5KHKA

Hcn2 cnbd in complex with 2-aminopurine riboside-3', 5'-cyclic monophosphate (2-nh2-cpump)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 64
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khkA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khkA02
4MGKE 5FDBA 4XFAA 1RUNA 2C0ZA 2GC1A 2BNNA 5CADA 3OGJA 1H1IA 2MNGA 3DKWA 4MX3A 1WGPA 1QY4A 3BU7A 1FI2A 3NL1A 5JCTA 4E2SA 1O3SA 1EYBA 4UXAA 1UIJA 4RD7A 2FMYA 5J7MA 1VR3A 5KHHA 4META 1QWRA 1XE7A 4PIYA 3SCGA 1TQ5A 1XE8A 4N9IA 2WC2A 4XEZA 4I3PA 2XLGA 3LA3A 2D5HA 2PYTA 3D0SA 3WW1A 1CAVB 4HZFA 3S7IA 3E5XA 3SCHA 1Q43A 4QGNA 4HSLA 5E16A 3MZHA 3NKTA 1OFNA 3TNQA 4EWDA 1XRUA 5BXXA 4FAHA 3FWEA 2HKXA 5BV6A 1UIKA 4IEXA 4IEPA 1RC6A 2V09A 3ZDSA 2UY9A 1ZZ7A 1X82A 3IIAA 3QOPA 4H7LA 1IPJA 4I0BA 3UKNA 3QACA 2PAMA 5K8SA 3WW4A 1ZX5A 1UD1A 2XGXA 4R8HA 4HBNA 2UY8A 5FCCA 1CAWA 1ZRDA 2CAVA 5BY5A 5C6CA 4XETA 1Y3TA 1LR5A 2OPKA 4I0AA 1PM7A 1J59A 4AXOA 1ZZ9A 1CAWB 2IC1A 2IXJA 1ZZ8A 5KHIA 2OYZA 2ET1A 1LKNA 2WFPA 2B5HA 1O7FA 4HMZA 4Z07A 5LRRA 2GU9A 4JTOA 4EV0A 2XLFA 3JZVA 2IXLA 3CL1A 1O3RA 3E5QA 3PNAA 4FAGA 3WW3A 5FQ0B 3NSTA 1CAXB 2PAKA 1J58A 1CAUA 2OA2A 2H0VA 2UYBA 4KWLA 4IEOA 4HVRA 4HVQA 2OZJA 1DGRA 4UBHA 4XFFA 5EZWA 4YYOA 2P17A 2D40A 2UYAA 3DL3A 3DN7A 4EWEA 4IEYA 3ELNA 2BNMA 2H6BA 1O3QA 3DV8A 2OZ6A 4QM8A 1Q5OA 4QGLA 3LAGA 2F4PA 1UCXA 1DZTA 1SQ4A 2PHLA 2PFWA 5FPXA 1CGPA 4ORFA 4Q0VA 2EAAA 5JR7B 3U0ZA 3CF6E 1SEFA 3FJSA 4WZCA 2XLAA 3E97A 5LEJA 2XKPA 4LUKA 5LRSA 3MPBA 3SCFA 5F1RA 5BUVA 1ZZBA 4MGYE 4L2NA 2XL7A 3FE5A 2GC2A 3H3ZA 4LEJA 5HI0A 3BPZA 2VECA 5CU1A 4E2GA 4TLFA 5FLJA 1OI6A 3FX3A 2VPVA 2ET7A 4F7ZA 1LB2A 1ZREA 3U10A 4QMAA 3E6CC 3ES4A 5J3UA 4QX5A 1EPZA 5FLHA 2Z2SB 3KCCA 1L3JA 3M3IA 3LOIA 4QM9A 2GH2A 1V70A 4O9GA 2GC3A 5JSPA 3H3UA 2MHFA 5T3NA 1ZZCA 3NVCA 4Q29A 4E2QA 3SMHA 3BCWA 4XF1A 4JV4A 4KU7A 1VP6A 1YLLA 4XF3A 3HT1A 5JSOA 3FFQA 1X7NA 5KHKA 3I54A 1ZRRA 4XFBA 3MDPA 4NVPA 4X6QB 4PJYA 1UPIA 4I02A 1J1LA 3CO2A 4ZU5A 3USSA 5FPZA 1IPKA 4Q0QA 4N9HA 4WBBA 1NXMA 2BEOA 1O3TA 4I01A 4ZU4A 2Q4SA 2PHDA 4MGZE 2MPFA 1O4TA 1OMIA 4HSJA 4KU8A 3KSCA 3LZZA 4O9EA 3LA2A 2GZWA 4D7TA 1FXZA 1PMIA 4HLTA 4OLLA 1YFYA 3H7JA 4XFCA 4QGMA 3KMHA 4AQ2A 2IXIA 2ZKLA 2PA7A 1O5UA 1ZRCA 1RGSA 4I2OA 4I09A 5I8TA 2D5FA 2K0GA 3S7EA 5I0UA 3BALA 5KBFA 2Z69A 4MV2A 1ZRFA 1YWKA 1GQGA 5C8WA 2DCTA 4A2UA 1H1MA 3OF1A 3KGZA 4BYYA 3H9AA 4R52A 2XKOA 3L2HA 5LEKA 3OTFA 4XFGA 1RL3A 1DZRA 4XF0A 5CVRA 3CEWA 4EWAA 4WVZA 2QDRA 3M70A 4MH0E 3RPQA 4AQ6A 4XF9A 3HIFA 1LRHA 3EO6A 3FHIB 5I0TA 1YFXA 4HN0A 4Q0PA 3EQEA 4IEQA 1J3PA 4YARA 2PTMA 5I0SA 4P9GA 1QXJA 1Y9QA 3H50A 1FT9A 4JVAA 4UBGA 3R6SA 4CYDA 4IESA 4QXKA 3G7DA 4BHPA 4ZU7A 3ST7A 5KHJA 4Q0UA 1QXRA 1EY2A 3PVBB 1RUOA 3UKVA 2HJIA 4AVBA 2EA7A 3O14A 3I7DA 2QNKA 3IWZA 4B29A 3I59A 1CAUB 4IEWA 3RZZA 4DINB 1CAXA 4LUMA 1YUDA 4YRDA 5I8YA 2B9UA 4KWJA 4HN1A 3TNPB 2I45A 2PQQA 4XFIA 3FZ3A 1GQHA 1OD5A 1DGWA 4LTAA 1X8MA 1ZZ6A 5JAXA 4LLOA 2CV6A 1YFUA 3HQXA 4LULA 3SXWA 2CGPA 3I59B 3BB6A 4FBFA 5FLIA 1NE4A 5EFUA 4MGIE 4BIFA 1I6XA 4J1XA 4IEZA 4Q0SA 1NE6A 3D0JA 3B02A 1J3RA 1RTVA 3RYPA 1WA4A 3IDBB 3GYDA 3H1WA 1NZCA 4JTNA 3IDCB 1NYWA 2EVXA 3SHRA 3H1YA 4FT8A 2IXHA 2Q30A 3NJZA 4D7SA 3KGLA 3VHRA 2PAEA 4X6RB 3RYRA 4YSFA 2GC0A 3S0MA 1G6NA 2BNOA 4HVOA 3EHKA 4Z82A 3IBMA 3LA7A 3RDIA 4MUVA 4AVAA 3RNSA 4KWKA 3E6DA 3RYKA 4J1WA 3UKTA 2BYVE 4K8FA 4IERA 5BPXA 4XF4A 2BGCA 4L11A 3CLPA 5E1RA 3ETQA 1I5ZA 2GAUA 3C3VA 3H7YA 5J48A 4IEUA 1HW5A 4GULA 5FQ0A 2IXCA 3HT2A 3H1MA 3N4MA 3E5UA 1Q3EA 2QCSB 5I91A 3WW2A 2XHKA 2ZCWA 2O8QA 5JSRA 2Y0OA 3MYXA 4EROA 3NW4A 1UW8A 4AVCA 5I93A 3H8UA 2IXKA 2XL9A 5D1IA 3EBRA 2QVSB 4ONUA 2D93A 5I0RA 3PLQA 2H6CA 4OFGA 2N7GA 5KHGA 3CJXA 4XFHA 1CAVA 2E9QA 2KXLA 2O1QA 5AVPA 4F8AA 1CX4A 1ZNPA 1SFNA 2FQPA 1ZVFA 3OCPA 1WLTA 4PIXA 2B8MA 2ATFA 3U11A 1U12A 3ES1A 3LWCA 3ACLA 2CAUA 4BH9A 3E6BA 3ROUA 1J3QA 4LA3A 2Q1ZB 3OD0A 3GBFA 1JUHA 2VQAA 2ETEA 1YFWA 5I8SA 2QJVA 1YHFA 4YNIA 4LA2A 1X8EA 1EP0A 1O5LA 1VJ2A 4PIZA 4IETA 4IEVA 4MZUA 4KL1A 2Q0AA 2K9ZA 3D82A 3EJKA
chains in the Genus database with same CATH superfamily
1DCSA 4MGKE 4PQ9A 3ON7A 3GALA 4N43B 2UXNA 2ZXQA 1O3SA 4UXAA 1VR3A 5FY4A 1CD3G 1RUH3 5BR8O 3K4AA 3EHBB 1TGOA 1PIV1 2ETNA 1UZWA 2D5HA 4SLIA 2WS93 1AXKA 3T1YB 2LRPA 2OUJA 4IHJA 2OXBA 5D21A 3HWJA 1U5XA 1XILA 1NU1H 3B77A 1AYN2 3T3YA 3W59A 1OVSA 1RINA 2WZPP 4H7LA 5K8SA 1EUUA 4AOCA 2A0LA 3JSLA 1XU1A 4BWAA 4D6QA 3LF7A 3WNNA 5C6CA 1KP3A 2VZOA 3Q8AA 4JC1A 5IT9N 2IXJA 3HKCA 5KHIA 2WFPA 5LRRA 4EV0A 1QJX2 1HIXA 3N9QA 5D8AB 1SDWA 4QHZA 5IJ9B 1ACCA 3ABMC 2YPDA 3MV11 4KWLA 1X59A 3ZRXA 1QXPA 5EZWA 5B66Z 2UXBB 3JD73 3DN7A 1AJKA 4LPLA 1O3QA 4TN7A 2OZ6A 3W9AA 4TV8B 2VH9A 4MXWB 2LW7A 1P8JA 2C6SA 1DZTA 5IFTA 4EKWA 2XBO3 1G9FA 1UY0A 3OT7A 4F6RB 1TMF2 2VCBA 5EZYB 3VHNA 4AW7A 1NBMG 3RI9A 1YXWA 3SYQA 4CC6A 5BUVA 1OT5A 1VMGA 2FL4A 5HXMA 3CEIA 3C2UA 4FQZA 2GC2A 3H3ZA 4E8DA 5FP3A 4AL9A 1M9NA 2F17A 2YIBD 3F5WC 1ND2A 1FV2A 1UOGA 2VGDA 2DV9A 1RUI3 4BAYA 5L3CA 2CAZC 4DEVA 4X1IA 1BEV3 4RFT0 3ZXKA 4G2KA 2YSUB 4H37A 3JALB 2MHFA 4XDPA 3HR0A 1B04A 4AILC 1N1YA 4TWTA 1E5IA 1HRV1 1VBB3 2RDRA 2XJTA 1R081 4KG8A 4WCEV 1OSGA 2FCUA 3CMAV 5KHKA 1QCEA 4XFBA 2W46A 3T1HO 1FX5A 4WVMB 5FLXN 3QH6A 3U07A 3KZIZ 2WAOA 4XUNA 2AR6A 1SA0B 2BU9A 4B7EA 5FR3A 2GSMB 5GZFA 1YI2V 4DY3A 5H9SA 4WM7A 2CSGA 2RDQA 4LQRA 2VS0A 4FQ4A 3NJXA 1JU4A 3KWVA 2Z69A 1B6QA 3CDZB 3OJBA 2CDYA 4Y5TA 1XYPA 5ISLA 3OTFA 3FX7A 1CZTA 3ZRWB 2JEMA 2ZA9A 5LYJB 4DEQA 3EYPA 3OM3B 5JVVA 4CDUA 5JCOC 1R3JC 4B7KA 2AH2A 1G6UA 1S5LZ 3ZFGB 2PTMA 3AG4B 5LASA 2RS33 3PVNA 4GA9A 1W99A 4NRQA 1S0IA 4WFHA 1RUOA 2XQXA 3MIBA 3IM0A 4GB31 1NT0A 4LF7B 5LP6A 4XJZA 4Q5OA 4O4IB 3I59A 2F23A 3ZLIA 4J9ZB 1ENSA 2WO2A 1WW6A 2RJZA 1OJHA 4DV0B 3AP9A 1RUF3 5BNOC 2DFBA 2D44A 1WBFA 3GF6A 4BQ3A 2WT2A 4X8AA 3ZFGC 2GN3A 4P5YA 2EULA 3ZR6A 1NKDA 3I59B 3OW2U 3JUUA 4J1XA 1K4CC 1Q90D 2VBDA 3IDCB 4Y1YA 2WYFA 3ZPOA 2IXHA 1M56C 2QQMA 3ZFGA 4AGVA 2XONA 3B40A 4Z82A 3RI8A 1YIPA 5FPOA 1K45A 1GTOA 5FZMA 1JMKC 4AEDA 4BE3A 3F7YC 4XDOA 4K8FA 5EWSA 1S77D 1P4RA 1N34B 5BNNA 2WR9A 3L74H 2A7WA 4LIUA 4O4LA 4Y5Z0 2VUDA 2QCSB 4D69A 2ARHA 1GN3A 1OCRB 5JUVA 4WF9V 1JMUB 1OKOA 4EN7B 3VZMA 4AVCA 2XL9A 1LUWA 2D93A 5B3SB 4M01A 4OFGA 4YW3A 4Y5SA 3TEXA 2E9QA 2KXLA 4F8AA 1CX4A 2ATFA 2TUNA 2O8OA 3E6BA 1GV9A 1S0CA 2LTNA 5BNPA 2TEPA 1CXZB 1KITA 1N32O 3K51A 5A3LA 5LGUA 2JE7A 3WP6A 1K7DA 3M8AA 2VNRA 2VTXA 5FYVA 2RV9A 3OGCC 2D6LX 3HKEB 2IJJA 3SJQC 4YVSA 4X88A 3O0VA 1K73W 1RUNA 1RUE3 5C8CA 2FDJA 1FKAO 2IH1C 2WS92 1WGPA 1FI2A 3UO3A 1ZLZA 5CFDB 3T2TA 5J7MA 1DQ1A 3ABKB 3C90A 1E1QG 3R66A 1LULA 1GLHA 3RYCA 3H1KH 1GKBA 5K1XA 2R1DA 3UNPA 5FTTC 5H6RA 2DCKA 2R6QA 2AGSA 1N1SA 1VQ6V 1K3IA 1OA3A 1UIKA 3QOPA 4DXTA 3ALQA 4LIVA 1FATA 1UYXA 1KJLA 2HWE3 2Y6JA 1OVPA 3I2DA 1RHI2 5IJ9A 2ZIOA 4E2LA 2YFUA 2LQTA 2QA4V 1GR3A 4AHXA 1ZZ8A 1D2QA 3MEPA 4Z07A 4K1ZA 5BR8B 1RUD1 3I2IA 1VQNV 3CL1A 1QJEA 4M3CB 2P4VA 1RVF2 2ZGTA 4LHSA 1J58A 3CWBH 1JXNA 2HHHB 4J42A 2AYHA 1F7YA 4MG2A 3CKHA 3GZUC 4AI8A 1X33A 5LMUB 4AK3A 4W65A 3VL9A 1JZ7A 3DL3A 2JE9A 2NQYA 4CP2A 4QGPA 5GZCA 1LENA 2WLQA 1OPOA 4Q4X1 4OI0A 2VMIA 2JG9B 5L36A 5DZGA 3VBFA 1GZTA 3FHQA 2CNAA 3FE5A 5CKQA 3QG5A 4WBNB 5LK7B 2VPVA 4EFBA 2CDPA 1ZREA 1RUC3 5BNPB 5FP9A 3WDVA 4LF9B 1EPZA 3I5DA 3AMQA 2EIDA 3CMEV 3SPGA 1MG1A 3K9AA 2BSKA 2Y8KA 3FB6C 4M00A 3AKRA 1TNFA 3WY6A 4CU8A 3MICA 2E63A 5EC2C 3R05A 2ARCA 2UXXA 3ZMUA 3O7OA 1ULPA 3USSA 3VDDB 4UFHA 1Z5VA 5ABJA 1XL6A 4TT3G 1SQXH 3AP4A 2RR13 4B3SO 3IIIA 1P7BA 2CWMA 4JAVA 1VQKV 1R6KA 5BNNC 2YUAA 3LUTB 5F3GA 4AQ2A 1VLNA 4HYOA 3D6EA 4DY5A 5K0UB 1W8NA 1O5UA 1IKQA 1PHMA 1PO13 3MW2A 5EYYA 5DM6V 1VIBA 2ITCC 3BPSA 2VMFA 4ZXKA 3N2GA 3WF2A 5KBFA 2UXCO 1H8EG 2ZDIC 4LBKA 3ZEDA 5C8WA 4NYKA 2ZR2A 4RL7A 5LEKA 4Y1VA 1UF2C 5FK7A 4NE9A 5JH7B 2RNBA 4NROA 4EWAA 5L7OB 1SRYA 4LFBO 3CRCA 1W2NA 2VM9A 4XABA 3TK1A 2QQKA 1TEIA 3HIFA 2YUEA 5FREA 4Q0PA 4QQOA 4JI8O 4LORA 3W7XA 5A33B 1QXJA 3ABLC 3E22B 2A06H 4X65O 4FPKA 4CYDA 4IGQA 3TEYA 3JCZA 3ZFFB 1JN2P 4GAZA 4J11A 5LA6B 1NUKA 4MVSA 4H0LB 5T50A 1QDOA 1EAH2 3ASOC 1QDCA 1YC61 4DR5B 3PUAA 4Z2WA 2WZR1 3FZ3A 5FP8A 4NAMA 4RUEA 4CTEA 4FPGA 4FP2A 3K03A 4JTDB 3ZXDA 1HB1A 5ACA3 1QVFU 5A7NA 2CGPA 2F95B 3OPTA 5HCBA 4JI1B 3I49A 4I0XB 4IEZA 1J3RA 3IN9A 1NZCA 1WAZA 1H2KA 2XQRA 4IGOA 4DRXB 4JV5O 2ADPA 1BHAA 5IK5A 1HNWO 1Q81W 3KGLA 3AYCA 5EK0A 1VBB2 2XUMA 4AQSA 1RYYA 4TQFA 1LR1A 2EIKC 1SMVA 1VF6C 3WFVA 4NTWA 3KHCA 3JD4A 1E1RG 4K8XA 3ZYGA 3TWIA 3ETQA 2XNDG 1I5ZA 4X1YB 3PUQA 4IEUA 3CPWU 4BMBA 3N2KB 1URXA 1RUC1 4XQWA 5JOWA 2DCZA 5CMUA 1PNMA 2FZ2A 3ZYPA 2EIGA 4UV8A 1NCRB 3CHXA 4LOTA 2LFRA 2YICA 1S0FA 1Q8VA 3WD5A 1W0OA 4Q4Y2 5FXZA 1ZVFA 2JEUA 2J1RA 4N7UA 3X2QC 2JGUA 1VF5B 4GQ7A 3BKZA 1U5ZA 4GMP1 3C7GA 1QJY3 1ZAUA 3FB8C 2RS32 2VW0A 2WLIA 2ENRA 2IZWA 1V6LA 3OGJA 2E7TA 1GP6A 1X50A 4DXZA 2DCJA 2RJKA 1QJU3 2WLLB 1Y67A 4IE7A 4TV8A 3BVCA 1VRH3 4LFBB 4KUMA 2Y6HA 1D4M1 2P3KA 2WC2A 2DYCA 4DO2A 4R6ZA 2L6LA 4CH4A 3VQVA 4H2AA 3MZHA 5E16A 1XNQB 4X65B 2ARBA 3NKGA 2D6OX 2HWC1 5EQUA 4QX8A 4MYEA 3UKNA 1XHXA 3G6EV 1WB8A 3L71H 3AG1B 2GUZB 1HNWB 3JAWB 5FCCA 2XG3A 3W21A 1V54C 1TG7A 1EV13 1Q7YW 1CAWB 1Y43B 4O7XA 1O4YA 2OQ7A 5FPUA 3WB1A 1C8M2 1R6TA 4FOVA 4COZA 2JB4A 3PNAA 5E1AC 2EILB 3G67A 4CCLA 2UYBA 4HVQA 3A0RA 4AGGA 2MEV1 4UBHA 4QDRA 2JDKA 1JFFA 5HPOA 3MAQA 4CDQA 3ELNA 5L7OA 5JH7A 2QQOA 2VNVA 4LLFA 3K4DA 4JYAO 3NWKA 4ABMA 5J2TA 4LNVA 4FZ1A 3N9LA 4MGQA 2FMDA 4N43A 4LHLA 4CCDA 5HFLA 1SEFA 2YZ4A 1HRI2 4P9PA 3P6BA 1PVC3 3FAVA 1FPOA 2W5FA 4XQDA 3BPZA 4E2GA 1PK6B 1W03A 2J1TA 5C3SA 4BLIA 1JPXA 3W7UA 1ZX3A 5T5JA 2IUWA 1OCZC 3U10A 5AFBA 4OQ9A 1FOD2 2P3JA 1NJIW 4PLMA 2PI5A 1CEZA 3WOGA 1RUH2 2D98A 3BIEA 3FLRA 4GX1A 2W6IG 1IXBA 1QOTA 2WSVA 2HBTA 5H2FZ 3ABLB 4A5UB 4FLVA 2QSAA 4KU7A 2G9FA 5JSOA 2E74B 2BP6A 3C7EA 1JYWA 1BKZA 2YXLA 3I54A 1ZRRA 4I3GA 1J1LA 1PGSA 4Q0QA 1BE3H 4I01A 2EIBA 2MPFA 4JZ2A 1HN0A 3KSCA 2GDSA 3KM5A 3AG2B 2GZWA 4H33A 4LWSB 4QGMA 3W7TA 1GOGA 3O1VA 1W8TA 3E83A 4XURA 4YJ3B 4B4QA 1G9CA 2K0GA 2X6AA 2JDNA 3OR6C 2QQLA 1DQ6A 1BSMA 1D7PM 1BMV2 2VTXJ 4H14A 1NCQA 2P06A 4PLNA 3WB2A 4DV3O 2PHWA 3B3QE 4DR4B 3ZM8A 4BQ2A 3JD72 1EN4A 1DF0A 3CYOA 4YIOA 3H8XA 3U4SA 4UW5A 2IH3C 1PP9H 4NWWA 2Y69B 3RPQA 3HNMA 3EO6A 3MFAA 1X9TA 3EQEA 4IEQA 3U78A 2XUEA 3RWNA 3WNXA 4Q27A 1VBC2 1WUVA 4OHYA 4Q0UA 3WDXA 2DOSA 1EY2A 3VBRC 2RS51 3L70H 4AVBA 1SBEA 1H2SB 1CPMA 5C33A 1MEC1 2WNEA 3WX5A 2MW2B 1OXCA 1ODMA 1CAXA 1VBD3 2DU0A 1SFYA 5DAWA 4Q20A 4XJWA 1BCCH 1JZ6A 1GQHA 1GOFA 4ZI7A 1ZL8B 4DV5O 1AL22 3TCUA 3J7LA 1W2UA 3A0KA 4P9WA 4I4TA 5FYUA 2HYKA 4J25A 3SNMA 4URTA 1AR92 3M2MA 3RS6A 3WNKA 3ZJZA 4A4AA 3HOBA 3AKTA 2WNUA 5KR7A 1RUG1 2YXSA 3LPGA 2CDOA 4OHXA 1HKDA 1XBFA 2P90A 5IHRA 2RQ6A 1GP5A 4JF3A 3NV3A 1S76D 4U3JB 3T0AA 3S5AA 2ZNJA 3R4UA 5CFCB 4QPIA 1E57A 4KWKA 3IKWA 5CEHA 3BTAA 2Q1MA 5GTHZ 3UKTA 4JYYA 4DV5B 2XHNA 3LQCA 2EF6A 3L75H 1SZXA 4GLXA 2W47A 3H8RA 4O4JA 2CH7B 1HW5A 2ZOEB 2ZGLA 1XYOA 2AEZA 1K92A 2UURA 3O1MA 4UCSA 2QZ2A 2VUJA 2XBO2 3ETDA 3JAKB 1OQEA 2KR2A 4LCUC 3E35A 2R071 4IIJB 4CEYA 5F32A 2QVSB 2UU9B 1UWWA 1FXKA 1J95A 3GCWA 4FM1A 1A8MA 5LY1A 3O1SA 1SFNA 2PHTA 1U5YA 3SPCA 1REDA 1PO11 4KP4A 4L8QA 3KV5A 2ZHLA 2SBAA 3HJRA 4NUBA 1W6QB 2P5OA 1O4ZA 2YU1A 4D6SA 4IEVA 2BVVA 2Z5UA 1Q6HA 1N36B 2EILC 3PMEA 1OOPA 1F5FA 2WT1A 4N53A 3DSQA 1VE0A 2BFUL 4XBLA 1HW7A 1JBCA 1ZWIC 1Q82W 2UWAA 4DR3B 3AG3C 1GBGA 1WB7A 2VJXA 2ZINA 4FFBA 5A6YA 1WW7A 1XSRA 2Y6FA 2JG8A 2F1MA 3MLKA 3N9PA 5C4WB 4LXLA 1VRBA 1E5HA 4Q1RA 4A44A 2ZX4A 3TNQA 3ACGA 1TME3 3Q9OA 4DFSA 3QACA 4L87A 2HWC3 2UUCB 2W2IA 4HNAA 4FOYA 1S72V 4QPYA 4LFAO 3S6PA 1Y3TA 3VBFC 3RW0A 1AX1A 3LEIA 3ZRSA 3NAPA 4DR2O 2QWRB 4QPGA 3WXPA 4YVWC 4QNHB 1JHNA 3JZVA 1CQ9A 5TSWA 1O3RA 3NV4A 5FQ0B 1VQ5V 3J4UH 4AEKA 1CAUA 2JDPA 3ZN0A 2Q7HA 2CWSA 4PT6A 1XNQO 5HXVA 1ULCA 4B1LA 4L97A 4YYOA 2UYAA 1HRI3 4IEYA 5JZGA 3M1HA 5B4NA 4AI3A 2K1EA 1UCXA 2R7EB 1W8UA 3V0BA 4IE5A 2AGAA 2PFWA 1GANA 4CDWA 1N33O 1JJOA 3AP5A 3CF6E 3DXTA 4I9WA 4WZCA 2NM1A 1KRIA 4CA9A 1JYVA 1NKGA 1I5PA 3OUJA 4AZZA 4UB6Z 2ZXWC 3T2MA 1SQVH 1UY2A 4YW4A 1E79G 1CZSA 2R0FA 4NKGB 1DG6A 3C3TA 2WO1A 4AHZA 4FFGA 4QX5A 4Y1ZA 3KCCA 3JARA 4CP9A 3JSNA 2GH2A 1VMFA 4FLZA 1Q8OA 1DBNA 4BQXA 5DUXA 1RUG3 2FYUH 3NVCA 5B3SC 1QJU2 3ABTA 3OPZA 1PGW2 2YBSA 4F3JA 1X7NA 4IL7A 1OLRA 1S0DA 4FFFA 1APNA 4HKLA 2BOIA 1V55B 2OYQA 1AR1B 4G9SB 3HPLC 5FMCA 4CXWA 1YJWV 5FYBA 3KHBA 3NRUA 1MSDA 3LZZA 5C93A 5KC6A 3POSA 5GONB 5F5CA 2BBAA 5APAA 2ZKLA 2AC1A 1HQWA 3I4IA 1YJ9V 1NI8A 1KDMA 3LDDA 3S7EA 2OT5A 2W87A 3TN91 1ZRFA 1M1KW 4CZZA 5LZ6A 2A70A 3BY6A 1BHBA 1A32A 1JZ5A 4JQRA 5FZ9A 1KD7A 4WVZA 1UYPA 1YQCA 2ZEWA 2ATKC 2HP8A 4U3FH 5A9GA 1Y9QA 1VAMA 1JJ2U 3R6SA 4BHPA 2BTQB 2E75B 3QF7A 3UKVA 3V0AB 1AR93 3VBSC 4IV3C 4B29A 3VBHB 2DWDC 4GH4C 2LGQA 4HPKB 4IEWA 2IFRA 4QB2A 3VZJA 3K79A 2A5ZA 4UV9A 5I8YA 3SH3A 2X6BA 2LUWA 1D2DA 4P14A 4UUJC 3FKSG 1TVKA 2W95A 3G6BA 5F2VO 2YROA 5KX5B 3B94A 1SG3A 1VBC1 2JDYA 4ZIBA 4NRPA 4LKEA 3GJAA 3I3EA 4P9XA 1UOBA 4YIPA 5LGTA 4RGGA 3H9VA 4PDLA 2HFEC 3E8HA 4JDNA 4GH4B 2ZABA 1SQGA 4NR1A 1GICA 2OCHA 4JDMA 4CBCA 4YSFA 3T0BA 4YFWA 3S30A 2V4AA 3DF0A 1K5JA 1HB3A 3WUCA 5JXIA 5FOJB 2XT9A 4ATFA 4PA3A 2ARXA 3WG2A 4JI7O 4DK0A 3AG3B 2RMKB 4UOJA 3E86A 1RVF1 1QJFA 5K7PA 4KHPO 4LF9O 3DXRA 2Y38A 4PDRA 5C8YA 4TYSA 3UGFA 2HEYF 3EBRA 4FPYA 4EYUA 2QTWB 3PLQA 5DG2A 2AZ2A 3THTA 3CJXA 5LA1A 2CYFA 4PA7A 4X1KA 1SPPB 4P2ZA 3OOXA 5J9PC 4YZ2A 1GU3A 1W2TA 3BOWA 4A45A 2XR4A 3VLBB 5CB7A 1WW5A 1RPOA 2GNTA 4ARXA 4BB3A 4XW3A 4BDVB 1HJFA 1EV11 5FO8B 1THZA 3HAGA 3AG2C 1DLCA 3WZ1A 4IT5A 4MVRA 2BGOA 4OULA 1UKGA 3D82A 4EB6A 4AVTA 4P9LA 3SISA 3TN93 2BOJA 1OLMA 3JBG2 1Q56A 3O1RA 3QD6A 3ETEA 2ZGMA 2QTSA 1WPBA 3DPRA 3OYWA 4C0BA 1YIJV 2W68A 4U7NA 2R062 2V5YA 5L3EA 4JGYB 4RGAA 3BGAA 2RR12 1CAVB 1V00A 2X0LA 4FMTA 5LMUO 3OD4A 3FWEA 4IEXA 2QE3A 4LNUA 2AHYA 1S2BA 4KH9A 3CJIB 4H44B 5FNVA 4AEMA 1VBE3 4Y20A 2X10A 1ORQC 1YVWA 2XVGA 3RZMA 5B5EZ 2KD7A 3GXUA 4M3CF 5L9VA 2YEVA 1B35B 2YY1A 4NRMA 3RZJA 5FUIA 2QQNA 1NR1A 1HNZB 4R9AA 1YRZA 1YJKA 3LSDA 2HLDG 4XCAA 2B45X 1GN4A 3TXSA 3CJIC 2BWCA 4JI6O 2BNMA 2ZX0A 2EXKA 3UV9A 3DV8A 3POGA 4S2DA 1JZ3A 3LAGA 2W1UA 4CDXC 2IWGB 2B42B 1LHOA 5IE9A 1JZ4A 3ECQA 2Y34A 1XYNA 3VBOC 1MS9A 2FDHA 2ET7A 3JATB 1AX2A 5F7UA 4CDXB 3SDLA 2BE3A 2VVDA 1DGSA 2QFEA 1N3PA 3J8F2 4A6SA 1REEA 1VP6A 1YLLA 4QHOA 1IKPA 3U1XA 1JYTA 1LHUA 4X8PA 1WD4A 1LECA 5FPZA 4JYAB 2VL4A 3A4UA 1AR63 3T2QA 3OGSA 4KU8A 1SLAA 2JJ1G 4RQPB 4OLLA 1R3KC 1AI5A 1UNBA 3W5MA 1EN6A 2XTAA 2I2SA 2Y0PA 4CS4A 3ZO0B 3JASA 2KM2A 3ZMNA 1AVMA 2J1UA 2OIIA 1PMJX 1XDCA 1ND3A 5I0UA 4A42A 3AVRA 1ENVA 1NR7A 5IK8A 2XAQA 3ASNC 4MTGA 4UB8Z 2DCTA 1R3LC 3H9AA 3VDDC 2WWSA 2J1VA 4OZOA 4I7ZB 4PDWB 2XVLA 1PO12 2QDRA 4UW6A 4A41A 2JK5C 2TNFA 3R4SA 3AXDA 2QQWA 3HBKA 3NJVA 5FIXA 4QX0A 5DUUA 1YF2A 3OE7G 4QXKA 3G7DA 3ZSKA 1GM8A 3QVNA 2UXBO 1P84F 3I3DA 4CEWA 4JI6B 2XDVA 1WLEA 1K5QA 3J7MA 4JKLA 4JPRA 4DUZO 2AZ5A 1N33B 2KQXA 1AP5A 4Q2FA 5L7OC 1DYPA 2PQQA 2VBBA 4AEJA 2BGPA 4CP1A 1DGWA 5B2GB 3K77A 2VRZA 1CR7A 3J80N 1UU5A 1UN1A 3RRDA 3RYHB 4NJ4A 2KSDA 1AF9A 1Q8PA 4JAAA 4CCOA 4FBFA 3TOJA 3QO8A 1IOAA 1H9WA 1OA2A 4OHVA 2FMLA 2ARAA 1PVXA 2GNBA 4ZOLB 3N3HA 1WP7A 4BXFA 3NJZA 3VHRA 5F9TA 1G6NA 1S55A 2BW8A 4MUVA 4AVAA 2QDOA 3VDBA 3HKDA 4X66O 2DJVA 1HB4A 3AKSA 1DLBA 1TME2 3A22A 3CZUA 1QIQA 4HL0A 3HMYA 5C3RA 4IERA 2HWF3 3AFGA 4OXSA 3J7NA 1UY1A 2DYRB 2K2SA 2RS11 4C1XA 2B1IA 2OS2A 1JQ0A 1GH6A 3VZKA 4XUTA 5CA1B 4ZY9A 1W2AX 2VD7A 4P02B 1IS5A 1GUIA 3WW2A 1YQ2A 1GWLA 3GGLA 1TUBA 4ZHNA 1Q8IA 3NW4A 1AI4A 4B3TB 2NLJC 4X89A 2BJSA 5I0RA 4RYDA 3SEPA 1N8RW 4XVHA 5A1FA 4ATEA 5BMVB 2F66C 4HANA 1AR61 1SBDA 2CAUA 1I5XA 4Q4V3 3POBA 3K59A 4LBQD 1W04A 2JVDA 3WLUA 3UGGA 3KT7A 4UT5A 4XCBA 5CISA 2DMXA 3J7AU 4KNCA 1VJ2A 2Y6KA 4CUAA 2K9ZA 1FOD3 1QNWA 4JASA 4AFCA 5CADA 5DDJ2 2DDUA 3CJHB 3DKWA 4LITA 2JWPA 3FD9A 4FM2A 1V6KA 3K5NA 3V65A 1CJDA 1FXKC 4E2SA 1NTKH 5BZBA 4AHYA 3IJ4A 4META 2VUCA 4LKFA 1Y9MA 3B9CA 2W9XA 4N9IA 1ENQA 4QXCA 4DK1A 1PGL1 3WW1A 5D5QA 1W05A 4QGNA 4YM2A 1UOFA 3LIGA 5JVDB 3ZS8C 3TGUH 4YGEA 4HOOA 5BXXA 2ITDC 1QHTA 2V09A 2UY9A 1OCCB 3AVSA 4FJCC 5HV4A 3WEZA 1N3OA 4Q4Y1 3VBUB 1ZX5A 3HD8B 2W92A 2PYJA 3OTOB 3VBSB 1W0NA 2YBPA 2PHFA 1MZEA 1J59A 3QBQA 5KMGB 3BA8A 3ABZA 3DYPA 3UK9A 3BCCH 2DVBA 2GU9A 3WNPA 3J9SA 2ZS6B 1UMZA 1Y7BA 3SLIA 5GJ6A 3A23A 4NXMB 1QJU1 3Q8CA 1WWYA 2HJFC 1I08A 2YDEA 2JIGA 3OUHA 1POV0 1VMJA 4RGKA 1Y6XA 2R073 2CTQA 2HG5C 1W0JG 4NB5A 3OEBA 3AG1C 4XMIA 2BRTA 2FTKA 2D6MA 1VQMV 5GZEA 5LMNO 1EUTA 5FXWA 1NAEA 2F4PA 5EV7A 1PZ8A 2VQUA 4RQPC 4YM0A 3K06A 4NMIA 3U0ZA 3K5OA 4TQDA 3P30A 1LJ7A 3ILNA 2XLAA 5LRSA 2IJKA 2AW9A 4MGYE 2V72A 1LU2A 1B09A 2DW4A 5CU1A 1HP8A 5FZKA 1OI6A 1GFF2 3ZOIA 2HBUA 5DAXA 2O0OA 3D4KA 1A8DA 1STMA 1M4WA 3KCXA 1BQ0A 3B2EE 2GC3A 3ZN6B 4RR3C 2ZPXA 5EBWC 2JGDA 4ZHQA 4BLJA 1GP4A 4E2QA 4BIOA 1JZ2A 4UF0B 3BCWA 1DGWX 1TNRA 2Q73A 4R8CA 3BODA 1AR71 1LEDA 2QQPA 1UPIA 2FBEA 4L8JA 4C0HA 4BPZA 2LFSA 2ZTNA 1WN7A 1O4TA 4OI1A 5IVFA 3KMHA 1RVF3 2ORXA 2IXIA 4PBOA 4PJ0Z 1AILA 2WLKA 5DZEA 5D5PA 4MVQA 5FZAA 4CC5A 2VG9A 5FYZA 1YWKA 3RYIB 3OF1A 5EYPA 4NIGA 5FUNA 1XMOB 2XBO1 5CVRA 4K0KB 2M7WA 4FOQA 1W6MB 5DN2A 4YGCA 2HLEA 1V9U2 5FK8A 1RMU3 4HN0A 4OI2A 1VRH2 1KS5A 2IU3A 1ENXA 4AFBA 2IVIB 1IURA 2GMPA 2ZGRA 4YZ3A 2HJIA 1QQP3 1YZBA 2YHJA 3N9MA 5CA0A 4UCUA 1BYHA 1UZZA 3O14A 2KKWA 5C5TA 3CCMV 3I7DA 1C5IA 1G86A 5LBQA 3RZZA 5ANNA 2GV9A 4LFAB 3PU3A 1H2LA 3CQOA 2EIJB 4IV1C 2VOXA 5C8YB 1YTFD 3ZHUA 3CCUV 1IX9A 4LF4O 4K7JA 1REFA 4HT1T 2VY0A 3K3NA 1F35A 2AACA 5IATA 1SQBH 1D0HA 5FYMA 3MHZA 2HH9A 1LHWA 3N27A 4TUYB 1D5AA 1JYXA 4CVUA 1Z5WA 4DNYA 2RJLA 1RTVA 3H1WA 3L73H 4UXNA 3POJA 1JODA 3AZVA 5C9AB 1MSWD 5DPNA 5FV3A 1Q8QA 2A6ZA 4GWIA 1VALA 3QCWA 4HVOA 2BNOA 3RYFB 1HNXB 4DR5O 4IE6A 1WCQA 4GH4A 4LHKA 2VU9A 3WB0A 2R72A 3I2OA 1YYNA 3CLPA 1XOUA 1KMIZ 4K9SA 1Z2GA 4IV3B 2Q69A 4MVMA 2JD9A 1V55C 5FKCA 5FP7A 1XU2A 4UFMA 4B3TO 4D8MA 3T2OA 4AHWA 4I9QA 4W4ZA 3P3PA 3FMGA 3VBUA 1K12A 5AVPA 3BAAA 5A1LA 2WNVA 1KP2A 2NP0A 3U11A 2Z79A 3LWCA 5HCAA 5IAVA 5IAXA 2V4DA 1H4GA 2R9RB 3I2FA 4XBFA 2P67A 5CB4B 4PA6A 1PMHX 4KI5M 4GYCB 4FPJA 2DYSB 4CP0A 2VMGA 3SYCA 4MX3A 1RFYA 1PVC2 1RUG2 4QHBA 3FN9A 5A2QN 3LFMA 2QE7G 3VBBA 3MW4A 2YIDA 3AJYA 1NVPB 1C5HA 1S0JA 5DUVA 3VBOA 1J83A 5GLUA 3LIHA 4H3WA 3POWA 5LXTA 3E5XA 3SCHA 5F8PA 3OBTA 2RN9A 3HB3B 1BBT3 4NXNB 3WV6A 5C9AA 2VW1A 3TJTA 4QAWA 5IVBA 1POV1 3DKQA 3W7SA 3JD0A 4JV5B 2QKAA 1ZZ7A 5FY0A 3DGTA 4YW1A 1LTEA 5FZEA 1M4UA 5BMVA 2BV4A 2UY8A 5H6QA 1UOJA 1ZRDA 1NA1A 4WM8B 2WAAA 4XMAA 2B46X 1WPXA 3VUOA 2DFCA 1VBA1 4SBVA 5CBGA 2HWC2 2QTOA 1RITA 2FHRA 1DYKA 2E31A 4MVUA 2HWF2 5F3CA 5FZ3A 2R063 2HWB1 3AK3A 3OG2A 4AHCA 1ULDA 3WDUA 4K3AA 4BISA 2VUAA 3ZHQA 5L3FA 1H8TA 3Q4HB 1AL21 1FPN2 4QM8A 1Q5OA 2PLV2 1Y74B 4DV6O 1GNYA 4YG3A 3VN4A 4QX2A 1PX3A 4RA0A 5ITZA 4JGYC 4O2AA 5FPXA 1CGPA 5EBLC 3ZFEC 4NPMA 3FJSA 2PY5A 3E97A 1HDKA 3WDWA 1Y4MA 1HX6A 3ASNB 4A6OA 5FLJA 5C3PA 1ZBA1 3R65A 4C8DA 1RUF2 3SGIA 4Z92B 1B3QA 1S5JA 1KD1W 4QMAA 2RM21 3L2YA 3SKVA 5FLHA 1F9KA 3LFIA 1LOAA 3LOIA 2D97A 4TSFG 1O59A 4W4LA 4O2BB 5FO7B 3WQ7A 3Q8BA 1IGOA 5J98B 5CN0A 3MUZ1 2VQFO 2FB5A 1V9PA 2P7TC 3ZMSA 4QU1A 4YW2A 1GKFA 3INAA 4AWDA 3ZVXA 3FB7C 3WNLA 4UF0A 3GZAA 5F3IA 3K0DA 3MUY1 4XUPA 1QR8A 4MGZE 3EB7A 4PELA 2X7RB 1PMIA 3QH7A 4FFBB 2OVUA 4TV9A 5FZHA 1AB3A 2WL1A 2HEWF 3B09A 5FUPA 1DDLA 1GMGA 2F4LA 1XNRO 3ZCCA 3CSXA 2WQ8A 3RGBA 3L2HA 2VQEB 1CZVA 1VARA 3CEWA 3PTYA 5IWAB 1NT2B 1HXS2 4RN5A 1S0BA 3FHIB 1XMQO 4LHNA 2FD8A 1PO21 5A6QA 3FUOA 2A79B 4E9KA 4YARA 1AR82 2NN8A 1FT9A 1F4MA 3ST7A 2RDSA 2QM4A 3PURA 4CH3A 2N74A 3VBUC 2QNKA 1W39A 3OGIB 2D3SA 3PIJA 4EN9B 2ZE6A 1WLWA 4WM8C 4DB5A 3BVOA 3JAKA 4LJHA 4CDXA 2Q5TA 2DN9A 2JDMA 2DVDA 4JDOA 5LY2A 1UL9A 1SQQH 1NE4A 5DAQA 4DRVA 1Z7S3 3OY8B 3SYPA 1ZUQA 1R091 1KXGA 4X6RB 3RVHA 4MVTA 3S0MA 2CU5A 2Q7EA 3FUQA 2EAKA 3CBNA 3VHOA 1BZWA 4N90A 4NO4A 5HCFA 1AI6A 3AP6A 5HV0A 4KMQA 4GT1A 2HVKC 1SLTA 1OCOC 4O4HB 1XOYA 1LUVA 1VBB1 2Y0IA 4GULA 1CVNA 2VZQA 1OFSA 5I91A 5JMCA 2XPJA 2J7MA 5FZ8A 2CHHA 1NQDA 5JSRA 1KJRA 3MO4A 1W6NA 1RPRA 3H8UA 5A70A 3FBYA 5EIYB 3MD0A 3U75A 4ONUA 1AX0A 4PD4F 2H6CA 2R072 3GJBA 3DC5A 3PL0A 2WFF1 2XJQA 1WLTA 3KV6A 2QM8A 1U12A 2QEXV 2W1SA 1XI1A 5LA0A 1V54B 4M4PA 4UCOA 2PI4A 4URAA 1JUHA 2ETEA 2CTVA 5FY1A 2DWEC 5DAPA 3CZJA 3L9DA 4NWVA 4LF6O 4LH6A 3RZKA 4Q8KA 2QKDA 3JD71 4FSJA 4LBQA 3EJKA 3RWRD 1W6PB 4BZ4A 1HWYA 2A71A 2GC1A 2BNNA 2MNGA 2AHZA 5FPVA 1QY4A 3TB0A 3MGUA 4ZPIA 1EYBA 1UIJA 1BK1A 3LSQA 2R0HA 4CRQA 4PDVA 4Y22B 5JIAA 4YJ2A 1VQ9V 4ASKA 3ML0A 1K5SA 5FY5A 4AAXA 1H6XA 5LA2A 4Q4V2 2VMEA 2QJ1A 2A6YA 4JGSA 4Y1UA 4O2BA 3ZHTA 1UQXA 1X82A 1SPPA 1I0HA 4IYIA 4UI9L 4GKXA 1GNHA 3O12A 5JXGA 2HWF1 3SJBC 2PMWB 4D3WA 1LR5A 1KEXA 2P4KA 3T2PA 1AJOA 1XEQA 4PI0A 4ICGA 4FLXA 1RUH1 2EIEA 5GALA 3ZXGA 4HMZA 4UW3A 4Y4RA 3B01A 2IJHA 2RM22 2ZE8A 3U37A 4OQ8A 1AP6A 4D94A 1JYCA 4ZKTB 1XNTA 2PAKA 1B06A 4EEQA 1Q86W 2Q1FA 5A32A 4FK5C 1RXFA 3OEEG 1AZDA 2D40A 1QJY1 4Y22A 1C8NA 2VNGA 1COWG 3POIA 4I5SA 4O2AB 4OUSA 5ITZB 3J8F1 2NYYA 4XDJA 3PJQA 5CFCC 1KKCA 3VQWA 1WMXA 5JIUA 1W3VA 2Z5WA 4QKBA 1H8TB 2JDAA 4FI9A 1W6PA 5J2UB 2D6KA 2LO1A 3K46A 3ABUA 1XBLA 4E4HA 3WNMA 1BCXA 1VQLV 1U5IA 2UU8A 5ERLA 4GZ9A 4OVEA 1MEC2 4UVCA 4IW3A 1L3JA 3M3IA 4NPLA 4WVWA 2XH6A 2PHXA 1NLQA 3PJSK 5T3NA 4QKFA 3JAWA 4GKKB 3BUCA 5L9BA 5JDBA 3VBOB 1W6OB 1MABG 2ZXWB 2R16A 1FOD1 2PXJA 3OGRA 4CCMA 1IPKA 2GP3A 1Q6IA 1R73A 2P5BA 2BEOA 3MIDA 1RUF1 1RHI1 4E4EA 3CD6V 4A3ZA 3LOBA 1RUI1 4HSJA 4O4HA 3LA2A 3HNBM 1FXZA 4HLTA 3PN1A 3ACIA 1A34A 1D4M2 3LSUA 4P08A 1IQDC 2PA7A 4PF1A 2HJDA 5IYZA 4LH7A 5DMYA 4CH5A 5E6HA 1NLRA 4B4PA 2D5FA 4D6RA 1K34A 4M4RA 3DCQA 2VZPA 4RO2A 1OV9A 5FYIA 2XAGA 1QKQA 5C71A 1H1MA 4FPCA 1COV2 4UW4A 4X64O 4R9DA 5LK5A 2B5UA 2Y4UA 5A1AA 1GZWB 3OY8A 4FFKA 3NV2A 1K5MB 4H13B 3T4VA 4Y33A 5HCHA 1MR5A 2X05A 2YMZA 4ZBMA 4JI2B 4XJAA 3OMAB 4FM0A 2FDIA 3AK2A 1OQ1A 2BQPA 4QX1A 2RMU1 1FJGO 5EYXA 1LOGA 1OCCC 4QPIC 2E3CA 5BYNA 5KXDA 1OCOB 5JQGB 4AQYO 1NQJA 2RM23 2VCAA 3A2FA 3CCLV 1U97A 4TLGA 3LB9A 1OZ0A 4BK5A 5L3DA 2WFF2 1Q8SA 4MT8A 1O8PA 3DXUA 2P34A 5DN6G 1XNBA 4OHWA 4N8MA 5AC91 1GN2A 2CV6A 2Y33A 1ASJ2 1URFA 3R0RA 5KAIZ 1MMMA 1HV0A 4BIFA 2CK3G 2VOKA 4Q0SA 5FZOA 1DQ4A 4LNUB 1OLQA 1BEV1 2CTPA 1C1LA 3UL2A 1RUD2 4K40A 2W91A 1UKRA 3SYOA 4XJUA 2Q30A 4D7SA 4PCRA 1OKQA 5BNOB 3LNNA 4JGYA 2OQ6A 3J8F3 1NZIA 3PHMA 1W6MA 4K6BA 1DIWA 2D7FA 3MLLA 4JI5B 4W4KA 2X6CA 3J81N 1N1VA 2WSSG 5E1RA 1BQPA 5C7GA 4EFEA 3KCYA 4WFAV 3WSOA 1Y4WA 4TOIA 2HEVF 4KXRA 2JRIA 1R092 4ES8A 3H1JH 2JIZG 2HEPA 3THDA 4OPAA 4BW9A 5LMNB 3RJRA 3IAYA 4MADA 3CS5A 2ZJCA 2JDZA 4IGPA 2WA3A 3THCA 3RSJA 1JU3A 4L99A 4MVOA 1BBT1 3ZXAC 4X64B 2Q9LA 3DECA 2ZHKA 3D36C 4QT6A 3ZYFA 3MHHC 5A33A 1QHDA 1NX9A 2ZGSA 3IAPA 4EN6B 4JI7B 1YFWA 1EZVH 4BOWA 1K97A 5IY5C 2Z0AA 3ZMVA 3O9OA 4NN0A 3C3SA 4PIZA 1OURA 4IETA 3AEIA 2IBZH 5FYYA 5FDBA 4XBQA 1GQPA 3BOPA 3ZN4A 2P4EA 3D3AA 3I2GA 1Y74A 3BIWE 3CB2A 3LPFA 1UMHA 4NPRA 2XVKA 4DV2O 1SESA 1I9RA 1YQ5A 1XE8A 5KWRA 3MIHA 3K58A 2WINB 5KAFZ 4I3PA 4OHZA 3ZKYA 2WKKA 4K8ZA 4YW6A 4QQ2A 2ADEA 1S0EA 4JI3B 3O1OA 4G27B 3TYJA 1JS9A 4P9YA 3VKOA 3FB5C 1H2MA 2YXHA 2E32A 2ERFA 1HDJA 3ZN6A 2Z4FA 5FBJA 2ZCEA 3WW4A 3ZYIB 5T54A 2CTWA 2ZE7A 3OEHG 2G9ZA 4FLUA 1L0NH 3DYMA 1Z0HA 5CFDC 1P49A 2OPKA 4AXOA 3B9IA 4UFIA 1ZSPA 1G9BA 3IB3A 4LF5O 3B00A 1TVKB 1I5YA 1GSLA 4LE4A 2UUAO 3VDAA 4N7IA 3E5QA 3ZPYA 4YG0A 1AJQA 2WNUC 4ISRA 5FPBA 4TZDA 5FL7G 1DGRA 5CNAA 5BNOA 4DR4O 4U36A 4DUYO 1TE1B 1RUJ1 2ODMA 3WQ1A 3SPIA 5E89A 2A73B 2H6BA 3VV1A 2R70A 1F4HA 2NMNA 5FPRA 4MSWC 1FMD2 2WNOA 5M0TA 2PHLA 3OUFA 4PQQA 4COUA 5FZIA 1IDSA 1N0NA 5FMOS 1PGL2 2EAAA 1GZWA 5G05L 1JYNA 1QOSA 4YG6A 2XKPA 1TAEA 3HQRA 1IVSA 4MOAA 4N21A 2WZR2 4LEJA 5HI0A 2WNUB 1DLLA 1GWKA 2XWBB 5ACA2 4MTFA 3FX3A 3DTUB 3JB4C 3CX5F 1TUEB 3N7MA 3DUIA 2Q8EA 1K5MC 2A7AA 2DBIA 1K42A 2EXJA 1O91A 4CSWA 1ZBE2 1VB4A 4Q29A 5B1OA 4W6WA 2WYSA 3T0DA 2P6CA 4XQ4A 1UAIA 2QQJA 3ZSJA 3CO2A 4ZU5A 4CS3A 4LO6B 1YO8A 4C90A 1WNSA 1OUXA 5FKBA 5FFOC 3WQ0A 4CU6A 3STZC 1A6CA 3ZMTA 4IXLA 4K3UA 1TUBB 5A3OA 1FFTB 4RAIA 2JDIG 1QBZA 3SH4A 5C4WC 5I8TA 3IFXA 3VQXA 1R083 3LEMA 1QJZA 5IVYA 1XE0A 4MVZA 4FFIA 1IXMA 4LFCB 2R1BA 5FJHA 2XJVA 2ZM6O 1LRHA 5BNQA 5F5AA 2EICA 1ZBA2 5FP4A 4CCKA 5I0SA 4XXAA 1UYYA 2CUGA 4IESA 3I97A 4QQLA 1KB9F 5JZGB 2X5IC 3VOUA 3T1LA 1UPGA 3POEA 3M7AA 2DUOA 2C9AA 1YNAA 2BVBA 1SLIA 1CAUB 5CA1A 2YXYA 3K5MA 5K4LA 2B9UA 4GXLA 4S2FA 1JX9A 2I45A 3H1HH 1JHJA 5HFMA 2ZM6B 5J2UA 3OR7C 2MEV2 1NTMH 4QKDA 3SH5A 4BWOA 5FLIA 1PK6A 1VQ7V 1I6XA 4MGIE 2ZD9A 1NYWA 1EBOA 5DG1A 1AR62 1VBA2 4XZPA 1FYJA 2GC0A 3JQWA 2OIGA 3E8GA 4RQEA 1AYM2 5JPMB 4YXWG 2VOTA 2W94A 3N7LA 3AC0A 5BY1A 4L0PA 4JI5O 3K3OA 5IYBO 4Z8BA 4RS5B 2W0FC 4RHV1 2B39A 2G9GA 2GAUA 3H7YA 4BA6A 1N0JA 5H9CA 1HJGA 1D4M3 4DR2B 4D0QA 4K0KO 4BK4A 4OMDA 1IBKB 2ZCWA 1A78A 1WW4A 2WZEA 1M5IA 1EM1A 1UW8A 4N53C 1DF4A 1FPN3 2QWPB 5LW9A 2E6VA 3SR2C 3K08A 5GZGA 2JS5A 3H1IH 3SEEA 1I7FA 2O1QA 4JGZA 4RS5C 3ETPA 1POV3 1LOEA 5B4XA 4C7UA 1XUQA 5F2SA 1VBD2 2ZAHA 1GZCA 1FJGB 3I2HA 1EP0A 3PUIA 1IZ3A 4Q4Y3 4PDWA 5FZ4A 1ND3B 5A80A 1UU6A 1OOPB 2R30A 4JZRA 3D3IA 1QQP2 1F23A 2BOCC 2VZ3A 1XNKA 3E8BA 2PF4E 4J10A 3OMIB 4FXGB 5JXHA 5JCTA 2BZDA 3WG7B 1XNRB 1DYOA 3ZYBA 2AXTZ 3SJCC 4HKWA 1SERA 3LD8A 4DV4B 1PM4A 5FY9A 1Z7S1 4UFKA 2DTYA 4HSLA 2EJRA 4ZZ5A 4YZ1A 3BHPA 4ZS2A 5A7OA 3ZMZA 2ZGKA 4EWDA 4FAHA 1O9HA 4FFHA 1RC6A 4KBBA 3ZDSA 4I0BA 4LBLA 1XB9A 5A3MA 5KMGA 4XHBA 4DV6B 1SLCA 5BY5A 1NA1C 4DR6B 2RHPA 2CGNA 1VRH1 1ZZ9A 1B35A 2ZMLA 4NIHA 3JB8A 5A3WA 4NTYA 4JI4O 4DOUA 3IZOA 3GHNA 1HRI1 3N36A 1CAXB 4J7KA 4IV3A 3WUDA 3BN6A 5CFCA 4FXKB 3E89A 4L92A 5C70A 4DQAA 5FOBB 3OGGA 1JA8A 4AVVA 1S2KA 1AR81 4G3YC 2QUOA 2XXZA 3BABA 1DP0A 1YITV 1G8MA 3K9SA 1NXD1 3OEAA 2KA3A 4DR7O 1W28A 3UESA 2VZUA 4Q0VA 2WN3A 2CY6A 3ZN5A 4XC9A 3W58A 1SFPA 3CRAA 2NPIA 3GHMA 3N7JA 4LMFA 1BEV2 3DPRB 4L2NA 4P9JA 4RHV3 1AR72 3DC6A 1JCHA 1HV1A 5AG2A 1OA4A 5A3UA 3JBG1 1ASJ1 3MF6A 3O1PA 3Q8FA 1HB2A 3AXEA 1IBLB 3E6CC 1SDDB 1BS3A 4UFJA 5JI9A 1LGCA 4JGZB 1S0VA 1MS3A 5EIBC 3SMHA 5EIBD 4GIQA 1AI7A 3MIFA 3WF0A 2EXIA 4YGBA 2NMOA 1RUD3 4I02A 4V2VA 1VMHA 3ZSEA 2UWCA 3IC9A 1MACA 4UAPA 1MZ6A 1ZA4A 2PHDA 3ZHVA 4DR1B 2V7QG 4NIAA 1GO3F 2FDGA 1YFYA 3T08A 5A7QA 5JOXA 4XDQA 1YHQV 4EB6B 3NO8A 2D6PA 3CE2A 2WA4A 1QLNA 2W1WA 5DABA 3JXSA 3H0OA 4WFEA 4INDA 1K3EA 3THOA 2WWWA 4R52A 1ROPA 4LE3A 4YZ5A 1FPN1 4KHPB 1V6MA 3ZXFA 2OPWA 5CG9A 3OMNB 5FWJA 4COYA 1H2GA 3MBWA 2C26A 2YFZA 5A3PA 1IG3A 3ZIWA 4X1KB 1JI6A 2HWE1 2XJPA 5I0TA 2UU9O 1EAH1 1J3PA 2FZ1A 4ZKIA 5KXBA 1AR91 2PYLA 3G6JB 3H50A 4UBGA 1SC5B 1UY4A 1CPNA 5KHJA 4LBEC 2ZGOA 1SKVA 4U2AA 4CXXA 3W7WA 1SACA 3V56A 2B9ZA 1HXS3 3T1MA 2EA7A 2D6NA 5IDJA 3QLQA 2ZHMA 1RUC2 3LSEA 3ZBHA 4MGTA 4GKYA 3T30A 2JGDB 1BZKA 2IVJA 5KA6A 2GSYA 3CCRV 3ZFEA 4XFIA 5IVEA 1IBLO 1H30A 3HPNA 4LF4B 1AUYA 2DVFA 5LHGA 4LTAA 3GVMA 1X8MA 1US2A 3CXCU 1OF3A 1FS0G 4COWA 5KC5A 4QIWF 4E4DX 1NE6A 3D0JA 3IPVB 1XPWA 5LL6Y 4JTNA 4BQYA 4QD2A 4QXHA 4FLYA 5GKAC 1CWPA 5CBLA 2ZACA 2V1DA 3IMMA 2VMDA 2JG9A 2A3YA 1ZBE3 1PKXA 4LKSA 2G4IA 3D3QA 4WFGA 4PA4A 3T1YO 3TETA 4COVA 5IYCO 1SETA 3IBMA 4Z1VA 1XNAA 4AI2A 4LF8O 3RYKA 3VHPA 1J84A 3G4SV 3OBZA 2Y4TA 1ZA7A 3KB5A 4DW1A 1D2SA 2EJ7A 3IT8A 5CB4A 2A6VA 3J7HA 2ZR3A 3ZXLA 4WM8A 1GOHA 3H1MA 5FZFA 5C9AC 5KX5A 1ASJ3 4CUCA 4ASMB 3NMBA 1YCIA 4NHLA 3GB7C 4LKDA 3MLJA 3F5TA 3F95A 1RUE1 2WSUA 4DV7O 5IVVA 5FMOL 1XMOO 3WDYA 1HQNA 4Q4X3 2LJ2A 1ZNPA 2FQPA 2VMCA 2CTRA 1K5MA 2AUYA 2VXJA 4BIUA 3J26N 1J3QA 1JOPA 2Q1ZB 3OTOO 4QE9A 4PLOA 4FLTA 1LAJA 3HBZA 1G1XB 3VD9A 2WQZC 3AKPA 1YEWA 1VIWB 3CXHF 5F37A 2Z3YA 4DUVA 4IGGA 1R1A1 4AYUA 4KG0A 4X1YA 1HNZO 2WLNA 4F83A 5CKNA 3CJHA 4K35A 2YB7A 1QWRA 2F43G 5EC1C 4PIYA 2YU2A 3IDEA 5A6ZA 3OBAA 3D36A 5FMBA 5GONA 1W6OA 4IYHA 2WNVB 1OUSA 1DZQA 3IPVA 2A75A 4PBPA 4KGQA 2YGMA 4LF8B 1OFNA 3WQBA 3SPHA 2RJ2A 4RQFA 2HKXA 3VKFC 2YEVB 2W52A 1R3IC 2WBKA 1RM1B 1US3A 1N34O 1AJNA 2XJSA 5E88A 2CAVA 1OHFA 2DURA 1F8VA 3ZIXA 1HNXO 5FNVB 3TN92 1XNDA 2IC1A 1M56B 3M7MX 3UQ8A 2C2AA 2OYZA 2Y6LA 1GNZA 2JE8A 4JYCA 1N36O 1WCDJ 1R082 2RG4A 2EIMB 2WJSA 4OI4A 3E2EA 3AYEA 2OZJA 1H38A 4LBJA 4QQHA 3F7VC 3VBHC 4XFFA 4JRAA 5L3GA 5FZ6A 3THPA 2VTFA 4EWEA 5J36A 2AREA 3O65A 2YIAA 1O6UA 3WF3A 4E8CA 1SQ4A 2WQ4A 3RYIA 1UU4A 4ARYA 1ULOA 1ZBA3 5TISZ 1R1BA 4GCZA 2YI9A 2QZ3A 2LW8A 4LUKA 5LBEA 4G4FA 2NZ9A 2UXDB 2VZRA 5FJKA 1KS4A 2XL7A 4PV1B 3KV9A 4TLFA 1HRV3 2PELA 1NTZH 4DR6O 1GWMA 3M3QA 1Y66A 4UCTA 4BM8A 2ZZJA 3BI3A 4LBQB 2BPA2 4HNAB 3WCSA 5CA0B 3AB0A 1F5JA 3AP7A 4NTXA 5JSPA 5K0UC 3ZMOA 1UMIA 4QB6A 5IY5B 1D0GA 1W9SA 1L8DA 2C9KA 3ZRVA 1FXVA 1POQA 1ALYA 4LO7A 2XWJB 4HETA 5FY8A 1VB2A 2QQUA 4KGGA 1DGLA 4CXYA 1VBA3 3SJAC 1FXKB 1O3TA 5IW0A 5EPAA 4DUZB 4CDUB 2YBKA 4MTXA 4D7TA 4NXNO 5A3NA 3H7JA 1O8SA 3AK1A 2J42A 3UT0A 5CIRA 1LESA 2OW4A 4AR2A 1OOPC 5B1BB 5DQ0A 3BU0A 4LK6A 3GWKC 1K33A 3ZFFC 2C4XA 4BYYA 3WG7C 2TBVA 4WM7B 1RL3A 1N3QA 4A3XA 2QM7A 3ASOB 2LALA 2VWKA 4I30A 1H8VA 4MH0E 1PNLA 4YZ4A 3L72H 3GBWA 2ZIMA 1ULFA 5GLTA 2WNVC 4Q4V1 3D5OA 5LA9A 4Q8LA 3SITA 1T6GC 2E33A 3PMSA 4ZHQB 3VKMA 1CPYA 2QBXA 3JBG3 4HK9A 2UXDO 1UO9A 3NAPC 3ZYHA 2D3PA 2WS91 2WN2A 1N32B 4HPKA 4HN1A 5H9PA 5H9RA 1HXS1 5JQGA 1ULGA 4CEWC 1IBKO 1ULEA 4XJ8A 5FRAA 1WBLA 1AR73 1BVP1 5EJ1B 5JAXA 2IU0A 3K5LA 3SPJA 1G7YA 4QPIB 3CCEV 3PDQA 2PLV3 1YDXA 5IWFA 2VC9A 2WABA 3GYDA 2AENA 5B1AC 3H1YA 4FT8A 3RJ2X 1G8WA 5SV8A 5EZYA 2LP7A 2BTVC 4P5HA 5F2WA 4AFDA 3EHKA 3UYJA 1AROP 3RNSA 1LHVA 2DYSC 3ICXA 5FO9B 3VDCA 1GM7A 3IMNA 5FAXA 5JZGC 4R7CA 5IYZB 1RIRA 1WD3A 4QB1A 2YC2A 5J48A 2JJ2G 2IXCA 4YVSB 2HWD2 1LHNA 4I4TB 2B7YA 1H6YA 2WLJA 1AVBA 4WVVA 2ZT9B 3GWOA 2WLPA 4EROA 2RCVA 1ST8A 1AR83 1FMD3 2GBOA 5JVDA 5D1IA 1MEC3 3E1F1 4GD4A 1YSCA 5IJRA 4QJFB 1SZBA 1JOBA 2N7GA 3WF1A 4WV8A 2EALA 1SS3A 1UJWB 3ROUA 3O0WA 1TMF1 4FPHA 1C28A 1EPWA 2VW2A 5C3QA 3H01A 4QDSA 3AK0A 3GBFA 1XNCA 1YHFA 4FPLA 1HQLA 4AE2A 2XAFA 1UZVA 4RS5A 4KL1A 2Q8VA 3VD3A 1KU9A 4R4XA 3OYWB 1TME1 4XFAA 1QR9A 5GM0A 4B3MO 2B4KA 3LDRA 3WDTA 3K0GA 5GLWA 3V0BB 1LU1A 3I56V 3S5QA 1M93A 1XE7A 2WUHA 4LFCO 1MS4A 5CKMA 2Y48A 2W6JG 2OCCB 3OB8A 3D0SA 1RXGA 4O61A 1ZYBA 4Y26A 4QWNA 3NKTA 3EMRA 1NLSA 4AGRA 4ZOLA 2A9HA 2HWB3 3M8LA 3S3WA 4PDMA 2PAMA 4M3CE 1UD1A 1GM9A 1YXBA 5KXEA 4HBNA 2WLHA 3B4SA 4OUEA 3BFRA 2ZX1A 1AL23 1UXZA 4CDQC 4XETA 2JS3A 1AJPA 4I0AA 3HKBB 2E51A 1I1EA 5FZ1A 1PL4A 2YGLA 1AXZA 3JAMN 5L3BA 2ET1A 2B5HA 3LDKA 2DUPA 1PGW1 2WIIB 5LBCA 4AF9A 2EIKB 4YGDA 2LGWA 2JD4A 4NIDA 2EX3A 4JI1O 2EZPA 1PVC1 2DYRC 2QDNA 4FVMA 4LBMA 3G80A 3QTCA 1VBE1 5FXVA 4DS0A 1W06A 4X62O 5E79Z 5LP6C 3TEWA 1KQSU 1HRV2 1CJPA 4GALA 1BMV1 2LS6A 3MV01 2OX0A 4BQWA 2ZX3A 1B35C 3ZRWA 5LEJA 1KKDA 2YG0A 2ZGUA 1ZZBA 3CRRA 1MVEA 2EBOA 5H9QA 5DDJ3 1QNMA 5CZKA 1WMFA 4F7ZA 4XAAA 3K4ZA 2RS31 4LO8A 3T09A 5LP6B 1MNGA 4HFSA 3EFFK 1MS5A 4X62B 2GP5A 2ZEXA 3QO7A 3H3UA 4XIOA 3GZTB 4JV4A 5CA6A 4CEYB 2OTJV 3MFCA 1W6NB 1LOCA 3MDPA 4NVPA 3GDBA 4X6QB 4N23A 4ES9A 4BW5A 3VKLA 1DQ0A 4Y3OA 4N9HA 3NNMA 5LBFA 2Q8OA 2W0XA 3KZ4C 4DXWA 3JALA 3L9JT 4GKJB 4O4JB 3G71V 4GB32 2JIJA 2GDFA 3MIEA 3AYDA 4E4SA 5FZBA 2E7AA 1LNSA 3ZX6A 1GQGA 4M0NA 2P37A 3H8OA 5C8CC 4XFGA 1PV0A 2YS8A 1DZRA 2VQEO 2LROA 1YI9A 4DV2B 3N7KA 4J80A 5KLVH 4JCKA 3FLTA 5EP9A 4XF9A 1C8M3 2VNOA 4HG6B 3KV4A 4OUMA 2PZSA 1KBHA 1V6NA 5SV5A 3K75B 4ZU7A 3I3BA 3GM8A 3MHSC 1NQTA 4AI9A 2GH8A 4A7KA 2J22A 1PL0A 4DINB 4DR1O 3JATA 3AJZA 4XZUG 2VO5A 4F4LA 1WMEA 3ZYJB 1U96A 1FD9A 2Q68A 3UJQA 4CP9B 4R9CA 2RS53 3MPPG 2OUHA 4LLOA 4DV4O 1H0BA 3TRSB 1XQ8A 3CJIA 3KT1A 5EFUA 2ZHNA 2X5IB 5FZLA 1BL8A 1V6IA 1PZ7A 3ZR5A 4JI0O 2XHBA 1PK6C 4P9OA 1IHMA 3JD2A 3USUB 2LM3A 5IWAO 1VPHA 1N47A 5IT6A 3D8CA 2NN4A 4CDWB 4LR3A 1NCQB 3BTXA 3PVOA 2XJRA 3LA7A 1RJ8A 3CC2V 1W9FA 4TUYA 1P7GA 5IVCA 2W1QA 3O0XA 4J1WA 1S3JA 2BYVE 5D8AA 4LT5A 5JJEB 1CIWA 4OCTA 2DCYA 5DEDA 2C1FA 4DMIA 2X53S 5FQ0A 2Q6AA 1W9TA 4IE0A 1XHZA 5AC92 1PO23 3N4MA 1BJQA 1W3XA 1K9MW 4QPKA 2EZOA 2WZR3 1NZ6A 2FDFA 3JD1A 3FL7A 5LA6A 4XUQA 5JPNB 3IC7A 2UUAB 1W8ZA 5F6LB 3CRMA 1S2EA 1RUI2 4DXRA 1HR0B 1YJNV 3NV1A 5JLVA 2FCVA 4FOWA 4H55A 5IVJA 1CAVA 4LC1A 2P3IA 3OCPA 1RM1C 4PIXA 1HN1A 5LGNA 1PIV3 3ES1A 3DXRB 2JICA 5JJJB 4BH9A 5IJ0A 1DQ5A 4LA3A 5T55A 4Q4W2 3NNFA 4JI2O 5JCOA 2WO3A 3I2KA 2JG8B 1NH2D 2A6XA 3VZLA 2A3XA 2Y69C 2QWQB 1DGRN 1RJ7A 4YM3A 3B5LB 2Q0AA 3AFKA 3DYOA 2C0ZA 3KQRA 1H1IA 4HK8A 3O1TA 4HXCA 5FYTA 2FMYA 1KFXL 5KHHA 4YLZA 4FLWA 4DW0A 4LBNA 1JR9A 4QDQA 1TQ5A 3AL6A 3KQ4B 2VMHA 4JI4B 2P1BA 4GJYA 2NLRA 3ZXJA 2BFUS 1F15A 4RR3A 2I74A 2PYTA 2YYOA 5FZOB 1OPMA 4XDLA 4NIIA 1Q43A 4DV7B 3PU8A 2VOVA 3WT3A 3CRQA 1XRUA 5BV6A 4CPBA 3O5SA 4J9YB 1G9DA 3NNGA 3U4XA 1HLCA 2XGXA 3EXAA 1CAWA 2AZ0A 2UUBB 3RT3C 4XIKA 2CL2A 1QU0A 3CC4V 4P30A 1FMD1 4DV1O 5FXXA 3RVYA 1QH6A 3RBZA 2A6WA 3K48A 1O7FA 3HR9A 4YPJA 5FZGA 1UZ0A 4AFAA 2RDNA 3BRCA 2WT0A 3WW3A 4RWUA 2ZGNA 2VQTA 3GCXA 1LGBA 2VQFB 4HZ3A 1WJZA 3H1LH 3V0AA 5DECA 2CE4A 1PIV2 1BVVA 4NOTA 3SQOA 2JEXA 2ZKNA 2OKXA 1C8M1 1WLDA 5DXDA 5FZDA 4FPEA 3T4HB 2JB8A 4YW5A 4CDUC 4JRLA 3LDCA 1DK1A 4TSVA 3H3LA 1D5NA 2P22C 1MS1A 4CDWC 4UVBA 2R041 5FBZA 4BXSV 3JU9A 3GBGA 5EJZB 2UWBA 3LE0A 3CCQV 4NHYA 3SCFA 5AVAA 1NY71 5AC93 1DQ2A 4S2GA 4BCUA 4AG4A 2D2CB 3BTZA 1J5EB 1NVPD 1WP8A 5F39A 3KD4A 5C8CB 4W8JA 4WM7C 4M3CA 3VB9A 3HKEA 1MVQA 3MI8A 1ZBE1 4DR3O 4PF5A 1C1FA 1V70A 4O9GA 5FY7A 2YIBA 3RQ0A 1GMMA 1YTFB 3RFRA 2RMU2 2L9LA 1N1TA 1X36A 3RMXA 5ACA1 1ODNA 4CCNA 2XOMA 1XC6A 2GN7A 1NY72 5JR2A 3N2KA 2VE1A 3KKYA 1OF4A 1NH2B 4GKJO 4LR4A 3WP4A 3ZHSA 4B3RB 1COV3 4JGZC 3AG4C 2BTOA 2A3QA 4Q26A 1ZRCA 1KFUL 1MOFA 1BLZA 3M3OA 3C7HA 3BALA 3HQUA 3VQYA 2HWB2 4JYBA 2ZDIA 1GAXA 5CBHA 3RYFA 2HWE2 4LOSA 4XUOA 2B9VA 4DUXA 2OIEA 4PA9A 3KGZA 4YM1A 3UT5B 4LF5B 5I0DA 2ADQB 4YHHO 2XAJA 2JKBA 3I3MA 3PUSA 1QJY2 4EE2A 1QGLA 3ZYRA 1TMF3 4E27A 5A32B 1AHSA 4DR7B 4GKKO 4K21A 4P9GA 3AZYA 3A8TA 1MQTB 2V73A 4QE7A 5CAZA 3ACFA 5ABJC 1QXRA 3LSSA 4DXSA 4IQPA 2GNMA 2H8PC 4IE4A 2G38A 1W9WA 1LODA 2HWD1 3TNPB 4F6EA 1RB8G 5BNNB 2E76B 2PHUA 5E8AA 1E5SA 3MDSA 1BBT2 3NJYA 4AQTA 4JKMA 3HN1A 2W08A 2EIMC 2HR3A 1CX1A 1H8TC 3HKDB 2C5DA 1F51A 2DQ3A 1EAH3 1XL4A 5FYCA 2JDUA 1BK0A 4YJ2B 3B7MA 1KC8W 1DFQA 4MGSA 4O65A 1SLLA 4AEDB 1W9YA 3JCIA 1JYIA 2PAEA 4B08A 2R043 4UYBA 3T4ZA 1SLBA 3FLPA 3HNYM 1V6OA 1JUIA 2V4VA 4DYLA 3WHTA 1JOJA 3RYHA 5BPXA 4OGQB 2JENA 4EQVA 4MHRA 4JQTA 1JOYA 1J5EO 3C3VA 3CCSV 2WPDG 3ZXEA 2A1XA 3K2OA 5F3EA 3KS7A 1WKYA 2VZTA 3A0BZ 4GX5A 2BCCH 3WR0A 3WU2Z 4FP3A 1SA0A 2O8QA 1UFIA 4ASUG 3K57A 2ZGQA 2OCCC 4CEWB 5GTIZ 3MYXA 1AYM1 4K1YA 5DUWA 1I94B 3H42B 4O4IA 3AL5A 4XFHA 5C4WA 4UWDA 1CP9A 4J41A 4KFMA 3OPWA 2AEYA 3P3NA 3WP5A 5B1AB 2GTAA 4UFZA 1Y76B 4IIJA 5CA3A 1F31A 3NXSA 5I8SA 2DTWA 4ISQA 1PZ9A 2WAMA 1WLCA 5IK4A 1X8EA 3CNAA 3ZSMA 4FPPA 1O5LA 2ADDA 4N53B 2ZX2A 2P2KA 3UT5A 2WLLA 4LP8A 2VCMA 4KWUA 1UZYA 1W6QA 4RQPA 3BU7A 2HKOA 3EXUA 4CCEA 1C57A 3URFA 1C4RA 3OUIA 2X09A 4RD7A 1UX6A 1M06G 2GMEA 4LK7A 3TBDA 3UETA 1IG0A 4YHHB 3SCGA 5H5NA 4FTBA 2XLGA 1X9PA 1LEMA 3VZNA 3S7IA 4NHXA 5D8AC 1KGYA 3U14A 1V6JA 4WVMA 1QQP1 1UY3A 3WG1A 5LATA 1IS6A 2F4VB 1MPXA 2K46A 5EJ3A 1M90W 1QVGU 1RMU1 5IFPA 1NCRA 1GK9A 5JJNB 1KUQA 2E53A 4V1PA 2MEV3 1QJX1 3ORJA 1ZL8A 4X1IB 2YV8A 3EVKA 3RZLA 4JTOA 3HKCB 2XLFA 1W8WA 5A7WB 1SQPH 1CESA 4FTEA 5CG8A 4IL6Z 1PNFA 3NSTA 4I50B 4Y20B 2XOKG 5C5UA 2HHHO 1ND2B 2J1EA 2YC4A 1WCKA 1R1A2 5FYHA 3RYCB 4MXWA 3OFNG 2PHRA 5FYSA 2IJIA 5JWPA 3MW3A 4AEDC 1XJAA 1J1TA 1S4CA 3I3QA 3P1IA 4FVVA 5L19A 2R9AA 1RP3B 2WDBA 1XSQA 3AZZA 4ORFA 3A21A 3LDBA 4NHMA 2BOBC 3WG3A 2JX9A 1ENRA 1L7QA 2B1GA 4TV9B 4DO0A 1TVGA 3AMMA 2CGOA 4QPGC 4YVWA 2RVAA 4GJZA 2GNDA 4CUBA 2FCTA 1LB2A 4YVSC 1LOFA 4Q4W3 4PHZA 2Z2SB 3RZHA 2RS52 2ZMNA 3CCVV 3LCPA 2DVAA 2DBNA 2P6JA 3P32A 4OZXA 3GNEA 3AM2A 5GW7A 1JTZX 1MA1A 5DAVA 1FXHA 4UCVA 5GZDA 2Q4PA 3HT1A 1K4DC 3DPRC 5KXCA 5F5IA 2ES3A 1FV3A 2ZBJA 4KQ7A 4PJYA 4X9QA 3X2QB 5FZCA 1AYN1 4R4ZA 4PDWC 4ZU4A 4M0HA 2K9PA 5ANQA 3WVJA 1VP7A 1OMIA 3UKMA 4O9EA 3ZSLA 4YW7A 2E5LO 1V0AA 4XFCA 4CU9A 3C7OA 3PVEA 3WF4A 1RGSA 1QU7A 1R1A3 4MV2A 3KF5A 1M57C 4QPJA 2E26A 5LCWL 4RUFA 1EV12 2VZVA 5HBAA 2IM9A 4RSUA 3Q4HA 4ZONA 5LBBA 4CDQB 3T1HB 4QX7A 3TAYA 3M70A 1VQ4V 1JFFB 2R9IA 1OC1A 4IUGA 3W20A 4B4RA 2VZ1A 3ATGA 4JI8B 4DPNA 3CMGA 4FO9A 2QKCA 3CCJV 2Y60A 3BYWA 2P3YA 4JVAA 4Y4YA 1T6BX 1VQOV 4CEYC 4UFLA 1G9AA 1WA8B 2QKSA 1LGNA 4S2HA 3VD5A 4LUMA 1YUDA 4YRDA 4KWJA 2BSKB 1NA1B 4XE9A 3UM7A 1OD5A 3FAVB 1MS8A 1OD3A 5T5LA 1W0KG 2YPJA 1YFUA 1OLME 1QEXA 4YY3O 2RE9A 3GZEA 3SXWA 3BB6A 3B93A 4MHUA 1HR0O 3NQHA 3B02A 1RSOB 5LXTB 1H4HA 4GWMA 3SKJE 3IDBB 3B8MA 3VBFB 3VGIA 3K04A 1JW6A 1OCRC 3DGEA 3BTYA 3KLSA 2H3OA 1BXHA 2F93B 3WINE 2PN5A 1BMFG 2R061 1ND3C 3USUA 2KB1A 3PJYA 3AZWA 1IPSA 1QF3A 2ZEYA 2BGCA 3VBRB 4LO4B 3KT4A 4QQPA 4QU2A 5J37A 3AG7A 2WLMA 3RZGA 3WCRA 3E5UA 4I55B 4ZS3A 3SYAA 2XHKA 2XJUA 2BUKA 1RUJ3 4GMP0 2Y0OA 2Q5ZA 1BQZA 2BTQA 5AFEA 3PUHA 4L9BA 3O1UA 1MS0A 3T4DA 4FTSA 4DUYB 4JAUA 3CP1A 2ZKOA 4X20B 1DTOA 4JHZA 2N04A 3OD0A 3UCSC 2UUBO 1VAKA 4DUWA 3APOA 1FYUA 3M99B 1V9U1 4LA2A 4DV0O 4TWKA 1W2BU 4CE8A 1XQNA 4MZUA 2WLIB 2J1AA 3N9NA 1LOFC 1W0PA 1S5HC 1QQCA 4LF7O 3ABMB 3T1CA 5LOVB 3IGAC 3F2ZA 4YY3B 2FDKA 3NR7A 3HN3A 3NL1A 1M57B 3A7QA 5LB6A 4ET7A 3FYIB 5KUKA 3POYA 4X20A 1D4VB 4XEZA 1QNYA 1MZ5A 2VCCA 1PNGA 2Q8CA 3LNMB 4HZFA 4NAOA 2RS13 4D6TH 1FFXA 2ZGPA 4TTGA 1S0GA 2X29A 4DIQA 1JVMA 1RSOA 2UUCO 2F4VO 4I0XA 3JARB 4R8HA 1PNKA 1YQ6A 3ILFA 4EN0A 4XACA 1YIFA 1CIYA 1PM7A 3M4FA 1PX4A 1PO22 4A7YA 1SF9A 3CIHA 4B8EA 3RMYA 4GX2A 3VBRA 3JD3A 2M6YA 3AMHA 3NNLA 2JG9C 2VWJA 1DU3D 2IXLA 1QLEB 4XPVA 4FAGA 1F4NA 3E22A 2GMMA 1SZTA 4XYXA 4IHJB 2OT7A 3I8TA 4J7ZA 4IEOA 2JXAA 3POFA 4HVRA 4BMEA 2D3RA 1WA8A 4MO3M 2YC0A 5A3TA 4WZFA 1A3KA 2F6BA 2P17A 2ZZQA 1KQRA 3ZHRA 1Q6UA 4IV1A 1AXYA 1IS4A 2VZSA 3ZDVA 1XREA 3KVAA 4JKKA 1QMJA 5EYPB 4E4ZA 2VAUA 1F2NA 4ITCA 1Z7S2 4JX0A 1R1ZA 2XAHA 3N2GB 4QXBA 2VQ0A 3KF3A 3S3XA 1QLEC 3MPBA 1W8FA 5F1RA 2WFF3 4B3MB 3AX4A 2GALA 1F4AA 3QNEA 2W39A 4CCJA 4H7MA 5FZ0A 4GWJA 3OBRA 1L7LA 4KBZA 2KG7B 5T5OA 4DV1B 1SCRA 3A0NA 1I3HA 4A7ZA 5J3UA 1KYOF 4EZHA 4OX9O 2Q0OC 4QM9A 3P5BA 1OH4A 2JG8C 2H0BA 3M3EA 1VBD1 4UCRA 1MQTC 3VD4A 4WFFA 4C1WA 3KVBA 5ABJB 3LEGA 3FFQA 3VDDA 4JHTA 4FPFA 4MW8A 1PPJH 4WBBA 2Q4SA 1VQ8V 1IS3A 4WBNA 3HEIA 2E5LB 1R093 2PLV1 2IW5A 3PTRB 2VXRA 2JECA 1AR4A 2DE0X 4UVAA 3M3CA 1N4CA 2ID4A 5K0UA 3BEHA 1WZXA 4NXMO 1VEWA 4N43C 1IBMO 4P9IA 3LKJA 1RMU2 5LWBA 4A2UA 2W3JA 4FCAA 4AAPA 1US6A 1EN5A 2XKOA 3X29B 4RFRB 4XF0A 1UXXX 5J1XA 4XBNA 3ABKC 1RHI3 1NG0A 3QO5A 1YI7A 5F6KA 1L1FA 4B3SB 2Q7GA 3BA9A 1T5EA 2JDHA 4U3JA 4I0WB 2Q67A 5JOYA 2R49A 5L73A 5B1BC 5GLZA 3FHAA 4HONA 5JXJA 3PVBB 1KECA 2Y64A 3JQXA 4Y1XA 1GN6A 3IWZA 1EZJA 2UXCB 4MTOA 1ONAA 3UJOA 2X8KA 1R6NA 2O57A 4I50A 4Q4W1 4GMP3 5A7WA 3VBSA 2CH7A 2RR11 3VBHA 3Q8EA 3RG0A 4YVWB 3ZIAG 2HVJC 4GX0A 4BJ0A 3W5NA 4Q1PA 1VAVA 2XB6C 1ZZ6A 2QGNA 2BWAA 1AL0G 1RUE2 4EN8B 2RMU3 1AYN3 2E7QA 2BERA 1XXNA 1YJLA 5A7PA 4EZ4A 1TA8A 2EXHA 1WA4A 1IQAA 2A3WA 2ZE5A 2EVXA 3B8NA 2QWNB 3MF9A 1UX7A 5K9YA 5CFDA 3WG4A 4JI3O 5GLVA 3RDIA 1QJX3 1LNQA 4ASLA 3ME2A 2BBVA 3SC7X 1PM9A 1RUJ2 4XF4A 4L11A 1BT8A 2WWUA 4ZI7B 3LEKA 4J7JA 3S57A 2WRAA 2Y6GA 2ZNIA 4OYUA 1NOVA 3HT2A 4V2WA 5LHIA 1Q3EA 2ZEZA 4GUNA 4W50A 4OX9B 4CH6A 5IK7A 4BIZA 1DF5A 3ZX7A 2R32A 1W59A 2VVFA 2IXKA 1IBMB 1Y76A 4CUGA 1FNZA 1R64A 3ENRA 2JKXA 4CPBD 5FPAA 1OBNA 4TXWA 1C3HA 5A7SA 5CBFA 4GZRB 4YFZA 2QQIA 2GTSA 3OAAG 4O4LB 1VQPV 3FFZA 1ZM1A 1L7RA 5JMOA 3V64A 1QH7A 4RR3B 4G28B 4YNIA 2PUSA 4LF6B 3MIGA 5BXZA 3I2JA 3KG2A 1K8AW 4AFMA 5T5PA 4LWSA 4XAEA 4ZZ8A 3C8XA 4MLOA 4JZGA 1SHWB 4MSVA 1G4YB 2QWOB 1JH5A 3FBMA 2I07B 2G1MA 3DEMA 3N9OA 4NHKA 4XTMA 1I94O 5J2TB 4AI0A 3LA3A 5KA5A 5KUMA 2L35A 4FPOB 3RVZA 4MXVA 4CS2A 3ZN1A 3WP3A 4X66B 2ZAAA 3PIGA 1BHGA 4IEPA 1E5RA 3IIAA 1IPJA 4QPGB 3NAPB 3ACHA 1FAYA 1QOOA 1OHHG 4HKOA 3ETGA 1YQ8A 2KG7A 2QQVA 5EXOA 4HAMA 2DWRA 3I55V 3TEZA 3LDEA 4JTCB 1LKNA 1CN1A 3AZXA 3UO2A 1U0AA 4XJ9A 5C3OA 2VULA 3AMNA 3A0HZ 4GB33 2Y26A 1MZFA 5F5QA 2D3OW 5J96B 4XHXA 2OA2A 2H0VA 3R4DB 1VBC3 1W8OA 1Z78A 3VL8A 3WHUA 4BQ4A 4JI0B 3IAQA 5LYJA 1H9PA 1OCZB 3VZOA 2EIJC 1WCUA 4IV1B 5EBMC 1AR5A 4OMCA 2WZ8A 4QGLA 1V9U3 1FFXB 3JCUZ 2VBPA 5EHDA 4B1MA 2WO7A 1X4TA 2BDRA 5JR7B 4D7YA 1ZTEA 3APBA 2JJ6A 3JASB 2VECA 2DUQA 2DVGA 2X5IA 4YWAA 5LOVA 3AMPA 2C24A 5B1NA 1H1AA 4P00B 4MW3A 5CYYA 3ES4A 1WMDA 3RN4A 2GUZA 1OH3A 1SQFA 1H8HG 3ZKUA 5T52A 2V5DA 1XMQB 2P6HA 3ITQA 1ZZCA 1NCRC 1MQTA 4XF1A 4XF3A 4BQ1A 1GZ9A 3ASIA 1LOBA 5IYDO 2ILMA 4W6YA 2G19A 3CC7V 1NXMA 1UYZA 2H94A 1OQDA 2Q8DA 2PQSA 1FNYA 1W2OA 4RHV2 4AVSA 1T2XA 4EJRA 2OTLV 1VF7A 2IFWA 4WFBV 4BQ5A 1W8HA 4I2OA 4I09A 2QR4A 1FAFA 3WNOA 4QX3A 3LGRA 2J1SA 4AI1A 3CU7A 1O9GA 4XDKA 1WA6X 4IDZA 1KDKA