5KHKA

Hcn2 cnbd in complex with 2-aminopurine riboside-3', 5'-cyclic monophosphate (2-nh2-cpump)
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
201
structure length
200
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cyclic Purine and Pyrimidine Nucleotides Bind to the HCN2 Ion Channel and Variably Promote C-Terminal Domain Interactions and Opening.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 64
structure length 200
sequence length 201
ec nomenclature
pdb deposition date 2016-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5khkA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 5khkA02
3I59B 1I6XA 4ZU5A 3WW1A 2WC2A 2PHDA 3PNAA 4MX3A 4XEZA 5C8WA 5E1RA 5KHJA 1O3RA 1VR3A 4N9IA 4AVAA 1RUOA 2QNKA 2WFPA 4YARA 3H7YA 1EY2A 4QM8A 4XFAA 3ZDSA 3M70A 3RPQA 5E16A 4FBFA 4J1WA 2IXHA 4CYDA 4AXOA 3M3IA 3G7DA 3USSA 2QDRA 3LAGA 2Z69A 2OA2A 3IIAA 4LA2A 3E97A 4D7TA 1Q3EA 2K9ZA 3ES1A 1H1IA 4FAGA 4QMAA 2GH2A 3GYDA 4IEYA 1O3TA 4QX5A 3MYXA 1O4TA 4I01A 3HT2A 4HVRA 4XFHA 2PAEA 1YFUA 3LWCA 1SEFA 4META 5LRSA 1ZRCA 1YLLA 3NVCA 1WGPA 1SQ4A 4IEVA 4N9HA 3WW4A 4XF1A 5FPZA 4Q0UA 4XFFA 5BXXA 1ZREA 3HQXA 1YWKA 1L3JA 3QACA 4IEPA 4HN1A 5I91A 2O8QA 3KGZA 1EYBA 3ROUA 1XE7A 1NZCA 5JSOA 2F4PA 3D0JA 1OI6A 3CF6E 3H50A 4LTAA 3RYRA 3KCCA 2B5HA 2ATFA 2BEOA 1X8MA 1Y3TA 2IXKA 2PYTA 3DL3A 5JAXA 1FT9A 1HW5A 1ZRRA 1ZNPA 3OCPA 4HBNA 4BH9A 4ZU4A 4YRDA 1CAXB 3UKTA 4LUKA 4KL1A 1NE4A 1ZZCA 2D5FA 4L2NA 2XL9A 4MZUA 5FLHA 3OGJA 3PVBB 5I8YA 1NE6A 2Z2SB 3HT1A 3H1YA 5J48A 5KHGA 5T3NA 2H6CA 4JTOA 1Q5OA 4E2GA 1I5ZA 3CL1A 2K0GA 1WA4A 4XF3A 3FX3A 5J3UA 3BCWA 2DCTA 4I2OA 1ZVFA 3IDCB 4EROA 2PTMA 3FFQA 4Q0QA 5FPXA 5BUVA 3RYKA 3UKNA 2OZJA 5LRRA 4IEQA 4I3PA 3OTFA 2GC2A 4GULA 2KXLA 3BB6A 2GZWA 5EZWA 1ZZ9A 4QGNA 4XF9A 5CVRA 5I93A 1QXJA 3CJXA 4YSFA 4AVBA 1UD1A 4HN0A 2VPVA 5CADA 3SCFA 2CAUA 1DGWA 3H1MA 3B02A 4KWKA 4J1XA 3R6SA 4Q0VA 3CLPA 1DZTA 1G6NA 1RUNA 4OFGA 3EQEA 5FLIA 4AVCA 1O7FA 2IXIA 3O14A 3I59A 4IEOA 1LR5A 1OMIA 2FQPA 5JR7B 3H8UA 4ZU7A 2VQAA 4MGYE 1J3QA 4MGZE 4XFIA 5I0UA 2ZCWA 3LOIA 2D93A 5FLJA 4JTNA 1FXZA 5I8TA 2GU9A 3DKWA 4DINB 4XFGA 1JUHA 2H0VA 4YYOA 3DV8A 2OPKA 3OF1A 1OFNA 3BPZA 4X6QB 1Q43A 1UPIA 2UY9A 3E6BA 2ZKLA 4UBGA 5JSPA 4RD7A 5I0SA 1VJ2A 2PQQA 3QOPA 2IXCA 1J58A 4E2SA 3LA2A 3LZZA 2P17A 3D0SA 2D40A 1J59A 4LULA 3VHRA 4Q0SA 5AVPA 3S7IA 3MZHA 4HMZA 1X7NA 4NVPA 3CO2A 1J3RA 5JSRA 2PHLA 4O9EA 4I09A 4KU8A 5BPXA 1V70A 2Y0OA 3CEWA 4BIFA 5K8SA 2GC3A 3H1WA 5BY5A 1Y9QA 1J1LA 2E9QA 3UKVA 1CAWA 3S0MA 4A2UA 1U12A 2XLAA 1CAWB 3EHKA 2OYZA 4I0BA 2XLGA 3H3UA 4R52A 4EWAA 1ZX5A 5C6CA 2ET7A 4IEWA 2MHFA 2CV6A 1IPKA 1ZZ8A 1LB2A 5J7MA 2XKOA 4Z07A 2PAMA 1IPJA 3H9AA 1ZZBA 3I54A 1LRHA 5F1RA 1CAVB 4JVAA 1CAVA 5FQ0B 5LEKA 4X6RB 1YUDA 5FQ0A 2EVXA 1XE8A 4R8HA 3KMHA 1EP0A 4HVOA 2ETEA 4IETA 4AQ2A 2B8MA 2GC0A 3PLQA 1RTVA 2CGPA 3SXWA 1YFYA 2QJVA 1OD5A 1PMIA 2UYAA 1UCXA 1CGPA 5I8SA 2XHKA 3NKTA 3I7DA 1ZRDA 5KHKA 1VP6A 2H6BA 1RGSA 3H7JA 3LA3A 4K8FA 2Q30A 3FJSA 4PIXA 2V09A 4FAHA 5KBFA 1PM7A 3IBMA 4B29A 2IXLA 2XL7A 1SFNA 2HJIA 4XETA 2BNOA 4HSLA 5EFUA 4EV0A 4MV2A 4BHPA 1H1MA 3TNQA 3JZVA 3EBRA 1UIKA 3E5UA 3ES4A 2CAVA 4MGKE 2BNMA 5D1IA 1DGRA 4PJYA 4AQ6A 4WBBA 3WW2A 4H7LA 2BNNA 1CAXA 2BYVE 4HSJA 1GQHA 3EJKA 4OLLA 1O5LA 4MUVA 4ONUA 3SCGA 1QXRA 2EA7A 1QWRA 5I0TA 2N7GA 1NYWA 3NJZA 3MPBA 1CAUB 4XF0A 1RL3A 4LLOA 2Q0AA 2IC1A 2XKPA 5HI0A 3NSTA 1CX4A 4HZFA 4YNIA 1RC6A 3WW3A 4UBHA 3RNSA 4I02A 1O3SA 3C3VA 3ACLA 3MDPA 3ELNA 4JV4A 4D7SA 2GAUA 3FHIB 4XFBA 4E2QA 4QGMA 1LKNA 3N4MA 2Q4SA 1UW8A 3GBFA 1DZRA 2FMYA 4QXKA 2PFWA 4I0AA 2GC1A 4PIYA 3E5QA 5CU1A 1CAUA 3RDIA 4IESA 2PAKA 3U0ZA 3NW4A 4IEXA 4QGLA 3S7EA 3EO6A 4KWJA 4LEJA 1O3QA 5LEJA 5FDBA 4HLTA 3SMHA 2Q1ZB 3OD0A 2XGXA 3SCHA 5I0RA 1XRUA 3FWEA 2I45A 1WLTA 1ZRFA 1X8EA 3NL1A 1TQ5A 2UYBA 4XF4A 2HKXA 2OZ6A 4FT8A 2XLFA 4TLFA 3SHRA 4IEZA 2PA7A 4EWEA 4MH0E 4PIZA 5KHHA 4XFCA 2QCSB 2QVSB 2VECA 4LUMA 4LA3A 3BALA 2D5HA 3TNPB 5FCCA 3E5XA 4L11A 2MPFA 1QY4A 4KU7A 3KSCA 1EPZA 5BV6A 2MNGA 3FE5A 3RZZA 1NXMA 4F8AA 3E6DA 2UY8A 1O5UA 4Z82A 3LA7A 3KGLA 4MGIE 1J3PA 5JCTA 1FI2A 3DN7A 4EWDA 2B9UA 4UXAA 4IEUA 3D82A 4WZCA 3HIFA 3U11A 1YFXA 2EAAA 1YFWA 4QM9A 3ST7A 4Q0PA 4Q29A 2IXJA 3H3ZA 3RYPA 4IERA 3IDBB 3ETQA 2ET1A 4HVQA 1UIJA 3L2HA 4BYYA 3U10A 3IWZA 1ZZ6A 1GQGA 1YHFA 3E6CC 2C0ZA 4KWLA 4ORFA 1ZZ7A 5KHIA 1X82A 3BU7A 2O1QA 4F7ZA 4WVZA 4P9GA 3FZ3A 4O9GA 2BGCA
chains in the Genus database with same CATH superfamily
3SGIA 4HETA 4MTOA 4L8QA 1GNHA 2ZKNA 1OLMA 5HCAA 4NMIA 1J83A 5CFDC 3KKYA 5E16A 4XJ8A 2BWAA 2W6JG 5LOVB 5L9VA 1YJNV 5C9AA 1POV3 2ZMLA 1VE0A 1G86A 1RMU2 2ARBA 1O3TA 1U0AA 4EZHA 1AILA 1XNCA 1MS9A 3GVMA 4QB2A 4UUJC 2ZACA 3MIBA 1XSRA 4N9HA 2KQXA 2CNAA 3AG1C 5FPZA 4R7CA 5H9SA 4I5SA 4A5UB 2NZ9A 4X1KB 4FM1A 4N53C 2WQ4A 3OPZA 4B08A 1YIPA 3CJIC 3RYRA 5GLWA 2BEOA 2IXKA 1GICA 5FZCA 1OXCA 4FPLA 1T6GC 4Q4W3 4YG6A 4DXWA 5BZBA 2WQ8A 5F6KA 4JHTA 4KL1A 2F93B 1EPWA 3HPNA 1W99A 2F4VB 4YW4A 3O1OA 3CC2V 1KDKA 3OGJA 1D4M2 2Z2SB 4DUYO 4CPBD 4TV9A 5FPOA 3SC7X 3ASOB 4CH3A 3EMRA 1UZWA 4FOQA 3FHQA 1W6QA 4Q6GA 5LYJA 5BR8B 2JS3A 4JGZC 4KFMA 2PHXA 3PIJA 4JGZB 2RJ2A 4GULA 4XBFA 3WNLA 3LNNA 1RINA 5C8CB 4O2BA 2JDYA 5E88A 2JEUA 1R6TA 1H2NA 2W92A 4Q1RA 1GRJA 5FO7B 1XYPA 1WKYA 2E63A 2XDVA 5EYPA 1OMIA 2ZGPA 5A3PA 5C4WA 4MGZE 1KC8W 3V0AA 4QX7A 2V4VA 3CB2A 4NRQA 2VNGA 5LY1A 3W7WA 1D7PM 2WAMA 1UPIA 2DBNA 5F7UA 2FMLA 2ZDIA 4XQ4A 2YC0A 2R1DA 1OCRB 3HNMA 2PYJA 4YY3O 4E2SA 3NWKA 3ABMB 5FK8A 1FOD3 1J59A 1DYOA 3QO5A 3M99B 3K9AA 4JKMA 1FV3A 4J9ZB 5FZ6A 1EN4A 1Z7S1 4XBLA 3LDDA 3VBSC 1LNSA 3NV4A 1H8EG 2FDFA 2ZGRA 2XVLA 2XPJA 1LJ7A 4GIQA 3F95A 2DWDC 5H6RA 4IEWA 3J80N 1RUG1 5FYSA 1V9U3 1UY4A 1FXHA 4GWMA 1LU2A 2IH1C 1IPJA 1XU2A 1AJOA 1CAVB 2HWD3 1L1FA 4CEYC 3IMMA 1GH6A 4X6RB 4NHKA 3HNBM 3VBRC 3JB8A 2GC0A 5L3CA 1OD5A 5IFTA 5EJ1B 2WS91 4JYBA 4I4TA 1R3LC 1HNZO 4DK0A 4IGOA 2RR12 2OXBA 3LCPA 1VQ7V 1GSLA 4I0WB 4F6EA 2ZPXA 2VL4A 1H9WA 1EV12 3SKJE 4CXWA 2YB7A 1UIKA 2CAVA 3B94A 5LASA 2BNMA 4YFWA 4W6YA 4JI2B 5IJ0A 3OEBA 4QPIC 3H1KH 3NV2A 3DGEA 1O5LA 1ZLZA 1GNZA 2EA7A 1IKPA 4P5HA 5F6LB 3BOWA 2C2AA 1AR92 1QHDA 1DGRN 1BYHA 3KM5A 5F5CA 4XF0A 1NTMH 3OGCC 3M7AA 4DV1O 4I3GA 1MA1A 2A3QA 3WCSA 2EICA 3W21A 1JZ4A 3NMBA 3ZO0B 1ND2B 2V7QG 2XQRA 3J8F1 2XOKG 3SNMA 3E5QA 4DV3O 1W0KG 5FZAA 3S7EA 2B5UA 2NQYA 4OULA 3N9PA 1LHUA 2FL4A 2XASA 4ATFA 4Q8KA 2RMU2 4OI0A 5F2SA 1XNQB 4EEQA 2EINB 2XONA 3RWKX 4IEZA 4XE9A 5LXTA 2EILC 1W6OA 1W8ZA 4F83A 3JD72 2QWPB 3H1JH 1JOYA 2EIEA 5JDBA 4RS5B 2R16A 2KG7B 2HYXA 4TSVA 1QR8A 5EYPB 5HCHA 1W2NA 1D4M1 3LDRA 3MIEA 3FLTA 4XAEA 2MEV1 3QVNA 3AZYA 4UFHA 1R1A2 3KQRA 1K8AW 4BWOA 3CS5A 4JGZA 1GTOA 2WT0A 3V56A 1JZ3A 1BK0A 2E76B 1CX1A 3K3WA 3CJHA 1WCQA 3KT7A 3U10A 5FP4A 1THZA 1CIWA 2C0ZA 3WB2A 4CXYA 4W6WA 5F3EA 1X82A 2OT5A 4FFBA 4E2LA 2EINC 4DUWA 3AFGA 4QPGC 4N9IA 4B3MB 3I2HA 4PD4F 4E8CA 1NT2B 1AI5A 1XB9A 3M70A 5FWEA 1RSOA 1VMFA 4J1WA 1VQNV 4W4KA 5FZKA 4D7TA 4FK5C 1OOPA 3ES1A 4ZPIA 3OGVA 1U5YA 1YNAA 3WF1A 2GH2A 2UWBA 2VRZA 1PO23 4LF8O 1I94B 3RW0A 3ZMSA 3JD1A 1YFUA 2HLEA 3W58A 3ZPYA 3T4DA 4ES9A 4O2AB 1S5JA 3UGGA 5JI9A 4XDOA 3FAVB 4LBQA 3WW4A 2YGMA 1SETA 4QE7A 3EYPA 1AI4A 1WB7A 3WQ1A 3PUIA 2BSKA 5JSOA 1VRBA 4NIDA 3O7OA 2WLJA 3WSOA 2P34A 4HXCA 4UWDA 3JUUA 1LOEA 5ANNA 1SQBH 2E7QA 4CCKA 2XBO3 2V4AA 3T0DA 3UKTA 5GZCA 4JGSA 4MXVA 2D5FA 1NCRB 3ZLIA 5LA0A 4JGYA 3RYCA 1RUC3 3AG3C 1RUI1 2P06A 4AEDC 4UFLA 1JFFB 1H8HG 3PDQA 3AZXA 3UGFA 2R071 3AYDA 3HBKA 1E79G 4XF3A 5FIXA 2HWB3 4GX1A 4I2OA 4BLIA 4DRVA 1TAEA 3FFQA 3MF9A 4WF9V 2WLIA 3IN9A 2KXLA 3MAQA 4QGNA 5FO8B 5GZGA 1X9PA 2EZOA 4NXMB 1ASJ2 4HN0A 3D8CA 1DGWA 3H1MA 4MS2A 3VKNA 3AP9A 2RDRA 3AMNA 3ZXAC 2CTRA 3O14A 3IC7A 4JI7B 4DUYB 1JYXA 3AB0A 5DXDA 4S2DA 3N3HA 5J36A 4AGRA 4AFAA 1CN1A 3LOIA 4GJYA 1HP8A 4FPPA 5ITZB 1SQXH 4DINB 1Y4MA 5JQGA 1MEC1 1MQTB 2ZKLA 3J26N 5E6HA 4QHOA 5JJEB 4QPKA 1VJ2A 3VBOA 4IE6A 3BAAA 3JYCA 2VNOA 3N9NA 1YTFB 1NLRA 3LD8A 1GOHA 4L99A 2R063 4Q27A 3S7IA 1X7NA 2WNVA 2Z0AA 2A06H 3ZRXA 5L19A 3N7KA 4JI3B 4GT1A 1FXVA 1NR1A 1CESA 4CZSA 4R52A 2BU9A 1UYZA 4RA0A 1EN6A 2HEPA 4S2HA 1E1QG 5BNOA 2OCCB 4XJWA 1QKQA 3N35A 3HPLC 3CRQA 2XWBB 3SPCA 1RTVA 3ZXLA 5FY8A 3UL2A 1CZVA 5KWRA 3NKTA 4IW3A 4K8FA 3WD5A 1OFSA 3T0BA 2WJSA 4XETA 4ZXKA 1NA1C 4A7YA 5BNNB 3JD73 3ES4A 4K35A 1NH2B 5D1IA 3OBZA 2JGUA 3AYAA 1AYN2 3WNKA 3E22A 5IYZA 3MFAA 4TQDA 3LIHA 4FPOB 5IWAO 4IT5A 3OW2U 3GGLA 2E7AA 4RWUA 4ONUA 3ZSLA 1R1A3 2N7GA 1HRI2 4Q4X3 3THPA 3AL5A 2PLV2 1JFFA 4MVSA 2ETNA 1WPXA 5FOBB 5B1AC 4ASUG 4OHWA 3BTYA 1AR73 1OKQA 1RC6A 1R081 2AACA 5IVEA 1XNKA 1QMJA 1CP9A 4Y5TA 4K20A 2Q4SA 1F4NA 1PGL1 1QU7A 2VMIA 2P3YA 3S30A 1G1XB 2QQPA 2ZEYA 3POWA 5IWAB 3KF3A 4V2VA 1WLEA 3WR0A 2UU9B 1ZL8A 1W8FA 2OTLV 1HV0A 5DECA 1WZXA 2PN5A 2DF7A 3JD3A 1REFA 2E26A 4M3CA 5DUVA 3RI8A 4PIZA 5KHHA 5A3NA 1F51A 3T2MA 1LEDA 2W1UA 1SKVA 1STMA 4OMDA 1KEXA 1EPZA 5ACA2 1YXBA 3EXUA 2ITDC 2DYCA 3AP6A 4IYIA 2ZX4A 3SJAC 1O5UA 5F5AA 5JZGA 2LTNA 1ND2C 4UXAA 3I3EA 3C7OA 5HFLA 4GB31 3FYIB 5L7OB 2HFEC 1SLCA 3AZVA 4UV9A 4OI4A 1ULEA 1VQ5V 4H3WA 4Q29A 4XXAA 2Z5UA 4HVQA 4JYAB 1WNSA 3E6CC 3QNEA 3NV3A 1WP7A 1HRV1 2RS33 4YW5A 4YFZA 1KD7A 1Q81W 4ZI7A 1QJEA 2V5DA 1O3RA 2VE1A 1M06G 4DUVA 2YIAA 4J25A 2LW7A 3GZUC 4X1YA 4P9JA 2RM22 3G7DA 5K0UA 1W0PA 2OYQA 4JDNA 3P6BA 3UT5A 3ASIA 2Q7EA 4CH4A 1AL21 2ILMA 1ZM1A 1PIV3 4DRRA 2LFRA 1SLIA 1BCCH 5E89A 2ZDIC 2YY1A 4META 1UO9A 4JI4B 3STZC 1SQ4A 4YXWG 2YICA 1JA8A 1QVFU 4FLWA 4CP9B 1AYM3 3IZOA 3RZJA 2LW1A 1T6BX 5FUIA 1OI6A 5KC5A 1PNMA 5KXBA 2WO2A 2DW4A 4AGGA 1H8VA 3B5LB 3OUFA 2LGQA 1QJY2 2E53A 2ZJCA 2PYTA 5DN2A 4CTEA 1HLCA 4HOOA 4HBNA 4MW3A 1ENVA 4RUEA 4RQEA 1AROP 1UX7A 3I2OA 2W87A 3TBDA 4I50A 2HYKA 2VBDA 4DK1A 4R4XA 3TEWA 3CMAV 1UY0A 1BQ0A 1MVQA 2DURA 4PLOA 3FX3A 4NHXA 3I2DA 2PTMA 4GKJO 1QVGU 2WFF1 1HXS3 3D4KA 4DFSA 4IEQA 3VZKA 3TXQA 2DQ0A 1S2BA 3BYWA 3P32A 4UW6A 5C93A 3DXRA 2VMCA 4FTBA 5DDJ3 3SCFA 1PL4A 5A2QN 1J5EO 4XZPA 3I59A 1LR5A 5C4WB 4ZI7B 3K9SA 1S72V 3CCEV 2A3YA 3A7QA 1FXZA 1PNFA 2PHWA 3WUDA 1GR3A 3M3QA 2ZKOA 1VRH3 5IJ9B 4X64O 1UZ0A 5I0SA 3STLC 3HKEB 3POEA 3D0SA 4AFDA 2LQTA 1UZYA 2DTWA 3VHRA 3VGIA 1N0NA 4UFJA 5FMDA 2X8KA 2WAAA 4ZHQA 1ND3A 4X8NA 5JSRA 2PLV3 4BIFA 2YPJA 1VBB2 2F43G 2QM7A 1SZXA 4JC1A 2KA3A 3SYCA 1RXFA 3VBFA 1AX1A 2DYSB 4GALA 4JZRA 1RJ7A 3ZVXA 4X66B 1IPKA 2W91A 4YW2A 2XKOA 3QH7A 2QKCA 4E4ZA 3VBUC 3TEXA 2QBXA 2RDQA 2JIZG 4XPVA 4YWAA 2X5IA 5FZMA 1O4ZA 3NJVA 2CTVA 1XNRB 1JMKC 2H6BA 1XHZA 1N34B 3S5QA 1BHGA 5M0TA 3MV11 3TEYA 4L97A 4N43B 1G6UA 1YI9A 5F5QA 1AR63 1VEWA 2VBPA 3MICA 2QEXV 1OJHA 3KT1A 1YVWA 1ZA4A 2BGPA 3BU0A 1OQDA 2WO1A 3SH4A 1RUJ3 1MQTC 4QB1A 5LOVA 5F2WA 2UXCB 2PQSA 3MPBA 1CAUB 5EJ3A 1KKDA 4MHRA 4BK4A 1LGNA 3OG2A 4RR3C 2IC1A 3MW2A 2XTAA 4PDVA 1AR91 1CIYA 1HQNA 1LOBA 4CCJA 1WBLA 3ME2A 1T5EA 3BTXA 2QZ2A 1XBLA 1EUTA 3ACIA 3VBHA 2QQNA 5KC6A 2EF6A 3FHIB 4MXWA 3N4MA 4FPGA 1VRH1 4PELA 3AXEA 3GBFA 4DR7B 5LXTB 2ZX1A 3I8TA 4M3CE 3O0VA 2G1MA 2LP7A 2Y33A 3SISA 2UWCA 4I0XB 2A0LA 1IKQA 5T5LA 1ZSPA 2Q1ZB 4OI1A 4PDRA 4P02B 1UKGA 4GWJA 2GNTA 2N04A 3APQA 4F6RB 1APNA 3AL6A 1R73A 3ZN6B 5L7OA 2PA7A 2WNUB 2HP8A 1S4CA 3K08A 4XUPA 1P8JA 3BALA 3IKWA 1WMXA 3THCA 1FFXB 1UYXA 4YJ2A 2MPFA 4Y1ZA 4LBEC 4AG4A 3VKFC 2Y6JA 5BV6A 5IE9A 3K77A 1P7GA 1ZL8B 2ZAAA 1VBE1 5F3IA 4Y1XA 5EC2C 3E6DA 1D0HA 3DYOA 4OZOA 2UY8A 1DYPA 3AC0A 3LA7A 4KNCA 1FI2A 1GM9A 1K5JA 5D5PA 4CC6A 1XOUA 1QJU1 1O8PA 3LPFA 2UUAO 4RHV3 2EAAA 4QM9A 4Q0PA 1BS3A 3QD6A 1AJKA 5DAQA 3GALA 3M7MX 4COVA 1FNYA 2HLDG 1VLNA 4ORFA 4BOWA 5IVYA 3FBMA 2DCYA 5CG8A 4WVZA 3IC9A 2G38A 1UX6A 1LHOA 2CY6A 3B9IA 1OOPC 3WW1A 2WC2A 3WP3A 1LAJA 1IZ3A 3WDYA 1ND3B 1H8TA 2OIGA 3D3IA 3RZMA 1VBD2 4RSUA 3OPWA 1RUOA 1HDJA 1DQ2A 4AHWA 4IQPA 5T55A 1K45A 2P6JA 3H9VA 4Q2FA 2P37A 3SLIA 3RZLA 4D7YA 4PHZA 1LESA 4W65A 3I4IA 3HT2A 3PUSA 5JZGC 2JDZA 1C5HA 4LE3A 1LR1A 1W2TA 4WBNA 2UXXA 4IEVA 1XEQA 1CXZB 3UV9A 4XFFA 1R093 4Q0UA 5GZDA 1K4CC 1W0NA 2X53S 2C26A 5K9YA 4CDQC 2VOVA 1TVKA 3ZYIB 3QLQA 4FPEA 4QX2A 3LSSA 4FTSA 5C7GA 4IYHA 1F9KA 1K5MA 4M3CF 3CRCA 3HKBB 1WP8A 1NZ6A 1SQQH 1JTZX 2BTVC 2WZEA 2QKDA 1WD3A 3T09A 1NQTA 3KZIZ 1S0DA 4E4DX 2ARHA 1JZ7A 2E6VA 4P9IA 4DV7O 2DVFA 2QQOA 1V55B 2X6CA 4WFHA 2VD7A 2DUOA 1YO8A 5EHDA 2VVEA 3LFIA 3U14A 2ZZQA 2YDEA 1WMFA 3C3SA 3T2QA 4GH4C 3CBNA 4YHHO 4CCMA 3OTFA 4FCAA 2VMFA 2D3PA 3MHZA 1PKXA 5LATA 2RS12 3KCYA 5JPNB 4AI8A 1S2EA 4P9OA 4Z1VA 3VBFC 3R6SA 1RUNA 1XQNA 5CA3A 2ZGUA 1A8MA 4LBQD 2OT7A 3H3LA 3PUQA 4RS5C 1SBEA 5FMCA 5KMGB 3MGUA 1C5IA 2VR4A 4EN8B 3VZJA 2W1QA 5F3GA 4UXNA 1UOGA 1NTZH 5JUVA 1M57B 3U07A 3A22A 1OH4A 5EPAA 3B01A 3U4SA 4DV7B 2V73A 3RZHA 4NHLA 4XTMA 2Q73A 3CX5F 5GONB 3OD4A 4NVPA 1G8MA 5CKQA 3HJRA 5BPXA 1K7DA 4B1MA 5FYHA 5B5EZ 4M01A 1Q8PA 3AG7A 4CS2A 5ANQA 2QQLA 4B4RA 2XAGA 2CV6A 4FPKA 2QTSA 1U5XA 4Z07A 3B3QE 2FDGA 1KECA 3BHPA 2Y8KA 1OLQA 2Y34A 3KVAA 4L87A 3JD71 4CCCA 1Z0HA 3NJYA 4F4LA 4A4AA 4U7NA 4QKFA 2D3SA 3B69A 4AQ2A 4IETA 3K06A 3L2YA 1OPMA 2CGPA 1F31A 2DVBA 1X36A 4JI1O 3O12A 4NXMO 2Y48A 5LMUB 1A78A 3H7JA 4FTEA 3LA3A 3TK1A 2X09A 4XIOA 1PM7A 1O91A 2IXLA 2HJIA 1ZBE1 3T0AA 4HSLA 4MV2A 3VBUA 3VQYA 1Q6UA 4QNHB 4MGKE 3O1MA 1UY3A 1V6MA 1TUBB 1BXHA 4H7LA 2DUPA 1UN1A 2RVAA 4N90A 2VY0A 2XBO2 3SYOA 1KQRA 2F95B 4B8EA 4LO7A 3WV6A 2JECA 2Q8OA 1LODA 3C90A 4TV9B 4NHYA 1HXS2 4P5YA 1VBC1 5IY5B 1YQ6A 4SLIA 2Q7GA 4I30A 1CX4A 1UJWB 3INAA 2WLPA 1Y74A 3O5SA 3OTOO 5L3EA 4E2QA 1S77D 1W2BU 2UXNA 4ZY9A 4PI0A 2RS51 2WZR1 5IJ9A 1W9YA 2F23A 4AAXA 3FB5C 1FXKA 2QWRB 2VOTA 1KDMA 1D2DA 4EJRA 1RM1B 2B39A 4PA6A 1US2A 3OD0A 4NRMA 2UUBB 3VKOA 3FWEA 4F6RA 1WLTA 2HKOA 3KZ4C 1IS4A 2W5FA 4QDQA 5C5UA 1LTEA 4CDQA 1J84A 2DU0A 3ZM8A 1RUH3 4WFEA 5JQGB 3A8TA 1XNTA 1XE0A 3L73H 4L8JA 1LNQA 3RZZA 4BJ0A 1MG1A 3Q4HB 2FMDA 1K5SA 4AR2A 1KP2A 4GYCB 3ZN0A 3LB9A 3AZZA 5IDJA 3DPRC 5IFPA 2FBEA 4LE4A 3HIFA 3IGAC 2D6OX 2VCBA 3POJA 4ZZ5A 4YM3A 3RJRA 1OC1A 1QOOA 5APAA 1JXNA 1WJZA 4D6SA 2BGCA 1FFTB 3WHUA 1NXD1 3HKDB 4XEZA 4AHCA 4D6TH 1VF6C 3ZDSA 2Y4UA 2R0HA 1IBMB 3JALB 5H9QA 3ENRA 4JQRA 4B1LA 4LPLA 2WWUA 2QDRA 4HAMA 3ML0A 1JBCA 2QJ1A 3V64A 2JENA 1H1IA 4EZ4A 2OX0A 3GYDA 2J7MA 3PUHA 5C8CC 4CDXB 4TV8B 4LKDA 5A3WA 4TV8A 4FSJA 1NBMG 4BB3A 4FLVA 1KFXL 1CONA 1EV13 5BXXA 2BWCA 1JX9A 2A6XA 3TAYA 2WO3A 1EUUA 3HR0A 4YW3A 4CC5A 4NUBA 2RMU3 5FMOS 1Y76A 3PMEA 2ZGOA 5LA9A 2WLLA 3B2EE 2IWGB 5AC92 1VPHA 3VKLA 1ZNPA 3JCIA 4NOTA 3T30A 4OXSA 1SDWA 4C1WA 5CBFA 1Y66A 1QCEA 4OHYA 4LO6B 3BKZA 3PVBB 1GKFA 1YJKA 4CP1A 2WIIB 1FMD3 5FV3A 1BSMA 1I3HA 4LR4A 1Q5OA 1I7FA 1W9FA 1CJPA 4NN0A 3I2JA 2QQJA 1H2KA 5JMCA 2OUHA 4NO4A 4G4FA 2VWKA 2CGNA 2VZ3A 2FZ2A 3RRDA 1OA4A 2ZHMA 3UKNA 2J1RA 5LRRA 1AVMA 1NCRA 2GC2A 2UWAA 2Q8VA 2HWD2 3USUB 4YSFA 1XILA 1KFUL 3A21A 1AR83 2JE8A 3IJ4A 1DP0A 3OBRA 4OFGA 4WFFA 3KLSA 2R061 2E3CA 3RI9A 1KJLA 1FPN2 5JZGB 3VQWA 5JJJB 2OQ6A 4LF5O 4AFBA 1C8M1 4JTNA 3U1XA 1L7RA 4R8CA 1FV2A 5C8CA 3J8F3 4HNAA 4ARXA 1DLLA 3E6BA 4ZS3A 5IT9N 2GUZA 1DG6A 4X65O 3MV01 1AL22 4RQPB 3ZYPA 4BIUA 2HVKC 4IV3B 1KP3A 1W9TA 1W6NA 4LULA 2JDMA 1R64A 5A7QA 4N53B 5TISZ 4I09A 1NY71 3THOA 1Y9QA 4Y1VA 4N8MA 4CEYA 1OCZB 4DV6O 4O4HB 3E2EA 1COV2 4LF7B 2XAJA 1OA3A 2ET7A 1YIJV 1IQAA 2VW2A 1YI7A 4CA9A 3CCVV 5FKBA 3L9JT 2CH7A 1CR7A 1SESA 3BGAA 2R073 5FQ0B 5LEKA 3G67A 1JJ2U 1JOPA 1W8WA 2HJFC 2J1VA 1DGLA 3AK1A 3SXWA 3WINE 3CEIA 4JI6O 2XMLA 4JI5O 4CEWC 2QQWA 4CP2A 2VZTA 5LK7B 1VP6A 3VLBB 1F4MA 2F4LA 1JPXA 3DSQA 4D69A 1IOAA 2JB4A 2ZCEA 3WP6A 3VN4A 3GJBA 4EV0A 5GM0A 4NHMA 1JYCA 3WY6A 2BV4A 3AJZA 3BIEA 1CAXA 2VBBA 1S0CA 3UQ8A 1RUG3 2BP6A 3DXRB 1YEWA 3WNNA 2NN4A 1LHWA 5T54A 1BZKA 3IPVB 2W0XA 2PMWB 5LBQA 4CCEA 3TEZA 2VULA 2R1BA 4L0PA 4TTGA 3E89A 2ADQB 2XH6A 5JIAA 5HI0A 2AREA 3HOBA 4LHSA 4Y5SA 3OEEG 1UU5A 1L7QA 3FAVA 3M8AA 4BZ4A 5IVJA 3W7SA 3BOPA 1FKAO 4JI6B 2AZ0A 3HAGA 4Q4Y1 1DZRA 3QBQA 4PIYA 5CU1A 3EO6A 2HWC2 4FQZA 1AYN1 2X05A 5BNNC 1SG3A 5FDBA 4DR5O 1A32A 2JXAA 2LFSA 1QR9A 3H8XA 1XOYA 4XF4A 5LP6A 1TMF1 5EP9A 2XLFA 3RJ2X 3CDZB 4EWEA 1OUSA 1AR81 2WSVA 2QCSB 2WDBA 2ZIOA 4MT8A 4NAOA 1RVF2 1WW4A 2LROA 4Y26A 5FKCA 4O4JA 4AFMA 3UESA 4QKNA 3DYPA 3J7LA 1JYTA 4E8DA 4E9KA 3D82A 3HQUA 4EFBA 4CH6A 3U11A 4LNUB 2F1MA 4YW6A 5CN0A 1W06A 1NY72 1R3IC 3BIWE 3ETQA 3Q8FA 5HPOA 1CPMA 4AWDA 5A80A 1NU1H 1YHFA 1S5LZ 3ZJZA 5LK5A 4WVVA 2WZPP 2KG7A 3BU7A 2O1QA 4FPCA 1POV0 3KT4A 1WMDA 3WXPA 5FTTC 3I59B 3QO7A 4LC1A 5FYMA 3J81N 4AEDB 1AJQA 2YXYA 4AVAA 4AHYA 1EY2A 4QM8A 4O61A 2ZNIA 2YZ4A 1Y67A 2VH9A 3ABLB 1BBT3 4YVSA 3ZMVA 2DMXA 2R7EB 4LOTA 2LGWA 4XMIA 5FXXA 4D3WA 1IHMA 2JIGA 1KQSU 5LBFA 4COZA 2VQFB 5IUQA 1S0VA 4UV8A 1N3QA 4M4RA 4JGYC 3MIDA 3JD2A 2JWPA 2ZMKA 4DPNA 4AOCA 3CPWU 3SYPA 4XDPA 3N9QA 3JAWA 3ROUA 5D8AC 2F4PA 3SPIA 1N1TA 1WA6X 2J1EA 4XUOA 3L71H 2HWE1 2ATFA 4YZ3A 2XVGA 1QJU3 2PHUA 1ZRRA 2R041 5FPAA 1FPN1 1LOCA 1LHVA 1OCCC 2Y6LA 4L2NA 4FXGB 3H1YA 5LB6A 1S1AA 2FKXA 2BOJA 2M6YA 4CSWA 1IPSA 4DUZB 2HR3A 4DV2B 4DRXB 2WQZC 2IFRA 4Q4V1 4BMEA 5DUUA 1NA1B 2E32A 2PHFA 3BCWA 2QQKA 2VTXJ 4H33A 1YSCA 4FZ0A 3DC5A 4EN0A 1V9U1 5SV8A 5B66Z 1TNRA 3R4UA 4QPGB 2ZABA 1OA2A 2P3JA 1D2SA 2DCKA 5DQ0A 1PZ9A 1IS3A 1DFQA 2W47A 1NH2D 2DYRB 4LF7O 5EK0A 4YZ5A 3LFMA 4E4SA 4ZHNA 2Y69B 4DS0A 1AI6A 3ZXFA 5H9PA 2D2CB 3E35A 4KGQA 3IB3A 2YPDA 2P5OA 2CAZC 3H1HH 4J42A 4O7XA 2ZCWA 5ITZA 2VMHA 1UOFA 4PDLA 1Q8SA 3OBTA 1VMGA 1UOBA 1PIV2 5H5NA 1UXZA 5BNPC 4UBGA 2ORZA 3QOPA 4I55B 1VBD3 2XJSA 4DR6O 1LENA 2XVKA 1V6JA 4U7OA 4JKKA 4HMZA 2VMEA 4UFIA 3CP1A 2DVGA 4P9GA 3T2OA 2FDKA 2ZX3A 4G28B 4B3RB 5EJZB 3ZMUA 2QA4V 1DYKA 4WFBV 3RS6A 3Q8BA 1CZSA 2VNVA 1LB2A 5J7MA 3AG3B 3RYFA 4AK3A 1RPRA 4GZ9A 2CH7B 1G9AA 3VBUB 2Y4TA 4BXSV 3OBAA 4DV1B 1VMJA 4CDWC 1NCQA 4B4PA 3CCRV 2QQVA 3VHPA 1I9RA 4XAAA 4URTA 2ENRA 2VW1A 4GB32 1BVVA 3KV6A 1YYNA 2R72A 4UVCA 5I0DA 3ATGA 2XJQA 1R3JC 4K0KB 1SFNA 4DRXA 1HRV2 1BKZA 5E79Z 1HW7A 2QWOB 1C3HA 3SYAA 4XQDA 5D8AA 3JARB 3N2GB 1DGRA 4K1YA 5KR7A 1JN2P 2UURA 3SQOA 2BNNA 1GWLA 1TUBA 2VCAA 1ORQC 2IJKA 2H3OA 2Q1MA 1JJOA 5EBMC 3K57A 1GK9A 1QXRA 4CCLA 1QWRA 1TA8A 2GNBA 1HNXB 5CFCB 5JH7B 4Y20A 4IV3C 1TUEB 4QXCA 4U3JB 5K0UC 5F8PA 1KGYA 1QJFA 1GU3A 3AKQA 1B09A 1POV1 1VBA1 1JZ2A 4UF0B 3VBHB 4GMP3 3OUSA 1R083 4JV4A 4LK7A 4N43C 4JZGA 1G7YA 2YUAA 1ENRA 3BA8A 1IXMA 4FP2A 3N27A 1Q8IA 5KA5A 3ABKB 1SPPA 1S0GA 4FFKA 4EE2A 5L3GA 5IHRA 2W39A 3J9SA 4BW5A 2E7TA 4KWJA 3P3NA 3MLJA 4GKYA 3SCHA 3WDUA 4N21A 4C0HA 4YIOA 5D21A 3ZDVA 5KUMA 3SHRA 2YS8A 2EIJC 4JI1B 4Q4W2 4YY3B 1K42A 2GP3A 4YGCA 3WQBA 2YUEA 2D5HA 2Q4PA 2BDRA 4RS5A 3WG4A 2LRPA 5A7WB 3VZLA 1TME1 3AMHA 1VRH2 1JU3A 1GZWA 4DYLA 3MF6A 2ZTNA 3HWJA 5IT6A 3WU2Z 5EBWC 2ODMA 2RDNA 1XL4A 1OT5A 1RUH1 2JDUA 3PN1A 1S2KA 1V6LA 1GWMA 2ET1A 2XAFA 4FM2A 2QQIA 1ZZ7A 3VD5A 1W6MA 1V54C 4DQAA 3PNAA 4N53A 1IBLO 2YEVB 5KHJA 1NZIA 1XNAA 4AEMA 4FBFA 3VBRB 1KITA 1OOPB 1ZBA1 1AX0A 2GUZB 1VARA 2WZ8A 1GMGA 4FAGA 4P9YA 4EB6B 4QMAA 5GW7A 1OQEA 3L75H 3BABA 2K46A 1COV3 3LWCA 2AGAA 5FLXN 1GFF2 1XL6A 2VMDA 2W9XA 1BHAA 4XJ9A 5IVFA 4CP9A 4OHXA 3UO2A 4ISRA 5CBHA 1LU1A 1XE7A 2ZXQA 5DUXA 1VBE2 2ZINA 5LHGA 2O0OA 3J7MA 2OW4A 3KCCA 1HN1A 4TUYB 5JPMB 1B6QA 3OYWB 1HJFA 2RJKA 5A7OA 1M4UA 4NXNB 3AMPA 3LDEA 1AR1B 5LHHA 4HK9A 3KWVA 4XJAA 4JRLA 4AQYB 2FDHA 4BH9A 4ZU4A 1OHHG 4OUMA 4XHXA 3ZRWA 5LW9A 3T4VA 3S5AA 1DDLA 2OWOA 4PLNA 4X9QA 4TWTA 2B4KA 3TB0A 1QQP2 1CD3G 4E2GA 2EXIA 3P5BA 4JCKA 5FNVB 1RUI3 4PBOA 1VAVA 4NE9A 3ZMOA 1GBGA 2PELA 3LSEA 3JU9A 4NPLA 3WUCA 1DIWA 5JOYA 1DF5A 3KQ4B 4P9XA 5EZWA 1ZZ9A 4XF9A 4B4QA 5I93A 1N4CA 4DV5O 2YI8A 1PO13 2VPVA 5A7PA 1DZTA 1BZWA 2C4XA 3WF3A 1OCZC 1C1LA 3I56V 5IVVA 4K3AA 4BCUA 2K1EA 2X29A 2W0FC 2FQPA 5JR7B 4XJUA 2G9ZA 1H4GA 1PD3A 3I2FA 1LGBA 2JKXA 1RHI1 1PZ8A 1JUHA 4CU8A 2BE3A 1JYIA 2ZE5A 2H0BA 1PMHX 3RN4A 1BL8A 2BBVA 1M5IA 3CMGA 1V0AA 1WCKA 4XJZA 1C4RA 2A6VA 3CO2A 4NJ4A 5JVVA 3HKDA 4GH4A 4KQ7A 1WN7A 4C1XA 2E9QA 1UPGA 4CE8A 2Q9LA 4ES8A 2XLAA 3UKMA 1HB4A 1TE1B 3EHKA 3L70H 2CWSA 3OMAB 4JV5B 3LDBA 2R0FA 4EYUA 1GAXA 4OPHA 1JYVA 5HFMA 2RN9A 2A6YA 3J7HA 3A0NA 1C1FA 1PX4A 5CA6A 1OVPA 4OX9O 5GZEA 1W28A 4X1YB 4OQ8A 1CJDA 2PHTA 4ZOLA 5BMVA 5IYCO 1CGPA 5I8SA 1OUXA 3I7DA 4ZONA 1YJLA 2Q69A 2GP5A 1PNLA 4QXHA 3R4SA 3VDDC 1FAFA 5J2UA 1D2QA 1MACA 4PIXA 4FAHA 3AKSA 4H14A 5KBFA 5LWBA 1E5HA 3I3BA 2DFBA 4MOAA 4E4HA 4QQPA 1H1MA 4KI5M 2WLLB 3KB5A 5FP7A 3APOA 2OQ7A 4UFKA 2XNDG 2ZEXA 1P7BA 4NAMA 4FLYA 1Q8OA 5EYXA 3BUCA 1ENXA 2CDPA 1R091 4QX0A 2MW2B 5FY7A 2ARCA 1YDXA 2X5IC 2RNBA 1MEC3 3POGA 1HB2A 4LKSA 3C2UA 1N32O 5EWSA 1NCQC 1K12A 2WAOA 4UBHA 4NR1A 4XXPA 3VDDB 3MI8A 3NAPC 4HONA 3ACLA 5L36A 1GUIA 4TZDA 2QFEA 3N2KB 1LGCA 3ZXGA 4XFBA 3ETDA 2EX3A 4PDMA 4M00A 2CTPA 3N7MA 1I1EA 3ZKYA 3E8BA 1DF0A 2X0LA 4QXKA 1WPBA 2JE7A 4TOIA 4X1IB 4NTYA 4L92A 4MVUA 2W08A 3GZTB 1RUD1 1QH7A 2I45A 4CUGA 3R65A 2DYSC 2HWB1 2XT9A 4QPIB 1AXYA 3ZSMA 2HKXA 1W04A 5FZHA 2GV9A 4XFCA 2QVSB 5FZ0A 4AI3A 5H9RA 4YJ2B 5FCCA 4KU7A 3B7MA 2RCVA 3MHHC 2JVDA 1GN4A 4DZGA 3VKMA 3T2PA 3ASOC 5FBJA 3WF0A 1W90A 4IUGA 5F32A 4CDWA 2WABA 5A9GA 2X6BA 3P3PA 4DV6B 2ZGMA 1S0JA 4OZXA 4J6GA 3T1YO 1L8DA 1VQ9V 4C91A 1O9GA 2HWB2 1LOAA 5LMNO 2R9AA 1VF5B 1BQPA 2LS6A 1VQ4V 4W6XA 2W95A 3JQWA 3VZNA 1GMMA 3MBWA 3EFFK 4XCAA 1ZZ6A 1VBC2 4U2AA 1V00A 3HKEA 2ZGTA 4D94A 1XYOA 3UNPA 1I6XA 5FYUA 1QJY1 2Y6KA 1AR4A 4CBCA 3QG5A 1AF9A 3R05A 3Q8CA 3H7YA 3OM3B 2WLQA 3ZXDA 2HH9A 3GJAA 3M3IA 1P4RA 4Y1UA 3BTAA 1H2MA 4UCOA 1N0JA 1DGSA 1BBT1 4J41A 3C7FA 2ZEWA 3ILRA 4LFCO 5JH7A 3LPGA 1GANA 1OURA 2GDSA 4I01A 3N9LA 4A42A 4LBOA 4YLZA 3HNYM 1V6IA 5DDJ2 5LRSA 5FP8A 4X62O 3K5NA 3ZSEA 4UF0A 1YZBA 1QLNA 1UFIA 3QACA 5I91A 4G9SB 3FL7A 3AEIA 4MTGA 4LQRA 3POSA 1URXA 1AR61 4PDWA 1QJX2 3HKBA 1GLHA 5J2TA 3GM8A 4FI9A 4Y33A 3VQXA 4CVUA 1KUQA 2RG4A 1Y3TA 1FT9A 3WVJA 3GCWA 2XJUA 1IBLB 1XNBA 3JSNA 4X89A 2ITCC 3APBA 4YRDA 1B35B 1HRV3 2XB6C 1XMOB 4MSWC 2A6WA 3ZX6A 4C7UA 5J48A 2VVDA 4P30A 1RVF1 3X2QC 2ZIMA 4BXFA 1FJGO 3AKPA 4XHBA 1VF7A 2Z42A 5JIUA 1VBA2 3OT7A 5F39A 4EROA 2GSYA 4BQYA 4X20B 1W0JG 5DAWA 2RS11 3ZFEA 1DQ5A 1WLCA 4DY5A 5DUWA 5ACA3 1AXKA 1Q6IA 3CMEV 1MZ5A 1V9PA 3ZFFB 3NQHA 4XZUG 4AVBA 4XBNA 2JG9A 2WR9A 1R082 4KWKA 4QXBA 4N7IA 3OEHG 1DU3D 1GN6A 1MS8A 2BTQA 3VL9A 1US6A 3B8MA 2A73B 1DHKB 3T1CA 4XFIA 1KD1W 4UCRA 4AEDA 1EV11 4H2AA 4YJ3A 5I8TA 1PO22 1NLQA 1JW6A 1XC6A 3ASNC 3G6EV 4TLGA 4AW7A 2JJ2G 3F7VC 1MS5A 3CD6V 2KD7A 4XUNA 3LZZA 2VAUA 4DV2O 1VQPV 2AHZA 4Q4Y2 4CDWB 1W03A 5GONA 2DU1A 4JRAA 4BR6A 3RFRA 1PO11 1J5EB 3JXSA 4FLZA 2VGDA 1G4YB 4LFCB 3B00A 4XCBA 3KS7A 3M4FA 2MHFA 2A75A 1LCLA 2ZGSA 3TN91 5F9TA 5KUKA 1YC61 5F1RA 4CDXA 3WF2A 4TWKA 1SF9A 4YVWB 2JD4A 4HVOA 5D8AB 3ZRSA 1W8TA 2YYOA 1ULGA 2VO5A 5A6QA 3M3OA 3JAWB 2Q8EA 1W8NA 4A6OA 3IIIA 1RFYA 2AC1A 4B29A 4TUYA 5J1XA 2TBVA 4BHPA 4GUNA 3E5UA 1EAH1 3VOUA 1YITV 5HCBA 4MADA 5AC93 1FXKC 3EJKA 4EFEA 3PJQA 1PHMA 5LL6Y 3ABZA 3K5OA 5A7NA 1D5NA 2JG9B 2UXBB 4YW7A 2G4IA 2B7YA 4OVEA 1SC5B 4MVTA 2BTQB 2XKPA 2JDKA 5CA0A 2GTSA 3AM2A 4B3MO 1Y74B 1AL23 5DEDA 1KXGA 3LF7A 4QGMA 4CXXA 4G2KA 4AQSA 1VQKV 1MQTA 1AP5A 1YJ9V 1AVBA 1HNZB 5A6XA 2PAKA 1FYJA 2DFCA 4CH5A 3PU3A 3ZFEC 4AHXA 1XMQO 2UXCO 1V6OA 1YJWV 2WLMA 2Y69C 4HLTA 1MOFA 4MGTA 3OAAG 1PV0A 4AZZA 1BCXA 1RMU3 1M90W 1QBZA 2E5LB 1GZ9A 4WVMA 5GJ6A 4X64B 3ORJA 1EAH3 3DEMA 4O65A 2WN2A 3S3XA 1UMZA 1WLDA 1SCRA 1NTKH 3AMMA 3ZYJB 1XNDA 2CHHA 1CQ9A 1R092 2OUJA 5J9PC 3JD4A 1W6MB 3WDVA 3ETEA 1W6QB 5F3CA 1UPSA 1J3PA 3I97A 2Q6AA 1GZCA 1QJX3 4LNUA 4BQ3A 4WZCA 2IFWA 4FPYA 4LBLA 1J95A 5BY1A 5A32A 5HXMA 2YROA 1IVSA 3ZN4A 3F7YC 1RUC1 3RYHA 1GOFA 1UIJA 5EC1C 4KHPB 3F2ZA 1M93A 3N36A 3BVOA 5FBZA 1DZQA 1NCRC 5EIBC 2XBO1 3ITQA 1H2LA 4GJZA 1W8OA 3CRAA 3PUAA 4J7JA 4CU6A 3B77A 4Q4V2 5FXWA 1JZ6A 4CYDA 2QDNA 3UT5B 3I3QA 1U96A 1OCOB 5C3PA 4B3RO 2ZHNA 4PDWC 4X8AA 2CGOA 3MO4A 2Y0PA 3MHSC 1QOTA 3MYXA 4Y20B 1LOFC 1XMQB 4PQ9A 3H42B 2CYFA 4B3TB 3U4XA 5BNNA 3VD7A 1ZBE2 1HNWO 3K58A 1WGPA 3T1YB 4DW1A 4IHJB 2UXDO 3JSLA 3AKTA 3D0JA 2QM8A 1KRIA 5DAVA 4ASMB 3WNMA 4S2FA 1RUG2 2B5HA 4QHBA 1NOVA 1SMVA 1AL0G 3NJXA 1OLRA 2Z3YA 2VOKA 3RYIA 2BTOA 4LUKA 4UW5A 4AQTA 3DPRB 5IWFA 1NUKA 5FY1A 5I8YA 4JHZA 2WT2A 3A0KA 4MYEA 2CDOA 2W1SA 3PVOA 2GBOA 2ZX2A 1WA4A 2YU2A 4FVMA 5D2AA 3E1F1 3VDDA 3B4SA 2AENA 2BOIA 5LYJB 4DR4O 5ERLA 1UKRA 3T3YA 5FZ9A 1BEV2 3CCLV 3VBOC 4YVSC 5AVAA 1G6NA 5FNVA 3GB7C 1CWPA 4FFBB 3UT0A 2AZ2A 3ZHQA 2VZQA 4Z2AA 1YF2A 2P4VA 3S57A 3H8UA 5CA0B 1BK1A 2YI9A 1ULPA 4CDXC 1RHI2 1FJGB 1JYWA 5IK4A 3WB0A 5H2FZ 2Y0IA 2YSUB 2XHNA 1WUVA 4UAPA 3KF5A 4DR2B 3DKWA 1MSWD 4UI9L 3OF1A 4S2GA 1Q43A 1FD9A 3VB9A 4WM7C 2VXRA 3ZN5A 5JSPA 5G05L 1EZJA 3CZUA 1XI1A 5LBEA 2D40A 5LA2A 2YFZA 5AVPA 4LITA 2QTOA 2NYYA 4QQOA 2HG5C 1MS0A 3AG4B 2VM9A 1OCRC 1TZOA 1Y43B 2YV8A 3JASA 3WLUA 2FCVA 3H1WA 5F5IA 5FYVA 3ZXEA 1CAWA 1BMV2 3HKCB 1AXZA 5DAPA 3VHOA 1XXNA 4B3TO 1US3A 2RM23 4LBNA 2F6BA 2W68A 2Q1FA 5FYYA 4Q4V3 1D5AA 4FFFA 4EN7B 3OSDA 3MFCA 2DVDA 2ORXA 4TXWA 5FK7A 2VZSA 5GTIZ 2QJVA 3CNAA 3WDTA 1W39A 3G6BA 1NQJA 2BSKB 3FUOA 3FLPA 5ISLA 5K7PA 1AYM2 2WA4A 4XW3A 2RV9A 1SACA 2D6MA 2BNOA 4N7UA 1R1ZA 3EBRA 1RUE2 1H38A 2WYFA 1MS3A 2YC2A 1MS1A 1D4VB 3T4ZA 4JQTA 4DV0O 1GQPA 4K40A 5CKMA 1RUD3 3VZOA 4W4ZA 3G4SV 5IK7A 1QLEC 3JB4C 2BCCH 5B1BB 3CRMA 3JATB 4GXLA 2AEZA 5DABA 2EZPA 4FFHA 4O4IB 1O4YA 1FYUA 1ZBA2 3M2MA 1QQP3 1XBFA 4FOVA 5JCOC 4I02A 1V6NA 2P4KA 1O3SA 1A34A 1WCUA 3FN9A 4K21A 2Q5TA 1JVMA 2QR4A 1BLZA 1I08A 3FB8C 5T52A 2EILB 4IV1C 5FFOC 5JMOA 3C3TA 4I55A 1N33O 4D6QA 4DEVA 4NTXA 1SPPB 3VQVA 2NM1A 1FNZA 4QQHA 4R9CA 2EJ7A 4X20A 3N9MA 1HKDA 1FATA 5KXCA 3S6PA 4A3XA 4BM8A 1X8EA 3K79A 2GDFA 3TETA 4UT5A 5KLVH 5FJKA 4JGYB 3RG0A 4MH0E 2WBKA 5C3QA 2TUNA 3C8XA 4QDRA 3FD9A 1P49A 1UQXA 4EKWA 1N3PA 1DGWX 3PVNA 1K73W 2NN8A 1UMHA 2B1GA 4YW1A 5IAVA 2VW0A 3BVCA 4XACA 2HEYF 3UK9A 3HD8B 3G80A 3RYPA 1VBB1 4Y22A 1M1KW 2BVBA 2EBOA 4YM0A 4Q8LA 2KSDA 1AYN3 4ZU5A 1FMD2 4Q4W1 3ZS8C 2CDYA 2D3OW 2ZA9A 2G9GA 2QNKA 3ZEDA 5H9CA 2ZGNA 4Q4Y3 3CYOA 5BNOC 1AUYA 2EXHA 5HXVA 4L9BA 2M7WA 2W3JA 3IIAA 2C1FA 3NO8A 1ST8A 4YIPA 1KBHA 2OTJV 4AE2A 4PF1A 5CEHA 1W6PA 5JXIA 3X29B 5IYBO 1UZZA 4IL6Z 2OKXA 2DQ3A 2KB1A 5FRAA 3WOGA 3CC4V 3K5MA 4Q20A 3LEGA 4XF1A 2GNMA 1K3EA 4IEPA 1AR62 2O8QA 5F37A 3CRRA 3KCXA 5J2UB 4IIJB 4FZ1A 1JOBA 1PX3A 1SLTA 1PVC3 1DLCA 4LFBO 2ZQMA 1RUD2 4JF3A 2Y6FA 4LF8B 4CCDA 3NR7A 4NRPA 4M4PA 4UCVA 4WVWA 4WM8A 4O4LB 1CAXB 4IHJA 3IT8A 4I9WA 2Z4FA 3ZCCA 4BQ5A 2WPDG 2XL9A 2SLIA 1F35A 2BUKA 2P90A 1NG0A 2ZR3A 5FZLA 3DECA 4I50B 4XDJA 2N05A 4RGGA 2X6AA 3D3QA 1F5JA 1QNMA 5KXEA 5FL7G 4JASA 2FB5A 1W9WA 1RUH2 3LDKA 1KU9A 3ZRWB 2VJXA 4QAWA 2LO1A 3VBSA 5B1OA 3VDCA 4RGKA 2ZNJA 4LH6A 2H8PC 3T1MA 3K4ZA 3MDSA 3ABLC 2VMGA 3TGUH 2DUQA 3ZX7A 2GMEA 2RR11 4PA4A 4Q5OA 4LK6A 1H30A 2PYLA 4IEOA 5L3BA 1SERA 4N23A 2YC4A 2FDJA 2UXDB 4HANA 4J9YB 2GU9A 1G9DA 1F4AA 1LUVA 3NKGA 1EM1A 1G8WA 4CUAA 5FY0A 4WZFA 1MVEA 2NLRA 4RUFA 1WCDJ 2H94A 2ZX0A 4RD7A 2PQQA 2VCCA 3WCRA 2P17A 3DC6A 4QQLA 5B3SB 1KJRA 3ZIAG 4MO3M 1BT8A 3RBZA 1JH5A 3NAPA 3OMIB 1J3RA 3PJSK 4ZS2A 1V70A 1WWYA 5BY5A 2ZD9A 3Q8EA 3UKVA 5DG1A 4A2UA 4CEWA 4MW8A 4W50A 2JDNA 1OCCB 1PM4A 2YFUA 2IM9A 3GHMA 5J98B 3K59A 2KM2A 4PLMA 1QNWA 3HN1A 1KS4A 4Z92B 2VU9A 4MG2A 4XUTA 2VNRA 3I54A 3PTYA 2ZR2A 3Q4HA 1XDCA 2A9HA 4HKWA 2JJ6A 4H44B 2HWE2 2Y26A 5CB4B 3GDBA 4DR2O 4Z1MG 4BDVB 3EVKA 4OQ9A 4OHVA 1W3XA 2A5ZA 1Z2GA 1FX5A 5FPVA 1CEZA 2AYHA 5LA6B 1PM9A 1Y76B 3SDLA 2IU0A 1LUWA 5L3DA 1QDOA 1UYYA 2IH3C 5FYBA 1TVGA 3RMXA 4DV4B 4DO0A 3OR7C 3TN93 1H4HA 3GBWA 3N2KA 4RFRB 3ZFFA 3WG2A 3SCGA 5C9AB 4EB6A 5I0TA 3O1RA 3AP7A 2VG9A 3D5OA 1WA8B 2UUBO 1HIXA 3WG7C 1RL3A 3PMSA 2VZRA 4LLOA 2Q0AA 1Y9GA 3MIHA 4HZFA 3RNSA 1W3VA 5BNPB 4FIPC 2AEYA 5KMGA 5LP6C 3MLKA 3T2TA 5LP6B 1NAEA 2RMKB 4HKOA 1REDA 3BODA 1Q90D 5LHIA 4LF6B 4HYOA 3D36A 4P14A 4LEJA 4GZRB 2UXBO 5FY9A 3NL1A 4B3SO 1YQCA 3L72H 3AMQA 4FQ4A 2WNUA 1M9NA 2PXJA 1IS6A 1N34O 1MMMA 4LWSB 3E5XA 5DPNA 3MIFA 3WF4A 3ZHSA 2D3RA 1G9FA 1SQPH 1W59A 1Q6HA 5FZIA 1OCOC 2ZMNA 5JOZA 3CQOA 3K46A 3BRCA 5IY5C 3AFKA 4MVQA 4EWDA 4H55A 4K1ZA 3URFA 2HEWF 2WLIB 1Q86W 5GZFA 2A6ZA 3ST7A 4ZOLB 4CCOA 1RP3B 2OCHA 4NTWA 4Q1PA 3H1LH 3ZRVA 2IXJA 2VQEB 1ENSA 1K4DC 1HB1A 1PGW2 2IVJA 4BYYA 1E5IA 1GQGA 4ITCA 4DXSA 4CCNA 4ASLA 1S5HC 5KHIA 3GHNA 3P1IA 1PMJX 3CC7V 3W7TA 3ZXKA 1Q56A 3Q9OA 5C8WA 1AR82 2OPWA 1IQDC 2EIMC 1OF3A 4YARA 5L7OC 4XFAA 1H2SB 1COV1 4LORA 1V9U2 3USSA 2WWWA 3VBHC 3VBRA 3JATA 1TVKB 5LGNA 2SBAA 3VBOB 4LF6O 3A0BZ 4IIJA 2P4EA 4IEYA 5BXZA 4X66O 1SEFA 5C3SA 2DV9A 3M3EA 2VZVA 4WBNB 2AH2A 3CJIB 4DXRA 2WRAA 1RSOB 4BIOA 3RZKA 4LBQB 3OGRA 5IK8A 1PZ7A 1NR7A 2VCMA 4MHUA 3VL8A 3CF6E 2F66C 2GMPA 4RL7A 5LGTA 3ZR6A 2EULA 1PPJH 1SZBA 5BNOB 1HR0B 1X8MA 2WNUC 2EXKA 1YCIA 3JARA 1WMEA 4K9SA 4P9LA 1Z5VA 2BFUL 3VD4A 4A44A 4CDUC 4J7ZA 1F2NA 5FLHA 1G9CA 1OBNA 3LIGA 3ZN1A 3PU8A 1ROPA 3VV1A 2RS52 2JEMA 3CL1A 2YIDA 4WCEV 1GZWB 4LH7A 2DCTA 5ABJB 4R9BA 4WM7A 3ZFEB 5BUVA 5FWJA 2XR4A 1XPWA 4YGBA 4YPJA 4QJFB 4QQ2A 2VVFA 2JG8C 1YQ2A 3THDA 2XXZA 3THTA 4ATEA 3TRSB 3ZFFC 1UD1A 2VZUA 4TQFA 1ND3C 2CAUA 2JRIA 3O1SA 1HN0A 4RFT0 1BEV1 1VQLV 3HEIA 2JG8A 3O1PA 4JX0A 1WD4A 2YHJA 1AR71 2O14A 3T1HO 1XMOO 2OPKA 3AZWA 3BPZA 1OHFA 4X6QB 4Q4X1 5A33B 4JZ2A 3UGHA 2CWMA 2JEXA 2YIBD 4HZ3A 2BOCC 4PQQA 3PIGA 4Q0SA 3W9AA 5AFBA 1UY2A 2BFUS 2E74B 3E86A 2GC3A 3T08A 1GOGA 2HWC3 1J1LA 3JASB 4UCSA 1U12A 3NNFA 3WP4A 2CK3G 4D8MA 3TOJA 1RIRA 4FPHA 1D0GA 1DBNA 5FYIA 4WFGA 4LOSA 4UYBA 1ULCA 4GLXA 1K33A 3U75A 1GN2A 2VXJA 2VS0A 2EVXA 4JYYA 1O9HA 4R8HA 4BISA 1XJAA 3H8RA 1YFYA 1QNYA 2IBZH 2XHKA 2L9LA 2DE0X 1ZRDA 4LF9B 2UUCO 3GWOA 4HG6B 1DQ6A 1YI2V 1QEXA 1UXXX 3ZYRA 1RM1C 3QTCA 1K5MB 3GXUA 2XJPA 2QQUA 1YQ8A 4LF5B 2ES3A 3DF0A 1DQ1A 1S55A 4HSJA 4GMP0 5JI7A 5FJHA 2DOSA 2JDHA 2WYSA 5DMYA 5A3UA 4R6ZA 1NYWA 5FZ4A 1X4TA 4K8XA 1UYPA 2Y6GA 2HWC1 1VIBA 4A3ZA 4AAPA 5GLZA 5FMOL 4SBVA 3LSDA 4I0XA 2ZOEB 3RVYA 2YBSA 4BMBA 2YIBA 2DBIA 1VALA 1TMF2 4DR1B 3CU7A 3ELNA 1FOD2 3L74H 1XHXA 5B4XA 2FCUA 5J96B 4URAA 3QF7A 5JVDA 2JKBA 4I0AA 4LBJA 3T1LA 1RHI3 3K2OA 2JS5A 4QGLA 1POQA 1W2AX 5J37A 5FZOA 1Q82W 3MLLA 2PGGA 2WLNA 3FKSG 2VC9A 1AHSA 4AVVA 5A6YA 3V0BB 4XUQA 1UY1A 5IVCA 1ASJ3 5FOJB 4LO8A 2HWF2 1N36O 1QDCA 3LOBA 4QIWF 1YXWA 5HV0A 5EBLC 5FUNA 4LUMA 4L11A 3LGRA 1N1SA 3VDAA 3FYEB 3J8F2 4DIQA 3O1UA 2D44A 4DR7O 2MNGA 3WEZA 3JBG1 3RYFB 4EQVA 3J4UH 2WS93 1VBE3 4MVRA 1R1BA 1COWG 5JCTA 4YVWA 5CA1B 3JCUZ 3I49A 5CBGA 4I9QA 3ILFA 3WHTA 3AP5A 1OVSA 3B09A 2FCTA 1R3KC 3H3ZA 4IERA 1MZEA 4ASKA 3WB1A 3WQ0A 3L2HA 3QH6A 2B1IA 3K51A 1SQFA 4YZ1A 4KBBA 2GNDA 1W6NB 2WZR2 1MZFA 1PK6C 5IW0A 3NXSA 4QX8A 2NP0A 1S3JA 2KKWA 3WG3A 4OUEA 2ZBJA 2BZDA 2J22A 3AG2C 1XU1A 3OUHA 4ARYA 1Y4WA 1JZ8A 3PTRB 5LGUA 3ZHVA 1NVPD 2XHBA 3KG2A 1SBDA 4NIHA 4AI0A 5IYYA 3O0XA 1UOJA 1W6PB 3ZIWA 1HR0O 1B3QA 1P84F 3DTUB 1N33B 2G19A 4QX5A 2ADEA 4HVRA 2PUSA 3A4UA 3V65A 1Q8QA 3KV4A 3POYA 3EXAA 3FC0A 4RN5A 3ILNA 3CCQV 2VZPA 3HQXA 2ZHLA 1AB3A 2JJ1G 1VB4A 2FHRA 4OI2A 3AG2B 1ZBA3 4WM8C 2BBAA 2CL2A 1TME2 3BTZA 4NWVA 4QX3A 1R6NA 5C5TA 3OYWA 5CYYA 4LBMA 4DR4B 4YHHB 4JI0O 3DL3A 3MUY1 5JAXA 3OCPA 3QO8A 3SH3A 5GLVA 2R9IA 2RS31 4R9AA 2K9PA 4XMAA 3PHMA 2WL1A 1QIQA 5FZ7A 4JYAO 3N7LA 1ZTEA 1LOFA 3AJYA 4QD2A 4RAIA 2FDIA 4MVMA 1TMF3 5J3UA 3ZYGA 2UU8A 2YXLA 5A3TA 1ZVFA 5FREA 3EHBB 2YG0A 2CTWA 2D6PA 4LO4B 4LLFA 2GZWA 2MEV2 4H13B 4R9DA 3CJXA 2DWEC 4QKDA 5CADA 4LHNA 3DUIA 3B02A 4J1XA 1FFXA 1AR5A 1E5SA 4X1IA 2WNEA 2IXIA 4P9PA 2P1BA 1SRYA 1OV9A 4RR3A 3DKQA 1SHWB 1HQLA 1U5IA 4ZBMA 3AP4A 4BK5A 1M56C 1VQ6V 1QQP1 4FOWA 1B04A 3SH5A 3JALA 4YYOA 3K03A 3WP5A 2YXSA 5BR8O 3FBYA 2E31A 1V6KA 3DGTA 1SFYA 3VBFB 5FZBA 4INDA 2IXCA 2A3WA 3U78A 2WWSA 1QHTA 1N36B 4GMP1 1BGYH 4DUZO 3WG7B 3B8NA 2VTXA 4MSVA 4AL9A 3I5DA 3CXHF 1AX2A 3CCSV 3CEWA 4GKJB 1REEA 3AG4C 3JAKB 1JQ0A 4ZKIA 3RGBA 2XG3A 5G04L 2RJZA 1B35C 1CAWB 3CE2A 4I0BA 2A7AA 1X59A 2WFF3 1IG3A 1FS0G 1ULFA 4XILA 2G9FA 1PGSA 1GM8A 3E8GA 1BBT2 5F2VO 4NB5A 3RMYA 3KV5A 1VIWB 2QWQB 1MR5A 5FQ0A 5EQUA 1VP7A 1Q8VA 1M4WA 1JUIA 5BMVB 3JBG2 3T4HB 4AVTA 1F7YA 4NROA 3RYHB 1UZVA 2IJIA 1EZVH 1RGSA 1NI8A 2ADDA 1XYNA 2Q30A 3FJSA 2V5YA 2V09A 2ZEZA 3IBMA 2GMMA 3Q8AA 4DR5B 3F5WC 3TNQA 4BW9A 1SLBA 1CPYA 4N43A 4PBPA 4FLXA 1XNQO 1A8DA 1DK1A 1W05A 1RMU1 1BVP1 2BQPA 4YM2A 1IDSA 4MUVA 2J1UA 3ETGA 1QH6A 1YHQV 3ACHA 4NIIA 1OZ0A 1VQ8V 3B40A 1SLLA 2YU1A 1C8M3 1O6UA 4AYUA 4CS3A 3LSUA 5C4WC 4YNIA 2BW8A 3W59A 3D36C 4LFBB 4OX9B 2ID4A 2AHYA 1VBD1 4D7SA 5IK5A 4QDSA 1LKNA 1SBFA 3ECQA 1TGOA 3JQXA 5C33A 5DZFA 2GHYA 3U0ZA 4IEXA 4FP3A 2C24A 5HV4A 4DEQA 1LHNA 4AI1A 3MPPG 3SMHA 5AC91 1XRUA 1NX9A 4OUSA 1HNWB 3V0BA 3K4DA 3ABKC 3K0DA 5B1BC 4DR6B 1ND2A 1ZBE3 3HBZA 3OTOB 1JHNA 4IGPA 1GV9A 4QKBA 2Q8CA 1TME3 1L7LA 3KGLA 1TG7A 5IATA 2XJVA 4QX1A 4LFAB 3DN7A 1O8SA 3CSXA 3QCWA 3M8LA 4M3CB 3JAKA 1MS4A 2VWJA 3GZEA 1XSQA 5EXOA 1NLSA 3IDBB 4M0HA 1HDKA 5FYZA 1FAYA 4JTDB 3AK0A 4J10A 1K9MW 2PHDA 2ZGQA 5FZGA 4MVZA 1R6KA 1B06A 3TYJA 4XIKA 2E5LO 1WW6A 5A32B 4KG0A 4FM0A 1KS5A 3LAGA 1I5YA 5TSWA 2F17A 5DN6G 1Q3EA 1NKGA 2D43A 4LIVA 2QE7G 4JYCA 3NNLA 1HWYA 4DV4O 1F15A 2PAEA 3UJOA 4XVHA 3ZR5A 3CJIA 1H8TC 4O2AA 1DLBA 3ZYHA 1ZREA 2B9VA 1I0HA 3S3WA 3KGZA 1EYBA 1BMV1 1NZCA 5CISA 1JI6A 1SQGA 4PA9A 3ABMC 3BA9A 3M1HA 1IX9A 4BQ1A 4X88A 1HW5A 5ACA1 3SJQC 3AK2A 1NQDA 4CPBA 2P5BA 3GWKC 4IL7A 1ZZCA 3RYCB 4LP8A 4RQFA 4XTPA 1NE6A 3HT1A 2R30A 4DXTA 2RDSA 3ZMTA 3HB3B 1EN5A 5E8AA 2H6CA 1YIFA 5FZEA 2JDAA 3TJTA 1WCSA 4YG0A 4GX5A 4FO9A 5IVBA 1CVNA 4B7KA 3ZHUA 3ZBHA 2DCJA 2VTFA 1HNXO 2VOXA 2HWF3 3OGIB 4DNYA 2WSUA 5CBLA 1JS9A 3IAYA 3OB8A 1IBMO 3K3OA 1WBFA 4JI0B 4GX2A 2OZJA 1X33A 3BB6A 2AXTZ 4U3FH 3VZMA 4V1PA 5T5PA 4PCRA 1QXJA 2NMOA 1QGLA 4O2BB 3I2IA 4GWIA 4KXRA 1GYKA 2L35A 2QGNA 1S0EA 4AVCA 4E27A 1O7FA 3VDBA 2JGDA 4QB6A 1MABG 4ZU7A 2MK3A 4JI4O 4MGYE 3NNJA 3WT3A 4QPJA 1DTOA 4AQYO 1XREA 5FLJA 3A0HZ 4DR3O 1VBC3 3VD3A 4PV1B 5KX5B 1OFNA 1QU0A 1SA0B 4O4HA 4HL0A 5L73A 4IV1B 3WX5A 2O8OA 1ZX3A 2HHHO 1J58A 5JXJA 2R042 5JOWA 2B9ZA 3A2FA 4LT5A 3UO3A 5FPBA 3C7HA 1SZTA 3MZHA 1XQ8A 3O1VA 3POFA 1LEMA 2WLHA 4QWNA 5GALA 4NIGA 2D98A 4RQPC 2PHLA 5K8SA 4ZHQB 2Y0OA 4GKKO 2EIKC 2P6HA 1ZWIC 4JTCB 3SKVA 3D3AA 4BQ2A 2Q7HA 2XOMA 4AILC 2OYZA 1QJY3 2GH8A 5A1LA 5FXVA 1ZZ8A 2GSMB 1K5MC 2JD9A 2PAMA 2Z79A 1ZZBA 3GF6A 4P2ZA 1BMFG 4JVAA 2HHHB 3PVEA 1LECA 1YUDA 4FJCC 3H0OA 1IXBA 5LCWL 2A70A 3IDAA 3R66A 4XDLA 4B3SB 1URFA 2PF4E 1PMIA 3BY6A 2XJRA 5EV7A 4Q26A 4X1KA 3UJQA 1O59A 2WNOA 4RGAA 2NNUA 4ET7A 3ZMNA 1K92A 2ZM6O 3A23A 1FPN3 3LEMA 2A1XA 1V54B 2OVUA 4JAUA 4JI8O 4CZZA 1PVC1 3LE0A 2J42A 4BIZA 3LKJA 1KKCA 3KHBA 4Y4YA 2X10A 5DZGA 3FB7C 5LBBA 4QGPA 4UVBA 4GX0A 4AI2A 5C9AC 5T50A 4JI5B 3I2GA 1JHJA 4KUMA 1FXKB 2EAKA 2JG8B 3WW3A 4W4LA 4O4LA 4WM7B 2V72A 1FOD1 2I74A 5FYCA 4UVAA 4DO2A 3MDPA 1ULDA 1GKBA 3W5NA 2XUMA 5ABJC 4XDQA 2ZGKA 3UCSC 1WLWA 3U37A 3R4DB 3FB6C 2R072 5CFCA 2PFWA 3I3MA 4PA7A 1CAUA 4IV3A 1SLAA 1ODMA 5A3OA 1IS5A 1O3QA 2Q5ZA 4JI8B 5LEJA 5ABJA 5J09A 2P3IA 4HPKA 3RVZA 1AJNA 2W94A 1F23A 2UYBA 3MW4A 4FT8A 3UM7A 4TLFA 1N8RW 2A3XA 2CE4A 2BERA 4FOYA 2JICA 3OUIA 4RYDA 5AG2A 5JR2A 1HRI1 3IFXA 5KXDA 5GKAC 4IGQA 4IGGA 3KSCA 4LHLA 2MEV3 2VQFO 1JCHA 1XUQA 1NXMA 1D4M3 4X8PA 4JDMA 1GNYA 2DVAA 1NKDA 4O4JB 1IG0A 4YZ2A 4MGIE 1C28A 1TEIA 1NCQB 2UU9O 4G3YC 4LHKA 1HRI3 1PVC2 1ONAA 4LKFA 2D6NA 2IZWA 5KAFZ 1CPNA 1UU4A 4DR3B 3T1HB 2QTWB 3GCXA 4JAVA 3NNMA 2OIIA 5FPUA 4TYSA 5E1RA 1VR3A 3PJYA 1ZRIA 2WFPA 5FY5A 1N47A 1H1AA 5GTHZ 5K0UB 2Z5WA 1V55C 4LA2A 4MVOA 4FPFA 4LIUA 1S0BA 3ICXA 3RZGA 4XC9A 1WAZA 4V2WA 1LULA 2WUHA 4GH4B 4XYXA 4AI9A 3AKRA 3CHXA 1DF4A 4LJHA 3W7UA 5HCFA 1F5FA 4UW3A 5IJ0B 3HKCA 1L3JA 4HN1A 4FFIA 1C8M2 2EIMB 5LA6A 3H50A 4LTAA 1QJZA 4A7ZA 1FPOA 1JODA 3KD4A 1SQVH 4FLUA 2D97A 3AVRA 3I55V 4IE5A 4QE9A 2ZXWC 1M57C 4C90A 1NE4A 1H6XA 4MZUA 1A3KA 4C0BA 4R4ZA 4LXLA 4ZIBA 3IAPA 1QQCA 4JTOA 4FPJA 4YGEA 3E83A 2IU3A 2ZAHA 5T5OA 3RT3C 1W2UA 3TWIA 1QJX1 4RHV2 2QE3A 4ZKTB 5B2GB 1PVXA 3FFZA 3POIA 5LBCA 1PNGA 4KBZA 2YBPA 2IW5A 1OD3A 5BNPA 2RM21 3K0GA 2TEPA 5FPXA 4CS4A 5JWPA 1HX6A 3POBA 5BYNA 3X2QB 2VUCA 2DTYA 4KWUA 4Y3OA 3VBSB 1SA0A 2V1DA 2AR6A 1Z7S3 2WA3A 4HT1T 2LW8A 2UUCB 2BGOA 3CLPA 2RQ6A 1I5PA 2QKSA 1JMUB 4GKKB 2W6IG 4JTAB 4AEJA 5FMBA 1GP5A 4K8ZA 5EIBD 1AYM1 3IAQA 3IMNA 2QUOA 5LMNB 4A45A 2O57A 3W7XA 1AR93 2PZSA 3SEPA 3UYJA 4KMQA 3JCZA 3KVBA 1X50A 3RQ0A 2H0VA 3UETA 2CTQA 1YRZA 4NWWA 2WZR3 1IURA 2ERFA 1PK6B 1QJU2 4IE4A 3CJHB 3TCUA 2P7TC 3J7NA 3C7GA 1I5XA 3OJBA 3TN92 5B1AB 1RUJ1 4NPMA 2XQXA 3DXUA 5FZOB 5CMUA 2J1TA 4GWNA 4UW4A 5L3FA 5FXZA 5FUPA 1S0FA 2OIEA 4GQ7A 4JI2O 1Z78A 4KU8A 3I3DA 5FPLA 4JKLA 3S0MA 1PK6A 3H3UA 2QM4A 4NYKA 1L0NH 5L9BA 2C9AA 3HMYA 2ARAA 3W5MA 2GALA 4LKEA 2Q68A 2HWF1 3ON7A 3R0RA 2ZE8A 3H9AA 5J2TB 1LRHA 4DV0B 2CU5A 2YEVA 1EBOA 3NAPB 1RITA 2EIGA 1XE8A 4P08A 1EP0A 4WM8B 2QKAA 1J1TA 4MGQA 4YGDA 4Y5Z0 5KAIZ 2UYAA 5JJNB 1WW5A 1RUI2 1HJGA 5C3OA 3SJBC 3H01A 4XDKA 2ZE7A 4FVVA 2XL7A 4A6SA 1UMIA 5EFUA 4OGQB 1BQZA 3AYCA 3GZAA 3ZFGB 3VHNA 3N2GA 5C8YB 1RUF3 2E33A 1AP6A 4AQ6A 3ZHRA 4WBBA 3RYIB 4B7EA 2ZT9B 2BYVE 5DZEA 2EIBA 4LNVA 2A7WA 4K7JA 4OLLA 3OEAA 5B1NA 4P9WA 1OLME 4DMIA 3NJZA 2A79B 2JE9A 2CUGA 4BWAA 1N1YA 1QLEB 3RSJA 2YXHA 4UB8Z 1UF2C 1IBKO 1JU4A 4HPKB 1MNGA 1AI7A 4K3UA 4KG8A 3G6JB 2J1AA 5A3MA 1JR9A 1VBA3 4DV5B 5D5QA 1BEV3 3IDEA 3MIGA 2EIDA 3NV1A 5B3SC 4F3JA 4WV8A 2AZ5A 1OSGA 4Y1YA 3HQRA 4QPWA 2FMYA 3IPVA 1NVPB 2GC1A 1RUE1 4IESA 2ZE6A 3NW4A 5DM6V 1R1A1 1ZUQA 5K1PA 5A3LA 1KYOF 1HXS1 2HVJC 3KHCA 1X9TA 4RR3B 2A71A 1WW7A 2CSGA 5I0RA 3E8FA 2IVIB 2TNFA 2VQEO 4BLJA 2ADPA 3BN6A 2OZ6A 4C8DA 3LQCA 4QU2A 2VQTA 4ZZ8A 2NPIA 1CZTA 4FFGA 2RS13 3FE5A 4PI2A 3F5TA 1RUJ2 4Z82A 4CUBA 5GLTA 1BJQA 2Q67A 1E57A 1YFXA 4JV5O 4Q4X2 2EIJB 1YFWA 2HBTA 3H8OA 2XUEA 2D7FA 3OPTA 4AHZA 4CEWB 5HBAA 1ZAUA 4GKXA 1GN3A 3IWZA 4TSFG 2XAHA 2DDUA 4KWLA 1E1RG 1PNKA 4TT3G 2JGDB 1AJPA 4O9GA 2WFF2 4IDZA 1H8TB 1GP6A 5H6QA 2WO7A 4R50A 2KR2A 4GA9A 4CP0A 2BVVA 2IUWA 4DR1O 2JIJA 4A41A 2X5IB 2RS53 4Y4RA 4JPRA 3RPQA 1ODNA 3I2KA 1NT0A 2OA2A 2R70A 2K9ZA 5DAXA 1A6CA 2DN9A 1MZ6A 1O4TA 3ZIXA 4D0QA 4XFHA 2R32A 1VMHA 3BPSA 3O65A 2JX9A 4CRQA 1Z7S2 3AK3A 4YZ4A 1YLLA 3NVCA 1N3OA 5CIRA 3GBGA 1YWKA 5FZFA 1UWWA 1GO3F 1RPOA 3BFRA 1S76D 1DCSA 4X65B 5LA1A 1RB8G 3A0RA 4JI7O 2BPA2 4A7KA 5JXGA 4GAZA 2NLJC 1ULOA 5CKNA 4FMTA 2BOBC 3CZJA 2JDPA 2WLKA 3K4AA 4BAYA 5CB4A 3ACGA 4COUA 3VBBA 2ATKC 3G71V 4CDQB 5FZDA 4OMCA 3MUZ1 3AVSA 3BCCH 4W8JA 1IGOA 4KHPO 2WS92 5T3NA 4OHZA 2BJSA 3RVHA 5JLVA 4UCUA 3IM0A 2V4DA 2PY5A 2K0GA 2AGSA 5E1AC 5FZ3A 3LDCA 3N7JA 3IDCB 1NA1A 1OPOA 5C71A 2P3KA 2VUAA 4Q0QA 1QXPA 1JYNA 3WZ1A 4I3PA 3V0AB 3ZYFA 3CCJV 1RUE3 5EZYA 5EZYB 2PHRA 1RJ8A 2HWE3 2NMNA 3K75B 3JD0A 2HEVF 1DQ4A 5GLUA 4PT6A 4NXNO 4OCTA 3O1TA 1Y7BA 3CWBH 2VQAA 1J3QA 1ZA7A 1AZDA 4XBQA 3SPJA 2D93A 3HN3A 4XFGA 3DV8A 1AR72 2OCCC 1E5RA 2UY9A 3WNOA 3N9OA 3KV9A 4MLOA 2Q0OC 1ALYA 1BHBA 1EFRG 2FD8A 3LA2A 4H7MA 5FZ1A 3JAMN 1WB8A 5IYDO 1XNRO 3WNPA 3B93A 1VQOV 3OGSA 4O9EA 5CA1A 1PP9H 2XWJB 2AW9A 3ZN6A 3D6EA 5JXHA 5KX5A 4NIAA 1C57A 1W6OB 3OGGA 2XLGA 4EWAA 1NS1A 5FAXA 1ZX5A 5C6CA 3VUOA 3VD9A 2D6KA 4YVSB 2OS2A 4I7ZB 2ARXA 3L9DA 3RWRD 5L9RA 4XQWA 1VF6A 2BRTA 1RYYA 3MD0A 1JOJA 4JDOA 2P2KA 3WDXA 1ZYBA 1RVF3 4J80A 2ETEA 2B8MA 4ABMA 4BQXA 2HBUA 3PLQA 3K04A 4IXLA 3MEPA 3ZKUA 2B42B 2R9RB 4LF4O 2E75B 5KHKA 3SITA 3CCUV 3WQ7A 5JCOA 3K3NA 1QF3A 2ZS6B 5CZKA 3ETPA 3O0WA 5IJRA 2P22C 1YQ5A 2C9KA 3FHAA 3PL0A 3BI3A 3J7AU 4PJYA 3WW2A 5JOXA 1B35A 2C6SA 5CG9A 3SYQA 1GQHA 2VZOA 3M3CA 2RE9A 2C5DA 1GZTA 3LUTB 5LZ6A 4PDWB 4AEKA 1VAKA 1ACCA 5LY2A 4CU9A 1PGW1 4IE0A 3NNGA 2ZM6B 3ZHTA 4O4IA 4P00B 4Z2WA 1UU6A 3DYMA 3NSTA 5CFDB 3ABUA 5C8YA 4KGGA 2AUYA 1K3IA 2K2SA 3C3VA 3OFNG 4NPRA 1UW8A 4M0NA 4RQPA 2DCZA 1WA8A 3FLRA 3NRUA 1G9BA 2IJJA 1RUC2 4COWA 2UUAB 2GTAA 2XGXA 3SPGA 3GNEA 5A1FA 5FPRA 2EJRA 2RHPA 4FXKB 2R6QA 5CB7A 2QDOA 2GN7A 4XABA 4RHV1 1W9SA 4PA3A 5KA6A 3WDWA 2VECA 2QSAA 4LA3A 5JVDB 1VQMV 1H6YA 4XOGA 4IE7A 4F8AA 3JBG3 2P67A 2VUJA 2R043 2B9UA 4IEUA 4Y24A 5FZ8A 2N74A 1F4HA 2FZ1A 2F4VO 3OY8B 1ASJ1 4LWSA 4EN9B 3DXTA 4DOUA 4BQ4A 4LMFA 4B3NA 3FZ3A 4YG3A 1MPXA 2ZZJA 4CUCA 4MX3A 3O9OA 4PF5A 2I07B 4AGVA 1M56B 4YM1A 3B9CA 1DQ0A 2IXHA 4G27B 4AXOA 4KP4A 1PO21 4DUXA 1JZ5A 2Z69A 4E4EA 2XAQA 3P30A 3E97A 5IAXA 5A70A 2EXJA 2RDCA 2DJVA 4U3JA 2JK5C 4MTXA 2ZXWB 4HKLA 4LR3A 5C3RA 3ABTA 2B46X 1ZRCA 1PIV1 3ALQA 4UFZA 1W0OA 1KB9F 1W8HA 4CDUB 2VZ1A 2RJLA 3ZSKA 4QHZA 2WN3A 4BQWA 4Z8BA 4XURA 5C70A 2EALA 5T5JA 3EB7A 1OQ1A 4J11A 4ICGA 1VAMA 1SFPA 3K48A 1VBB3 1W2OA 3HVDA 4LF4B 4LO5B 1LOGA 2B45X 4LFAO 5CFDA 2D6LX 1S0IA 1HB3A 4QT6A 1Z5WA 3ZMZA 3DPRA 3AYEA 5CNAA 2FYUH 1HV1A 3USUA 1QOSA 1K5QA 1RUF2 5KHGA 5FY4A 2LJ2A 5A7WA 3ACFA 4GB33 3H1IH 1I5ZA 3BEHA 4FLTA 2DYRC 3SJCC 1TNFA 2VUDA 1W8UA 4UB6Z 3RYKA 1HQWA 1YTFD 4MXWB 1GM7A 5AFEA 4NKGB 5B4NA 5A7SA 4UCTA 5CVRA 4UFMA 3ZPOA 5A33A 4LF9O 1SS3A 2PLV1 3CIHA 5BNQA 4Q0VA 2JDIG 4QU1A 3EQEA 5FLIA 4CU7A 3ZSJA 4D6RA 4QPYA 3ASNB 1OF4A 5K4LA 3SR2C 3TXSA 5I0UA 1MEC2 4YJ3B 2Y60A 2W1WA 5EIYB 2P6CA 3CCMV 4CEYB 3PURA 3OY8A 1GWKA 2XJTA 1ENQA 3ZOIA 5A6ZA 3OR6C 1Q7YW 4ZXEA 2HJDA 4HK8A 2WNVB 2WSSG 5DG2A 1U97A 1H2GA 5DDJ1 5SV5A 4WFAV 4RO2A 2LALA 2EIKB 4HNAB 4H0LB 1OH3A 2PI4A 2ZHKA 2NR5A 3OE7G 4KH9A 4DY3A 2RS32 5CFCC 2WKKA 3ZFGC 4HFSA 1RXGA 4LBKA 3LEKA 3LEIA 4J7KA