND2A 3FB6C 1UZVA 1YZBA 4Q4Y3 4M0NA 3WG4A 5GLTA 5DZGA 4JI3B 4EQVA 2ZXQA 1YJ9V 3B4SA 4A2UA 4MLOA 1MS8A 1WA6X 1S0JA 2VZ3A 2VQFO 5FMDA 5C5UA 4LF6B 2WLLB 4M4PA 1GYKA 3B77A 5ITZA 4O4IB 5FZ0A 4AE2A 3OEEG 4AK3A 4BU2A 4CEWC 3RYHB 1R1A2 2B7YA 4MH0E 3SJBC 2JG8A 2FCUA 2ZX2A 3CJHA 3A0BZ 2RN9A 5CZKA 3ACLA 4YHHB 3S7IA 5IYYA 1DP0A 1P7GA 1ACCA 3UT5A 5CG9A 4FQZA 3E8FA 1XQNA 4QQPA 4XEZA 2JJ2G 1ZZ9A 2G19A 2YBPA 3JBG1 3SCGA 3WNLA 2IJHA 1HN0A 2VTXJ 3LDBA 1MS4A 3MBWA 3PVNA 3GWKC 5BV6A 3OPWA 1L3JA 2LM3A 1QHDA 3KF3A 5LOVB 4PDMA 3ZN1A 1SHWB 2E31A 2J1AA 2L9LA 2VG9A 3OEBA 5IWAO 3W58A 1IVSA 4ASLA 1B06A 4YNIA 4XUQA 5AG2A 4XF4A 4ISRA 3CS5A 2ZR3A 1AVBA 3KCYA 2VJXA 3C7GA 5KC5A 1J5EO 5KWRA 1BZWA 3RVHA 4LUMA 1RUC2 2WZ8A 4XF9A 4BB3A 3I2DA 1IGOA 5AC93 4B08A 3B02A 5A6QA 5B1OA 1EZVH 5BNPA 2XWBB 2G4IA 4FLUA 1AUYA 4HYOA 4YG6A 2DVBA 2RDSA 4R9BA 2V4DA 3AZZA 1GV9A 4M00A 4OHWA 1D2QA 4UFMA 4UB8Z 3VBBA 4QPGA 4B3MO 1A78A 1UZYA 2ZEZA 1W28A 4PDWA 2HKOA 2Z0AA 1V00A 4O61A 2D3PA 1DFQA 1OC1A 4O7XA 5IYBO 3WZ1A 1F5FA 2ZAHA 2VC9A 2ZAAA 5GZFA 3ZYBA 1SLTA 4GLXA 3S3XA 5J2TA 3FKSG 4QQLA 4I55A 3HKEA 4JX0A 3OMAB 1LB2A 4JGZA 2XNDG 3J26N 4ZBMA 3WG1A 2DVFA 3AZYA 4JCKA 1GH6A 4QGLA 1ZBE1 5CKMA 1B3QA 2JE9A 1JFFA 4IIJA 1BQ0A 5F8PA 3ON7A 1UKRA 5F5IA 1O4TA 4ATFA 3U4XA 4CDQB 1XREA 3C90A 1R1A3 1EPWA 2KXLA 4CRQA 4GA9A 2VVEA 2X0LA 1K5QA 1S2BA 1IS6A 3HBKA 3O1VA 3LIHA 3K2OA 4FPGA 2FDJA 5FK8A 4ES9A 3RJ2X 3ZXKA 4COWA 4U7OA 2P06A 3PU8A 1R3KC 5FYVA 4GMP3 2X6CA 3MIHA 4JI2B 3AP9A 2A75A 4U36A 4FOWA 2VXRA 4BXSV 4LFAB 1EM1A 1RGSA 4JI7B 4XMIA 3RYIA 4OX9B 3O65A 4COUA 3DPRC 1AYN3 5IYCO 3L2YA 5T5PA 2VQFB 4UCUA 4UWDA 3LSQA 1HRI1 3OBRA 2DBIA 5HCBA 2RS33 4Y1ZA 1XPWA 3J8F1 2D6OX 1LU1A 1HJFA 4HXCA 5FZOB 1JZ7A 1UU6A 3BI3A 5F3GA 3AK0A 1E1QG 1AXYA 2NN8A 3LFMA 4QM9A 5DDJ2 4IV3C 1XMQB 4XIOA 1QJY1 2LFRA 4GALA 1HR0O 1N32B 4AEDC 4TSFG 5C3PA 4I50A 3VHPA 2WO7A 5FYBA 2VNGA 3U75A 3HEIA 1G9BA 2D43A 2GMPA 4MZUA 1EAH2 1TE1B 3O0VA 3QF7A 2UY9A 3M70A 4B3RO 2H0VA 1WA4A 4QKFA 2GP3A 1KJRA 4FAGA 2PHWA 1UOJA 5L73A 1GM7A 4QQHA 3ATGA 5GLUA 2ZX1A 4JGZC 3SXWA 2BCCH 3FN9A 3APOA 1JOYA 2ZA9A 1NYWA 3RYIB 1WLCA 5KHIA 4JTAB 3H1MA 3OOXA 1VRBA 4GH4B 3WT3A 1AL22 2J1SA 3ABLC 5I91A 4SLIA 3I97A 2R042 3B69A 1MPXA 5IJRA 1NT0A 3H7YA 2ZJCA 2QGNA 2O8QA 1Q8OA 1F8VA 4LR3A 5H9PA 5JJEB 4CCNA 5IVJA 4LOSA 4CDUC 2CV6A 1Y9GA 5I0TA 1W2OA 3SYPA 1LHOA 4MXVA 2WNUC 2EX3A 1XYNA 3I2IA 3E97A 1Q82W 1D4VB 5BNNA 1Y76A 2LO1A 2PHDA 4GKKB 3K08A 4B3MB 1FPOA 3IDCB 1YJLA 5C3RA 3DKQA 1IOAA 2NLRA 5F3EA 3ZN6B 3FB5C 4N53A 1COV3 5F7UA 2QQVA 5FPXA 4IESA 1RJ8A 2VW1A 1SPPB 3HQXA 2AZ0A 1UY4A 1P4RA 1O7FA 2VZTA 4JI1O 1N3QA 4X65O 4PA9A 2RDCA 5EFUA 5FY7A 4LHLA 3N7LA 4LA2A 4XOGA 5L7OA 2C1FA 3O0WA 2ZHLA 4EN0A 1JYWA 5A1FA 2QE3A 4EWAA 1NR1A 1QVGU 1FXKA 1N1YA 2OT5A 2EALA 1N0JA 4MVUA 1V55B 2B42B 1OOPC 1SPPA 2OVUA 1R093 4QXKA 3FBYA 4K3AA 3EO6A 3VZMA 4JZGA 1JS9A 5H6RA 4FSJA 4FVMA 1YF2A 1RVF2 2DUPA 3WNOA 3TRSB 5DEDA 4CDQA 1R082 2D44A 1O4ZA 3RG0A 4CU7A 5M0TA 1PGW1 1UX7A 4Q6GA 1YNAA 4JHTA 1Y4MA 4YG3A 4AQ2A 4GZ9A 4E4SA 3WP6A 2VVFA 2BDRA 2X53S 1PGL2 2HBTA 2OYQA 3DN7A 1JW6A 1F9KA 3I7DA 4NPLA 2LTNA 3DCQA 3WDTA 3X29B 2X05A 1H2KA 1UY1A 2W0XA 3WDXA 3B5LB 4CZZA 1Z7S1 4WM8B 4LFBO 3MEPA 4J25A 4QDQA 2JB8A 5FP4A 5D21A 1HDJA 4UXNA 4BE3A 4J10A 1D5AA 2YC2A 5LBBA 2OUJA 3DYPA 1MZ5A 4YLZA 1A6CA 2Q68A 1WA8B 1PMIA 5E89A 3AMNA 3JARB 5F5AA 1O5UA 1TVKA 2GNTA 4YZ3A 1QQP2 4AHXA 3PVOA 4LFCB 2ETNA 3SJAC 2BV4A 3MUZ1 2P5BA 4LITA 1W2BU 3T09A 3B8MA 2ENRA 3PNAA 2XMLA 1VRH2 4JGYC 1D4M3 1HQNA 5J09A 1T6GC 4AVBA 1PM9A 4JGSA 2YPJA 5FIXA 2V72A 3UO2A 2YUEA 1VQ6V 4YW1A 4HZFA 3FLPA 3K75B 5JH7B 4AI0A 5TISZ 5J3UA 3AC0A 1JZ4A 2CGNA 2GC2A 4Y1UA 2JGUA 3KVBA 1KP2A 2B1GA 3PVBB 1CGPA 3ASNC 5H9RA 1VIWB 2ARHA 2JGDB 3B2EE 3RZZA 3ZSMA 5EZYB 2BVBA 1N1VA 4MGYE 4NXMB 3BEHA 1L1FA 1S0VA 3O1UA 5FL7G 3T1CA 3ETQA 4IE6A 5ACA2 4DK0A 3AK1A 3T1YO 2VR4A 4PDWC 1W99A 1FS0G 1CR7A 2Z69A 1NG0A 2MNGA 2GV9A 5IT9N 2QDOA 3AG1B 4B4QA 4QU1A 2P6HA 5LBFA 2VM9A 3H8UA 4AHZA 4QWNA 4Q8KA 1S0GA 2DYSC 3JAWB 2HWF1 1N36B 1WW4A 3IM0A 4C7UA 4K40A 2Z42A 1FNYA 1JZ6A 4TT3G 1KB9F 4AFCA 2FCTA 5LA6A 3EXUA 3T4HB 1XNQB 3KT7A 4QGMA 1AR92 3ABMC 1W8WA 2UXXA 2ZR2A 4GWNA 4BOWA 2QQUA 4BK4A 4XBFA 1NX9A 2W0FC 3H1IH 1SFPA 3ZFFB 3DKWA 5C3QA 3KMHA 3G71V 3IIAA 3ZIAG 4NIAA 2YUAA 4Y3OA 2QKAA 4QM8A 3DV8A 5F37A 2ZE5A 4NPMA 4N21A 2QQPA 2ZGLA 2RJZA 1FV3A 1XNRO 3N9OA 3IPVA 4R9DA 1WA8A 1CAWA 1ONAA 2RJ2A 4H7LA 4PLMA 1OCOB 1VF5B 1BEV2 2UU9B 3UKMA 3AG4C 3CC4V 3OGVA 1OQ1A 3HKBA 3ZMTA 4MVSA 1UZ0A 1H2LA 1PIV2 5DAWA 3CCJV 4FI9A 2VMGA 2W1QA 2GBOA 4ZXKA 1PL4A 4COZA 1HQLA 1F4HA 4UBHA 5FY8A 4NRMA 1VBB1 5FDBA 4LLFA 1UX6A 4FO9A 4DV2B 3A0HZ 4YVWC 3ZFGC 2R9IA 2R1BA 4KG8A 4AILC 4KNCA 4Q4X3 3RJRA 3LA2A 3SPCA 1SDDB 3JD1A 2JS5A 5GJ6A 4GX1A 3ZPYA 5FLXN 2E7AA 1KXGA 3MIEA 1CPNA 4O65A 4FLWA 3ZMVA 3NNFA 4OCTA 1H2MA 2JICA 3C7HA 3H7JA 1ZX5A 4YGDA 1XEQA 4I9WA 3RVYA 3USUA 3CRCA 1RUH2 1F4MA 3KQRA 2DYRB 2FMLA 1J84A 5C8CA 4N43C 4N53C 4P9JA 1G6UA 2EXIA 4XFFA 4YM3A 2ZEYA 1JZ5A 5K0UB 3VB9A 2XHKA 1C4RA 4MGIE 1Z2GA 1CAWB 1AYM3 3ZBHA 2OIGA 3ZHQA 4CUGA 3E8HA 2ZIOA 5SV5A 2QQJA 2HWD2 3UGHA 1Q3EA 1K3IA 1ZL8A 5KHHA 3E5QA 4R52A 3RZLA 4Y5SA 3IT8A 4QPKA 4R6ZA 3U4SA 1U5ZA 5JJJB 5CA3A 5T50A 1EV13 2OS2A 2XPJA 3N7KA 4UUJC 5ITZB 1C8NA 4EN8B 4RR3C 1YI7A 4LO6B 1H30A 5B4NA 4PF5A 1BHAA 4K1YA 4W50A 4FOQA 2DCZA 1XRUA 1STMA 1DG6A 1ZAUA 4HK9A 5H5NA 2GUZA 5J1XA 4CSWA 1IBLB 2JDNA 3I59B 1IBKO 4Y5Z0 5FCCA 1S2EA 4PIXA 2YGMA 5C4WC 3LSDA 2Y6HA 1M5IA 2E53A 1OT5A 1WW7A 3T2PA 5DG1A 3T1MA 1HNXO 1HX6A 4CEWB 3LWCA 3ZO0B 4NWVA 2FDIA 3VBUB 1QH6A 1PZ7A 1XL4A 3RMYA 2VCAA 4JI3O 4LH7A 1YIJV 1V70A 2B5HA 2NMNA 2Y6LA 2FMDA 4IXLA 3ZM8A 1W9FA 4KHPB 4CP0A 2VQEB 3LOIA 1AR81 1W6MA 1PPJH 5E16A 4PT6A 2DURA 1WW5A 1SFYA 3NWKA 1LOCA 3X2QC 1W04A 3I2KA 3I59A 1XBFA 5FZ9A 1YDXA 2CDYA 1W9WA 2BOBC 3EHBB 3OTOB 4FOYA 1VQPV 4INDA 1PX4A 4CU9A 2RR13 3CCVV 1ENSA 1LEDA 2NM1A 3K9SA 4LO5B 5LEJA 2UU9O 2AHYA 3BVCA 1LRHA 4LPLA 3ZYRA 3OD0A 5A2QN 1O3TA 5FJKA 4E9KA 1BLZA 3NKGA 1EY2A 1Y6XA 4DR5O 3OD4A 1WMDA 1MQTA 1WLEA 3ABZA 4XDOA 2QQOA 2CH7A 2CUGA 4K1ZA 5T52A 1OF3A 1PV0A 2XBO3 4FLVA 2BEOA 1OCRC 5FYSA 2HWD3 3CJXA 3ZMOA 1PD3A 3STLC 3USUB 2E6VA 4URAA 3SKJE 1ZX3A 3N7MA 3MO4A 5L19A 3VUOA 1EZJA 1VE0A 3PUIA 3T1LA 5FMCA 2PQQA 1LULA 2IW5A 3KCXA 3AM2A 1PGW2 2ARXA 3ETGA 2QWOB 1H0BA 2RE9A 2XBO2 5A7WB 4XURA 3MAQA 3D4KA 3WY6A 4FM2A 1RUNA 1H2GA 4K21A 1NU1H 3ZR5A 5HCAA 3G6BA 4DUVA 2WWWA 1LU2A 1K5MC 1P84F 2VZPA 3G6EV 1FX5A 1O3SA 2UXNA 2GSMB 3SEPA 5KA6A 3ACFA 2Z3YA 3BU0A 1DQ4A 3RYPA 5JUVA 3VBRC 1RUD1 1QY4A 2RM23 3SITA 2ZXWB 4IGPA 3FLRA 2A6ZA 2J42A 4AL9A 1Y74B 1ZBA3 2E63A 1UCXA 2CYFA 1V6JA 3OCPA 3VV1A 2VMFA 3POBA 5BNNC 3CEIA 5F5QA 1G9DA 1LAJA 3CE2A 5FP7A 2FB5A 4G9SB 2VMDA 4DUZO 1AXKA 5FPRA 4XJUA 5C8YB 3GJBA 4LULA 1V54B 2J1TA 4JGYA 4CEYB 4CZSA 2R9RB 5FLIA 1C8M3 1GN4A 4GB31 5FFOC 4HKLA 2X10A 1PO11 1FXKB 1Q8PA 3P6BA 2VZSA 4N23A 2KG7A 4G27B 4DW1A 1SQ4A 2VMEA 2XH6A 5FZKA 4TQFA 2P4EA 1W8HA 1YJNV 3ZFGA 5E79Z 3GF6A 4HMZA 2WYSA 1PK6A 4LHNA 1NTMH 3DPRB 4LK6A 2A6VA 2VNRA 4CS4A 3AZXA 4AHCA 4WVZA 4Y1YA 1QH7A 1JOPA 2BPA2 1H9PA 2A79B 3DTUB 3O5SA 4P9XA 4N9HA 5EJ3A 2HWE1 2QWNB 3K0DA 5IY5C 2NLJC 2C4XA 3U37A 1RPOA 4IV3B 3G7DA 1YFUA 4WBNA 4UVBA 1AR5A 3CMAV 1POV3 1LCLA 4XBLA 1QU7A 3WQ1A 4CC6A 2UUAB 1US6A 3VD9A 2XAHA 3SYQA 2B9UA 5FPVA 4F6EA 2O8OA 3R4SA 4WM7B 1QJEA 2I07B 3K06A 1IQDC 1UU5A 3V64A 1VBB3 1Q56A 2YC4A 1ND3C 1NQJA 1X50A 2G9FA 2F95B 2AGAA 4LO8A 2HWC3 4JYAB 3HKCA 4E4ZA 2GDSA 1TUBB 1H2NA 3HN3A 3L75H 2Y33A 5A80A 3ZJZA 1RUF2 1VQ8V 4QX2A 1ST8A 1H1MA 2RMU1 4AEDA 4GKYA 1G8WA 1JU3A 4LBQD 4LORA 2YU1A 1KFUL 5IJ9A 3JASA 2EULA 3WCRA 2RS12 5DUXA 4YY3B 2BQPA 3TCUA 4AEMA 1K33A 2ZHNA 1HDKA 3CQOA 5C33A 4GYCB 2WZEA 1RUD2 1YQ8A 4N7IA 5BZBA 3GJAA 4BAYA 2UWCA 3EFFK 3LE0A 1PIV3 2P3IA 2Q6AA 4Q0SA 1VMJA 3PTRB 1XNKA 4L99A 2B45X 4EWDA 3WEZA 1JR9A 2E26A 3PUSA 2BE3A 5KXEA 2YI8A 1TVKB 2ZGNA 2EVXA 5L3FA 3RDIA 3IC7A 2BOCC 2XJVA 4NIHA 2CAZC 1K73W 5K1XA 2BYVE 1RUF3 1A3KA 4LBEC 4LIUA 3B9CA 4B7KA 3OT7A 1SLAA 2XHNA 3RYRA 4X1YB 1CAXA 2IUWA 1DLCA 4X6RB 4FFBA 2EIEA 2HJDA 4NVPA 1UJWB 3H42B 1W9YA 5C8CC 4AGGA 3GDBA 4PQ9A 2GNDA 1YHFA 2KQXA 4YW6A 1YFYA 5FZFA 1YTFD 2EJ7A 5EWSA 2Y0IA 2YIBA 3V0BA 2UUCO 1LHUA 2W94A 4AF9A 1ZRDA 3AP4A 3UL2A 1TEIA 4NHKA 3HQRA 5FPLA 3RZKA 1AR71 3AYCA 1NVPB 1WCUA 4CDWC 1MG1A 4FCAA 1OKOA 2X7RB 2JKBA 4Z07A 4CDXA 2QSAA 2YIDA 4X1IA 1VAVA 5CIRA 5KHJA 1NLRA 3KV5A 1C28A 4CP2A 1SZTA 2DWRA 1JJ2U 5FZ7A 3J81N 1GLHA 2WNUA 1DDLA 1SEFA 2ARCA 5GONB 4AHYA 1XOUA 4HANA 1NY71 1RUG2 4O2AB 3AZWA 4ZY9A 4CTEA 2AGSA 4PDRA 5C9AC 2XAQA 3M7AA 1UL9A 3DGEA 4E2GA 5KC6A 1LKNA 5C3SA 4LK7A 4U3FH 1BBT1 1O59A 2BFUL 2ZGRA 1W9SA 3A0RA 3CF6E 5FXZA 5DN2A 3UQ8A 4AAXA 1O8SA 2Q4PA 1RUC3 5T5OA 3E35A 4LNVA 3OGSA 1NJIW 1RUH3 2EIDA 5JR2A 5BNPB 2Y4TA 3MD0A 2W3JA 4LFBB 1Y66A 3JD3A 2JG9A 2YEVB 2W87A 1RJ7A 4TLFA 3WQBA 1PVC2 4AVCA 5LA0A 2ZDIA 1I94B 2HWC1 1VRH3 2DVDA 2W1UA 3F5TA 1VBC1 1CAVA 3BTZA 3OBTA 3J7HA 4TWKA 1R6NA 2Q73A 4Q4V3 4P30A 3VQWA 4JTNA 3WP4A 5FZGA 5JCOA 2PAKA 2RS51 4X66B 4AI1A 5FZ4A 2QUOA 1QEXA 1EBOA 2ZGOA 5LOVA 4BCUA 5FXWA 3VZKA 2G1MA 1XOYA 3G4SV 4EN7B 4A7KA 3IC9A 2RG4A 5K7PA 3PJYA 2WQ8A 4ORFA 3C8XA 2OQ7A 4BHPA 5FAXA 1WWYA 1NXMA 1XYOA 3NJVA 3CBNA 3GZAA 2XDVA 5KUMA 4D7YA 3RPQA 3CCQV 4JTDB 4BLIA 3FB8C 3OPZA 1YJWV 3SH4A 2J22A 1O91A 5CFDC 1IXMA 1JOBA 1MZ6A 1LUVA 2VL4A 2J1RA 5A70A 2P6JA 1NT2B 3TB0A 3OUHA 4WVMA 2Q8EA 4LF9O 2BP6A 4HG6B 1VJ2A 4CP9B 3HNMA 3ICXA 1LOGA 1K97A 4YVSB 2G9GA 3N3HA 4YGCA 5FXXA 4QIWF 3TNPB 5C5TA 3AMHA 3JD0A 1OBNA 4ZS3A 4DPNA 3BABA 3D36C 1XI1A 4AG4A 5C71A 3WCSA 4WBBA 2Q67A 1CAUB 1OD3A 1NBMG 3T2QA 1FMD3 2JG9B 5FP3A 2PHFA 3HBZA 4TXWA 3CJIA 1VARA 4TV8A 1MEC1 2CWMA 4CEYA 1BVP1 3ILNA 4HNAA 2ORZA 4RFT0 2WRAA 1CJPA 3RI9A 3KVAA 5KHKA 2CY6A 3H3UA 3LPGA 2DVAA 4NJ4A 4H44B 4RUEA 3GZTB 1KS5A 2WWSA 4LF5O 4LE3A 1W9TA 1U96A 3OGGA 5IFPA 1LNSA 4GKJB 3DPRA 2XL9A 1FAYA 1IBMO 2DF7A 4NMIA 3ECQA 1BSMA 2HWF2 3VBSB 2PYTA 3RYFB 1NCRB 1GUIA 3STZC 3VD7A 1QIQA 4JGZB 5FYUA 4AR2A 3WD5A 4WFGA 5EYPA 3WDWA 3RNSA 4GT1A 4Q4V2 2ZGMA 5A3TA 2D93A 1PK6B 2AC1A 3M4FA 4OPHA 4ET7A 3LSSA 2NYYA 5IYDO 2FZ2A 2OZJA 1Q5OA 1FFXB 2NNUA 1AP6A 3SR2C 1GKBA 2G38A 1I94O 4CCMA 4DYLA 3PIGA 5FYCA 3N2GA 1TMF1 3VZJA 5A7SA 3LD8A 3AMQA 3K77A 4RHV2 1B35B 1OCZC 1GNYA 1MS3A 5JQGA 2RM22 3N9QA 1Z7S2 2YYOA 3U10A 1VBE1 3I55V 3NV1A 2Z79A 3THCA 3R65A 5B1BC 1FFXA 3BB6A 4I30A 2LALA 2JENA 2WSVA 5DZFA 2IC1A 1WW6A 1ULOA 4MXWB 5L7OC 2EA7A 3EBRA 2O14A 5D5PA 1VBC2 4XBQA 2ATFA 4JI5B 1NKDA 4Y1VA 3VZOA 3B7MA 3HMYA 2D97A 3M3EA 4BIZA 2XAGA 1J83A 4IUGA 1RUE3 3O0XA 1OA3A 4NIIA 3ZRSA 3ZN4A 3IAPA 3I2GA 1GSLA 2CTPA 1POQA 4GKKO 1S5LZ 1DLLA 3JASB 4DEQA 4IEYA 2P2KA 4YJ2B 1IS5A 4LBOA 4MUVA 3OBZA 2CDPA 2XBO1 4OUSA 3KHBA 2F6BA 3MLJA 2D6NA 2HBUA 4R8CA 2E75B 2UYAA 4PLOA 4YG0A 1S5JA 2W68A 1GBGA 4PBOA 5EBMC 4Q0PA 4S2DA 3UV9A 3GXUA 2XT9A 2B1IA 2EJRA 3LEIA 1RUE2 3ZEDA 1O4YA 3NAPC 3JALB 2TBVA 2PHLA 1FOD2 5FYYA 3K57A 4TV8B 4DMIA 3B09A 3OEAA 4Z2AA 2QTOA 3ZFFA 1VBC3 1IHMA 5JI7A 1QBZA 4F4LA 4O4IA 4YM1A 3J9SA 2XVKA 3BFRA 3TEZA 1ULPA 3FB7C 1BYHA 1DYOA 2XXZA 3IAQA 1J1LA 3IDEA 4JYAO 2D40A 3NKTA 4QXBA 3C3TA 4O9EA 1GP5A 5GZCA 2JJ6A 4OGQB 4DRXA 2D3SA 4TOIA 3E83A 1H8VA 1X4TA 1UYXA 5LRSA 1UYPA 5J7MA 2OW4A 5FV3A 4JI0O 3E6BA 1HRI2 5EC1C 4DR7B 4LKEA 5C93A 3W7SA 4IEUA 1YQCA 2YXYA 1AZDA 5BNOC 3H8OA 3M3OA 1BGYH 2BGCA 5H9CA 3RRDA 4MT8A 3SPJA 3PLQA 4QXCA 2ZHMA 1W6QB 4F6RB 3ZHVA 2I45A 1W0KG 4HETA 5B1AC 2HWB1 2JVDA 3JUUA 2WAOA 5A33B 2PAMA 1M57B 2YC0A 4HLTA 1AR63 2WLIA 1PO12 5DXDA 4CP9A 1PL0A 5JZGC 4XAEA 3RZMA 3OYWB 4ZHQB 5JCOC 2ZE6A 3H3ZA 2VECA 2WQ4A 1YUDA 2OXBA 1NR7A 5LHGA 2JDIG 1WBFA 4KXRA 1D4M2 3B9IA 3K3OA 5B4XA 5A7OA 5DAQA 2QQNA 1I0HA 3AKTA 1TQ5A 4MTGA 3RYCB 1RUI3 2GH2A 4ZXEA 3VZNA 4FZ0A 4FTEA 4UYBA 3RWRD 4DV6O 2EIGA 3M8LA 2A6YA 1SBDA 1O3RA 2JG8C 3P1IA 4XF3A 5HFLA 3H1KH 1LJ7A 1WD4A 2ZHKA 5IATA 4UW5A 3JXSA 5L36A 3H1HH 1GWLA 1N32O 3T1HO 2KR2A 1WP7A 3BA9A 4CUCA 2ZMKA 4TV9A 4MW8A 2R072 2D7FA 2LW7A 2BWCA 4D69A 4I4TB 2JDYA 1GM9A 2VNOA 2UUCB 3POYA 1LESA 4YM0A 4JDMA 3R66A 1WB8A 3GB7C 1J3PA 4EZ4A 1Q43A 1V6KA 1LHVA 5FPAA 1SQGA 3C7OA 5IK4A 4M3CB 1CZSA 1RUF1 4NTYA 5JWPA 5FPOA 1Z5VA 2YIBD 2WNOA 3HN1A 2ES3A 2BNNA 5IAVA 3MYXA 4FLZA 3LZZA 3SCHA 2CH7B 2WUHA 1VP7A 3VZLA 4Q20A 4ONUA 1NA1B 4Q4W2 3C2UA 1UQXA 5L9VA 3FHQA 1AX1A 4JYBA 4L8JA 5FLHA 4XQWA 4AYUA 4IEWA 4LLOA 1OPOA 4A3XA 3MV01 2SBAA 4J80A 3CWBH 3JYCA 2A3XA 4BQ5A 1N1SA 2ZABA 2YFZA 4HPKA 4DV5O 5IYZB 3EXAA 4FPLA 1PP9H 3ETEA 1HRV2 2GN7A 3VBSA 4GIQA 2QKDA 1WGPA 1BEV1 3SH3A 3N36A 2RS53 3MLLA 1R083 2W08A 3PMSA 1SBFA 3FYIB 4DIQA 3KHCA 2DE0X 4EFEA 5FK7A 5HPOA 3K51A 4PI0A 4O2AA 2UUBO 2YV8A 2PUSA 3LNNA 4Y20B 4JRAA 1K12A 1UXZA 5E8AA 1PGSA 4GKXA 4Q26A 1LECA 4CXXA 2DQ3A 4RQEA 5FZ1A 4B3TO 5KLVH 1J3QA 1WKYA 4UW3A 1FOD3 3URFA 4WFBV 4BQYA 2WABA 3K46A 4H14A 2EILC 1M1KW 5CADA 5GZGA 3LNMB 3PIJA 3APQA 5EYXA 1F31A 4FPCA 1V9PA 2VMIA 3OBAA 2Q7HA 2QJVA 3VOUA 2BWAA 1UU4A 1LGBA 3V0AA 1RIRA 3H1WA 2C6SA 5EZWA 2B4KA 4W4KA 4CE8A 3UJQA 1G86A 5GTHZ 4PA7A 3R05A 2ZNIA 2R30A 2Q7EA 4MTOA 2F4VB 3VQYA 1QXPA 2AR6A 2BVVA 4X1YA 5FBZA 3OR6C 4E8CA 4R4ZA 2VCBA 4KWKA 1DGLA 1Q8QA 1AL23 5LCWL 1NTKH 3LFIA 3IAYA 3ZN0A 3LDKA 4GJYA 4J1XA 1IPKA 1RC6A 1O9HA 1W8NA 4WFEA 4JTOA 2AEYA 1QJU2 4ZZ8A 4GMP0 2IFRA 3JAMN 4WVMB 3U11A 5AC92 1SZXA 3K59A 1KD7A 5IK7A 1TUBA 2ADDA 3QTCA 3GZUC 2OCHA 1YXWA 2H8PC 1SLBA 2BSKB 2ZX3A 2LGQA 1LEMA 1KS4A 5FYZA 4EN6B 1K4DC 5BUVA 3WDUA 2VVDA 2XL7A 2A06H 1MVEA 1EYBA 2XG3A 1ENRA 2HEWF 1V55C 4LNUA 3WDVA 4UCSA 5DG2A 2O0OA 4YIOA 3S5AA 4H13B 1ALYA 4Z1MG 4N90A 3T2OA 2ID4A 4XF1A 2QVSB 2WLJA 2DCYA 1W8OA 3ACHA 4UW6A 1NH2B 4P9YA 1FT9A 3GCXA 2Q1MA 1DGRA 4JKLA 1S0FA 2FDFA 1LR5A 5CEHA 1JU4A 4UBGA 3ZRWA 2AH2A 1U5XA 4ASKA 1OA2A 1Z5WA 2BNOA 3IPVB 5GZDA 3NNGA 2W1SA 1PHMA 2HJFC 1YQ6A 2ZE7A 3SC7X 3HJRA 1WLWA 2ZCWA 1OUXA 3ZXGA 2DQ0A 1S0BA 4I0WB 5EIBD 4CDXC 1VMGA 5JJNB 4KL1A 3TBDA 5KA5A 1BMV1 1QJX3 4JVAA 3ZHSA 3SPGA 4K8FA 1DQ1A 1PO13 2VBBA 3W5MA 3U14A 2X8KA 3S6PA 5F6KA 4LO4B 1KGYA 5FZBA 4Y1XA 1SQVH 3CP1A 1QLEC 1S76D 3LQCA 2D3OW 1I5ZA 4MVTA 1N1TA 3WP5A 4DY5A 2VOXA 3QO5A 1WLDA 4FM0A 1JFFB 5JOZA 5J2UB 2W91A 1TMF3 2BOJA 1RUC1 3BODA 2WINB 2VQEO 3VDDA 4QDRA 3MHHC 4PF1A 5JR7B 1GQPA 3GWOA 1CAXB 4XFHA 2EINC 4UFJA 1Z78A 3ZFEB 4DXTA 3VL9A 1GP4A 4WVVA 4MGSA 3R6SA 4B8EA 4G4FA 1WMXA 1CZVA 3HB3B 1K7DA 4XCAA 3MIGA 3WP3A 4X64O 1A32A 2WNVC 5LXTA 1NAEA 5F5CA 3ETDA 3L74H 3OE7G 1T5EA 2JD9A 2Q5TA 4DV1O 1PMJX 2K9PA 1XNTA 4GJZA 1UFIA 1XL6A 4IGQA 2Y6JA 2LP7A 3NJXA 4D6SA 3IB3A 5JDBA 3ABLB 4QU2A 1POV0 4Q5OA 5J48A 1QJU1 2JE8A 4MHUA 3OMIB 1Q6IA 4IGGA 1VPHA 4BMEA 3G80A 5F39A 4L8QA 2Y0PA 1O9GA 3AG1C 1OKQA 1ZM1A 3OY8A 1SLLA 4JZRA 4DV0B 2RCVA 1W39A 4IYHA 1QJZA 4ITCA 3SYAA 3J7MA 4H33A 4GB32 5GW7A 2QM4A 4RQFA 4H37A 1ND2C 1COV1 1YLLA 4YZ5A 5FZOA 2BUKA 2K1EA 5K4LA 4QPJA 1UPIA 1RUJ3 3FAVA 1C5HA 2VW0A 5F2SA 1EV12 4C0BA 2VQUA 2B9ZA 4J42A 4UFZA 2QCSB 1JYCA 2IJJA 2PN5A