5KHKA

Hcn2 cnbd in complex with 2-aminopurine riboside-3', 5'-cyclic monophosphate (2-nh2-cpump)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 64
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khkA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khkA02
3FZ3A 4O9GA 3EO6A 3LA3A 3BB6A 3ELNA 5EFUA 2GH2A 4NVPA 3FFQA 4YYOA 1CAXB 4J1WA 1O5LA 3BALA 4IEXA 1Y3TA 2VECA 4LULA 2OZ6A 3ES1A 4IEVA 4XFFA 4AQ6A 4J1XA 4X6RB 2PTMA 1QWRA 3WW3A 3NVCA 4EWEA 3OTFA 2BGCA 4KWKA 3R6SA 4HSLA 5FLHA 3GBFA 4Z82A 1CAUA 2Q4SA 2O8QA 4LTAA 1VP6A 1I6XA 2QDRA 5I91A 2EVXA 4F8AA 3E5UA 3SXWA 3KCCA 2BNNA 3RYPA 3LZZA 5JSPA 1DZTA 4KWJA 4JV4A 1GQHA 2D5HA 1ZNPA 3MYXA 4ONUA 5K8SA 4OLLA 4IEYA 3TNQA 4AVBA 3OCPA 3HT2A 3B02A 4BIFA 4UXAA 1WA4A 3DKWA 4N9IA 4YARA 3H1YA 2VPVA 2MHFA 3H1WA 1RC6A 4XF1A 4XFAA 2QCSB 5I0UA 1WGPA 5CVRA 4KU8A 5CU1A 4I01A 3D0SA 2GC3A 4I0AA 3ETQA 4XFCA 3DV8A 1YUDA 1QXRA 4I02A 1UD1A 4TLFA 1CAUB 1O3TA 4LLOA 4ZU4A 1U12A 3IBMA 3OD0A 3LOIA 4B29A 1SEFA 1UIJA 1OI6A 4Q0VA 2D93A 2DCTA 5E16A 5FQ0A 1ZZ9A 2ATFA 4F7ZA 5F1RA 4AQ2A 4Q29A 2GC2A 3CF6E 2IC1A 1PM7A 3E6DA 3IDCB 1OFNA 2Y0OA 1UPIA 3M3IA 5KHJA 3BU7A 3WW4A 3G7DA 2B9UA 2UYBA 2EAAA 2IXLA 3CLPA 1VR3A 1ZX5A 1H1IA 1OMIA 2UY9A 2IXJA 5FPZA 2IXKA 3ST7A 1SFNA 3FJSA 4MGYE 2OPKA 4Q0SA 4E2QA 3EHKA 1J3RA 3RYRA 2KXLA 4QM8A 1CX4A 3MZHA 3LA7A 1ZRCA 4I2OA 2BEOA 2PAMA 2ETEA 3D82A 4QM9A 4BH9A 3H7YA 3H50A 5FLJA 1EPZA 4Q0UA 1O7FA 4YNIA 2MPFA 1PMIA 5BV6A 5FQ0B 1EP0A 3RDIA 1ZRDA 4XF0A 4K8FA 4BYYA 4MGKE 1UW8A 1RL3A 1CAVA 3PLQA 4XFHA 5JSRA 4AVCA 3H9AA 3ACLA 1Y9QA 1I5ZA 3U0ZA 1RGSA 3KGZA 3E6BA 2B8MA 1J3PA 4IEOA 2CAVA 4PJYA 3SCHA 2P17A 4WBBA 3MPBA 2PHDA 3U10A 2WFPA 3USSA 1X8MA 4UBGA 3H8UA 5FPXA 4WVZA 2FQPA 2WC2A 3PNAA 2C0ZA 4N9HA 3H3ZA 5E1RA 4L11A 3BCWA 5C6CA 3C3VA 2F4PA 3E5XA 2PHLA 1TQ5A 3SHRA 1XE7A 4RD7A 3LA2A 4MGIE 4IEQA 4GULA 2O1QA 3IWZA 1GQGA 2K9ZA 3RNSA 3NKTA 4WZCA 3HT1A 3TNPB 3ZDSA 5I93A 3GYDA 1CAVB 1YFYA 2ET7A 4MUVA 4I09A 4QGMA 3S0MA 4MZUA 4E2SA 4XFIA 2HKXA 3KSCA 5KBFA 5LEKA 4KL1A 2Z69A 3PVBB 4O9EA 1LR5A 2FMYA 3UKNA 3KGLA 2VQAA 1YFXA 1IPKA 1ZRFA 2XLFA 4ORFA 5T3NA 5I0TA 3EJKA 2XHKA 1NXMA 2D5FA 4P9GA 2ET1A 4HN0A 3WW2A 1RUOA 1L3JA 2XKPA 4ZU7A 5JAXA 5BY5A 4HBNA 5KHHA 1DGWA 2QNKA 4HN1A 2B5HA 1H1MA 2XLAA 4IEUA 1CGPA 4XF3A 3CEWA 3LWCA 4MV2A 4ZU5A 4XETA 3I7DA 1DGRA 3M70A 1Q5OA 4LEJA 1NZCA 2BNMA 4MX3A 4Q0PA 5KHKA 3VHRA 4UBHA 1WLTA 1VJ2A 1CAWA 4LUKA 5BUVA 4KWLA 5EZWA 1O5UA 4JTOA 1XRUA 3H3UA 1YWKA 2QVSB 2XLGA 3FHIB 1IPJA 1J1LA 1ZRRA 1X82A 4XF4A 5JSOA 1CAXA 4R8HA 1UIKA 2GZWA 1FT9A 4EROA 5CADA 4XEZA 5LEJA 1HW5A 3E97A 4IEZA 4IEWA 3CJXA 2QJVA 1J59A 3E5QA 3HQXA 1O3SA 3SCFA 5I0RA 1UCXA 4JTNA 3QACA 2MNGA 2UYAA 5BXXA 2PAKA 4IESA 4FBFA 3I54A 5I8TA 1J3QA 1ZZBA 3HIFA 4A2UA 2V09A 3NJZA 5I0SA 4Z07A 4HVOA 3NSTA 4L2NA 1QY4A 5AVPA 1ZZ7A 2CV6A 1O4TA 4QXKA 1NE4A 4HVQA 3CO2A 1LRHA 5JCTA 5FDBA 1X8EA 1CAWB 1EY2A 2UY8A 3I59A 3QOPA 2XGXA 2PFWA 3JZVA 4FAGA 2PQQA 1RUNA 5I8SA 2PA7A 2EA7A 4HVRA 3IDBB 2D40A 4AVAA 1YFWA 2K0GA 3UKTA 2H6CA 4OFGA 1NE6A 1SQ4A 2HJIA 3N4MA 2GU9A 4DINB 3IIAA 2H0VA 1Q43A 4QGNA 3D0JA 4AXOA 5KHGA 4JVAA 2OYZA 4MH0E 3LAGA 3DL3A 3KMHA 1RTVA 1QXJA 2BYVE 1FI2A 2IXIA 2Q1ZB 5BPXA 3NL1A 3CL1A 5J7MA 2XKOA 1NYWA 4HSJA 4LUMA 2GC0A 3H7JA 2PYTA 1ZZCA 2BNOA 4XFBA 3I59B 3EBRA 3FX3A 4EWDA 3FWEA 2PAEA 2Q30A 3EQEA 4I0BA 1Q3EA 2E9QA 4CYDA 3OGJA 3S7EA 4D7SA 4Q0QA 4IETA 5KHIA 1LB2A 4LA3A 3SMHA 1YHFA 1EYBA 4LA2A 5HI0A 4EV0A 2IXHA 1YLLA 3RYKA 2XL7A 1FXZA 2N7GA 4XFGA 5J3UA 3L2HA 1JUHA 1O3RA 3MDPA 3RPQA 3ES4A 4E2GA 5LRRA 4QGLA 1V70A 1X7NA 1O3QA 4IEPA 2CGPA 1DZRA 2ZCWA 4QMAA 1OD5A 4QX5A 1ZREA 2XL9A 2CAUA 4BHPA 3BPZA 2Q0AA 1J58A 4PIZA 4FAHA 4HZFA 4H7LA 4HMZA 2ZKLA 1LKNA 5I8YA 4HLTA 4X6QB 3NW4A 1XE8A 2H6BA 2OZJA 4PIYA 4PIXA 4R52A 4EWAA 2GC1A 1G6NA 3O14A 5D1IA 3ROUA 4IERA 1ZZ6A 3U11A 4META 4YSFA 1ZVFA 1YFUA 1ZZ8A 3H1MA 4FT8A 3RZZA 3SCGA 2I45A 2Z2SB 4YRDA 5LRSA 3UKVA 2GAUA 3E6CC 2IXCA 4XF9A 3OF1A 5JR7B 5J48A 3S7IA 5FCCA 3WW1A 2OA2A 5C8WA 4D7TA 3FE5A 4KU7A 4I3PA 4MGZE 3DN7A 5FLIA
chains in the Genus database with same CATH superfamily
1CZSA 3F5TA 4CCNA 3K3OA 1AR1B 3BODA 4YYOA 2LQTA 5IYDO 5C70A 2ZGPA 1PL0A 2OZ6A 4WBNB 4MLOA 4YVSB 1AX1A 3KS7A 4Q4Y1 1AILA 3M8AA 3BVCA 2GDSA 2FDJA 1N0JA 3MUZ1 2IBZH 1QXPA 5LHGA 4YY3B 3DXRB 1V0AA 2EVXA 1GN2A 3E1F1 2IH1C 1JYVA 1XHXA 3O1OA 2WQZC 1QOSA 1E5RA 3ATGA 3I2OA 2RR13 4X8AA 1WWYA 4UFIA 4YARA 1OOPC 2XVKA 3MW3A 2VZVA 5FZ9A 4XF1A 1S3JA 1QF3A 2HWB3 2ZQMA 4JI5O 2XJRA 4B7EA 4KU8A 3D0SA 2AZ2A 2ZPXA 3ME2A 1TVKA 2YC2A 5K0UC 5L9VA 5CFDC 5F2SA 4RWUA 5LXTA 3LOIA 3AZVA 4Q0VA 5A3LA 2HWC2 2D93A 1SFYA 2EIJC 1XB9A 3VZMA 2ATFA 1W2OA 4ZOLA 2R9AA 1PMJX 4L92A 2VVEA 4B4RA 4DEVA 1HV1A 3NAPB 3G7DA 3WW4A 3ETPA 3POWA 3F7YC 1HRV3 1ZX5A 2IXJA 2VBPA 3UETA 4Q4Y2 2X10A 2OPKA 4Q0SA 3NNLA 3JD72 1Q8OA 1IBMB 3VKFC 4YFZA 3MZHA 2FDIA 2Q69A 4I2OA 1V6KA 2OW4A 5ANQA 2AACA 2R16A 3WCRA 4QX2A 2QZ2A 4R9DA 5SV5A 4AILC 2VVDA 1NCRA 3FB5C 3UYJA 4P9JA 1GFF2 3UKMA 4P14A 1FNYA 1W6NA 3M99B 3K77A 3ASOC 3CS5A 3O0XA 3I2JA 1KS4A 4N9HA 1HJGA 2KSDA 2C9AA 3RVHA 5KXDA 2VS0A 3CRAA 5JWPA 3H01A 3WG7B 1AR73 5D8AA 1CEZA 2W1WA 1J83A 1K5MC 3UGFA 1H30A 1OUSA 2ZOEB 3ZN0A 4FLZA 4RR3A 4CRQA 5C8YB 1DF5A 3OPWA 3VOUA 3LFIA 4CEYC 1NH2B 2BQPA 5EJ3A 4UW3A 4E9KA 4DR5O 2VW2A 4BJ0A 2YXLA 3WVJA 4QXHA 2Y60A 3KGLA 1JZ5A 4KI5M 5A7WB 3GVMA 1YIJV 1BT8A 4HBNA 3UGHA 4B3TO 2RCVA 3B69A 1DGWA 1R093 1IBLO 5FUIA 3WUCA 4XF3A 4O4IB 1N1VA 2NZ9A 4EE2A 4DV4O 2ES3A 2QZ3A 2XJTA 1WP8A 4AQSA 3Q8CA 3VHRA 4N8MA 2YROA 4CPBD 3O1UA 4KWLA 1US3A 2Y6KA 5L7OB 2QDOA 1VMJA 1Q82W 3FHIB 1SQPH 3NQHA 1MEC3 4EROA 4WM7B 5CADA 1DFQA 4JGZB 4JQTA 1HLCA 1ZX3A 1F15A 2A6WA 4FP2A 4JTNA 1D2SA 1MS8A 4GKKB 1W9FA 3DGTA 4LXLA 2PAKA 2R32A 3IPVA 1C4RA 1NAEA 5JCTA 1LRHA 1S0EA 3QOPA 1RUE1 3SEEA 4I4TA 3BHPA 3TXSA 5I8SA 2YICA 1VQ6V 1QCEA 2PMWB 3HWJA 2Q5TA 1HP8A 4JPRA 2QM7A 3WF2A 4WV8A 2R70A 1YZBA 1MABG 4LUMA 1A32A 1C8M1 2Q1FA 1MR5A 2BE3A 2Q8OA 4QPIC 2HEYF 3OD4A 5KXCA 3M7AA 3FX3A 2YXSA 1VQLV 5JUVA 1SZBA 4IE7A 1TME2 5JIAA 1TGOA 4UXNA 4GMP3 1UPGA 4EB6A 2VZRA 3DPRC 2ZGSA 1K12A 3ZRVA 5FMOL 5EXOA 4EN7B 5IYZB 1T6BX 2P4EA 2UUBO 4BQ4A 1YEWA 1PO11 3MD0A 1HB3A 4ATFA 1UYXA 5EBLC 2CTWA 1W9YA 2ZCWA 4A7ZA 3POGA 1ASJ3 1POV1 1ZREA 2BCCH 1V54B 2I74A 3TWIA 2ADEA 3I2FA 5IVBA 4L9BA 2BTVC 5A3OA 4IHJA 1RUE2 3BPSA 4K8XA 1CZVA 4I0WB 4GWJA 2B39A 1OUXA 1Q6HA 2ID4A 2ENRA 1BEV1 1SQVH 3Q8FA 5FYCA 2RNBA 1TNRA 2QQMA 3I2KA 2VMEA 4M3CA 2CH7B 2DUQA 3WY6A 2R071 1K45A 3OBRA 1IKPA 2P3YA 2A3XA 2CWSA 4D7TA 1H2KA 2D2CB 1C8M2 2QQVA 3KV5A 3JXSA 5EFUA 1OCZB 2PF4E 3VBFA 5FPBA 2W87A 3ES1A 5T52A 3Q4HB 4J10A 1GWMA 3IZOA 3RZGA 5FUNA 4IV1B 1BQZA 4CH5A 4MGTA 2D7FA 1QR9A 2JIJA 2JG8C 4CCCA 3I5DA 2NQYA 2HLEA 1CD3G 4NIAA 1SG3A 2KKWA 3ZO0B 1WN7A 3H8OA 1DIWA 4RQEA 1GU3A 1PO12 3I8TA 2WO1A 2OCHA 4FM2A 3PVNA 4XURA 4I0XA 3HT2A 5HV0A 3B77A 3P1IA 5C7GA 4EN6B 1W0KG 2VPVA 1KECA 4FTSA 1LAJA 3BN6A 3D36C 1AR92 5KA6A 5GKAC 4TT3G 2UXDO 1JH5A 4YVWB 5FP7A 1BEV2 4D8MA 4KMQA 4JTAB 5DUUA 5FZKA 1YSCA 2RS33 1ZLZA 2R072 4F7ZA 4GCZA 1AI4A 2DFCA 4LHKA 1K92A 4G2KA 1MG1A 5KHJA 1FOD1 5FZCA 1ND3C 1V55B 1W05A 4LNUA 3WDVA 2JDZA 2IXKA 4K7JA 3ZM8A 4QDRA 4E2QA 4OXSA 1GRJA 2JDIG 4QHBA 1VQPV 4QQ2A 4Y1ZA 1XU2A 3KB5A 2ETEA 1EUUA 3OMIB 2CNAA 1MS5A 1TVGA 1NH2D 4Y1YA 3K3NA 1X33A 3JAKA 4IT5A 2BVVA 3U78A 5DM6V 4WFGA 1K3EA 4MGKE 3JCZA 4JHTA 4HPKB 2NNUA 2Q7GA 4JYAB 4I55B 4QAWA 4WBBA 4FLXA 1C28A 3JD1A 3HKBA 2FD8A 2FQPA 1BKZA 1ACCA 5FP8A 4QB6A 2Z0AA 1X36A 5JQGB 4YW6A 1OC1A 2XXZA 3SHRA 4RD7A 4R50A 4CU9A 4IEQA 2R043 4U2AA 4QX8A 3IWZA 2R30A 3NKTA 4WZCA 3SYOA 2JEMA 1RMU3 3GYDA 1JXNA 3IFXA 2FBEA 3HN3A 3V0BB 4TV8B 5KX5A 1X50A 1IPKA 3ZXJA 2ZEWA 1FOD2 1QJX1 5JPNB 2KA3A 5ACA1 3PUQA 2TNFA 5B3SB 1Y67A 3ZJZA 3K5NA 2WWWA 4CDQB 1GM8A 1UZVA 1V9U3 1TG7A 3O0WA 4MADA 1Q6IA 1F31A 1O5UA 1MZ5A 4BLJA 4JGSA 1XREA 2KG7A 1ENRA 4KHPB 1KEXA 3ZFEA 3LFMA 1C1FA 4JDOA 2F4LA 3K79A 4JI1O 1L7QA 3SCFA 5A3PA 1UCXA 1AR63 1HNXB 2OXBA 2MNGA 4XJUA 3VN4A 3JD2A 1WJZA 4WZFA 5H6QA 4AL9A 3D6EA 2PYLA 5HXMA 3N2GB 1DK1A 1YNAA 4GLXA 3I59A 2XGXA 2PFWA 4QDSA 1RUNA 2Q8EA 4AHWA 2ZS6B 1U5ZA 3FB6C 4GH4A 1NUKA 2QKAA 5JVDA 1SETA 3T1YO 4DR2B 3N35A 3NKGA 5FK7A 1Q43A 3O1VA 4AXOA 1QJX2 2VZ3A 5GJ6A 5ACA2 2W91A 3O0VA 1NT2B 1AVBA 2IXIA 4DRXB 4PDLA 4UW4A 3VBUC 3AM2A 4LHLA 1M90W 3NXSA 5C4WA 1AHSA 4U3JA 4PJ0Z 4JI6B 1EPWA 1PZ9A 1ZZCA 2ZR3A 3JARB 3TN93 3EBRA 4GQ7A 4M00A 1ZBA1 1VMHA 1T6GC 2WJSA 5FMOS 3ZYIB 2Y69C 1M56B 2JIGA 2YGLA 2JRIA 4XUNA 4BOWA 1YXBA 3RPQA 4JGYC 2P6CA 3V64A 3OUIA 2WRAA 1K7DA 2YBKA 4IYIA 1XU1A 2X8KA 1AYM3 2AUYA 1R1A1 2GP5A 5A6QA 4LBLA 4L8JA 1D2DA 5IVYA 2YI9A 1XNBA 4JAVA 2HLDG 3JUUA 3SCGA 4Y3OA 1KRIA 5DG2A 1RHI1 2FDGA 4NB5A 3NMBA 3WHTA 3HN1A 4Y20A 3OFNG 3WW1A 2JS5A 1W6PA 4MGZE 4B3MB 1WMFA 2GH2A 1GP6A 4IEVA 3GWKC 2E75B 2WYSA 3B93A 1OCCB 3BA8A 4I50B 1ZBA2 2AHYA 4J11A 2BU9A 2IJKA 5BNOC 4LK7A 2DMXA 3OR7C 1MQTA 2HJDA 2ZTNA 3MHHC 4DV7O 3SXWA 1V6NA 3CEIA 3LZZA 3G67A 1XNKA 3QTCA 2P37A 3OUJA 3CB2A 2Q5ZA 4P08A 4K3UA 4ONUA 1SDWA 1ND2C 4AVBA 4CUCA 2WQ4A 1RUJ1 2Y4UA 5FY4A 3A4UA 1QMJA 1R1A2 5IVCA 5C9AC 1IDSA 3FHAA 2DF7A 4IGGA 4YZ2A 4C91A 4M0HA 1Q6UA 2A7WA 4X1KB 2JICA 4ZU4A 3IBMA 4DXSA 3ETDA 4BW5A 1HR0B 1OA3A 1SEFA 5LP6A 2CTQA 1H2MA 3O12A 2A6YA 2DCTA 4DXTA 4PDMA 1JODA 5F32A 4QKBA 4J80A 4X1IB 3PL0A 4L97A 1H8TB 4HKLA 2O0OA 5LZ6A 1PM7A 2UXNA 4PLOA 3IC7A 4BAYA 3WP3A 2BVBA 3MHSC 3HQRA 5FP3A 5C8CA 3B9IA 4GX1A 2DU0A 5IK5A 2D44A 1SFNA 4PI0A 2OIIA 3RYRA 4L0PA 4KBBA 3I4IA 3POJA 4FTBA 1UAIA 3N7JA 4ES9A 5B5EZ 5F7UA 4XF0A 1AUYA 1B3QA 3PLQA 3T1CA 4FFKA 4FFBA 4MW3A 3U0ZA 1BHAA 2WNUA 4HYOA 4PF5A 3HPNA 2QM4A 1AJKA 1RUJ2 4LR3A 4XJAA 4XTPA 4GKXA 1WA8A 1UN1A 2RDQA 3H3ZA 4X65B 2VVFA 3E83A 3VBRB 1TMF2 1KDKA 3UV9A 4MSWC 3EHBB 2XJSA 4MTGA 4XAAA 5CFCB 3T0DA 1VF6A 3POFA 4ZKIA 3HT1A 5BYNA 5FO9B 1DYPA 5I93A 1CAVB 5FPRA 1ENQA 3ASOB 4QQPA 1ODMA 1XBFA 1B06A 2VUJA 4LBKA 5T5JA 4J7JA 5CNAA 1H4HA 2BRTA 5F37A 1NKGA 5DUVA 2GNDA 1US6A 2XKPA 1FX5A 2W39A 4XUOA 4ZU5A 1WUVA 3JALA 2CY6A 4XETA 2I07B 4JI3B 3P5BA 1BVVA 2BNMA 4Q0PA 1SHWB 2F43G 2X5IB 3JQWA 5FXXA 4LF7B 5FYZA 1GNYA 4LWSA 1ULCA 1BK0A 2IWGB 4FCAA 2WLJA 4M0NA 2CSGA 3EMRA 4UV8A 1NQTA 3RZJA 1X9PA 1ZRIA 3M3CA 5EC2C 2HWC3 2QKDA 3VDCA 4LE3A 3ASIA 1HQNA 4CVUA 5AVPA 1ZZ7A 4PDWC 5FDBA 3WDWA 2JWPA 5IVVA 3K9AA 3V56A 4GX0A 4PBOA 4Q4Y3 4LKFA 4HVRA 4YGCA 3JD73 4AVAA 5A3MA 2ODMA 3UKTA 3UNPA 1NLRA 4OHYA 2QBXA 2RN9A 4I7ZB 2H0VA 1RVF1 1VQMV 3K51A 5K4LA 4ASUG 1SQBH 5IHRA 3QVNA 1S72V 2XASA 5FZFA 5LA2A 4K0KO 2Q1ZB 2D6OX 4OPAA 3AZYA 1GMMA 4XBFA 2BBVA 4KHPO 3WD5A 1URXA 1R3JC 4YPJA 4CE8A 2ZMKA 1ZYBA 4RHV1 1VARA 2WLLA 1VBB1 3A7QA 5BNNA 2ZKOA 2OS2A 2YIBD 1JUHA 2WFF3 1EBOA 5KR7A 4RFT0 1DLBA 4LIUA 1VIWB 1SS3A 1O6UA 4K35A 1XQ8A 2JENA 3BIEA 3BPZA 4QKFA 3HKDA 1IX9A 1DBNA 1QQP3 4N53C 3B8NA 2ITCC 2YSUB 3B94A 5BNQA 5EIBC 4LCUC 1ULDA 4DUWA 2UWCA 1VB2A 3H1MA 4DFSA 2Z2SB 1RSOA 5LRSA 1RVF2 4ZBMA 2Y38A 5LYJB 3PJYA 1OBNA 4FFGA 1Y9MA 4KU7A 1JJOA 3E8HA 2FCVA 4FLTA 1L0NH 3AXEA 3SISA 1OH4A 2DQ3A 1R081 1FYJA 4P2ZA 5JXGA 1W6MB 4DY3A 5A3UA 5FWEA 1A3KA 3OTFA 1Y43B 4RHV2 2BGCA 3DYMA 1OLQA 4ET7A 4LBMA 4BMEA 1COV1 4MS2A 1VP6A 3BFRA 3KCYA 1QHDA 3E22A 3WNPA 1I5XA 2VCBA 1Q7YW 1WLDA 4CXYA 1MA1A 3WINE 2JJ6A 1DCSA 5L3EA 4ITCA 3IAQA 2BDRA 3H1YA 4TTGA 1RC6A 4CA9A 3POEA 4K8RB 5CVRA 4ZONA 2WYFA 4H14A 4AOCA 2UU8A 1W3XA 4I02A 1POQA 2VNVA 5BNPA 2XJPA 1UIJA 2VR4A 3F5WC 1PIV1 5EBWC 3JB8A 1TME3 1WCDJ 2OTLV 2WAAA 5JIUA 2GC2A 2C26A 5HCFA 2RJ2A 1O4YA 3W7TA 1JYWA 5GZGA 1LOCA 4AAPA 3Q8BA 5FZEA 2ATKC 1R082 5EZYA 1VR3A 1OQDA 1SMVA 3ABLB 1HNZO 4GKYA 2V5DA 2NMNA 4CPBA 1TVKB 2VMFA 2WZR3 1RUC1 2PAMA 4TOIA 5LXTB 1F51A 3L75H 1QR8A 1EPZA 4WVMA 1KC8W 2HYKA 1SPPB 2FCUA 3OGSA 2QUOA 1RUE3 4ZOLB 2VTXJ 3ZMUA 4DPNA 2GTAA 3ACIA 5IWAB 3E6BA 3T4ZA 2CAVA 3SCHA 2ZGUA 2XG3A 3IMMA 4AHXA 3WNKA 2VMIA 2YYOA 4MVMA 1JFFB 1NA1C 5DAWA 2C0ZA 1B04A 1R1ZA 4BU2A 2PHLA 4ZHQA 2B46X 2F4VO 3I3QA 1GM7A 1LEMA 4X64O 3APBA 3T4HB 1SESA 3KHBA 1PIV2 1UPSA 3KT4A 4RUFA 4LFAO 1G9BA 4OUMA 1MS9A 1NCRB 4JI7B 4KL1A 3CJIC 1S55A 5JCOC 1W6NB 4PBPA 5B1AC 5FREA 1NXMA 4DYLA 3U1XA 2VGDA 3WV6A 2A9HA 3ABKC 4AI2A 4JI4B 3UESA 3JBG1 5D8AB 5ABJC 3PMSA 1PO13 1IGOA 1PHMA 1DQ4A 1C5IA 2HR3A 1K4DC 1RUC2 1FFTB 3M4FA 4RR3B 1VBA1 1GZCA 1UYPA 1NY71 1NZ6A 3ZN6A 4UFKA 1F4AA 1PD3A 5ISLA 3ABMC 1W6OA 3MI8A 3H3UA 1AR93 4O4LB 1UIKA 3ZFGA 2NP0A 4K1ZA 3MBWA 4NMIA 1SACA 4LF5O 1N32B 2Q8VA 2CYFA 3C7EA 1JYIA 3AX4A 5FUPA 1YI9A 2Y6LA 2R073 5FNVA 1NZIA 1OCOC 2EX3A 4YZ3A 3ZN5A 4XAEA 1HNWO 4ZZ5A 1CX1A 1P84F 4Z07A 3VD3A 3DXRA 3NSTA 2VOWA 4Q8LA 4DEQA 4EZHA 2CV6A 5A1FA 1BBT1 2NYYA 3FB7C 2VC9A 1CN1A 5FXWA 2WINB 2QQPA 2KM2A 3RQ0A 4WM8C 2ZGMA 1XNDA 4D69A 4JHZA 4LBQA 2RDCA 2GV9A 4TV9A 2RE9A 3CMGA 4Q4X3 1TUBA 5IT9N 4QKNA 2NR5A 1UOFA 4FVMA 3OUHA 5BY1A 4BXSV 3JBG2 3VGIA 3GHMA 2UWBA 1W2UA 3IPVB 2VBBA 4N21A 4GYCB 3SYPA 4Q1RA 2OUHA 5J36A 3W7UA 3OPTA 1VBA2 2TUNA 1NY72 3N9LA 5FL7G 2KQXA 1VALA 1JOYA 1VE0A 3PUIA 4LFCB 4MVZA 3B00A 3T2PA 4QU2A 1HJFA 4BQ5A 5KHIA 5FLXN 3ZRSA 3ABTA 1HN1A 1NG0A 1N34O 1YLLA 2PI4A 1FFXB 1W8OA 1H8HG 4WFAV 5LRRA 1V70A 5JOXA 5FR3A 4QPGA 3I3MA 2JDHA 3ZXAC 4QMAA 3LPFA 2Q0AA 4YJ3B 3IDEA 5DUWA 4HMZA 1LKNA 4RL7A 5D21A 4AVVA 1VQ5V 4CU6A 1BBT2 2OZJA 2DBIA 2E7TA 4PA3A 2ARBA 3VBBA 5SV8A 1G6NA 4JZ2A 3W9AA 5CA0B 1ZZ8A 3IMNA 5EIYB 4JF3A 1QNYA 3RJRA 3L9DA 4YLZA 1BS3A 2QQJA 1AR81 1DHKB 1PK6A 1WW4A 2QWNB 2W0XA 3UT5A 3L74H 2JGUA 3AYCA 1RUD1 4XCBA 1G1XB 4NRPA 4AFAA 4NVPA 1GKBA 4IHJB 1CAXB 4TWKA 5AG2A 1LGBA 4XDLA 2WLKA 3SPIA 4EWEA 2EAKA 3D3AA 3FLRA 2C2AA 4KWKA 2WNVA 2RG4A 1C3HA 2H0BA 3GBFA 1UU5A 5E8AA 3ILRA 1GLHA 3I2DA 5FJKA 4YZ4A 3WDUA 1ORQC 4LO5B 5JSPA 2DWEC 4MGQA 2QE3A 3VB9A 4GWIA 3VL8A 2VZUA 5H9QA 4FP3A 3VBFB 4UXAA 1WA4A 2YGMA 5JLVA 2Y8KA 1FPOA 3J4UH 4DRRA 5GZCA 4ZI7A 2BUKA 5ACA3 2RR11 3WP4A 3S3WA 5FYHA 3I56V 3N7LA 5CU1A 4AGGA 1H0BA 2QJ1A 1O8PA 1OA4A 5FK8A 4R8CA 3ABUA 3C7FA 1EN4A 4Y4RA 2D6KA 4QQLA 2ZD9A 2W47A 3AG4C 5JZGA 1ZBE1 5EP9A 3GZEA 4Q20A 1AR82 1LOFC 3B7MA 3VDDC 1A8DA 4QPJA 4I0XB 3AG7A 3IDCB 1L8DA 1VLNA 2ZNIA 1GP4A 3BU7A 4DUXA 2UU9O 1U5XA 4CH6A 2EXJA 2DYRC 2A70A 3E86A 1RUH1 3FJSA 4MGYE 2ZXWC 2WN2A 3AKTA 4JTDB 2VO5A 2BP6A 3D82A 4W65A 1CESA 2CDYA 5FLJA 2R9RB 1WZXA 4XC9A 1JR9A 4YNIA 1PMIA 4W4ZA 1KD1W 1M4UA 3OEAA 4PELA 1UW8A 1MNGA 1V6MA 1DU3D 3WNNA 2W5FA 5K9YA 1VQ7V 3MICA 2E7AA 4LNUB 5FPXA 3AVRA 4MO3M 2RR12 4W6WA 5A33A 1O4ZA 2YB7A 5T5OA 1N8RW 4F6EA 4V2WA 4XBNA 1UOGA 3T0BA 1VB4A 4DNYA 1GQGA 5FYBA 4LITA 1OF3A 1PZ8A 2PYJA 3RMXA 1ZBE2 4B1LA 5JR2A 1W9WA 4OI2A 4CDXC 1YFXA 1OLMA 3HKBB 5T3NA 1BJQA 1DQ5A 2DCKA 2W1QA 2D5FA 4QWNA 3VD4A 4HN0A 3WDXA 1KFUL 1ZWIC 4WVVA 5KHHA 1RUH2 2D3OW 2WNEA 3WR0A 2PELA 4IEUA 3AKSA 1CGPA 5IWAO 3POYA 2VD7A 4WCEV 1VQ8V 1C1LA 4FVVA 1YXWA 4AI9A 3HJRA 2ZMLA 1CPYA 2W94A 3ZPYA 1R1A3 1VRBA 4LC1A 4D7YA 2WLNA 2F17A 1FT9A 3G6BA 2ZR2A 4IQPA 4DOUA 4KQ7A 4IGQA 2AW9A 1MEC1 4NWVA 4BR6A 4LOTA 2GALA 1G9DA 1MSWD 1AL0G 4QXCA 4GUNA 4MHRA 2RJLA 1IQDC 3RYFA 1PV0A 3RYHA 2DE0X 4UI9L 2KG7B 1VRH3 3N4MA 5JJEB 4UCOA 1AX2A 3QBQA 4YGBA 2RDSA 3ICXA 1RTVA 1QNWA 1N36O 2JDUA 1OPMA 2EIEA 4DR6O 1JYTA 3HQUA 5A7QA 1S77D 3CL1A 5E79Z 4FLUA 3I59B 3ZSJA 1RUJ3 4IV3A 1JYCA 4NOTA 2D3PA 2ZACA 1H2SB 2ZBJA 4GH4B 4R6ZA 4FXKB 1TMF3 5JVDB 2EXIA 2VQFO 3BTXA 5L3CA 1OZ0A 5F2VO 4XXPA 2XL7A 2VXJA 3GF6A 4FOYA 5LW9A 2ARAA 3MDPA 5APAA 3IC9A 5ITZB 4DV1B 1E1RG 1K5SA 4ABMA 5C4WB 5A1LA 2N74A 3MEPA 3ON7A 3CHXA 1QH7A 3MO4A 1W8ZA 3CCQV 2XUEA 4X89A 4I9QA 4YW4A 4GWMA 1JCHA 1IXBA 4CS2A 4I55A 3JAWB 1L7RA 1PX3A 5LWBA 1PVXA 2X6AA 3PDQA 1OKOA 4MOAA 2X53S 2OIEA 4N53B 5JQGA 4KH9A 2WZ8A 3A21A 5FZOB 3S7IA 5IY5C 4LH6A 3H8XA 4N43C 4JYYA 1QKQA 1RIRA 1R6KA 1LNQA 3OW2U 3GALA 2F6BA 1X59A 1W0JG 3CCLV 3PVEA 3VBHA 2Q8DA 1RUG1 4NRQA 3GCWA 4BQ1A 5CISA 4Z82A 2Y0IA 3DXUA 5L73A 2EIBA 1G7YA 4CCLA 4Y20B 2XAGA 2XVGA 1NS1A 3LD8A 3I2IA 4KWJA 4RO2A 2EINB 3R4SA 1J84A 4IEYA 3ZX7A 4Q26A 5EPAA 3WOGA 5DN6G 1Z78A 2PZSA 1T5EA 1VQNV 3H1WA 3X29B 3THTA 3L72H 1F35A 3ZMZA 5A6XA 1WGPA 5FPUA 1FPN1 1MQTB 4FPFA 2Q6AA 1LCLA 3DECA 3NJVA 1CP9A 4LLOA 5L3GA 4Y5Z0 2ETNA 4RYDA 1AROP 2D43A 1JW6A 2VJXA 3ASNB 5FYSA 2HVKC 1JA8A 3ZHVA 4BB3A 1Y9GA 5J1XA 2IC1A 2RS31 4XW3A 3S5AA 2XOMA 4Y5SA 1GOFA 5FXZA 1YQ6A 4JV5B 4CCMA 1G9AA 2FB5A 4JRAA 3OGIB 1CR7A 3ZLIA 1W99A 3I97A 1RUG2 1BGYH 4A45A 1AR4A 1XYPA 4U7OA 3LA7A 4GKJO 3AP4A 4JYCA 1URFA 4Y1VA 5EWSA 2ZMNA 4IL7A 2Q9LA 5DAQA 1ZRDA 4DRXA 4R9BA 4ZZ8A 4BYYA 2Z4FA 4CDWA 4AVCA 2FDFA 3BUCA 1EAH1 1RYYA 3OTOO 2LM3A 4UT5A 2BV4A 2ZX4A 3V65A 4CEWC 1RVF3 4DR1B 3J7NA 4O4HA 4UW5A 1IBKB 2ADPA 5E1RA 1Z7S3 4OHXA 1FPN2 2GUZB 3GWOA 2YHJA 3BRCA 4QXBA 4LF4B 1LOEA 2HEPA 5IK4A 5T50A 3RNSA 2VU9A 2JX9A 1WLCA 1AX0A 1KXGA 1UOJA 4I09A 4FFBB 4QGMA 4MZUA 3DKQA 3DC6A 4AEDC 2WNUB 3KSCA 4NN0A 4PQQA 4RHV3 2RS32 3T4VA 1BHBA 1BQ0A 2Q67A 2VULA 4AAXA 1GR3A 2A3QA 1L3JA 5JAXA 2QFEA 4DUZO 1PNGA 2QWPB 5FZMA 2R6QA 2VUDA 5DDJ2 1NOVA 1NJIW 4MV2A 4IGPA 3VQWA 2CTPA 3WDTA 1XOUA 3FLPA 5B1AB 1VJ2A 2ZDIA 5LY1A 1NI8A 2J7MA 1UZYA 2VOKA 1QVFU 1YWKA 2XDVA 5J37A 1EAH2 1V9U1 4URTA 1IPJA 1WB7A 5JSOA 2P1BA 2BTQB 3PURA 4NTXA 2QJVA 3HOBA 2ZGKA 1MS0A 2E51A 1NVPB 4IESA 3C3SA 3CRQA 1I3HA 1ZZBA 4OI0A 1AR61 1MVQA 3A22A 2A75A 4L2NA 1O4TA 2GMPA 1NE4A 2J1RA 4E4ZA 2AGAA 2UY8A 4LWSB 1VBE1 4M3CF 2P90A 1OD3A 3WCSA 4FZ0A 4AG4A 2VQ0A 3IDBB 4ZKTB 1VQOV 4RSUA 5BXZA 2H6CA 1QDCA 5FZBA 4S2HA 5GTIZ 3D4KA 3RI8A 4QGNA 3ZFFC 4P9XA 3A0NA 1JZ8A 4CP0A 4X1KA 1EUTA 3HNBM 1XYOA 2ZGQA 2VY0A 5A9GA 1OOPA 4NXNO 2UURA 3FWEA 3T2MA 4OVEA 2AH2A 4X1IA 2E9QA 2W92A 3S7EA 3ZHQA 2AR6A 1Y6XA 3AG3B 3THCA 1YJ9V 3QNEA 1V9U2 4NROA 1EYBA 5K0UA 5CFDA 4AR2A 4RS5C 1H1AA 1U5IA 2B1IA 5EQUA 3ILFA 3BOPA 3U14A 2GMEA 1WMEA 4Z2AA 1WCUA 1PIV3 5HCHA 3RBZA 1NQJA 1ULOA 3IT8A 5T5LA 1O3QA 4IEPA 4Z1MG 4RQPC 3APQA 3ZYRA 3RW0A 3ZXEA 4NHYA 3K46A 3J7MA 2ZEZA 3RJ2X 2IFWA 1VBE2 2WLLB 1SQFA 4CSWA 1H9WA 1YITV 4FT8A 4DB5A 1RUC3 1IVSA 1M57C 4YW2A 4BW9A 3CZUA 3ZRWA 2E63A 2GAUA 4AFBA 5A3TA 5HFMA 3E6CC 3ZEDA 5CBGA 1HDKA 3IIIA 1LODA 1N47A 2ZIMA 3K57A 4OULA 3FE5A 3HKDB 1S76D 4CDUC 2VTXA 2DYCA 4IE5A 3EFFK 1SF9A 3OEEG 4GX2A 5F9TA 5FZ3A 3BALA 1Y3TA 4C8DA 3SJCC 1XQNA 1DYOA 4J1XA 2X0LA 4QB2A 1WMXA 3DC5A 3HVDA 3OGRA 3WW3A 2DUPA 2Y0PA 3CXCU 2DVAA 3H1KH 1KQRA 1DDLA 2XH6A 3R6SA 5FBJA 4W6YA 4G27B 1K5MA 1PO21 2DVFA 1I6XA 3H42B 3MLJA 1UF2C 4DR7B 2RVAA 3D8CA 3CNAA 3P32A 3NV1A 4CEYA 2XTAA 4XUPA 2UXBB 1GQHA 4AGRA 2D5HA 3A0RA 3AG2B 2ZHKA 4Q1PA 1DGWX 5LMUB 4J9YB 2C5DA 3SH5A 4FSJA 4JTCB 4XIOA 3ZCCA 2JDNA 3AEIA 1X9TA 5I0UA 3JBG3 5F39A 1YUDA 4ZPIA 2EIKB 5EC1C 3K9SA 5C3QA 5FAXA 4AK3A 2G38A 1U12A 3KZIZ 3AP6A 3E22B 3CCJV 1VBA3 4HOOA 1EZVH 2RHPA 5CA3A 1OI6A 3BAAA 4EJRA 2W1SA 3CF6E 4M01A 2YPJA 3E6DA 4AFMA 1OFNA 1UPIA 4DXWA 1FXKC 3GM8A 3E8BA 1Q8IA 2ZXQA 4FFFA 2UXCB 2BWCA 3JCIA 4BQXA 1ONAA 1V6IA 1ZRCA 2DJVA 4LFBO 4BQYA 5BNPB 2R061 1ST8A 3AJYA 1PO22 4BISA 1S4CA 2MPFA 4UFZA 4OX9O 2Y6GA 1BXHA 4FPCA 1BBT3 1Y74B 5FYYA 4LNVA 4K8FA 3ZHRA 5JSRA 3A0BZ 4LF6O 3H9AA 5A32A 1PX4A 1W2AX 5J2TA 1RGSA 3KGZA 2B8MA 2ZXWB 1UWWA 1AL23 3K2OA 3VBSC 4WFEA 4WFFA 1OV9A 5EZYB 3BIWE 2ZEYA 3WQBA 4URAA 4WVZA 4X8PA 2MEV1 3PNAA 3M2MA 1U97A 1YYNA 2Y33A 5A7PA 5BR8O 1Y4MA 4CS4A 4GALA 4UFMA 2AC1A 4YHHB 2E32A 4YM3A 2L6LA 4WVMB 3FHQA 1VBD1 4QPIA 3IM0A 2K9ZA 2DN9A 2G9FA 4H13B 2UUCO 1QDOA 1QJU1 4AFDA 2W46A 3WB2A 3ETEA 3D3IA 5LCWL 4X62B 1AF9A 2AEZA 3VBOC 3DPRA 4QDQA 3G80A 2B45X 2VMGA 1XI1A 1NR1A 4X8NA 1NVPD 5LATA 5LBCA 3GZAA 1T2XA 1XC6A 2FDHA 1A6CA 1RUOA 5BNNC 4TQDA 2BW8A 2A79B 1VF7A 2A3WA 2QWQB 3FMGA 1DGRA 2R062 4PCRA 2P4KA 2OQ6A 1WD4A 3FAVA 1FS0G 1CAWA 2WLPA 3BU0A 1IBKO 1EFRG 2YEVB 2JG9C 1DLLA 2FHRA 5IFPA 2HYXA 3LOBA 4R8HA 1YJLA 2XAFA 4AVTA 2ZAAA 2MEV2 4BK4A 4GIQA 2WUHA 1AR83 5FPLA 2GMMA 1JJ2U 4AI1A 3NJZA 3CMAV 2GDFA 1QJEA 3ZHSA 2BFUL 4ARXA 4X66B 1VBD2 2P6JA 1A8MA 1YQ5A 3UM7A 4CUAA 1BCCH 3SDLA 1GM9A 1B35C 4FAGA 1QJU2 4LKDA 2XPJA 4DR3B 3U4XA 2HWE1 3E89A 1H2NA 2DTWA 2D40A 3LB9A 2JG8A 3ZFGB 3SLIA 1H6YA 2PHUA 5F3IA 3K03A 4LLFA 3WQ0A 3JD71 4MH0E 1UY3A 5FNVB 5CYYA 3OE7G 2EICA 2ARCA 4IDZA 1WA6X 3LQCA 4AWDA 2OKXA 2RDNA 1NCQC 5GLTA 4EWDA 3L70H 3I3DA 3S6PA 4Y1XA 3OGJA 2PQSA 3APOA 3D36A 2JDKA 4IETA 4LBQB 2XBO1 4QKDA 4TV9B 2WPDG 1TUBB 4QPWA 1UX6A 4FPKA 3JCUZ 1FXZA 3VD7A 1VAKA 3KF3A 4GZRB 3ES4A 1V9PA 2UUAB 1ZBE3 2A0LA 3AKQA 2LUWA 4YIPA 3SPGA 2B9ZA 3RN4A 3NV4A 4UCSA 4BQWA 1WB8A 3OAAG 2WFF1 1SPPA 1ND3A 4X88A 5LA0A 2WN3A 1JBCA 5FY0A 3ZDVA 3ZS8C 1SQXH 4UV9A 1XMOB 2ZCEA 3CRMA 3UL2A 2VZSA 1H9PA 1RUH3 2WAOA 1QQP1 2HWE2 4J7KA 3U11A 4YSFA 4JI2B 4I5SA 1JFFA 2E5LO 1PNLA 1OF4A 3UKVA 3KQRA 1MOFA 2WIIB 5E89A 5CBLA 3OF1A 2VH9A 2WWJA 3LSDA 4XILA 5J48A 2BSKA 1IS4A 3JSLA 2KD7A 4QPGB 2ZE7A 1GYKA 1XL6A 1U0AA 2DYSB 2XJVA 2G9ZA 4EFEA 4D6QA 4BMBA 4QPYA 4EN8B 3K4ZA 1O5LA 2OCCB 2VECA 1W2NA 3H8RA 1R73A 1QWRA 1H6XA 3NVCA 5GW7A 1TA8A 3GBWA 4FTEA 4KXRA 2XBO2 1O91A 3AMNA 4PLMA 2PY5A 2VZPA 3SQOA 4JC1A 1CAUA 4B3RO 2OX0A 1E1QG 3KCCA 3JD3A 1PK6B 5GZDA 3B09A 3N9QA 3UT5B 2DBNA 1KITA 3MYXA 2WZEA 3T1MA 5T5PA 5F8PA 1MS1A 3B02A 1I7FA 2LW1A 5A3WA 4DIQA 3DKWA 4RGGA 2WFF2 2Z79A 1FATA 2MHFA 3W20A 1NTMH 5LGNA 3TCUA 2QQOA 1VBC1 4I01A 1ENXA 4I0AA 2WNVB 2HG5C 4O4LA 1QQP2 1QXRA 4A5UB 1D0GA 4NHKA 1S2KA 4JI0O 4EEQA 1J95A 1V6OA 3RS6A 4CP1A 2KB1A 4NHXA 4IE0A 1GAXA 3KT7A 1UU4A 2IH3C 3CCRV 4W8JA 5G04L 2YMZA 4B3SO 4DR4B 3URFA 4UFJA 3AFKA 5CEHA 2X6BA 3KV9A 3QCWA 1TME1 3HR9A 3JD4A 4COWA 3O1MA 1PVC1 4ZI7B 3ZYBA 2IXLA 1EZJA 4UVCA 2UY9A 2BPA2 4XDQA 3TGUH 1QLNA 2B9VA 4DY5A 5FZIA 2A5ZA 4YVSC 2A3YA 3BEHA 2FCTA 3MIGA 3T2TA 3BCCH 3AFGA 2XWJB 5FO7B 2DCJA 3MIEA 1K5JA 3H50A 1NQDA 1UKRA 1XNQO 5BV6A 5JZGB 3CCVV 2WZR1 4Z1VA 3VD5A 4CP9B 4MW8A 5GLZA 2D3RA 3ZXDA 1AYN1 3USUA 3ACLA 1LJ7A 4AEJA 4LF9O 4XUQA 3ZX6A 2HWD1 4AQTA 2R72A 4NPMA 2UXXA 1GWKA 5FY8A 2C1FA 3USSA 4PQ9A 1DGSA 4NYKA 3TETA 2R0FA 5CA1A 1AJNA 1VBC2 4PI2A 5DN2A 3V0AB 3VBUA 1XUQA 4QQHA 3LA2A 5LHIA 3M3QA 1FFXA 5IVEA 3C2UA 3ZYJB 4BWOA 5F2WA 4CU7A 2XQRA 2JJ2G 3MGUA 4MUVA 3S0MA 2UXCO 3GZTB 5A6YA 5CBFA 5F3EA 3SC7X 4YJ3A 4P9LA 2C4XA 2FMYA 2LTNA 1XILA 1I9RA 5JXIA 2XLFA 1PVC2 3ZKUA 5AFEA 1JMUB 2WDBA 2GSMB 3NAPC 5A33B 4OQ9A 4YIOA 4JGYA 4MSVA 2HHHO 1H1MA 2XLAA 5CA0A 2FTKA 4XMIA 4D6SA 1XE0A 3VHPA 2X29A 3AZXA 1BVP1 4HFSA 1ZA7A 4LR4A 2A7AA 2JK5C 1ULGA 3OMNB 2WZR2 2EIGA 1AYN2 4AI8A 1UO9A 1KYOF 4DV5O 2QEXV 5L3FA 3ZIWA 1YQ2A 3CJHA 4E4SA 4XF4A 1CAXA 2HWD2 4J41A 3J26N 2A06H 3X2QC 4IEWA 3LSEA 1VIBA 1AR91 1YC61 1XNCA 3CC4V 1ULPA 1R3KC 5K1XA 4D0QA 4TLGA 2V72A 2EIMB 2BOCC 2BFUS 3KT1A 4QHOA 3I54A 4DXZA 3J7HA 5EK0A 4PV1B 3WG7C 3UQ8A 1OLRA 4JDMA 4JI8B 1WP7A 1P7BA 1LGCA 2C24A 1GOHA 4LBQD 2YIAA 2Z42A 4AVSA 4S2FA 2LP7A 3ZXLA 1KS5A 1RUG3 4J25A 3D5OA 5BNOA 4BQ2A 1XMQO 4NR1A 1HQWA 2G1MA 1G4YB 3D0JA 5C33A 3MIBA 1W0PA 2P6HA 4FPEA 1I94B 4A42A 3F2ZA 1REDA 3AVSA 5LMNO 1ODNA 3G6EV 4Q4X1 1YCIA 4ZHNA 4GB31 4D3WA 2FYUH 1ND2A 1NYWA 2DURA 3H7JA 3FL7A 5JI7A 2BNOA 1WLWA 2D6MA 3ZMNA 4HZ3A 2J22A 4XBLA 3RYFB 1JU4A 3EVKA 3RYHB 1QH6A 4WF9V 5C9AA 2Q0OC 1XOYA 2VWKA 3HAGA 1MZFA 1FPN3 2BOJA 5FZ1A 2YV8A 4LPLA 3ZIAG 5L7OC 4LA2A 1DGRN 3WNOA 4LKEA 4WM7C 1JHJA 4JGZC 2ZE6A 3ZN1A 3LDDA 4DV6O 1PMHX 2A6VA 3DCQA 4YJ2A 2QR4A 3B5LB 3N9PA 4YM2A 3ACHA 4CCEA 4H7LA 3ACGA 4IV3B 3SJBC 4AQYB 2J1VA 1DQ1A 4RS5B 2BTOA 2Y26A 1W28A 1REEA 4O61A 2E7QA 3O14A 4IERA 4RGKA 3K4DA 5DDJ3 2YC4A 2G4IA 4YY3O 3RZKA 3LUTB 4FPHA 1W8NA 1AR5A 4B4PA 3IAYA 4U7NA 4XDKA 2ZX1A 5JR7B 1GP5A 3SH3A 1WCKA 2EIDA 3IB3A 1OCRB 4Q4X2 4I3PA 4GB32 1S0GA 5J09A 1Q86W 3HKCB 1EAH3 3FZ3A 4A4AA 4O9GA 5JMCA 4TN7A 2JD4A 3ZN4A 5K7PA 1M57B 3VKNA 1TEIA 2R1BA 2ZHMA 3UO2A 1GH6A 4HKWA 4KWUA 4GJZA 1W06A 4AI3A 3SPHA 4NUBA 5JDBA 2PN5A 4CDUB 2O8QA 2VOXA 1SLAA 1FNZA 4F8AA 1LOBA 5JOYA 2BJSA 4A7YA 4CUBA 3VQVA 5KWRA 1CXZB 1AI6A 2JDAA 2JXAA 2A6ZA 1GQPA 1AI7A 4JAAA 1QVGU 1JS9A 4Q4V1 3OB8A 5HBAA 3VBHB 1S1AA 4XFAA 2VNGA 1IBMO 4K8ZA 1UY0A 1S0FA 2W95A 2ZX2A 3T4DA 2PI5A 5JVVA 3OD0A 1GN4A 3L73H 5CBHA 2ZKNA 1F5FA 5FZ6A 4DQAA 3M3EA 1N4CA 3DYOA 5A1AA 1SLLA 3WB0A 2PLV1 4Q29A 3N9OA 4IW3A 1DTOA 4PA4A 1J5EB 3ZXKA 1G8MA 1Q81W 1OCZC 4B08A 1K97A 3O1SA 1QNMA 3DSQA 4MTXA 4JI5B 4IV1C 5FKCA 4COVA 4MVUA 1E5HA 1YI7A 2F93B 1K33A 4MT8A 4PDWA 3VUOA 1XPWA 2RS51 4XPVA 4OI1A 4G9SB 4LO4B 1VBE3 1I1EA 4INDA 2WA4A 2WO3A 3RZHA 4LE4A 2P17A 3DGEA 1TNFA 3RYIB 3Q8AA 3U10A 3T2QA 2NN4A 5H2FZ 4Q4V2 4H7MA 1QJY3 4XTMA 3SH4A 1UXXX 3GJAA 3E5XA 4UYBA 4IL6Z 4FI9A 4FPOB 4H44B 3VBSB 5JMOA 5HCBA 4YVWC 1HRI3 5JI9A 4FPPA 4CDWB 2VMDA 3PUAA 5ITZA 4XFIA 4Y1UA 5DABA 4DW0A 2PLV2 4LH7A 1C8NA 4MVRA 3I3EA 1SLBA 3UKNA 3LEKA 2B5UA 1SZTA 3HB3B 3VHOA 2QM8A 2W2IA 5I0TA 1R64A 2XHKA 4Q2FA 3KF5A 1RUF1 4O4HB 3TOJA 1WLEA 4GKKO 2FKXA 1Q90D 1V55C 3JAWA 3MUY1 4AEMA 3WUDA 4U36A 5JJNB 2RJKA 2VNRA 4N53A 2A71A 3POIA 2RS52 1HN0A 5FZOA 1OQ1A 1ENVA 3QO8A 4DR5B 5EYPA 4BZ4A 2HKOA 3WQ1A 1NX9A 3W59A 1I0HA 4NRMA 5LA9A 3BVOA 1O8SA 4YWAA 4B3TB 4YM0A 2QWOB 3HIFA 1IBLB 1GZTA 5C3SA 4O4JA 5IDJA 2WQ8A 4QXKA 2XNDG 3BKZA 3CCSV 4W50A 3PHMA 3KCXA 4E27A 1JMKC 4DV4B 2H8PC 2Y6FA 1GUIA 3T09A 1KU9A 4LQRA 4R7CA 1VRH1 1GN6A 2GH8A 1PO23 1RUF2 3JAMN 1UY2A 4U3FH 3AP7A 1B35B 4E8CA 4CXWA 1N3QA 3NL1A 1HKDA 1QBZA 3MIDA 5B3SC 3GZUC 1OKQA 3AJZA 1GV9A 1SLCA 4KGGA 1OLME 4LO6B 2VZOA 1K9MW 4I0BA 4CDQC 4NPLA 4C1WA 3CRCA 4BLIA 3JD0A 5FZHA 1LB2A 1W8WA 2P4VA 1M93A 3KV6A 3TEYA 1P7GA 5KC5A 5FMDA 4NXMB 3GNEA 3WG3A 4QX1A 2WLMA 4FO9A 1TMF1 4XFGA 4K9SA 1KMIZ 3ZSLA 3N2KA 2VW0A 4JDNA 5F6KA 4G28B 3FN9A 2W52A 4JAUA 3PMEA 4P02B 2XL9A 3T0AA 1OOPB 3AC0A 2I2SA 3HBZA 4TUYA 1PL4A 2EILC 2B1GA 2W6IG 4Z8BA 5K0UB 5CFDB 4CXXA 1XSRA 1ZVFA 3AB0A 4NJ4A 3RZZA 2I45A 2QGNA 2R063 4O65A 1VRH2 2EIJB 3WU2Z 4OQ8A 3BTAA 2GUZA 2Q4PA 2YIDA 2UUBB 1AI5A 4BDVB 3W7SA 1QGLA 5JH7A 2WO7A 3CDZB 4O2AA 2WR9A 3QH7A 1BSMA 4J1WA 4X1YA 2YBSA 3KQ4B 1NA1A 3O65A 4Z92B 1JN2P 1JOPA 2MEV3 2QQNA 1W8HA 2WSSG 3TEWA 2NN8A 1OVSA 3DUIA 3ZRWB 1VBD3 1JHNA 3CXHF 2C9KA 4OZOA 3B8MA 2XHBA 4AQYO 1MACA 1RINA 1QJZA 1QJU3 1W04A 1RITA 3ZXGA 3CRRA 2CDPA 3PU8A 4OLLA 3CJIA 1DF4A 3LSQA 4A6SA 5JCOA 3N9NA 3F95A 3N27A 4XMAA 1XYNA 4P5HA 5KMGA 1LHUA 5ABJA 1UD1A 1K5MB 1O3TA 2V4VA 2BTQA 3QO5A 3SYQA 5B1NA 4K6BA 4CEYB 1S5LZ 2AZ0A 1ZZ9A 3MHZA 5FYTA 3O9OA 4JYAO 1BZKA 2M7WA 4EFBA 1SC5B 4NTYA 5DMYA 2F66C 4Q4W3 1SBDA 1YQCA 2P7TC 2EAAA 3CLPA 3H3LA 4FQ4A 1QEXA 3IJ4A 2XQXA 5LK7B 1OCCC 3M1HA 1BZWA 4Y24A 2ZGOA 1GO3F 4AGVA 3E35A 2UXDB 4Q0UA 2P3JA 1EP0A 3N7MA 2TEPA 4WM8A 1I5ZA 2HWE3 4IEOA 4QPKA 3OGCC 2IJJA 3AXDA 3CPWU 4H33A 1MPXA 4I3GA 1S5HC 1JZ4A 3PTYA 4UBGA 3JASA 3WG4A 5IYYA 1XHZA 1HIXA 1D5AA 3HNYM 3ZMOA 3CCMV 4XE9A 2VRZA 1YO8A 3BCWA 3S30A 3WP6A 1YTFB 3A0HZ 1QU0A 1Z7S1 5IJ9B 1NU1H 1W8TA 3ILNA 4MG2A 4KG0A 3VV1A 3TNPB 1GZ9A 5C5UA 1J5EO 5DZGA 5D2AA 3NV3A 5A32B 1JI6A 5FZDA 5J2TB 4QIWF 1ALYA 3T1HB 1YF2A 1H8TC 2VCAA 2XBO3 3MIFA 1ZRFA 2Y48A 4AI0A 3K59A 1YJNV 2ERFA 3LKJA 5GZEA 1HNXO 5CAZA 2YXYA 3M8LA 3KV4A 3P6BA 3KHCA 4QPIB 3L2YA 4CBCA 1RJ8A 3OEBA 2RM21 3I7DA 4AFCA 1R6TA 1Q5OA 1OHHG 4DV0B 4PLNA 1BL8A 5FZGA 3DPRB 3MF9A 4YFWA 2AYHA 4QE9A 1SBEA 3AG1C 4DR2O 2VM9A 1F8VA 1ZRRA 4XXAA 3EXAA 1WD3A 4QNHB 3WX5A 2A6XA 3E97A 3N3HA 5I0RA 4ZXKA 3QACA 4OUEA 3ZSMA 1JU3A 5I8TA 4JI6O 3VBRC 3TRSB 5CFCC 4XOGA 4K40A 2WAMA 3CO2A 1Z7S2 1PZ7A 3FAVB 2IFRA 4OYUA 1CAWB 2ZJCA 1GNHA 3ZXFA 5GALA 3X2QB 3G4SV 2W08A 1LECA 1AJQA 3U75A 3GHNA 2Z5UA 1M9NA 4OFGA 1PP9H 3JYCA 1ZM1A 5C3PA 4DO0A 4JVAA 3H9VA 1KB9F 4J7ZA 4JI1B 2CWMA 2ZIOA 1CJPA 3HPLC 1F23A 1AP5A 4NIDA 4E4HA 3LSUA 2ZX0A 4P9YA 1SQGA 3AL6A 2PYTA 2BZDA 1DQ0A 2RM22 5C5TA 3JATA 1UFIA 2NLJC 1HQLA 2PAEA 4K21A 1UZ0A 5IVJA 1AP6A 2WS91 2X5IC 2XHNA 4Q0QA 2JG8B 5LGTA 1VBC3 1KKCA 2D6LX 4EQVA 3RYKA 5DECA 3T1YB 4JKMA 2N7GA 2WT0A 3T08A 3O7OA 1ZA4A 3CIHA 4E2GA 1LOFA 5CB4A 3HEIA 3ORJA 3VDDA 4B3MO 2JS3A 2CGPA 1OD5A 4Q27A 1LUVA 3PUSA 1FMD1 4PIZA 4C0BA 4FAHA 1N1SA 1YJKA 1FD9A 4HLTA 1Y74A 5FZ0A 1ZL8A 4XACA 1PVC3 4A44A 3J7LA 3TAYA 4WFBV 1WKYA 2W3JA 1KD7A 1ZZ6A 1VMGA 4O7XA 2ZE8A 1BYHA 4YRDA 1U96A 3MLKA 2ORZA 2JDMA 1KBHA 5J2UA 2IXCA 3I2HA 4ZY9A 2MK3A 3R66A 3HMYA 3PTRB 5DXDA 1AYN3 4ZXEA 3AK0A 1UYZA 2P5BA 1ND3B 3J8F3 2HWD3 1NLSA 4NXMO 2K46A 4FOVA 3FFQA 2PHFA 5JXHA 1ZSPA 4LULA 3ZMVA 2N05A 3J81N 3STLC 1DF0A 1D7PM 2PTMA 1JZ7A 1ZUQA 2WS92 3TK1A 4UUJC 4B1MA 3AYDA 4N7IA 2ILMA 1HR0O 5FLHA 1KJRA 1UKGA 1UMIA 2D97A 4AF9A 3R05A 2QDRA 3E8FA 3NWKA 2HEVF 1EN5A 2BSKB 2PHWA 4GT1A 1D4VB 3VKLA 2XONA 4JV4A 2E74B 1E5SA 2C6SA 3GCXA 4CDXA 3O1RA 1FMD2 3OY8A 1HW7A 5LA1A 2R0HA 2YEVA 2VZQA 1H8VA 2GC3A 4CCDA 1LENA 1L7LA 4BM8A 3DV8A 4YGDA 4OHVA 2DVDA 1CAUB 1FKAO 3CD6V 1H8EG 3CZJA 2JE9A 3KKYA 4XDJA 3ZBHA 4DV7B 4PA7A 4QE7A 3OYWA 1G86A 2LFSA 1GOGA 2W1UA 5J9PC 1BLZA 1SQQH 2EZPA 2J1AA 2JDYA 1NT0A 3RMYA 4Y33A 4GA9A 3M3IA 5LBQA 1N3OA 4JCKA 4X65O 1YI2V 1YTFD 3H1JH 3LGRA 3EHKA 1J3RA 4S2DA 4CUGA 2YBPA 3VKOA 5J96B 4QM9A 2SLIA 2W6JG 5KUKA 3RDIA 4LIVA 1A34A 2LGWA 4XFHA 2HWF3 1W9TA 4KG8A 4QX3A 2D98A 4FPLA 5IJ0A 2R1DA 2HP8A 4DRVA 1AL21 2VUCA 3BTYA 5CG8A 3RGBA 2O57A 4GB33 4JI3O 2FZ1A 2EBOA 3RT3C 4GULA 2AHZA 2DVGA 3MFAA 4LF7O 3PUHA 3USUB 3ITQA 4ISQA 2HKXA 1ROPA 4MGSA 4D94A 3CP1A 1LR1A 2WO2A 1KGYA 3W58A 1FAFA 3ECQA 4ASMB 4IIJA 5CA1B 4P9GA 5A2QN 3WW2A 4ZU7A 4N7UA 1LU2A 5KAIZ 3VBUB 3ABLC 3J7AU 4CCKA 2UWAA 4QHZA 1WLTA 2OIGA 4LBEC 2BBAA 3ZHTA 1XRUA 4JTOA 2Y69B 4FQZA 3OG2A 1BK1A 5IVFA 2HH9A 2FMLA 1X82A 4MHUA 2GZWA 3AMMA 2BOBC 2ZAHA 4Y22B 4W4LA 1APNA 4JGYB 5FYUA 1AL22 2DOSA 5BXXA 4N43A 3ZKYA 4FBFA 5GLVA 2QQUA 4IYHA 2V09A 3T1HO 3G71V 1JTZX 1KP2A 1WW7A 4COZA 1RPOA 1EY2A 4P00B 1IG3A 3OGVA 2YPDA 3CJHB 3AP5A 3OBAA 1NCRC 4PA9A 1XXNA 5FY1A 5IW0A 1I08A 2HJIA 1WMDA 1C57A 3C7HA 1MMMA 1SCSA 2DCZA 4E8DA 3WHUA 3DL3A 5FIXA 2CGNA 2WSVA 3L71H 3PJQA 4O2BA 1FI2A 1MVEA 4DV0O 1H2GA 1SA0A 1V6JA 2EZOA 2YC0A 4GD4A 1KFXL 4HSJA 5D8AC 5T55A 1O9GA 1ZTEA 1CPMA 2QDNA 3LCPA 4Y4YA 3R0RA 4RR3C 3BOWA 5F3GA 4Q4V3 4W6XA 2GNBA 1Q3EA 1IXMA 3KVAA 4AHYA 2RMKB 4D7SA 5BNOB 1XSQA 2E76B 3CQOA 3RWKX 4ES8A 3RYCB 2FL4A 1IS6A 3M3OA 3UCSC 2HBUA 4COYA 1IS3A 4CS3A 4YW7A 5HPOA 2QWRB 5J3UA 3ZYPA 4IGOA 1YRZA 1ND2B 4K0KB 4QGLA 3PIGA 2PLV3 1DZRA 1JOBA 5DUXA 1K73W 1N33B 3VZLA 1LNSA 3WEZA 1Y76B 3NW4A 4CP9A 5C9AB 4OMCA 4PIYA 2D6PA 1TZOA 2JDPA 2ZGNA 1XBLA 1Y66A 3WZ1A 1D5NA 3N7KA 1OA2A 2DFBA 1IOAA 2FMDA 3VL9A 5FPVA 2G19A 4RN5A 4XF9A 2RS53 1DG6A 3A2FA 4YJ2B 3V0AA 5FCCA 1S0JA 2WLIB 1LHOA 2DUOA 5JXJA 2JKXA 3A0KA 2NMOA 2EILB 4JYBA 1AZDA 2WL1A 5B2GB 1PPJH 1RB8G 3ELNA 1US2A 3UJOA 1YHQV 4FLVA 1STMA 4CEWA 3M7MX 1LHWA 5KC6A 5FKBA 4X6RB 4AEKA 1GNZA 1CIWA 4H0LB 1O59A 3K4AA 2HBTA 1B09A 4TQFA 1RP3B 3QH6A 1UU6A 1KDMA 2Q4SA 4F83A 5I91A 3E5UA 4WVWA 5FZLA 3CMEV 5KA5A 4DV2B 5M0TA 4K3AA 4OZXA 1SFPA 5LBBA 2JIZG 3OPZA 1YVWA 4EN0A 4AEDA 2WWUA 1ZNPA 2VG9A 1SLIA 2VL4A 1F4HA 4UCUA 4UCRA 5DPNA 4UB6Z 3CSXA 2QCSB 1RUF3 2LJ2A 2EXHA 4XDPA 3DXTA 4TYSA 2EXKA 4OI4A 4ARYA 4TLFA 1XDCA 4JZGA 4C90A 1ULFA 4LO7A 1W59A 3FUQA 4B29A 2Q68A 1GKFA 4PD4F 2V73A 1NTZH 4AQ2A 5HFLA 1H4GA 4FLWA 5A7SA 4C0HA 4OHWA 4MVOA 2V4AA 1JZ2A 5CZKA 4FXGB 5LASA 4PDRA 1OMIA 1JX9A 5FPZA 3U37A 1TUEB 1CQ9A 4JKKA 4OUSA 2ZABA 2VUAA 3LEIA 2ZM6B 4K20A 4MVQA 5IWFA 5H9RA 3DTUB 2JJ1G 1W2TA 3C3TA 5LY2A 3DEMA 3WNLA 4JI7O 2VOTA 4GX5A 1RL3A 3MW4A 2IJIA 2Q7EA 1NBMG 5LOVB 1S0VA 3RZMA 3H1HH 4X9QA 4IUGA 3VBFC 4AHCA 3ZFFA 4JI4O 2LALA 2QQIA 5CKNA 3FYEB 4EKWA 3MLLA 1DP0A 4LKSA 3R65A 5EYYA 1SZXA 1HNZB 1D4M1 1GSLA 2DU1A 1F5JA 5LA6B 4PDWB 4ZS3A 3ZR5A 4AZZA 4UAPA 3ZYHA 3CU7A 1QHTA 1LTEA 2WLQA 4XIKA 2GTSA 2E53A 5LEKA 3PVBB 3WT3A 3PU3A 5DZEA 2VQAA 2ZHNA 4RS5A 4ORFA 1N32O 4YZ1A 4Q5OA 2J1UA 5FBZA 3I55V 1RHI2 4XZUG 3A8TA 2XMLA 2QQKA 1P8JA 1G9CA 1UZZA 2ZX3A 4RQPA 3ZSEA 3HR0A 3CEWA 1I5PA 1M4WA 2F4VB 1BHGA 3BA9A 5AC93 2RMU1 4X64B 2P2KA 3B01A 3BTZA 1XJAA 4LFAB 3HKCA 3HBKA 2FZ2A 4J6GA 3MV11 4DUYB 1S2BA 5AVAA 4YW1A 2ARXA 1GTOA 1WW5A 5KAFZ 2YG0A 4GZ9A 3LDEA 3B40A 3VDBA 4UCVA 1D4M2 4CDUA 5EV7A 4ASKA 5K1PA 3AG1B 3MDSA 1W03A 1QY4A 4LBNA 5H6RA 4LFCO 2QTWB 5H9SA 2PA7A 3IGAC 2EA7A 2ZT9B 3H1LH 5EYPB 2AGSA 2GN3A 3JSNA 4IE4A 4B8EA 3OSDA 5KXBA 2GU9A 1RUI1 2CK3G 4LF5B 1DGLA 3U4SA 4P9OA 4O4JB 2OUJA 2VWJA 2GC0A 4EZ4A 1HNWB 1GBGA 4E2LA 4XFBA 3ZMSA 1UQXA 2Q30A 3EQEA 4L8QA 3I2GA 4Z2WA 2RMU2 4DK1A 1SDDB 4X20A 2J42A 3SMHA 2BGOA 3WG2A 5HI0A 2YFZA 4MVSA 4BPZA 2VNOA 4NAOA 3LDRA 5GZFA 2EF6A 1N3PA 3OOXA 2V5YA 3I3BA 2H94A 2CAUA 4BHPA 4UF0A 1FXKA 1YDXA 2VE1A 4PIXA 5L9BA 4R52A 4GMP0 5DQ0A 2GC1A 5FPAA 2DWDC 1M06G 3ZFEC 3BGAA 3RYIA 5HV4A 2VAUA 1RPRA 3TJTA 3N2KB 4CCJA 1RUI2 5DDJ1 1N34B 2LRPA 1WBFA 4COUA 2VCMA 5C8WA 2CTVA 3B4SA 3W7XA 1HDJA 3DN7A 2IUWA 5FRAA 3VBSA 4H37A 4FIPC 3Q8EA 3EO6A 5A7OA 3O1PA 4IEXA 4CU8A 4TUYB 3S57A 5F5CA 4BIOA 1Z0HA 1Q8VA 4HL0A 1N0NA 5G05L 1IZ3A 4GH4C 1W6QB 2V1DA 5FPOA 4HANA 2Y64A 4XJWA 1N33O 4H2AA 3NNGA 1DZTA 2OTJV 1U5YA 2CL2A 3PJSK 2AZ5A 5JH7B 2CHHA 5HCAA 4V1PA 3S5QA 3VBOA 5K8SA 4O2AB 2W68A 2V7QG 3W5MA 4BCUA 5C4WC 1AXYA 4BIFA 4CTEA 5FV3A 4X1YB 1G8WA 4N9IA 1NA1B 3FYIB 2VMHA 1IKQA 3WQ7A 4FLYA 3Q9OA 3GBGA 4MXWA 3RZLA 1ZAUA 4LMFA 4HNAA 3OUSA 4TSFG 4DZGA 2RM23 4I9WA 4D6TH 3KWVA 5E16A 5FQ0A 4V2VA 2QQLA 3HD8B 3CJIB 3NNFA 5F1RA 2VQEB 2JG9A 3ZIXA 1FV3A 3GB7C 1EM1A 4DV3B 5GM0A 3B2EE 5BMVB 3K5OA 2B9UA 4CZZA 5FZ7A 3ABKB 4XJ9A 5KMGB 1DQ2A 5ABJB 5GONA 4F6RB 4DV2O 1HV0A 3ST7A 1PM4A 3VZKA 4J9ZB 3R4UA 4QM8A 3FKSG 4L99A 4OPHA 1BQPA 3JQXA 4I30A 1HXS1 4B3NA 4QD2A 2CTRA 3POSA 4W4KA 1IHMA 1B35A 3ABMB 3HKEB 5B66Z 5LHHA 3A23A 3LE0A 2Q7HA 3WNXA 3FX7A 2QE7G 3LEMA 5B1OA 2EINC 1HB2A 4FZ1A 3MPBA 2DCYA 4R4ZA 5GLWA 1AB3A 4RFRB 3WLUA 1WPBA 5LB6A 3SPJA 3H8UA 3NO8A 1VBB2 5DG1A 2UU9B 5FY7A 1XNRB 1OCOB 5H9CA 2WZPP 3K3WA 4YW5A 1R6NA 2EJRA 3ZYGA 1GN3A 5IYCO 4NHLA 1DLCA 1QJY1 1MQTC 4E4EA 1NCQA 1QOTA 5C93A 2ORXA 3P3PA 2ZGLA 4XHXA 1FAYA 3EYPA 4Y26A 3FFZA 1UMZA 1SERA 4WM8B 1R1BA 3ASNC 1R3LC 3OBZA 3KG2A 1HRI1 2WS93 1CPNA 2IU3A 1TAEA 3JASB 2YI8A 1KP3A 2VCCA 4UB8Z 2ZM6O 1JUIA 2XWBB 2RV9A 4GWNA 1N1TA 1GK9A 5L9RA 3OMAB 1RM1C 4HN1A 4BIUA 5EIBD 2JB8A 4YG6A 2FDKA 4MXVA 1FMD3 2Z3YA 3ZPOA 2RS11 4LT5A 1HXS2 2OVUA 1Z2GA 5LP6C 4IE6A 4UBHA 2JGDA 3GDBA 2E26A 4GAZA 2WNOA 1XNAA 3WDYA 2ZGRA 4XQ4A 3NR7A 1WCQA 4PDVA 1IS5A 4XYXA 4XVHA 4XEZA 5KLVH 4A3XA 4FMTA 5LEJA 5FMBA 1J59A 1W8UA 3HQXA 5C8CC 2SBAA 1VAMA 5F5QA 3P30A 2QKSA 4UWDA 2NPIA 1COV2 2HVJC 3VZJA 4XDOA 4KGQA 2DV9A 2K2SA 1LULA 1QJY2 4XBQA 4A2UA 5F5AA 4HVOA 4TZDA 4PT6A 1M1KW 2WKKA 2P06A 3OBTA 3VDAA 4DK0A 2YUEA 1XL4A 4GXLA 1OXCA 5JOZA 3FD9A 1X8EA 4QU1A 3B3QE 4JX0A 4XJZA 1HRI2 2YUAA 1SKVA 4RQFA 2WNUC 1NE6A 2YXHA 5LBEA 2YDEA 5KHGA 2IZWA 2HJFC 5T54A 5FO8B 1C8M3 1QXJA 4B4QA 4DV1O 2BYVE 4BXFA 5IT6A 5GTHZ 3AZWA 1VF6C 2QSAA 5B4XA 5CKMA 3FLTA 4DUYO 2RS12 4LP8A 1NXD1 1H2LA 2ZZQA 3T30A 2L35A 2CU5A 3C8XA 5J98B 1JZ6A 1W3VA 1QJFA 1W2BU 4DMIA 3TBDA 1PGL1 2QA4V 2Y6JA 3VZOA 3FB8C 2XAQA 2XT9A 1Q8QA 4GJYA 3WSOA 2XJUA 5DAVA 2N04A 4DS0A 1POV3 1O3RA 2GN7A 1GZWA 1UOBA 1QIQA 4H55A 1N36B 4FM0A 1P49A 3LDCA 4P5YA 5D5PA 2IVIB 4DR6B 2XUMA 1C5HA 3JATB 2IM9A 4HZFA 4F3JA 3SJQC 4JQRA 4PA6A 2VTFA 1EV11 1S0BA 2H3OA 1BEV3 1S0CA 1JVMA 4EYUA 4EWAA 4WBNA 4PF1A 4YVSA 2P5OA 4QT6A 1EN6A 3JU9A 3WXPA 2VQFB 2BGPA 3AG4B 2ZGTA 4SBVA 4CH3A 1DYKA 5C3OA 5CB4B 3RSJA 3VDDB 3WP5A 5IJ9A 3LDKA 3U07A 1O9HA 3WF3A 1ZL8B 1M5IA 1HX6A 4LK6A 2JECA 2DYRB 4XFFA 3WF0A 1E79G 1F4MA 2R7EB 3LNNA 3AG3C 2OYQA 4M4RA 5HXVA 1K3IA 2F95B 1PGL2 5AFBA 4LTAA 5J2UB 5GLUA 2RDRA 1YIFA 5C3RA 4YW3A 1LESA 1DQ6A 3AKPA 4I4TB 3ZVXA 4N23A 2ZNJA 3K06A 3TNQA 2WLHA 2LO1A 4JV5O 4XQDA 3OCPA 4JKLA 5DAPA 2JE8A 3OEHG 1LOAA 3NAPA 1EV12 1UY4A 3ETQA 5FWJA 1OURA 5ERLA 3AK2A 1W39A 3ACFA 1AJPA 1LOGA 1LGNA 2XAJA 1WCSA 4OHZA 1FOD3 4E4DX 1JQ0A 4NTWA 1QQCA 3OT7A 3JB4C 4NAMA 4CDXB 4OGQB 3OY8B 4EB6B 1BMFG 3SJAC 5D5QA 4DR1O 4LHSA 2O14A 3TYJA 4ZS2A 1PGSA 4Q4W1 4UCTA 2VQTA 1GANA 5A80A 4P9IA 4LF4O 5IFTA 2BEOA 2QQWA 1NKDA 3THPA 5FY5A 2PHXA 3OGGA 1O7FA 3FBYA 3OYWB 4UFHA 3F7VC 5C8YA 2YFUA 3CBNA 2JB4A 1Y9QA 1F7YA 4OMDA 1J3PA 3AG2C 3N36A 5A7WA 2XAHA 1UYYA 5FOBB 3MFCA 2YU1A 4M3CB 2Q8CA 4QX7A 2ARHA 1K4CC 1YIPA 3SKJE 5C6CA 4R9CA 1V00A 1K42A 1F4NA 2VQEO 2JD9A 1XE7A 3BY6A 2EIKC 4DV3O 4GKJB 4O4IA 1Z5VA 3CKHA 1WAZA 2ET7A 2M6YA 5C71A 1QJX3 2GSYA 5B1BC 4O9EA 5IJ0B 3VZNA 3PN1A 3LIGA 5L7OA 1KKDA 1HB1A 3OTOB 4WM7A 2HWB1 4JGZA 5TSWA 3K08A 3RVZA 4Q4W2 3NNJA 4Q6GA 3QG5A 2OPWA 5BNPC 4LEJA 4MX3A 2LFRA 3AL5A 2NLRA 1RUD2 1UY1A 1GMGA 4LUKA 3K5MA 4KNCA 4NE9A 1XNRO 1UXZA 3SGIA 1J1LA 5IK8A 4UW6A 2GNMA 3VQXA 1QLEC 4IIJB 3ETGA 1OH3A 4TXWA 5E1AC 4NO4A 1UL9A 1HRV1 3UT0A 3CJXA 1DZQA 3DYPA 1GWLA 3PVOA 5ANNA 1VPHA 2CUGA 1S0DA 3H1IH 2JE7A 4DUZB 1J3QA 1OFSA 4BK5A 3K0DA 1TE1B 2JVDA 1CONA 5FZ8A 4S2GA 3J80N 1BE3H 4BIZA 3DF0A 2WA3A 1VF5B 3NJYA 1LUWA 5FZAA 1YFWA 4RUEA 2YY1A 1SQ4A 5IYBO 4DINB 3IIAA 2AXTZ 2BOIA 2XVLA 2J1TA 4XUTA 5CN0A 2ITDC 4FK5C 2HWB2 5IY5B 3IDAA 4N90A 3JAKB 5IYZA 4N43B 2AENA 2ZA9A 2IJHA 2K1EA 1AR71 4CC5A 5CB7A 4DW1A 2XKOA 2DWRA 3VLBB 1ZBA3 2QTOA 3E8GA 3BYWA 4YZ5A 1W90A 1E5IA 1F9KA 2F23A 4G4FA 2L9LA 2WSUA 4LA3A 1OSGA 1SBFA 5E6HA 4SLIA 1YHFA 4EV0A 1NR7A 4HKOA 3LPGA 3SPCA 2E31A 1HRV2 4ICGA 4O2BB 2CH7A 1R091 3CCUV 1SA0B 1WPXA 1Z5WA 1X7NA 2VXRA 5KX5B 1CVNA 4FPJA 1J58A 1D0HA 3O5SA 1Y7BA 2ZKLA 5I8YA 1WBLA 2OT7A 1XE8A 2H6BA 4NXNB 5CKQA 3SR2C 3Q4HA 1RHI3 2A73B 3RWNA 4IV1A 2X05A 3STZC 3NNMA 1YFUA 1IG0A 4AYUA 2ADDA 3ZFGC 1JPXA 4YXWG 4DR7O 4ISRA 1RXGA 4C7UA 3K04A 4KFMA 3K0GA 2UXBO 2EJ7A 2D3SA 1E57A 5LMUO 3RFRA 2A1XA 1AR72 5FLIA 3C90A 3QO7A 3TXQA 4J42A 3LA3A 2CE4A 2WABA 3ZFEB 3EB7A 1FJGB 5FMCA 1G6UA 4MTOA 3PIJA 3POBA 3J8F1 3MW2A 2KR2A 3E2EA 4NIGA 3VHNA 5JJJB 2E33A 1OHFA 5L3DA 1D4M3 4DO2A 2P67A 4YVWA 1L1FA 2LW8A 2W0FC 4CCOA 1R092 2RQ6A 2LW7A 5LK5A 3CWBH 4CEWB 3LEGA 3IAPA 3ABZA 3LNMB 5IK7A 1K5QA 4GMP1 3ZRXA 5KUMA 4XFCA 4KP4A 5EYXA 1I5YA 3AMQA 1MEC2 4Y22A 4CZSA 4LOSA 4U3JB 4PHZA 3LIHA 1V6LA 4AEDB 5FFOC 2RMU3 2E6VA 4IXLA 1ASJ1 4QPGC 5FP9A 4HPKA 4XCAA 2WWSA 2DYSC 4QX0A 1SCRA 3ALQA 2OCCC 3QF7A 3J8F2 4YHHO 2PXJA 2B4KA 2KXLA 2QTSA 1CX4A 3AK1A 1JZ3A 3H7YA 2X09A 5IE9A 5FY9A 1CWPA 1UMHA 5FYIA 4X62O 1K34A 1PK6C 2Y34A 1XEQA 4YGEA 2AEYA 3CCEV 3WNMA 1W0OA 3V0BA 4TV8A 4HT1T 2PHDA 2HWF1 2MW2B 2WFPA 4LHNA 1FXVA 3GXUA 4HONA 3ZSKA 4KBZA 4FFHA 2WC2A 1RUI3 4LF8B 1MZEA 4HG6B 4F4LA 3NRUA 3RYCA 4EN9B 5FZ4A 2F4PA 3THOA 5L19A 2WNVC 1W6PB 1TQ5A 4MGIE 2O8OA 2O1QA 3CE2A 4LFBB 5CMUA 1RXFA 3KVBA 3SYAA 3TB0A 4CDQA 3SITA 1FYUA 4OX9B 3ENRA 3WF4A 3FC0A 1PNFA 4LF6B 1ASJ2 2Z69A 4CH4A 1LR5A 5A3NA 1OVPA 1Y76A 4UFLA 3ZFFB 1YJWV 2LGQA 3THDA 1K8AW 2PHRA 3K5LA 1VP7A 3IN9A 4XABA 2QNKA 2B5HA 5BR8B 2K9PA 4X66O 3TEXA 5DZFA 1S5JA 3AMPA 2Q1MA 3N2GA 4DR3O 4QB1A 5JZGC 2IVJA 2UUCB 5BUVA 2WLIA 4LJHA 5BZBA 4M3CE 2XLGA 2YU2A 2VZTA 1RM1B 4AW7A 5A6ZA 1ULEA 2RJZA 5L3BA 3KLSA 2HWF2 4IEZA 4LORA 2WT1A 5LP6B 4M4PA 3INAA 1UX7A 4RQPB 1WW6A 1R3IC 1POV0 1W0NA 5I0SA 1PGW1 3RI9A 5EHDA 3BI3A 4HVQA 1JYXA 1GICA 2V4DA 2OWOA 3JARA 5B4NA 2PQQA 5C8CB 3NV2A 3ZYFA 1HB4A 1IURA 4P9PA 1PNMA 1SRYA 4L87A 5JOWA 4FJCC 5KXEA 3K48A 5IATA 1QOOA 2PGGA 3MIHA 1VQKV 2DTYA 4NIIA 1J1TA 5CG9A 2OYZA 1NTKH 3KMHA 2IW5A 2UUAO 1NLQA 3NJXA 4QJFB 5FP4A 2VMCA 1A78A 5IAVA 2X7RB 5F3CA 2R041 3W5NA 3L9JT 3CX5F 3AZZA 1RMU1 4NIHA 1XMOO 1VBB3 5F6LB 4CYDA 3D3QA 3AMHA 2HFEC 4WFHA 1KJLA 3RG0A 1MSDA 1WA8B 4B7KA 3H0OA 5DEDA 4FPGA 4NHMA 1LHNA 1S0IA 5FXVA 5EJ1B 1V54C 4JI2O 2XJQA 1PKXA 3K75B 4QQOA 3N9MA 2JKBA 4DXRA 2CAZC 3W21A 3G6JB 4NPRA 4YG3A 2EIMC 4QX5A 4RAIA 3KM5A 2YIBA 5F5IA 3RRDA 1RJ7A 4HK9A 1PGW2 1UNBA 3BABA 5A7NA 5LGUA 4X20B 1LEDA 4XQWA 5L36A 5LOVA 3ROUA 4FPYA 2DVBA 3T2OA 4I50A 1IPSA 2VZ1A 2R9IA 1VAVA 1LU1A 3OM3B 3JALB 5IJRA 1HXS3 2GBOA 4AE2A 3SKVA 4HAMA 4TSVA 5H9PA 3QD6A 4MVTA 2WT2A 1R083 1VQ4V 5LA6A 4UF0B 3OJBA 1FXKB 2R042 4YM1A 3BB6A 1CIYA 5E88A 2ZEXA 1RMU2 4XHBA 4AQ6A 3K58A 1YQ8A 2F1MA 4ZIBA 3CYOA 1JOJA 1COV3 4UVAA 2B7YA 4HK8A 1KQSU 3RVYA 4HSLA 1W8FA 1FV2A 3ZOIA 4Q8KA 3KD4A 2DDUA 2PHTA 2E5LB 1IQAA 2BNNA 3RYPA 4FOWA 4DR4O 4C1XA 4BE3A 2PUSA 3B9CA 4CC6A 3AYAA 1H8TA 4K1YA 5FYMA 2X6CA 3AKRA 5IAXA 2LROA 3TN91 1UJWB 5JPMB 2ZHLA 4IV3C 2EULA 5I0DA 3T3YA 1Q8SA 4Y5TA 1VQ9V 4BA6A 3UGGA 1CZTA 1UZWA 2RS13 4B3RB 3VKMA 1AR62 3ZMTA 5LBFA 3LSSA 1FJGO 3FUOA 4A41A 1WNSA 3VBOB 1RFYA 4R9AA 4A3ZA 4AHZA 1OCRC 2Y0OA 3HNMA 1AYM1 2UYBA 5BNNB 5FYVA 1H1IA 2HEWF 3GGLA 4LBJA 4MXWB 1MS3A 4HNAB 2ZE5A 3VBRA 1L0LH 4BH9A 4RA0A 2CGOA 2Y4TA 5CFCA 2NM1A 4JI0B 2XOKG 5FQ0B 1BMV1 2P34A 1CAVA 1S2EA 2JG9B 3SNMA 1COWG 1PNKA 2XR4A 1AXKA 4PJYA 3WB1A 4B3SB 1LHVA 2QKCA 3TN92 1X8MA 4QGPA 2DW4A 1RSOB 5GONB 3VBHC 2P3KA 4P9WA 2DQ0A 1FXHA 3O1TA 3AP9A 4L11A 3S3XA 3C3VA 2YZ4A 2OQ7A 4JASA 5A70A 1JYNA 2GP3A 3ZDSA 1VEWA 1OQEA 2W9XA 4MTFA 3IKWA 1XNQB 1YFYA 1OT5A 1Q56A 4E2SA 2LS6A 3AYEA 2X5IA 2OT5A 3ZR6A 1ENSA 5KBFA 2R49A 3SYCA 2VW1A 3C7GA 4JZRA 1QU7A 3T1LA 4LF9B 1AYM2 3EJKA 1X4TA 2ET1A 3TEZA 2E3CA 1W9SA 3UJQA 5BY5A 5TISZ 4HETA 4H3WA 5IUQA 4LBOA 1OPOA 1XNTA 1NCQB 4HXCA 4R4XA 1OJHA 3ZHUA 2EALA 4NKGB 4JI8O 4FOQA 4BWAA 3LWCA 5B1BB 4YG0A 3M70A<