5KHKA

Hcn2 cnbd in complex with 2-aminopurine riboside-3', 5'-cyclic monophosphate (2-nh2-cpump)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 64
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khkA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khkA02
1RC6A 3D0SA 3B02A 1Q3EA 1J3RA 1NE4A 5JAXA 1FXZA 4UXAA 1CGPA 4JTOA 1VP6A 3SCHA 2K0GA 5LRRA 3H1WA 5KHGA 2GAUA 2QVSB 4WBBA 1DGWA 4I3PA 1SEFA 4XFFA 4EV0A 2BYVE 3O14A 4TLFA 4IERA 2D5FA 4QGMA 4EWEA 2QNKA 4FBFA 1TQ5A 5T3NA 1YWKA 1ZREA 2O1QA 1NZCA 1YFWA 3KSCA 1I6XA 1YFYA 5EZWA 4D7SA 1CAVA 1OFNA 4MGIE 2CV6A 3OD0A 1NXMA 1IPKA 3CO2A 4XFCA 4XF4A 4IEUA 4XFAA 2PFWA 3FE5A 2PA7A 3GYDA 4YNIA 4BIFA 4FAHA 4XFHA 3BB6A 3NSTA 1X8MA 4Q0UA 1EY2A 5FDBA 3H8UA 2PAKA 5FLJA 3OTFA 3OF1A 2BNNA 3ST7A 4XFGA 5J7MA 3IDCB 1XRUA 2Q1ZB 2K9ZA 2FMYA 4KU8A 1ZRFA 4IEOA 1PMIA 1O3QA 3FWEA 2KXLA 4KWKA 4X6RB 4JTNA 3C3VA 3M70A 1FI2A 2XLAA 4ZU5A 3EJKA 3L2HA 1ZNPA 3I54A 4WZCA 4D7TA 3NJZA 3PLQA 2WFPA 4MX3A 2Y0OA 4Z82A 2EA7A 3EO6A 2C0ZA 3UKNA 5I0UA 4UBGA 4XEZA 4OLLA 2VQAA 4XETA 3E5UA 2F4PA 4QGNA 4META 4QGLA 3WW3A 2XL9A 3FZ3A 5FQ0A 3IDBB 3D82A 3SMHA 1SFNA 3D0JA 3U10A 1Y3TA 3VHRA 1QWRA 5FPZA 1CAXB 2CAVA 3I59B 3SHRA 2QCSB 3CJXA 2D40A 4XFBA 1OMIA 1YFUA 4AVAA 1YHFA 4IEXA 4MGZE 3RNSA 2FQPA 4Q0PA 5CADA 3ES1A 1UD1A 3H7YA 1ZX5A 1O4TA 1ZRDA 4O9GA 2OA2A 1J3QA 1X82A 5HI0A 1RGSA 5FLHA 4I0AA 4A2UA 3RYKA 4HSLA 4FAGA 3KGLA 3S7EA 3FHIB 2XL7A 1UW8A 1X8EA 1ZZ6A 1RTVA 3E6BA 4EROA 5LEJA 1O3SA 1IPJA 2PHLA 2GC3A 2Z69A 1O3TA 4QM8A 2N7GA 2VECA 3FX3A 4L11A 1EYBA 2OZ6A 4BHPA 4HSJA 1Q43A 4YYOA 3ELNA 1J1LA 4XF3A 3CEWA 4LULA 1V70A 3CF6E 5FCCA 1WLTA 2IXKA 2ETEA 1ZZ7A 4AQ2A 2IXIA 1RL3A 1Q5OA 4RD7A 2XLFA 3UKTA 3R6SA 4MGKE 4E2GA 2Q0AA 4R8HA 5I8SA 2XKOA 3E6CC 3ZDSA 1QXJA 4PJYA 3EBRA 3PVBB 3LA7A 4I02A 5JCTA 2DCTA 1ZZCA 5KBFA 3USSA 2I45A 4HMZA 1YFXA 3MZHA 4ZU7A 3LWCA 4IETA 5C6CA 4I2OA 2QJVA 1ZZ8A 4DINB 3RZZA 4I01A 3RYPA 1LKNA 1QXRA 2H6BA 2UYBA 4Q0VA 3BU7A 3TNQA 3DV8A 4HN0A 5JSPA 2IXHA 2UYAA 3QOPA 3NL1A 3KGZA 1DZRA 1CX4A 1GQGA 4LUKA 1UPIA 4P9GA 4AVCA 5C8WA 1ZVFA 2UY9A 4IEZA 5BV6A 5BUVA 1CAXA 3I59A 2IXLA 5JSOA 2B5HA 1VR3A 4ORFA 3H3ZA 3E97A 4IEWA 2CGPA 1EP0A 3H1MA 5F1RA 1VJ2A 4X6QB 3BCWA 2P17A 4Q0QA 3EHKA 3KMHA 4AVBA 3G7DA 4E2QA 4AQ6A 1UIJA 4LEJA 4FT8A 4BYYA 4KU7A 3S7IA 5I8TA 4K8FA 4HVQA 1CAWB 1YUDA 5JSRA 1ZZ9A 3QACA 3CL1A 4H7LA 3M3IA 2OZJA 4J1XA 1DZTA 4XF9A 3I7DA 3ETQA 3HT2A 5D1IA 1H1IA 3U11A 4IEQA 2XLGA 1NE6A 4IEPA 4I0BA 4KWJA 4LTAA 3EQEA 2ET1A 1J3PA 2MPFA 3LOIA 2XKPA 3H1YA 5JR7B 2UY8A 1LB2A 3H9AA 1X7NA 4IEYA 3ROUA 4CYDA 2H0VA 2IXJA 2MHFA 3OCPA 5LEKA 1O7FA 3ACLA 3BALA 4IESA 4Q29A 3WW4A 4BH9A 2Q30A 3S0MA 4XF0A 2VPVA 3FFQA 1UCXA 2PHDA 1ZRRA 2GU9A 3LAGA 3LA2A 4F7ZA 2GZWA 3H3UA 4UBHA 4HVOA 2H6CA 3IBMA 4XFIA 2GC2A 4LUMA 5I91A 1RUNA 3H50A 4XF1A 1J59A 4JVAA 5I0RA 4KWLA 3E6DA 2E9QA 3SCFA 3U0ZA 4O9EA 4PIXA 5CU1A 4N9IA 3SCGA 3NW4A 4PIYA 1PM7A 2PAMA 5FLIA 2EAAA 2BNOA 2Z2SB 3DL3A 3E5XA 2D5HA 3DN7A 1CAUB 2WC2A 4HBNA 2ZCWA 2OPKA 4R52A 2QDRA 4LLOA 5I93A 1JUHA 1FT9A 2OYZA 3NKTA 4QM9A 5BXXA 5I0SA 3LZZA 2PYTA 3WW2A 3RYRA 5KHHA 4HLTA 2PTMA 4KL1A 5E16A 2HJIA 5FPXA 4L2NA 5BPXA 2D93A 3FJSA 4YARA 1CAWA 2GC1A 1SQ4A 3HQXA 1XE8A 5BY5A 3N4MA 3UKVA 2ZKLA 5KHIA 3HIFA 1OD5A 1H1MA 4HVRA 1L3JA 1QY4A 2B8MA 2ET7A 4QMAA 3TNPB 3IWZA 4MUVA 1LR5A 4WVZA 1Y9QA 2GH2A 5E1RA 4F8AA 4Z07A 2XGXA 1WA4A 3PNAA 5KHJA 3MYXA 4HZFA 1CAVB 5CVRA 4YRDA 3LA3A 5J3UA 4I09A 4MV2A 1NYWA 2IXCA 1RUOA 4LA2A 4AXOA 2ATFA 3CLPA 3NVCA 4IEVA 5LRSA 4E2SA 1DGRA 5J48A 1ZRCA 1O5UA 2BEOA 5AVPA 4OFGA 1J58A 2O8QA 3MDPA 1U12A 4HN1A 4EWDA 3MPBA 3OGJA 5I8YA 4PIZA 3JZVA 1EPZA 4MH0E 2BNMA 1ZZBA 5I0TA 4MZUA 4YSFA 2BGCA 4JV4A 2PQQA 1I5ZA 2XHKA 2B9UA 5KHKA 1OI6A 4LA3A 3SXWA 1O3RA 4ONUA 3WW1A 3KCCA 3BPZA 5EFUA 3IIAA 3H7JA 1XE7A 1G6NA 2GC0A 3GBFA 5K8SA 2HKXA 1O5LA 4ZU4A 1CAUA 3ES4A 1LRHA 2MNGA 3RDIA 3RPQA 2CAUA 4MGYE 4NVPA 1UIKA 4J1WA 2EVXA 2Q4SA 3E5QA 1YLLA 2V09A 4N9HA 3DKWA 4Q0SA 2PAEA 1GQHA 4GULA 4B29A 2IC1A 4EWAA 4QXKA 4QX5A 3HT1A 1WGPA 1HW5A 5FQ0B
chains in the Genus database with same CATH superfamily
3K5NA 1OLQA 3KVAA 2ZKNA 1AL23 4JHTA 4LQRA 4OHXA 5L3CA 4EFBA 2YY1A 1SEFA 3FHAA 1CJDA 3WQ1A 2RS51 5DDJ3 1SPPB 4YVWB 2KR2A 3A0NA 2VVDA 5A6XA 4BXFA 3CD6V 3DPRA 4HOOA 3ECQA 3IM0A 1NOVA 3ZSJA 2XXZA 2W3JA 4JV5B 2PA7A 2X6BA 2VOWA 4ZI7A 1S5LZ 2K1EA 3T1HO 5LOVB 1S0DA 1AR4A 1AF9A 2DWEC 3NSTA 3RSJA 5FL7G 3ST7A 1IBMB 1G1XB 2ZMLA 2IJIA 2K9ZA 1JYIA 2EIDA 4KHPB 5M0TA 4JTNA 3ZHSA 2KG7B 3PU3A 1IPSA 1Q81W 4LFAB 2JG8A 3L72H 1IKQA 2VVEA 3WV6A 5FYMA 1OF3A 3NO8A 5GZDA 1K4DC 1HXS1 1NKGA 2XBO3 1QNYA 2WWUA 4UBGA 4JI2B 4OULA 3POWA 5J1XA 3JUUA 5FKBA 1R081 1IBLB 2YV8A 5JVDB 1X9PA 1QR8A 1TVKB 3FZ3A 5LHHA 2RDCA 4AFBA 4QB6A 5FK8A 2DCJA 4U2AA 2OIGA 3R65A 3U4XA 4DV5B 5J2TB 3JU9A 2Q73A 4DRVA 1QHTA 2XHBA 4A44A 1JI6A 2KSDA 4Q0PA 1SPPA 4YVWA 1N33O 1O4TA 1RVF1 4O9GA 5JXHA 4F6EA 5FKCA 5ANQA 3AYCA 4LH6A 4PDWB 3WEZA 1IPJA 4YGEA 4DXRA 3SYOA 1BK0A 2OZ6A 5LOVA 4UFJA 4HSJA 2WBKA 1YYNA 1RHI3 3NAPC 4V1PA 3CEWA 1VE0A 5F39A 1RL3A 1MZ6A 1EZJA 2HBTA 4CH5A 1F5FA 2XLFA 3KS7A 5K7PA 5ERLA 4QE7A 2WAOA 4YVSB 4HPKB 4A6OA 2EICA 2KG7A 2WNUB 1GYKA 1K8AW 4LBNA 4PJYA 1AX0A 2PHUA 1WPXA 1OH3A 1UMZA 3KD4A 3SISA 4DK0A 4LLFA 1LKNA 4HAMA 1COWG 5JVDA 2JDKA 3QOPA 3VGIA 2D6NA 1GQGA 1TVKA 2DQ0A 3OGSA 5DAPA 1MZ5A 1K5QA 4UCUA 1RMU2 2RMU3 4GCZA 4O4HB 4KG8A 5J2TA 4PHZA 4JGZB 1Z78A 1MZFA 1BT8A 3HKDB 1F31A 5FFOC 3CMEV 2W92A 3BYWA 2D3SA 5KA5A 3G80A 4M0NA 2XH6A 3H1HH 3ABKC 2JDHA 4JI0B 2YI8A 1GNYA 3ABMC 3QACA 4PDWA 5A7NA 1VALA 1K7DA 1XNKA 2EF6A 1RUF1 2PYJA 1M1KW 1UOJA 4CU8A 2VQEO 2Q8DA 2GTAA 3CNAA 3H0OA 3OGIB 4Q29A 1YNAA 3QF7A 1OVSA 5C8CB 4YVSA 4HPKA 2ZXQA 2GU9A 3OBZA 2WNUA 5LBBA 1PVC1 2CH7A 4G27B 2FZ1A 4LBKA 3SEPA 5J36A 4GMP0 1SFYA 1XXNA 4QU1A 3E6DA 1GAXA 4AQYB 3C3SA 1YVWA 5CU1A 1AR81 1CESA 4GH4B 2F95B 2ZDIC 5ABJC 3GM8A 5HXMA 2YMZA 3WF0A 4GX5A 4SLIA 3FYIB 1OPMA 4COVA 4O4HA 5L73A 2F66C 5FYTA 4OI4A 4JGZA 3SH4A 5LMUB 3ENRA 2C6SA 2L9LA 3NKTA 3HKDA 3VBOB 5E16A 4D6RA 2A6VA 2DV9A 2WIIB 1FV3A 3T2MA 4LBQD 1NX9A 1FMD2 3ZR6A 1H1MA 2XOMA 1L3JA 3CCRV 3GB7C 3O9OA 3OD4A 4Z07A 2EIKB 3PNAA 4I9WA 4DXZA 1GUIA 1H2SB 3LEKA 4MV2A 3UJOA 3MW4A 1OT5A 2BOIA 5HXVA 5C8CA 5J48A 1OURA 1MS8A 3MDPA 1RP3B 3C90A 2JIJA 4Y5Z0 3ZYRA 1WUVA 2X8KA 2AXTZ 1UU5A 4YSFA 4JV4A 2PQQA 2Q1FA 5HV4A 3B69A 2QWNB 3ZRWB 1OBNA 5JLVA 3MW3A 1FNYA 1W6MB 5FZEA 3BPZA 2RM22 4GH4A 1FXVA 4LHNA 5LYJB 4N7UA 1F51A 3HKBB 5FZBA 1ODMA 3WG2A 1MS1A 1OCZB 4JAAA 3AYEA 3FBMA 4CS4A 4GZRB 1NU1H 1SQXH 1LHUA 4GULA 3ZYJB 2WZR3 3H1IH 4QXKA 2VBDA 2W68A 3VBOA 1AYM3 1GR3A 1XNAA 3ORJA 1ND3C 1VIBA 4JI2O 2CTQA 2WZ8A 1JYNA 4IYHA 4UW4A 4PV1B 4JI5B 3LEGA 1IBLO 2NN8A 2GSMB 3AJYA 3OGCC 5DUWA 1D5NA 4AI8A 3UM7A 1KFUL 1YFWA 1RM1B 1JFFB 3WG1A 2JDMA 2ZS6B 3BCCH 1J5EB 3ETPA 4FSJA 2OXBA 3VZOA 5C3OA 3URFA 1V0AA 2QQMA 3EXUA 4YW7A 2BNNA 1GBGA 3BY6A 4CP0A 3ZRWA 4DRRA 1Z5WA 1W6MA 5C4WC 4HK9A 3T4DA 5FPOA 5FYHA 1Q86W 2V73A 3THOA 3NJZA 4NJ4A 5LYJA 3U4SA 2YG0A 2Y0OA 3N2GB 3HKBA 3ZMZA 3MI8A 1W3XA 2CDPA 5T55A 4D94A 4XIKA 4CCEA 3CRQA 2Y0PA 1RINA 4OLLA 4BIZA 1NS1A 4O7XA 1S5JA 2XQRA 4B3RB 4QJFB 3ZMTA 4FK5C 4QPJA 1GANA 4KWUA 4D6SA 2CYFA 3E22B 2QGNA 1P49A 2QUOA 3KWVA 2VD7A 2FQPA 3BN6A 2BGPA 1AR61 1X59A 1W05A 4NWVA 5KUKA 1JFFA 3HBZA 5KUMA 4QKBA 2DBIA 1NH2B 1OOPC 3K77A 5JMOA 2YU1A 3R05A 3WUCA 4J9YB 2R1BA 4EN9B 5IK5A 1LOGA 2GMEA 1KU9A 1LEDA 4PQQA 5BNPC 1GMGA 3AVSA 5A33B 1I3HA 5FZDA 5LK5A 1YTFD 4UOJA 1RSOB 2BFUS 2VUJA 1ZAUA 4ARXA 1UMHA 4O65A 2FB5A 2YIAA 1BZWA 5HV0A 1T6GC 3I3DA 3N2GA 4G9SB 1YFXA 4E4EA 4M4RA 2QJVA 5LXTB 4YLZA 2WQ8A 1QQP2 3O7OA 3MHHC 4HN0A 3AKQA 3DYPA 2EULA 4DV4B 3RYIB 2A3QA 2W1SA 3AEIA 3THTA 3E22A 1YJLA 4IEWA 2CGPA 2GMMA 1JYWA 1EP0A 4U3JB 4X89A 5FY5A 2GUZB 4AQYO 4WM7C 4AFMA 1XE0A 4YG0A 3G7DA 4BJ0A 3TN93 4JYCA 5I8TA 3K3NA 4B4RA 3ZVXA 1XDCA 2PF4E 2W6JG 4LO8A 4BXSV 3JASB 1HRV2 1FAYA 4Q4V3 1WLWA 2XR4A 1VF6A 4NAMA 2DVBA 4W8JA 3LOIA 4XHBA 2XKPA 3MBWA 2HWF1 3CB2A 4JTAB 2VC9A 1NY71 4TSVA 5FZ4A 3VLBB 2YSUB 3GWKC 3FLTA 1RSOA 1PO13 4YPJA 5A1AA 2G9FA 2DYRC 3OUJA 3FC0A 5FPUA 4PBOA 4O61A 2FMLA 2EZPA 2JJ2G 3INAA 1WB8A 1RUNA 5LXTA 1NLSA 4Y4RA 4L0PA 4XDLA 5AC92 4O9EA 4WFEA 5LA6B 4PIXA 2OX0A 2A6ZA 2Q7GA 2EAAA 3RYIA 4NROA 2KB1A 2JJ6A 2ZMNA 3KT7A 5LCWL 4IE5A 3KT4A 4U3JA 4C7UA 2WSVA 4MVMA 2MEV2 5FPXA 1BBT3 2F4VB 4BM8A 3FJSA 3SJBC 1ODNA 1HNWO 2LW8A 3H8XA 4UAPA 1GZTA 2WAAA 4HANA 1OCCC 1VEWA 4AVSA 3F5TA 1S55A 2VOTA 1V6MA 2BOCC 1O4YA 1RUI1 2ORXA 5D8AC 4JI1B 3EYPA 1FPN1 1LR5A 5FNVB 4FLTA 2N04A 1A34A 3JASA 1PM4A 2WN2A 1GTOA 4UUJC 4C90A 4QPGB 2VZ1A 1OLMA 2CDYA 1N47A 5J2UB 2VQFB 2ATFA 2P5OA 4JI5O 1NA1C 1O91A 5AVPA 1XL4A 4OFGA 1ZBE1 4YZ3A 1W8OA 4RYDA 3J7LA 1SCRA 3JSNA 1XOYA 1ZBA3 2X10A 2GBOA 3LSSA 2ZEXA 2VZPA 4RQPB 1RUE1 4UCSA 3QO8A 1I5ZA 3R4DB 4Q4Y3 1OI6A 3OT7A 5LA6A 2R042 2PYLA 1FPOA 2EINB 2HKXA 2R7EB 2CK3G 3RDIA 2W1WA 4HYOA 3LF7A 3KVBA 1WCKA 2XTAA 4CA9A 1L0NH 1GQHA 1VQNV 2QQOA 5C3RA 4AHXA 2PQSA 1RC6A 2ARAA 5IVJA 1J3RA 3A22A 3VKNA 2ZINA 1BK1A 4JDOA 4KBZA 1RUG3 1ALYA 4LMFA 2X5IC 2RJZA 3K48A 3S5QA 4I3PA 3O14A 1BHAA 3D6EA 4QGMA 3A21A 1JMKC 4Y1UA 4B3RO 1PO21 5FNVA 3NV3A 2Z42A 3RMXA 4D7SA 4MGIE 1OA4A 5KX5B 2QM8A 3BAAA 1WKYA 4QPGA 1NKDA 1GM8A 5HFLA 5J2UA 2ARXA 1SBDA 1G9AA 4CH4A 4XFHA 1W2BU 5LGUA 4LPLA 1CVNA 1QQCA 1R092 5DUXA 4GWNA 1F9KA 4RUFA 3X2QC 3IDCB 4LIUA 4RQPA 3ZM8A 4IDZA 1FAFA 4CRQA 5EJ3A 3W7WA 3ZHRA 2WT0A 5IJ0B 1YIPA 4O4LB 4DUWA 4XMIA 2PLV2 2Z3YA 1R73A 4YWAA 2CAZC 2C0ZA 3GALA 4GKJO 1B35B 5DG1A 2Q7EA 1V6LA 1GFF2 3I3EA 3E5UA 1ULGA 1DBNA 1GP5A 3JD72 2FHRA 3T0DA 5FZ9A 5F6LB 1W39A 2BOBC 1MS0A 3VQWA 3I59B 3ZMUA 3ZYHA 1H8VA 2QCSB 4LBOA 4KH9A 3ILRA 4G28B 3RNSA 1TNFA 5J98B 2JG9B 1W2AX 1RPOA 3PUIA 3E35A 3JD1A 1X82A 3OGVA 4DV4O 2OIIA 5IE9A 4YXWG 2Z4FA 3JBG2 5KX5A 1X8EA 4FP2A 1CEZA 3ABLB 2FDIA 5FMOL 3ZRSA 3RI9A 3WQ7A 3RFRA 4P9OA 3N9NA 4XF3A 3S3XA 4I4TB 5EK0A 2JG8C 2VTFA 1SLLA 5A7SA 5C3QA 2Q5TA 3B9CA 3POJA 3T08A 3BUCA 1S0GA 3AP7A 1LHOA 5T5JA 2XPJA 3ZN6B 2DU1A 5IYZB 5IJ0A 4O4LA 3EBRA 1WBLA 5B1AC 1AVBA 1B35A 4WFGA 1POV1 1HNXB 1F4AA 4MVUA 4LOSA 3AXEA 3H1KH 2H6BA 4PI2A 5C8YB 5ACA2 1CPNA 2DYCA 2D97A 4GWIA 2BW8A 1RUH2 5H9QA 1SLCA 1GZ9A 3I2FA 5F5CA 4YVWC 3OAAG 1UZZA 5FWEA 3I59A 2ATKC 4DV1B 4OHWA 1TGOA 4LWSB 5CBGA 4JI8B 1N1VA 2LW1A 2YICA 2JG9A 5LK7B 2LO1A 1N32O 2ZEZA 3WLUA 1UIJA 1BZKA 2J1VA 4BYYA 1AHSA 1ND2C 4BCUA 4HVQA 1YUDA 3E83A 3MV11 5JSRA 2EIJB 5F9TA 2UXDO 1DQ6A 3W7UA 3NJYA 5IW0A 2DN9A 4J1XA 2LFSA 1AR92 4NKGB 1OLRA 4ATEA 1H8TB 4QT6A 1UPSA 3WFVA 3DSQA 4I4TA 2PXJA 1P8JA 2WS93 3N3HA 1M5IA 3ACLA 4IESA 4H37A 3KF3A 2PMWB 4XF0A 4JI1O 1R3IC 4KG0A 1AXKA 3MHSC 3ZN6A 3RI8A 3ZMSA 5IYZA 1Q56A 2GNBA 1XNTA 3WF2A 5FZLA 3UNPA 4MVRA 1J59A 1Q8SA 1QJU2 5C8YA 1QJX2 2B5UA 1UOBA 5L7OA 1GOFA 2RR13 2DOSA 3DXRB 2EIMB 4FO9A 4LWSA 4N8MA 2Y6JA 2UU9B 4B3NA 2DQ3A 4WFAV 1SQ4A 5IAXA 2JICA 4N43B 3UKVA 1R3JC 2RS12 1H8TA 3AM2A 1QJY2 1JJ2U 1J1TA 1HKDA 3I2HA 1NYWA 5K1PA 2LFRA 3AZZA 1XI1A 4GKKO 2RS32 3NVCA 4LOTA 5FP9A 1UX6A 3CMAV 2XUEA 1RXFA 3VBRC 5LBCA 5IYBO 3ASOB 5CIRA 1V00A 4NHYA 4FM2A 4XAAA 2V72A 4J42A 2E26A 1C5HA 4NE9A 5IK7A 4NUBA 1FATA 3E8BA 3CKHA 5FZ3A 3POBA 2XVGA 3ES4A 3DXRA 4MGYE 1VBB2 3K51A 1UY1A 1TZOA 3E5QA 1H0BA 1YQ8A 4GYCB 5CB4B 3UT5B 4E9KA 3WT3A 1Z7S3 1HNZB 3ZFGB 3A0RA 1VQ4V 2PUSA 1EBOA 4N43A 5B4XA 3ZEDA 1YXWA 4XYXA 3WXPA 1BGYH 1SZTA 2D5FA 3Q4HB 2Y60A 1RVF3 1V6JA 5FRAA 2VO5A 5C8CC 1LESA 1X9TA 1BYHA 3KSCA 4F83A 4K6BA 3TEYA 1FMD3 2VUAA 3TYJA 2OYQA 3GYDA 1CN1A 1QLEC 3MUZ1 2JE7A 4FAHA 4QKDA 3GXUA 1MABG 3TXSA 4OUSA 5EYPB 3CJHB 4R4XA 1GN2A 2RS52 3K06A 1E1QG 1PGL2 1NCQB 5FZKA 1D7PM 4LC1A 5L9BA 3EJKA 2B46X 3L2HA 1ZNPA 5H9PA 5CBFA 4HXCA 1RYYA 1W2TA 5I0UA 3ZBHA 1OPOA 4RGKA 3WP4A 1K9MW 4CEYB 5GM0A 3VDCA 1MQTB 1POQA 1JYTA 4QGNA 5CB4A 2HP8A 3UT5A 2RJKA 5KR7A 1OC1A 1SLTA 4DR7B 3SMHA 3ZFGA 4LF5B 3I3BA 4DUYB 1TEIA 1AI6A 4EEQA 2YI9A 1PL4A 3CJXA 4E27A 1HNXO 1NQTA 1YHFA 2QQIA 3Q4HA 2LW7A 1HXS2 4OUMA 4JI3O 2OUJA 4KNCA 1OCOB 4FFGA 4DY3A 2A3WA 1VQMV 1AX1A 1QGLA 1XQNA 4JYYA 1JXNA 1TA8A 4BK4A 1ZZ6A 4JRAA 3I2IA 1O3TA 4QX2A 1XILA 4Q1RA 1ZL8B 1Q43A 1PHMA 4HZ3A 2RHPA 5EYPA 3CJHA 1W2NA 3CF6E 2XAGA 2IXKA 2ETEA 3KQRA 5GW7A 5L3GA 3J80N 2OVUA 1NUKA 1RUD1 2UXBO 4NTYA 1NCQA 2VH9A 2Q0AA 3AK3A 2P6HA 5I0DA 1PNFA 4LBQA 4WZFA 4QXCA 4FPPA 3V0AA 1WLDA 1AR72 5KBFA 1H9PA 5FMDA 3GF6A 3E2EA 4QX8A 4XMAA 2LROA 4I01A 2AH2A 1AR83 2BRTA 3J7HA 4CEYA 3LB9A 1MQTA 1VBD2 4DRXB 4L8QA 1SKVA 5C5UA 1YQ2A 5JR2A 1DZRA 3WF1A 2Z5UA 1K42A 2EX3A 2F1MA 4UB6Z 4GUNA 4IIJB 4X8NA 1YI9A 1UYPA 3H1MA 5FY4A 5FLXN 4X6QB 1R1A1 3O65A 3I55V 2HWE1 3KMHA 5L3BA 2DFBA 2NMNA 3UL2A 2VZOA 2XUMA 3PVNA 4XZUG 5FZ0A 4DXTA 3VUOA 4XTPA 3MIFA 4XF9A 2DF7A 2RE9A 1EN5A 4YHHO 2UU9O 3AFKA 3U11A 2FKXA 4LTAA 3LSDA 1UO9A 5B1OA 1S5HC 5FIXA 1HDKA 2IJJA 4QQHA 4X64B 4LE3A 2C5DA 4AWDA 3VL9A 2W08A 5F7UA 4JQTA 5JWPA 1YQ6A 2ADDA 2DWDC 4XF1A 5DAXA 3ZX6A 5F2VO 4XCBA 4AGRA 4DRXA 1S2BA 4JYAO 1PM7A 3O1PA 3ASNB 1Q6HA 3DL3A 3N7LA 3MFAA 4BQ4A 3FB5C 4TLGA 4FPGA 4IIJA 5FZ6A 4I3GA 3JAMN 2QM7A 4LLOA 1QQP3 2OYZA 1G9BA 4AQTA 3CS5A 2UUBO 4MT8A 1SHWB 1YTFB 1NG0A 4D6QA 4JAVA 5D5PA 2JE9A 1N1SA 3N9OA 1DLCA 2XGXA 1CJPA 3JAKB 1HNZO 2G4IA 3PVEA 3W9AA 2GDSA 1KP3A 1AYN1 1CAVB 1JHNA 1IG0A 2WSSG 3CC4V 4RA0A 1GP4A 4UW3A 1BS3A 4FM1A 1HJFA 1HQWA 4X66B 4U7NA 1DGRA 2W94A 3D5OA 3ZCCA 4FPLA 3W59A 3VL8A 1OKOA 4WFBV 4MOAA 4FCAA 2WR9A 3TB0A 2X0LA 3ZSLA 5I8YA 1FV2A 5KA6A 1XSQA 2NLRA 1WWYA 3AB0A 2ZIOA 4QDQA 4LA3A 4YZ4A 1HV0A 1UXXX 1S2EA 1R6NA 3WW1A 4C1WA 1QEXA 1JZ8A 5DZEA 4NRPA 4ARYA 1UWWA 4ZY9A 2KKWA 1B3QA 1AUYA 1JN2P 5D2AA 4N21A 2WZPP 1U96A 4K9SA 2ZIMA 5DDJ1 1COV3 3L2YA 4EWAA 4UVBA 3HT1A 2DCZA 5FQ0B 5FZGA 4EE2A 1UKRA 3B4SA 3LD8A 2JGUA 1LOBA 3H1WA 2GAUA 5FP4A 2E74B 1HB1A 4XFFA 4D0QA 4A6SA 1AR63 2D6OX 4EWEA 4FBFA 1W9YA 2WKKA 1N3OA 2QE3A 3HNYM 1WZXA 5JOYA 2MEV3 3JAKA 5EIBC 5LMNB 1CAVA 2CV6A 1M56B 3ZN0A 4Y1VA 4YGCA 4TTGA 3SH3A 2VZTA 1YI7A 5HPOA 4DNYA 1GNHA 4CXWA 1KC8W 1D4VB 3N9MA 3THPA 1X8MA 1HIXA 3ZXGA 3ZXLA 1KKCA 2HWC2 2LQTA 3NXSA 1N8RW 4H13B 4LR4A 1DCSA 4QDRA 4X6RB 2Q8VA 4BB3A 3SKJE 3CHXA 1L8DA 2GNDA 2VCBA 3OUSA 3RWRD 2TNFA 3CSXA 1SMVA 2VRZA 4J7ZA 4XUNA 4ZZ5A 4JKLA 4LKSA 2UUCB 3VZLA 4GMP3 3CP1A 1IURA 1K92A 2CE4A 5FQ0A 4A42A 4MVQA 3P32A 3QH6A 3JD0A 2D3PA 4K8XA 2A9HA 5C7GA 2EAKA 2RJLA 1MVEA 5FREA 1ASJ2 2D6MA 2D40A 4XFBA 1YFUA 5GZGA 4ZOLB 3AZWA 3JXSA 3WX5A 3FB7C 5EC1C 5CG8A 4QPGC 1PPJH 4CH6A 1MACA 3SQOA 3ES1A 1QLNA 3NWKA 2B1IA 4MW3A 1S1AA 2ZGSA 4X62O 4AE2A 3H8RA 3MEPA 2X05A 4K21A 2A7WA 2VBBA 2XL7A 1RTVA 2DYSC 5JZGB 2W91A 3IB3A 3VBUC 1OJHA 2CHHA 1GN6A 4BA6A 2EBOA 2HWF3 1I7FA 1YC61 1IBKB 2WLPA 1OV9A 2KM2A 3MD0A 5SV5A 3UKTA 3Q8BA 3G4SV 1NLRA 3N27A 4Q1PA 1M93A 2HEYF 3V64A 3E6CC 3K03A 4CCDA 1R6TA 4HETA 4F3JA 2RMU1 2YROA 3ZKUA 4YM3A 4WVWA 2R9RB 2DURA 2LGWA 2QWOB 3BU7A 4ABMA 3MIEA 4W65A 3Q8CA 3ABZA 5C8WA 4DV6O 1QH6A 2UY9A 4IL6Z 1AI4A 1A78A 4YG6A 3MUY1 4DPNA 3ML0A 4ZOLA 2VW2A 1GN4A 3J26N 3AG2C 5JUVA 4DR1O 5FP8A 5B4NA 2YHJA 4RN5A 4B3MB 2GDFA 5HCHA 4QQOA 4XBLA 2P5BA 2EILC 4B8EA 2XWJB 4FZ1A 5FPAA 2QTSA 4P9JA 5JZGA 4AHCA 3OOXA 4Y24A 3BHPA 1N1TA 4CU6A 2XAFA 2A73B 1J84A 4FFBB 1W8WA 3QTCA 4IEQA 5IVBA 2ET1A 3JBG3 4Y20B 2XVKA 1C4RA 3IT8A 3O1RA 5FMCA 5BYNA 1B35C 3T1MA 3AG4B 3FFQA 2WNVB 4QB1A 1MSWD 4XFIA 1RUE3 2FCUA 3OBAA 4BQWA 1K5JA 4MVOA 1SF9A 5CYYA 3W20A 2VMGA 4X66O 1WMXA 3HR0A 2BNOA 1WMFA 1M06G 5L3EA 3NRUA 3T4VA 4GWMA 3SNMA 2AZ0A 4RR3C 4BQYA 2VCCA 4UVCA 3CZJA 5CA6A 2NN4A 4E4HA 4UYBA 1YQCA 4RL7A 5I0SA 5CG9A 2PYTA 1URFA 2R0FA 4KL1A 1KBHA 4DFSA 5FY8A 3BIWE 3Q9OA 4QU2A 5D21A 3OW2U 1AJNA 2YUAA 1QY4A 2B8MA 5FZCA 3IWZA 3SLIA 1YJNV 4WVZA 2IM9A 1WA4A 4FFBA 1AP5A 3A4UA 1FFTB 1YJKA 3MYXA 4PF1A 3POYA 1IHMA 2QQJA 2JDIG 4Y20A 1BXHA 3OMIB 3F95A 1GWMA 3IGAC 1BEV1 3A8TA 1QCEA 4NHMA 3MV01 5CB7A 1AR93 4Q4W2 2BEOA 2O8QA 4HN1A 5L19A 2WNVA 1BVP1 2BVVA 1RUI2 5LMNO 5E8AA 1FPN2 1T2XA 5L9RA 2E7TA 2B45X 5KAIZ 2BNMA 5L7OC 1DU3D 2FMDA 1FKAO 2WZR1 4I0XB 2HWD2 1Q8VA 5F32A 1G4YB 3KCCA 3M8AA 4J41A 4WM8C 2M7WA 5A2QN 4KBBA 3K0DA 3TK1A 4BMEA 1QJU3 2EIJC 4Q0SA 3UJQA 1NQJA 3CPWU 2RJ2A 4B29A 1K5MC 4X9QA 4XDJA 1TME2 1TMF2 1W2UA 2P22C 1CZVA 2FDKA 1JS9A 2ID4A 3B02A 4OI2A 5A3LA 3WNKA 3AMMA 1FXZA 1H8TC 5B1BC 1D4M2 1DF4A 3AMQA 1G86A 2BYVE 4TLFA 1K33A 2JEMA 3BPSA 4IGGA 4PJ0Z 4MADA 3E8FA 4Q8KA 4P00B 1FOD2 3K0GA 4XF4A 2DE0X 3GZEA 5FY9A 4YFWA 5AG2A 4FLZA 5GLVA 4XBFA 4C8DA 3VZNA 1QJY3 3JD2A 4AAXA 2VMEA 2XONA 4IE7A 2X7RB 1LTEA 1W9FA 2ZGRA 1UX7A 3S30A 1VF5B 1ZRFA 4IEOA 5F2WA 2EIMC 1TUBB 5JH7B 3DGEA 1QIQA 1H1AA 4WZCA 5JCOA 1IBKO 1OA3A 4BISA 1UYYA 4AL9A 4K8ZA 4NXNO 1LECA 4K20A 4XXAA 4F4LA 4K0KO 1E79G 4XETA 4AVVA 4QPYA 2XJTA 2RDQA 1MS9A 4LF8B 1EV13 4XJ9A 4GB32 3VQVA 3D0JA 3M1HA 2YXYA 4DR4B 2ZZQA 4JCKA 1VBB3 1YCIA 3B00A 4HONA 1KJLA 2JS5A 1U5IA 2WRAA 1AJQA 3FMGA 2QKCA 5CA3A 3ZYIB 4RQEA 3KZ4C 3K58A 2W9XA 3LCPA 3RYKA 2E31A 3ZRXA 5FYSA 5EP9A 2ZXWC 3AP5A 4NOTA 4UWDA 4Q26A 5FYUA 2PY5A 1XB9A 3B40A 1VB2A 3ELNA 1H2KA 4RUEA 4AW7A 1OD3A 3K59A 2HVKC 3IKWA 5FJKA 1TUBA 4ZXKA 5JH7A 1H8EG 1PP9H 4R4ZA 3WB0A 2E51A 2CTRA 1YXBA 1QNMA 1AX2A 3W58A 1JUIA 3MIHA 5C4WB 4FOWA 4HMZA 3LPGA 4M00A 3ZFGC 4I55B 2CGNA 3VB9A 4OZOA 1RUJ2 1CQ9A 4LBLA 1KQRA 1UOFA 3MF9A 3OBRA 4LUKA 4TV9B 5LBFA 1REFA 2YC2A 1LUWA 1ZVFA 5BNQA 1GSLA 5BV6A 5BUVA 1SBFA 1SETA 4MVSA 1C57A 1DQ4A 2A79B 2ZX2A 1Q82W 2JK5C 3BCWA 5EZYB 1WW5A 4Q4V1 2NYYA 2LM3A 2H3OA 1HW7A 3HKEB 2Q8CA 5EBLC 4GALA 3SPGA 1JZ3A 4QPIC 1PO11 1ULOA 1PIV2 3HT2A 4Z1VA 3UESA 5LGTA 1W6PB 4I0BA 1I94B 2O0OA 2RDRA 1C8M3 4GZ9A 2UY8A 1XU2A 2IJKA 1AROP 3ROUA 4CYDA 4TT3G 3HN1A 2VNRA 2XASA 1UCXA 2PHDA 2ZCEA 4A4AA 2GZWA 4DY5A 5IK8A 3T30A 1W6NB 5C4WA 1LU2A 5I91A 3ZPOA 1RUC2 1EFRG 5LGNA 1C5IA 3MICA 3U0ZA 2ZA9A 1GQPA 3IDEA 3I2JA 4FLYA 4C91A 3J81N 4PIYA 4TV9A 1BBT1 2Z2SB 2J1UA 4RGGA 1PX3A 1HB2A 2D5HA 3QD6A 4YM1A 1S0VA 1QDCA 2IU3A 1YIFA 3U37A 2E63A 2OQ7A 3WCSA 4LK7A 3KCYA 2JKBA 5BY1A 1VBD3 5EZYA 2VBPA 4CVUA 2LP7A 2Q4PA 2QWQB 1W0NA 5LBQA 4WM7B 3HKEA 3KHBA 3BODA 3DECA 4QXBA 1MG1A 1GMMA 3GJAA 1XE8A 4QQ2A 3IFXA 2VE1A 3HNBM 2ZMKA 1GKFA 2QE7G 3WNXA 2P3JA 3O1TA 2R061 2ZT9B 3RYHB 2CTVA 3CXHF 1AR1B 1ZBA1 4YRDA 2CU5A 3D8CA 2TBVA 2WNEA 4Q4Y1 1LGNA 4NPRA 2HLEA 1V6NA 4E2SA 3AP4A 1NJIW 3KT1A 1O5UA 3KV9A 1J58A 2WYSA 1W8TA 1W6NA 1ZSPA 3P1IA 5I0TA 4LJHA 3WB2A 4GQ7A 3C8XA 1H30A 5KXBA 1Y7BA 4DS0A 3E8GA 2K46A 3NNFA 4ISQA 3H7JA 3O1MA 1L7RA 5K8SA 4ZU4A 2CL2A 3ZIWA 4G4FA 3T1HB 1PZ9A 1UIKA 4CDWC 1SLIA 5A3TA 2ZPXA 1ZLZA 1IG3A 5FPRA 4W4KA 3POFA 3AKPA 4XZPA 4WM7A 1Q3EA 5B5EZ 4BAYA 3NQHA 1VBC3 5FZ7A 1V9U3 2YXHA 4J9ZB 2VOXA 4QHBA 4BQXA 1M90W 1XEQA 1X36A 5JXGA 3RYHA 3IJ4A 1ACCA 2AEYA 1I6XA 1XL6A 2Y48A 5KLVH 3MFCA 4XFAA 2PFWA 1LAJA 2N05A 2P3YA 4BIFA 4Y3OA 1VAMA 1LGBA 1OHFA 1B6QA 2C1FA 4H55A 3SDLA 3T4ZA 2QA4V 5LP6B 4ZHNA 3KB5A 3HKCB 4DO2A 3ASNC 3QO5A 3QLQA 4MVZA 4XFGA 2VU9A 4IXLA 1W0KG 4P5HA 5CISA 4YZ5A 2VXJA 3WG3A 1PZ7A 3FLPA 1I9RA 4ATFA 1W59A 4NPMA 1UJWB 1A6CA 2VMIA 4J11A 3T4HB 4RHV2 2DMXA 3THCA 4LF6B 4YJ2B 2WFPA 1MR5A 1STMA 2W6IG 5J9PC 4UFZA 2CTWA 4MGQA 2BUKA 3ETEA 1ROPA 2JD9A 2C9KA 3M3OA 4FPEA 4XQ4A 1N4CA 3U10A 5C70A 3JCIA 1H6XA 3SKVA 4CPBA 2CAVA 3OUFA 5IVEA 2D6KA 4RQFA 3HB3B 3CJIB 3F2ZA 3CMGA 4FOYA 3H3LA 1WW6A 4PQ9A 2RG4A 1VBA2 3A2FA 3M3QA 4GKXA 3T2QA 5LY1A 4M3CE 4DOUA 4FAGA 3U75A 4JI7O 4A7ZA 1HQNA 4EROA 4HNAB 4IUGA 3KG2A 3B8MA 1UOGA 3B01A 4TN7A 3FX3A 5FY0A 4L11A 4X65O 1GNZA 5KXEA 1G9FA 1MEC2 3NKGA 4YYOA 3OGGA 3OY8B 4NIIA 5LP6A 1C28A 3HKCA 2WA4A 4YW4A 1EAH2 2YS8A 4OHYA 1F4HA 2XJRA 4Y22B 2MK3A 4XUQA 2SLIA 2DCTA 1ZZCA 4YJ2A 1I94O 2NQYA 2H0BA 1OH4A 4CDXC 3JALB 2VQTA 2HWC3 2D3RA 1V6OA 3HAGA 2VQEB 1UZ0A 3DV8A 2L6LA 1UU4A 1WNSA 3NL1A 2H8PC 3HNMA 3CRMA 1HWYA 1ENVA 3SITA 2B1GA 5CA0B 4OX9O 2DTWA 3GZTB 1LUVA 2WWJA 1VR3A 3CJIA 5GTHZ 3WD5A 1HRI2 3LKJA 4QKNA 3O0VA 5CBLA 3MLLA 4GLXA 1C8NA 1EUUA 1XUQA 4K8RB 4KU7A 4MTOA 3IPVB 3JD3A 4P9XA 1AI7A 4ZI7B 3RYCB 3K9SA 4HNAA 3P6BA 3LDBA 1V55C 4FFIA 4FJCC 3C7EA 1MS5A 1JX9A 1GRJA 2ZR2A 3OY8A 4AVTA 1R1A2 4MVTA 5H6RA 1BL8A 4ASMB 4Y22A 3H1JH 4XW3A 4IW3A 1K5SA 1GH6A 1ULCA 2Y8KA 3JALA 3WG7C 1YIJV 2R072 3SCFA 2ENRA 2YBKA 1WCUA 2HHHB 1CAUB 3NJXA 1RMU1 3PUSA 4LK6A 3USUB 2E75B 5CA0A 3T09A 3JSLA 3I3MA 1Q8IA 1VAKA 2DVAA 1JUHA 1A8DA 1F7YA 3LZZA 5CFDB 4NTXA 5JZGC 1HDJA 3RYRA 4L2NA 2WFF2 3M99B 4LP8A 3G6EV 3IPVA 5BY5A 3LFIA 3RYCA 1ND2B 1VRH2 3HIFA 1OD5A 1JJOA 2OT5A 2HEVF 3VZMA 3DYMA 4Y1XA 2ZGUA 3LDCA 4UCOA 1PGSA 1IQAA 3HQUA 5FWJA 3HOBA 3ACHA 4FFFA 4EB6B 1NR1A 2F6BA 4I30A 5J3UA 2AZ5A 3JATB 3L73H 2E53A 3POSA 2BGOA 4NRMA 1KP2A 2HWB2 5IT9N 3J8F2 2VZ3A 1XHZA 1U12A 4LBEC 4XDQA 4YW5A 4FTEA 3N7JA 3IAQA 1ZZBA 2BFUL 3D3IA 2BGCA 3O5SA 1O9HA 5KHKA 4V2VA 3TEWA 1Z7S1 4LORA 1Q8QA 1UY0A 2Q5ZA 3GBFA 2VZVA 1CAUA 2B9ZA 4YY3B 3USUA 2MNGA 5HCFA 1W2OA 4BU2A 1KQSU 2PZSA 3VZJA 4DIQA 2AW9A 5EBMC 3GDBA 5CFDA 4W4ZA 4BQ1A 3CU7A 4KXRA 3U14A 4OYUA 4LF6O 1CGPA 4OPAA 4MSVA 1QOTA 1VP6A 3SCHA 1FMD1 4QAWA 1O9GA 1ND2A 3HJRA 3K57A 4CSWA 3RJ2X 1VQKV 1AL22 5JI7A 1W6QB 4TV8B 3ASIA 2EJ7A 1NZCA 3UKMA 3AG4C 5IDJA 5GJ6A 1YFYA 4EB6A 5EZWA 4JI6B 1NXMA 2WNVC 3JATA 2P4KA 1B09A 4FLUA 2QZ2A 1UY2A 2VVFA 2CH7B 1CX1A 1JU3A 4RS5B 3H8UA 2VAUA 5IFPA 4OI0A 3OF1A 4O2BB 1Y76B 1PNGA 5CEHA 5FZFA 5K0UB 3ZFEC 1XRUA 4Q20A 2FMYA 3VBRB 4PDVA 1Q90D 5E1AC 4I0WB 2KXLA 3BTZA 3C3VA 4JF3A 4ZU5A 4COUA 5T5PA 3DXTA 2YDEA 1V6IA 2FDGA 3VKLA 2DJVA 1K3EA 4XEZA 2R0HA 2XHNA 1KUQA 4IHJB 2XBO2 2HWD3 1C1FA 2IH3C 4CTEA 2BU9A 2FCTA 4COYA 5HFMA 2QM4A 4XURA 4G3YC 4R6ZA 3QVNA 2A6WA 4BQ2A 3HQRA 4MGZE 4NTWA 1W6QA 4DQAA 2XB6C 4TV8A 5CADA 1HB3A 2YBSA 1S77D 3ZXJA 4LO4B 4A3ZA 1WPBA 2NM1A 2AC1A 4AFAA 2RV9A 2PHLA 2GC3A 1QVFU 4NIAA 4XC9A 2VECA 4OPHA 1AXYA 1QOSA 1QLEB 4RS5A 2N74A 4O2BA 1Y76A 1WCDJ 1L0LH 1FOD3 5K0UA 4FQ4A 4AQ2A 4YFZA 4C0HA 1RHI2 5JCOC 3VBRA 4NPLA 4PI0A 5ANNA 5EV7A 4MTGA 3K9AA 1EPWA 4XILA 1QXJA 2DFCA 1XBLA 3CC2V 3PVBB 1LHWA 3KCXA 2VW0A 1Y74B 3ZYBA 5FOBB 1ZZ8A 1DGRN 4IHJA 2UYBA 5JOZA 1F23A 1B06A 4Q4X3 2AGAA 1GV9A 5IVYA 4XCAA 1U5ZA 2H94A 4LO6B 2IXLA 1NTKH 2FDHA 1GO3F 5F1RA 4XPVA 4QDSA 2BPA2 4CCMA 1US2A 2WINB 5H9RA 3PJQA 3WP3A 5LA1A 4H14A 3CQOA 3I2DA 5A1LA 2HHHO 2QBXA 3ACGA 2V7QG 4FTSA 3TEZA 3OEHG 4JQRA 4LKDA 1QOOA 2XJPA 4ZS2A 4AI9A 1CXZB 1OQDA 1SZXA 2VJXA 5IWFA 2QFEA 2VWJA 3A23A 2ODMA 5D1IA 1JOYA 3IIIA 1X33A 3FLRA 4IEPA 1YDXA 1BEV3 5FXWA 3MF6A 1U97A 2BWCA 4IV1C 2RN9A 2ZEWA 2H0VA 5FZOB 2VXRA 2JEXA 2XJUA 3WW4A 4DW1A 3PTYA 1HNWB 2VMHA 2BSKA 4F7ZA 1DP0A 2WLMA 4UBHA 1QR9A 4XDKA 4XTMA 1G8MA 4PBPA 1Y74A 3OPZA 1BQPA 4LUMA 3TCUA 5FYYA 1TUEB 2C26A 3LSEA 3WNNA 2UXXA 2V5YA 4YGBA 1QQP1 3I2KA 3VDBA 1ENXA 3G71V 2IBZH 2QR4A 4N9IA 3SCGA 5FP3A 1IXMA 5FUIA 1NVPD 1ULDA 5FYVA 4UFIA 1NZIA 3RGBA 1RUJ3 4NRQA 4B3TB 5IY5B 3F5WC 4OGQB 2HJIA 2VW1A 5EHDA 1XHXA 3T1YO 4D69A 1AP6A 1WAZA 4YY3O 5FR3A 1UFIA 1OXCA 4YGDA 4GX2A 5K4LA 1Y9QA 2EIGA 3VN4A 1IVSA 3E1F1 1RXGA 4NO4A 3ZDVA 3PMSA 5JDBA 1HR0O 2ZZJA 3F7YC 3L74H 5FZOA 2W1UA 3CZUA 5LRSA 3ZFFB 4TYSA 1PIV3 1CR7A 4EWDA 1I5YA 5JIAA 2BQPA 4JI6O 1KXGA 4HFSA 2ZGQA 1KYOF 5AC91 2P34A 5FOJB 2YXSA 1W9TA 1COV1 4JZRA 2OT7A 3K5OA 4RFT0 3L75H 4G2KA 2JIZG 4J7JA 3IIAA 2GC0A 3LDDA 3AL6A 4ZPIA 4S2FA 5KC5A 5A6YA 2CAUA 1RUC3 1Q7YW 1S72V 2JENA 1FNZA 2WYFA 3ON7A 2Q67A 4FPYA 2MEV1 2WO1A 2GP3A 4BWOA 3PTRB 4FXKB 2XAJA 2OQ6A 3K3WA 1AYM2 2DUPA 2ADEA 2C9AA 4TQDA 5IUQA 5A7QA 1JHJA 4X8PA 5T5OA 4IV3B 4GKJB 2WQZC 1RPRA 5LA2A 3RZJA 1OFNA 1O59A 2HFEC 1APNA 5EPAA 4A5UB 2ZOEB 5KAFZ 1FXKB 4URAA 3ZFFA 2ZGOA 3T1LA 1FFXB 1AJOA 1XMQO 5FDBA 2ZEYA 2V4AA 1BQ0A 4PT6A 4XDOA 1ENQA 4L92A 4DR2O 4B4PA 5BNOB 1BKZA 4XJUA 4JDMA 4GMP1 2R041 4LHKA 2D7FA 5DAWA 3ALQA 2ADQB 4E4ZA 4Z8BA 4LXLA 5AFEA 2QSAA 1JOJA 4O4JB 3POIA 1PM9A 4FTBA 2QKAA 2Y0IA 4OMDA 1Q8PA 4META 3FL7A 3IDBB 5IYCO 2B42B 3H8OA 2CTPA 5CNAA 3P30A 2A6YA 2ZHMA 2XJSA 2VUCA 1OMIA 2W1QA 3BVOA 3G67A 3RZKA 3HBKA 4AEDB 4IV3A 1UD1A 1ZRDA 2OA2A 2SBAA 5HI0A 1RGSA 5FLHA 5FTTC 3MW2A 1WW7A 4H0LB 1OLME 3E6BA 4CU7A 1JBCA 2YB7A 2Z69A 1FXKA 1JTZX 5FXXA 2N7GA 4INDA 5FPLA 1ZYBA 1S76D 1FFXA 2WAMA 4AZZA 2WLLB 4CUAA 1V70A 2UWAA 3W5NA 1N0NA 2EXJA 5BNOA 5A3MA 1N32B 3DGTA 1S2KA 4AEKA 3R6SA 4CEWB 4HL0A 1B04A 3BEHA 1XBFA 3STZC 2K2SA 1VP7A 2PLV1 4N53C 2UXDB 4I02A 3M3EA 3NMBA 2WWWA 1YJWV 4I9QA 2CNAA 3RZZA 4O4JA 4JI4O 4FIPC 3N9QA 4NYKA 3JD71 1L1FA 3M8LA 2GH8A 2UYAA 3ZHUA 2J1EA 1CX4A 1AB3A 2YC0A 1UPIA 4RHV3 5AVAA 2JB4A 4AK3A 1X4TA 1NTZH 4Y1YA 1HX6A 3VBSB 5L9VA 3CRCA 1US3A 3EHKA 4UCRA 4FOQA 4AEDA 3WHTA 4N90A 4RFRB 1OKQA 4CZSA 3JBG1 4AEMA 1H2NA 5A3PA 3TN92 5LP6C 3OPTA 4BZ4A 2R063 4B3TO 2DYSB 1H1IA 3RQ0A 3WDTA 2QTWB 3VBUB 4KWJA 2WLLA 3PDQA 1XU1A 4M3CF 3I49A 3P3NA 4LCUC 2IXJA 3OPWA 1XNBA 4CEWA 2I07B 1CZTA 4MO3M 2NP0A 1MEC3 1QHDA 3K08A 3HR9A 1LOCA 2QQNA 4DV7O 2HVJC 4XACA 5ITZB 4KI5M 1SC5B 2JEUA 1H2GA 4BQ3A 2W47A 4BIUA 2XT9A 1RUH1 3APBA 2ZE8A 5CN0A 3CJIC 4P08A 4JX0A 2WQ4A 3NW4A 2UXNA 3LIGA 3WDVA 3FBYA 1PGW2 1R1BA 3DN7A 4GKKB 3CRRA 3B93A 2WC2A 1JOBA 1H8HG 4FLVA 5IATA 5KMGB 4L97A 3VBSA 1JZ2A 2P6CA 2ADPA 5G04L 4NHKA 4R9BA 5KHHA 3O1SA 1F4NA 2D6PA 2Y6FA 3AG2B 1QXPA 1VBE3 4UV8A 3J9SA 1GM7A 1K12A 2ZKLA 4AGVA 3LSQA 3QNEA 3MGUA 1AR91 1HRI3 2ET7A 5IYDO 2OPWA 2YFZA 1WJZA 1Q8OA 2EILB 3TNPB 3CYOA 5FY7A 5KWRA 5HCBA 4QQLA 2WDBA 5JJEB 3VBUA 3WNMA 1W8ZA 2IXCA 2RNBA 1CD3G 3K3OA 4ZKIA 1QBZA 3B5LB 3F7VC 1VMHA 4FPHA 4AGGA 5ITZA 1BCXA 1UF2C 3TXQA 3AYDA 1BQZA 4MZUA 1Z2GA 2FDJA 4BQ5A 1QJU1 2YGLA 1ZBA2 2A70A 2Z79A 3S6PA 2JKXA 2HJDA 4Z2AA 3W7SA 2IZWA 2DDUA 4A45A 2IH1C 5BXZA 1DLLA 2UWBA 2QJ1A 4NVPA 5KMGA 1JYXA 2R073 3POGA 1W8FA 3VZKA 4CUBA 4RR3B 2HJFC 3NNLA 4FI9A 4ES9A 4QD2A 3R66A 1W90A 3SPCA 1JA8A 2K0GA 5LRRA 5F37A 1CPYA 4MXWB 2RS11 1RUG2 4IE6A 1TQ5A 3VBFC 3OGRA 1XSRA 5ISLA 2AHZA 1QJY1 3VD4A 2WFF3 1AVMA 2RCVA 5DZFA 1Z0HA 5JXJA 3VDDA 2ITDC 1CZSA 1OQ1A 2RS31 1V54C 3GGLA 3CX5F 3UYJA 5H2FZ 1FX5A 3AKRA 1FJGO 1HQLA 3OSDA 2D6LX 5GLZA 5IT6A 4CCLA 1VIWB 1SQPH 1EY2A 2YPJA 4JAUA 2KA3A 4JI3B 2Q1ZB 4YM0A 4KU8A 1LODA 2DWRA 5BNNB 2HWB3 1O3QA 1P84F 4GXLA 4DO0A 4NMIA 5L7OB 4IGQA 1EV11 3R4SA 3J8F3 3VQXA 4UB8Z 4AOCA 4QGPA 5CFDC 3MLKA 1BCCH 1VBB1 4WM8B 2PGGA 1F15A 4ASKA 2UUAB 1HJGA 3MLJA 3WDXA 1VQ6V 1Y9MA 4RR3A 2YXLA 2XL9A 3ZYFA 1SFNA 1ENSA 1K5MB 2UXBB 3I2GA 1QNWA 3K75B 3BABA 4MXWA 1PZ8A 4AVAA 4GD4A 2VCAA 3ATGA 5B1BB 5IJRA 2JX9A 1JVMA 1Q6IA 3UO3A 1PK6C 1ZX5A 5FYBA 3I56V 2D44A 3SR2C 4HSLA 2VZQA 4K3AA 2ZAHA 1JOPA 1KB9F 2YIBD 4XXPA 5T54A 3ACIA 2JVDA 4LT5A 3ABTA 3SYAA 1PGL1 1F4MA 4QQPA 4AR2A 1Q5OA 5FZ8A 5LHGA 4PF5A 1HV1A 5BNNA 4MGKE 1KITA 4LR3A 2XKOA 5JCTA 3LEIA 4N23A 4LHLA 3T3YA 3ZSMA 1TNRA 1AJPA 3BVCA 3MZHA 4WM8A 4YHHB 3WQBA 5FYIA 3RYPA 2WT2A 3LQCA 3T2OA 5JSPA 1H6YA 1RMU3 4P9GA 4CS2A 4AVCA 1N36B 3FUQA 1K5MA 4CH3A 3KZIZ 2Q68A 5JSOA 4IL7A 3E97A 3L9DA 3ZRVA 2P17A 4S2HA 3TEXA 5JI9A 4FT8A 1C8M1 2C2AA 3OTOO 1PV0A 4RS5C 4JYAB 3N36A 1VQOV 3M3IA 5K0UC 4LIVA 2ZXWB 3AK2A 2K9PA 4O4IB 2CY6A 2A75A 1OA2A 5FZMA 1S0FA 3ZO0B 5FJHA 3PUAA 1JZ6A 3A0KA 1K97A 1LB2A 3H9AA 1X7NA 3C7OA 1XMOO 1SCSA 2MHFA 3OCPA 1H9WA 3AK1A 2UUBB 1CP9A 2WS92 1GN3A 3BRCA 3MIBA 2Q1MA 3LAGA 1ZRRA 1AR71 5GONB 2VOKA 3J4UH 1BMV1 4PA7A 1WN7A 5B1NA 1D2SA 3EXAA 5FZIA 3E89A 1VQ7V 4P30A 3HPNA 1VBD1 3B9IA 3V0BB 1E5HA 3X29B 1LGCA 4KQ7A 4WF9V 4W6YA 1QJZA 3FN9A 4M0HA 1ZRIA 1F5JA 5TISZ 3PURA 1KECA 3BTYA 1IQDC 2B39A 3Q8AA 3H42B 2E6VA 1UNBA 1D0GA 4D3WA 2RR12 5FUNA 5FY1A 5BXXA 3CWBH 3D3QA 1VLNA 1WLCA 1SZBA 2PTMA 1MMMA 2OTJV 2FBEA 5DN6G 5FUPA 1WA6X 5FK7A 4O4IA 4DW0A 5DPNA 2Q8EA 2GH2A 4QPIB 2JDPA 1IS4A 3A0BZ 4LF4B 3DTUB 1P7GA 4K40A 1EZVH 2Y4TA 3CDZB 3OMAB 2DVGA 1A3KA 4LA2A 5EYXA 3WF4A 4LBQB 1WA8B 3V0AB 3FFZA 3R4UA 5A3OA 5GONA 4GJZA 1H4HA 1PMJX 4DV0O 5CA1B 4MH0E 1V6KA 5FZHA 1K45A 1OUXA 1K34A 2RM23 5HCAA 3V0BA 3MIGA 1JQ0A 2XAHA 5A6ZA 4AEJA 4PDMA 1G6NA 4LFCO 2RVAA 1VBC1 1V9U1 2BZDA 1GK9A 2VL4A 2G19A 5CBHA 3SPHA 4Y5TA 5DMYA 1R082 5FPBA 3WNLA 4QNHB 1DQ2A 4DR5O 5BMVB 2DVFA 4UXAA 3UV9A 1Z7S2 4UCTA 1DGWA 4MHRA 3RZLA 2UUAO 3IC9A 4E4DX 3M3CA 3RT3C 3ZXAC 4QPIA 1GZCA 4XQWA 1RVF2 3H9VA 2E7QA 4ICGA 4MGTA 3JYCA 3CO2A 1NCRC 3QH7A 1P4RA 1NVPB 1WA8A 3DXUA 4YW6A 5E89A 2OS2A 2J7MA 2VMFA 3PIJA 1NXD1 5IJ9B 5FLJA 5CA1A 5JIUA 2PHXA 2P90A 3VBHC 2V4VA 1DF5A 1KMIZ 5E88A 1R3LC 2Q6AA 1ZTEA 4X62B 3FWEA 3OEAA 5C9AB 4KGQA 4CCNA 2ZABA 5IY5C 3OR6C 3WNOA 4DYLA 4PA3A 1LEMA 4Y26A 1LHNA 4NHXA 4B1MA 1O8PA 2GMPA 4F6RB 5CFCB 3CXCU 2O14A 4JKKA 2F4PA 1UZVA 4CDWB 2R16A 2VR4A 4Z1MG 4JV5O 4H44B 4MW8A 5F3EA 3AXDA 3ZJZA 4MS2A 3VHRA 5BMVA 1CAXB 1M4UA 3LUTB 4NB5A 2HLDG 3C7HA 3M7AA 1G9DA 1IBMO 3B77A 2ZE6A 3QG5A 1XYOA 3ZFFC 5A3WA 4KHPO 1N36O 2VCMA 2VG9A 5T52A 3ZR5A 2EXKA 4LFAO 4GT1A 3OG2A 4RWUA 2FZ2A 4DV6B 1EYBA 1LCLA 1OQEA 1H2LA 4BW9A 4CE8A 1DTOA 1O8SA 1RUF2 4XVHA 5IJ9A 3ZSKA 5JQGB 2HWC1 5BR8B 3K5MA 5C33A 2JDZA 1Y43B 4DR1B 1J95A 1KGYA 2YZ4A 4JGYC 4EN6B 4AF9A 4C0BA 3HWJA 4JASA 5C9AA 4X8AA 1BSMA 1VAVA 4DV5O 3CCJV 3M4FA 4JPRA 1PVC2 1K4CC 4CCCA 2I45A 3RWKX 2XJQA 1KDMA 4F6RA 3HVDA 5CFCA 3D36A 4NR1A 1XNRB 1QXRA 4WBNB 2WSUA 4UVAA 4CDWA 1AR82 2BOJA 3IMNA 5FXVA 2L35A 4IV3C 1SQGA 1CAXA 1ASJ1 4ORFA 4S2DA 3UT0A 3LDEA 4AVBA 3WSOA 4XJ8A 5A3NA 3J7NA 1FXKC 4E2QA 1UL9A 1CAWB 1EUTA 1G9CA 1CIWA 5A1FA 4B3SB 3U78A 3NV2A 4H7LA 3O1UA 1HRV3 2LTNA 5BNOC 3ETQA 4LFBB 3QBQA 3RG0A 1ZX3A 2XLGA 5B3SC 4GAZA 2YPDA 5JQGA 4FLXA 4XDPA 4P9IA 5DZGA 4PLNA 4FFKA 4HKOA 2P06A 3WY6A 3A0HZ 1C3HA 2M6YA 2R9AA 2GNTA 4TSFG 2EXIA 2HEWF 2H6CA 4LF4O 4H2AA 4B7EA 5AC93 1WP8A 2QTOA 4JI0O 4CDXB 3BKZA 2P2KA 3CCEV 4WBNA 3VKMA 2ZGKA 3E5XA 1LR1A 4J80A 2Y6HA 3S57A 4AEDC 2ZBJA 3GHNA 3WDYA 3N9PA 4E8CA 5IWAB 2QDRA 4BPZA 3BFRA 1DFQA 2ZJCA 4QM9A 4DZGA 1GZWB 4XABA 3DC6A 1G8WA 2OIEA 1CAWA 4SBVA 2EJRA 4L99A 3N4MA 3OM3B 5KHIA 1T6BX 4JHZA 4HVRA 3JARB 2UURA 4MHUA 2ETNA 3DUIA 2RDSA 1V55B 3BA9A 3MAQA 4CEWC 1DF0A 3AL5A 1BE3H 5DUUA 4HZFA 2FTKA 3SJAC 3IMMA 3JB8A 4NN0A 2ARCA 3KLSA 4I09A 3PMEA 4UW6A 3SGIA 1QMJA 4CU9A 3AFGA 2WL1A 2E76B 2FD8A 4DUXA 3AZYA 4AI1A 5LMUO 4QXHA 4GA9A 2CWMA 4ET7A 5A7OA 3DC5A 1CIYA 2R043 4UI9L 1XC6A 3OUIA 5CKMA 1NBMG 1W6OB 4CDXA 2R49A 3RN4A 2A0LA 4CDQB 1O3RA 2VNGA 3VBSC 4IYIA 2Y6LA 3CIHA 2Z0AA 2Y38A 3WG7B 2R30A 4TXWA 5A33A 3VD5A 1MPXA 1XE7A 4DR3B 5FZAA 3FX7A 3AVRA 1V9PA 1POV0 1YQ5A 4ZKTB 1US6A 2EVXA 3LPFA 2Q4SA 3SPIA 3WDUA 5C93A 1SQVH 4CXYA 2ZGNA 2VMCA 1GZWA 1THZA 2D43A 2BTQB 1WBFA 4XUTA 1TE1B 1HW5A 1L7LA 3AX4A 3LDRA 1WMDA 1NE4A 4KGGA 1COV2 3ZXKA 2ZX1A 3CCSV 1S0JA 3UQ8A 1BLZA 4EV0A 3JARA 2BERA 3PUQA 4QX7A 1I0HA 2CGOA 4NXNB 1YWKA 4QWNA 2O1QA 5EYYA 1AR62 1OHHG 2GUZA 2P6JA 1N3PA 5JVVA 3RS6A 4K0KB 1XNQB 4BDVB 4CXXA 4I5SA 3FUOA 1JZ5A 3OD0A 1F8VA 1JZ7A 4Q4W1 3SYPA 4P9YA 4YNIA 3J7AU 1R093 4EKWA 4DB5A 1KDKA 1UQXA 1IGOA 4AHWA 4E4SA 2VQ0A 3ETGA 2XNDG 3OTFA 4EZ4A 2OCCC 3K4ZA 4JTCB 3ZHTA 3R0RA 1W6OA 2HWD1 2CDOA 4LO5B 2PLV3 4CDQA 4CDUB 3ZN1A 3FD9A 3I54A 3T2TA 2VQUA 1VQ5V 5B66Z 4MX3A 4P14A 4WV8A 4Z82A 2W46A 3EO6A 5BR8O 3BGAA 3JD73 2A1XA 1RFYA 2VQAA 1CONA 3ILNA 4FM0A 1TME1 1TMF1 2BTQA 1S0EA 1J5EO 3KKYA 5C5TA 4IE0A 3BI3A 1D4M1 5FPZA 3C3TA 4J25A 4FPOB 2RDNA 1YJ9V 5LBEA 5A9GA 3HN3A 3VDDC 1XNRO 2ZD9A 1JPXA 2WJSA 5FMBA 3H7YA 1JODA 4X1YB 4X88A 4I0AA 1FOD1 1RB8G 1YI2V 5GLUA 2YYOA 3W5MA 5GZFA 5A32B 3FHIB 3DYOA 5LEJA 2WN3A 3RZHA 2A6XA 1E1RG 3C7FA 1KS5A 2A5ZA 1REDA 2JDAA 1F35A 2AR6A 4LO7A 4PD4F 4PDRA 2IXIA 2I2SA 2HWF2 4AHZA 3PVOA 4IGOA 4B3SO 3ZFEB 1NY72 4Q4X1 2PHTA 2PHRA 1Q6UA 4CDUA 3S5AA 4LFBO 2R1DA 1BHGA 1W0OA 5IFTA 4UFHA 2P4VA 2JXAA 1PL0A 4BLIA 5ACA3 2ZGPA 1BJQA 1SLBA 3LWCA 4I2OA 3O0XA 3LOBA 1RUH3 4UV9A 5LW9A 4CCOA 4U36A 3K4AA 1W9WA 3THDA 2ERFA 1IS3A 4W6XA 4GB31 1DLBA 3BU0A 4LBMA 3T2PA 2QWRB 3JQWA 2WLHA 3I5DA 5LZ6A 3H3ZA 5J96B 3OE7G 1JH5A 5FO7B 4QB2A 4JGSA 1VMFA 4X1YA 3MIDA 2A7AA 4K8FA 5LWBA 2VY0A 4R9CA 2AENA 2DVDA 2LGQA 5A32A 1ZZ9A 4DK1A 4MXVA 5IWAO 4CP2A 1W06A 2F23A 1LJ7A 3SC7X 2Y64A 4QE9A 3H1LH 2A3XA 3DPRC 1Y6XA 5BNNC 4Q8LA 2P7TC 3FAVB 1NLQA 5TSWA 3T0AA 3BIEA 2GN7A 4FXGB 3ZXDA 5JPNB 4R50A 4GX0A 3SYQA 1O7FA 3LEMA 5G05L 5H9SA 3M2MA 2Q30A 3ZFEA 3AK0A 3GBGA 3LA2A 2IUWA 5DAVA 4U3FH 1ZBE2 1T5EA 1SBEA 3WB1A 4LKEA 1WP7A 4MLOA 3H50A 1RUJ1 2J1SA 1WW4A 1CWPA 1RUE2 1QJX3 2E9QA 2Q7HA 4UCVA 2VZUA 1PD3A 2IWGB 5H5NA 4TUYB 4GKYA 3W21A 1NR7A 3G6JB 2V1DA 1W9SA 5FYZA 3UGGA 2OPKA 4W6WA 3PL0A 2I74A 3U1XA 3IDAA 5LY2A 5GLWA 2DU0A 2RMKB 5APAA 1MVQA 5L3DA 1IS6A 4DR3O 4YARA 4IT5A 1P7BA 2RS13 4EYUA 2WT1A 4K3UA 2P4EA 2BBVA 4LHSA 2IFWA 1MS3A 1PIV1 4QMAA 4MUVA 1W03A 2WLKA 3ZSEA 1PO22 2J22A 3FAVA 1WCSA 2XAQA 2LRPA 2RS33 1QU0A 2UXCB 1W8NA 3P3PA 4B1LA 4YG3A 1RUOA 3JB4C 2QKDA 4Z92B 4IV1B 2W87A 2ZGTA 2EALA 4XHXA 2QQVA 4D8MA 5F8PA 1XNQO 3V65A 1RUC1 2YGMA 2F4VO 2WLQA 4QPWA 2B9UA 5EJ1B 2X09A 2HR3A 4DXWA 3OUHA 5EFUA 3AYAA 2W5FA 4TUYA 1K73W 4BK5A 4BLJA 4Y33A 3HEIA 1YF2A 2YIBA 1UXZA 1UYZA 2WA3A 4JZGA 4CCKA 1KKDA 5A7WB 4QX1A 2P37A 3MDSA 4LNVA 3VOUA 1OUSA 2EZOA 1OVPA 3H01A 2ZE7A 2VQFO 5C3SA 2TEPA 1DDLA 1PX4A 4PLMA 2QQKA 1J83A 3DF0A 2QVSB 3VD7A 4YM2A 1RITA 4IERA 2X6CA 5L3FA 2X29A 5DM6V 4AYUA 2JGDB 2YC4A 1NT2B 4PLOA 4Z2WA 3N7MA 4PDWC 3ZMNA 2ZE5A 3ZKYA 4IV1A 4AFDA 1XNDA 3AKTA 3PIGA 4QPKA 4HK8A 3MO4A 4MG2A 2C4XA 2RS53 4NIDA 3GWOA 1IKPA 1HP8A 3OMNB 3NNJA 3APQA 3RJRA 2W52A 1RJ7A 4YVSC 2R32A 2F93B 2R9IA 2WNUC 4FPCA 4JKMA 5A3UA 4JI7B 4XIOA 2V5DA 4LITA 5GZEA 3ZPYA 4X65B 2JE8A 4K35A 5A7WA 2GN3A 1VMJA 4YZ1A 1VARA 4XJZA 3AJZA 1S0IA 2BV4A 2GSYA 1SQBH 1G7YA 5JOWA 5B2GB 3WW3A 2DBNA 2FYUH 3GCXA 5FBZA 3ZX7A 4X1KB 2Y34A 1DGSA 4QHZA 1QWRA 1FD9A 4JGZC 1HXS3 1EV12 2BBAA 5IK4A 4IEXA 1R083 1UU6A 4S2GA 5H9CA 3B94A 2JGDA 2W95A 1N34B 3L70H 3ZMVA 1J3QA 4A2UA 5F5AA 3KGLA 3S7EA 5F3IA 4BOWA 1VQPV 4JZ2A 2ES3A 4DUVA 5HBAA 2ZR3A 3ZHQA 4OX9B 4HT1T 4JRLA 1J1LA 1WLTA 4I7ZB 4P9LA 2ZM6B 4MYEA 3TWIA 1PNKA 1AR73 1PNLA 4E2GA 3K04A 1R1ZA 5FYCA 3B2EE 4RHV1 3LA7A 4ZU7A 2JDUA 3AG1B 4DINB 4GH4C 3TNQA 2XOKG 4BIOA 2WPDG 1QJEA 3TRSB 1SFPA 3UGFA 4X1KA 1JCHA 4BMBA 1JMUB 1QDOA 3B3QE 4H3WA 5L36A 4HKWA 2PELA 3WQ0A 3GBWA 2G9ZA 5EWSA 2J42A 1VBA1 3VBOC 3RZMA 3W7XA 3S7IA 4EN0A 2X53S 2KQXA 1IS5A 1SQQH 1Y9GA 2JD4A 4Q5OA 4AI0A 2ILMA 3J7MA 3N7KA 2EIKC 2X6AA 3ZHVA 2QZ3A 1MEC1 3VHPA 1UMIA 5C9AC 4RSUA 3EQEA 1LULA 1HB4A 3H1YA 1EAH1 1ST8A 1WCQA 4DV2B 3VHNA 1C8M2 1PNMA 4PA9A 1R3KC 5CFCC 2JRIA 3D36C 4DV1O 3MHZA 3LNMB 1NT0A 3H3UA 2F43G 4JI8O 1RUF3 3OEEG 4TZDA 4N53B 2UXCO 4RGAA 5I0RA 2EIBA 3IAPA 3ACFA 4FFHA 1VRBA 1PVXA 4LH7A 3RYFB 3GZUC 4R7CA 2DUQA 1ZUQA 1PVC3 1VBE1 1OCZC 2Y6KA 2Y69B 1XYNA 2OKXA 1HRI1 2DW4A 1VQ9V 1BMV2 1LU1A 1SS3A 3WW2A 4R9AA 4HLTA 4M4PA 2D93A 2XJVA 4A7KA 1KS4A 1SESA 1URXA 1E5RA 3N2KB 4EZHA 1Z5VA 1Y4MA 1RM1C 5DXDA 3GJBA 5FMOS 1AILA 4L8JA 4GJYA 5KHJA 5CVRA 1QU7A 3LA3A 4FLWA 2VZRA 1YO8A 4IEVA 3WNPA 4X20B 3AC0A 2ZKOA 3MPBA 5IVFA 4PIZA 1ZL8A 1EPZA 1FXHA 4N53A 3AP6A 4AAPA 4P02B 4P9PA 2R071 3AG3B 3SXWA 1UY4A 4AI2A 3RYFA 3JD4A 1A8MA 2JDYA 4D7YA 2BJSA 2QQUA 4CPBD 1LRHA 2E33A 3I3QA 4J1WA 1FYUA 3KF5A 2E5LB 1DHKB 5T50A 1LNSA 1JYVA 4N9HA 3IZOA 1Y4WA 2PAEA 4UT5A 1IXBA 2WFF1 3WP6A 1GICA 4COZA 3SEEA 1OZ0A 1VRH1 5KHGA 1M57B 1LOFA 2AHYA 3N2KA 1VBC2 2QNKA 1V9U2 3RWNA 5T3NA 3CCLV 3I97A 1QJFA 1ZA7A 4Q2FA 3E86A 3CCUV 1ZREA 4DUZB 4ES8A 2OTLV 3TBDA 4WCEV 5EQUA 2XVLA 3APOA 1UAIA 1UN1A 3EFFK 3LGRA 1IPKA 4XFCA 3B8NA 4RAIA 2B9VA 2UWCA 3FE5A 2HWB1 3SYCA 5A70A 4XUOA 4KP4A 3J8F1 1VF6C 1SDDB 4X20A 4CUGA 4Q6GA 2EXHA 3RRDA 1N34O 2PAKA 3A7QA 3O1OA 1A32A 4OUEA 2A06H 1DYKA 4FP3A 3WG4A 1KFXL 1PMIA 1IX9A 4K7JA 5DABA 1RUD2 5CKQA 4AG4A 3M70A 3PU8A 2BWAA 3KV4A 4YW3A 3PLQA 5A80A 3NV4A 5IVCA 3UKNA 1FYJA 2ZX0A 2ZM6O 4V2WA 4ZXEA 3N35A 1S3JA 2XG3A 2GV9A 1OCRB 2VUDA 3D82A 1ASJ3 2IW5A 2NR5A 2ZAAA 1Y67A 4WFFA 3IAYA 1W99A 1AL21 3HPLC 2JJ1G 3ZN4A 3BA8A 2NLJC 2HWE2 3OR7C 3QCWA 3VBFB 3NJVA 2J1AA 1S0CA 1LENA 2XDVA 4UFMA 3UETA 3WUDA 3CBNA 1GP6A 3ZYGA 4FZ0A 1V54B 4ZS3A 3OFNG 4O2AB 4B08A 4CDQC 2WLJA 1YRZA 2CUGA 2F4LA 2ORZA 4LULA 4HKLA 2P3KA 1VPHA 2IJHA 4DR7O 2Y33A 1YSCA 1K3IA 4LF5O 2DTYA 3POEA 4DUYO 1W0PA 1DYPA 3K5LA 1XYPA 3ZDSA 4TWTA 4CZZA 3PJSK 1AL0G 1TG7A 5J37A 1H4GA 1I1EA 1AI5A 3USSA 4Q27A 2ZX3A 1NI8A 4PA6A 2XBO1 5FXZA 4DV2O 1AR5A 3BTXA 3PUHA 2E32A 2YBPA 1XQ8A 2GALA 5AFBA 2PHFA 2KD7A 2B5HA 3MPPG 1W8HA 2DCYA 1VJ2A 1QVGU 2TUNA 3TAYA 4UFLA 3UK9A 5CZKA 3AKSA 3VBFA 1UY3A 4TWKA 4K1ZA 2Q9LA 4KFMA 5F5IA 1GOHA 1PK6B 2UU8A 4YJ3B 4LF7B 1DZTA 3I7DA 5D5QA 1W0JG 2O8OA 5KXDA 3P5BA 4O2AA 1GOGA 1MS4A 5J09A 2D3OW 3D3AA 4CDUC 2VM9A 3AZVA 5JR7B 1RHI1 4IEYA 1AYN2 4ZZ8A 3Q8FA 1S4CA 2JDNA 1TAEA 1MSDA 2VWKA 3S0MA 1QKQA 3W7TA 3T1YB 2VPVA 5SV8A 1DQ1A 1KJRA 2LJ2A 4B7KA 2NZ9A 4DEVA 4RQPC 2GC2A 5EJZB 4OHVA 5LA0A 4I50B 2IU0A 1KEXA 3ETDA 4KWLA 3O0WA 2FL4A 4LF9B 3KQ4B 2EINC 2PAMA 4NXMB 1D2DA 2ZQMA 1HR0B 2C24A 2HYXA 2Y26A 1S0BA 2W0XA 3ZXEA 4R52A 1DQ5A 4TOIA 1GM9A 4M01A 1FT9A 2B7YA 3U07A 5DDJ2 5K1XA 4KUMA 3NNGA 4X64O 2GC1A 2AREA 5JJJB 1PK6A 5GTIZ 2Q8OA 3PJYA 2BTVC 1M9NA 4YJ3A 2E5LO 2ZGLA 3RVZA 2QQPA 3EB7A 4YZ2A 1JU4A 4F8AA 3VQYA 4FVMA 4XAEA 2P1BA 1DIWA 1E57A 3ZOIA 1MOFA 3LSUA 3IN9A 2ZTNA 4Q4W3 3JQXA 4XE9A 2RM21 3STLC 3N9LA 4AXOA 1WLEA 3VKOA 1LOEA 1RUI3 1ZRCA 4EFEA 5EIYB 1FPN3 1U5XA 2XQXA 4DUZO 3LE0A 3O12A 5LASA 2BVBA 4I50A 1E5SA 1C1LA 3SJQC 2XHKA 2G9GA 5F6KA 3NAPB 1BVVA 3M7MX 3OJBA 1ZBE3 1O5LA 3BTAA 3D4KA 1TME3 1TMF3 1YLLA 2IFRA 1XMQB 5FO8B 3EVKA 3WP5A 1UZYA 4QX5A 1D4M3 4DR2B 1WGPA 2AUYA 2D98A 4QX3A 5JAXA 1W04A 2GTSA 5K9YA 2NPIA 4WBBA 2JG9C 3ZXFA 2DUOA 3VD9A 4XBNA 3GCWA 2XWBB 2XMLA 2G1MA 3JCZA 4N7IA 3ABLC 2BSKB 1DGLA 3ME2A 4KMQA 4IE4A 5IAVA 1Y66A 3ABKB 3GVMA 4FMTA 3GZAA 2VGDA 3BB6A 3ABMB 1WD3A 1PO23 3DCQA 2HYKA 5F2SA 4LE4A 4AFCA 3OB8A 3ZMOA 3VBBA 2YFUA 2VNOA 3I4IA 2E7AA 4X1IB 2WABA 1IOAA 3WDWA 5DUVA 2PN5A 4KWKA 2Q0OC 3NAPA 4WVMB 1FI2A 4QHOA 2XLAA 4CBCA 3AMHA 5H6QA 1NTMH 3OEBA 2QEXV 2B4KA 1JW6A 1EM1A 2RMU2 5FPVA 4GB33 3VHOA 3SJCC 4GWJA 2JS3A 4IQPA 4C1XA 1ENRA 5C71A 4FPJA 2LS6A 4EN8B 2VMDA 2EIEA 1QH7A 2QKSA 1L7QA 4AILC 1AYM1 1ZA4A 3CCVV 3SHRA 3C2UA 2BP6A 4ISRA 2NMOA 1RIRA 4L87A 5FZ1A 2F17A 2Y4UA 5ABJB 1ORQC 4CC5A 2R6QA 3LNNA 2ARHA 1YEWA 4JI4B 1IZ3A 4RO2A 2WUHA 3I8TA 4DR6B 1UW8A 1IDSA 2WZEA 5C3PA 3Q8EA 2HG5C 2BDRA 1NCRB 4GIQA 3WU2Z 2A3YA 2UUCO 4PDLA 3B09A 1GWLA 2OCHA 4GX1A 5FCCA 3LFMA 5JXIA 4RD7A 3SPJA 4X1IA 4LF7O 3VBHB 4B4QA 4WVMA 4R8HA 5I8SA 2PHWA 2AZ2A 4OHZA 3WCRA 2Q69A 5C6CA 4WFHA 3CC7V 1JR9A 2HEPA 4YIOA 3VDAA 2WO3A 2IVJA 2IXHA 2ZNJA 1ZM1A 4CS3A 5GZCA 2R70A 3KGZA 1DZQA 5LB6A 4DEQA 4I0XA 2HH9A 4Q4X2 2W0FC 2YEVB 3AZXA 4XJAA 1I08A 3JAWB 1HRV1 2FCVA 4YW1A 3WR0A 1N0JA 1POV3 2ZDIA 1MZEA 4ASLA 4Q0QA 1DK1A 4LF9O 3WZ1A 5ABJA 4DV7B 1XOUA 4ITCA 4NXMO 4N43C 4AQ6A 4LEJA 2A71A 1GKBA 1DYOA 5EXOA 4K1YA 1MNGA 1OF4A 2LUWA 1G6UA 4OI1A 5JJNB 1PMHX 4NWWA 5CMUA 2OZJA 4R9DA 1AJKA 2W39A 1NCRA 1WB7A 3FHQA 3CCQV 1SLAA 1SACA 1LHVA 2ZACA 4LKFA 4URTA 1ND3B 1XNCA 1ZWIC 1WMEA 3AP9A 2QWPB 4ZONA 1D2QA 4D6TH 3RZGA 3ILFA 1BEV2 4R8CA 3BALA 4OXSA 4BR6A 1QF3A 3VBHA 5LL6Y 1DGWX 4JGYB 3HD8B 5A6QA 3ASOC 1YHQV 3EHBB 3CE2A 1OFSA 1E5IA 2OW4A 4B3MO 2ZGMA 2WLNA 4JVAA 5KXCA 3E8HA 4P5YA 1KD7A 1RJ8A 4ASUG 4IGPA 2WZR2 1F2NA 1UKGA 1UPGA 3KV5A 4JYBA 4A7YA 2AACA 3JCUZ 3FB8C 2YEVA 4HBNA 2ZCWA 3VV1A 2W2IA 3JAWA 1EN4A 3NV1A 3L9JT 3UO2A 5FO9B 5I93A 4ZBMA 1XPWA 1EN6A 3LIHA 3ICXA 1N3QA 3NR7A 1D0HA 5BPXA 4XJWA 4J10A 5LA9A 4NIGA 3TN91 2VOVA 4P9WA 4XUPA 4UF0B 1VF7A 1ULEA 4TQFA 1LOAA 2AEZA 4UXNA 5KC6A 2WWSA 3T0BA 5E79Z 3TETA 4FOVA 3K79A 1ND3A 4ZIBA 5GLTA 1XREA 1VQLV 1W3VA 5B3SB 4A41A 2ZHKA 1BHBA 2PI5A 1U5YA 5LATA 3AG1C 4BW5A 3WOGA 4MTXA 5BZBA 4U7OA 2MW2B 4JGYA 4J7KA 1D5AA 1OOPB 3OGJA 3JZVA 1W8UA 1NCQC 4MTFA 3K4DA 4NHLA 3C7GA 4QKFA 4WVVA 3KHCA 1UYXA 1NH2D 4CP9B 4ONUA 4OMCA 1PGW1 3UGHA 3VD3A 5FBJA 4QIWF 1JZ4A 3HMYA 5JMCA 5BNPB 3RMYA 4CEYC 1FJGB 3RPQA 1MQTC 3I2OA 2WLIB 2ZHLA 2LALA 1O6UA 4FPKA 1AZDA 1ONAA 2QQWA 2V09A 3DKWA 3ZS8C 3RBZA 4CC6A 4I55A 3FKSG 3ABUA 4DV3B 3D0SA 1DQ0A 5F3GA 2JIGA 3DKQA 4JTOA 2WO7A 4PCRA 4OQ8A 4UF0A 1R091 4A3XA 1PKXA 1OCOC 1XJAA 1UZWA 2VULA 4MSWC 3ZYPA 1ULPA 3B7MA 2HBUA 4AI3A 3CRAA 4IEUA 1LNQA 4JDNA 2ITCC 1O4ZA 3FB6C 4Y5SA 2G38A 2QQLA 3WF3A 1OOPA 4Q0UA 2VTXA 4W50A 5DAQA 1SG3A 2GP5A 5J7MA 4E8DA 5A7PA 4DR6O 1W6PA 4AQSA 2Y69C 2BCCH 3RVYA 1HN0A 5CAZA 2ZX4A 4COWA 4CP9A 1SQFA 5DECA 1FS0G 4EJRA 1BMFG 1SRYA 1HLCA 4D7TA 5BNPA 2VTXJ 5DQ0A 2V4DA 2EA7A 2WLIA 4UFKA 4NIHA 3LDKA 4H7MA 2DYRB 1AXZA 1LOFC 4QGLA 4CUCA 2AGSA 3TGUH 3TJTA 1H2MA 1DG6A 2O57A 1YITV 3DEMA 4CP1A 4OVEA 2E3CA 1Y3TA 5EIBD 5JOXA 4YW2A 2QDNA 3CCMV 3L71H 3BOPA 1VBA3 1GWKA 1SERA 1RUG1 2GHYA 4NAOA 3WHUA 2BE3A 3IC7A 1I5XA 2NNUA 2JB8A 5CKNA 4Q4V2 5E6HA 1I5PA 5FV3A 1TVGA 1O3SA 2R72A 4QM8A 1JYCA 4OCTA 1WD4A 2JWPA 1PO12 4BHPA 5DG2A 3AG3C 3ZIXA 3OBTA 2AYHA 4FQZA 1EAH3 3WVJA 1NQDA 1OCCB 2VZSA 5GALA 5ACA1 1CPMA 4PELA 4LF8O 3ZIAG 5D8AB 1ZZ7A 1R64A 5FP7A 5GKAC 2OCCB 5FAXA 2HKOA 4DR4O 2YUEA 1ULFA 3WINE 4P2ZA 3OTOB 1MA1A 2QDOA 3BOWA 3KM5A 2VS0A 3EMRA 3K46A 4YIPA 4IETA 1NA1B 3ITQA 4Q0VA 5DN2A 3RW0A 4LBJA 1RUD3 2ZHNA<