5KHPA

Tightening the recognition of tetravalent zr and th complexes by the siderophore-binding mammalian protein siderocalin for theranostic applications
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
173
structure length
173
Chain Sequence
b'SDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCID'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Engineered Recognition of Tetravalent Zirconium and Thorium by Chelator-Protein Systems: Toward Flexible Radiotherapy and Imaging Platforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 39
structure length 173
sequence length 173
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5khpA00
3FR2A 1O8VA 4ALOA 2ANSA 4EXZA 2FLJA 1LICA 4YGZA 3JS1A 1ERBA 2QO4A 2WQAE 1B4MA 1U17A 3P6DA 1U18A 3NQ9A 1GT3A 1KQWA 4ZHGA 1VPRA 3TGAA 4AZOA 5D4AA 1E02A 1JYJA 5D47A 1FTPA 2FR2A 1TW4A 5LJGA 2E4JA 4YGGA 1G85A 4IAXA 1JBHA 1FDQA 1SY1A 3ELXA 5BVQA 2HNXA 4AZRA 4GKCA 3STNA 3VG7A 4A60A 2OVDA 2OVEA 3PH5A 3PPTA 2A2GA 4OMXA 1MX8A 4A8ZA 2WUTA 3EBWA 2JU3A 2WQ9A 4PSQA 1PBOA 1CBQA 2MJIA 4TQ2A 3STMX 1RBPA 2KT4B 1CRBA 1ML7A 2Q2MA 2R74A 4GETA 4I3BA 3RSWA 2OVAA 1LIDA 1H91A 5HAEA 5H8TA 1OBQA 5HTEA 1AB0A 1S2PA 1YWDA 1CBSA 4Y0PA 5EEDA 2AH7X 5HZ8A 4OS0A 1EXSA 1SXWA 2AT0X 1BEBA 3PEDA 1KT6A 1QFTA 5F6BA 4ZJ0A 3KFHA 5H9AA 1SY0A 3DSZA 3HWGA 1QY0A 5BVSA 2PY1A 3C78X 5LJCA 4N7DA 4YH0A 1EIIA 3B2LA 3FW5A 2L5PA 1TVQA 3HWFA 1QFVA 5IO5A 4RUNA 3WVMA 1KOIA 3BU1A 4I3CA 2N93A 3B2JA 4TKHA 4N7CA 2LB6A 3APUA 5HZ5A 5IO6A 3BLGA 5HA0A 1PMPA 1T68X 4LKPA 1OEEA 4YDBA 3F9DA 2A2UA 2W2FA 1ICMA 1GT4A 2MM3A 3UEVA 3FEKA 1I04A 2R56A 5AQ6A 1YWBA 2ACPX 4ZHHA 1GGLA 2BLGA 4QZTA 3D95A 4ODDA 3D96A 1HMTA 4YKMA 5EPQA 4QZUA 2Q39A 3P6CA 5H9LA 3BY0A 5K06A 4OS3A 2HZQA 2AT8X 2A3FX 4GRJA 4TJZA 1EPAA 3ELZA 3VG3A 3ZUIA 2AMMX 3VG5A 2JU8A 5H9KA 3NX2A 3G7XA 3KQ0A 5EEEA 4AZPA 1RLBE 4QGXA 4AZMA 4UU3A 3L4RA 2AT3X 4QYNA 3BU9A 1B8EA 3F8AA 4XMDA 4ORSA 5EZ2A 5L8NA 1GT5A 4ZGUA 4AYHA 3PP6A 1E06A 4EEJA 3EYCA 1KZWA 1HBQA 3C77X 5FAZA 3WJFA 4YCHA 2ALLX 3TGBA 3CWKA 4YCEA 1HMRA 5KICA 1KZXA 1IFCA 1BSOA 3WBGA 3I0AA 5D48A 2RQ0A 5D8JA 2HYSA 4QGVA 2FT9A 3FW4A 4EDEA 1LKEA 1FELA 2A0AA 2JN3A 2L9CA 4NLIA 1AQBA 5HA1A 1O1UA 1ZNGA 4ZR2A 4YBUA 2WR6A 3TGCA 2K23A 2XKLA 3O22A 1FENA 2RCTA 3FA9A 4O9SA 4HPCA 2FWVA 1DZMA 4ZHDA 1OEKA 1TXLA 2AL0X 5B27A 4GNYA 4TKJA 1A2DA 5F6ZA 2HZRA 4Y0RA 1FE3A 3CR6A 4Y0QA 2JOZA 5D45A 1YIVA 3O2YA 5EDCA 2W2AA 4YGHA 5HZ6A 3NR3A 4YBPA 4D6BA 2WSJA 4ZFXA 2ACOA 2RD7C 3CBCA 4YFPA 1D2UA 1DFVA 1YWAA 4MVIA 1DC9A 1X8NA 4BOEA 1GX9A 3FIQA 3APWA 3VG2A 1ZNKA 1P6PA 4IB7A 4Y0SA 5LJBA 5DPQA 1IFBA 2DM5A 1JJXA 4ZCBA 1GT1A 5CE4A 4IB9A 1LFOA 1CJ5A 1GXAA 3VG6A 1X71A 1DZPA 1OPBA 1HBPA 3FMZA 3HWDA 1IKJA 4I9SA 1EW3A 1SXYA 3EM0A 5LKEA 4YKOA 5L8IA 4ORWA 1OBUA 5LJKA 2POAA 4TLJA 5HTDA 1VYFA 1LIBA 4IBAA 1MVGA 1TOUA 1JJJA 4BQUA 1MDCA 3APVA 1SY2A 2OFRX 1X8UA 1G74A 2OFMX 1KT5A 1A18A 2WEXA 4LZUA 1EALA 1ZNHA 4YFRA 5HBSA 3FA7A 4HFOA 1N0SA 4CK4A 3BDRA 3WXQA 2FR3A 4I9RA 2LBAA 2CZTA 2G7BA 4NNSA 2QOSC 3K3LA 1QG5A 2NP1A 3B2HA 4LZVA 3TZSA 2NNEA 1IW2A 2FRSA 1BSYA 1BLRA 3STKA 1ZRYA 5F58A 3WJCA 1EQDA 4IB6A 4DQ4A 4DQ3A 1XCAA 1X8QA 4M7MA 4RUUA 5F7GA 1QY2A 1HN2A 3NADA 1SA8A 3BS2A 4YMYA 4YDAA 3KFIA 4ALBA 1UZ2X 4OS8A 3PECA 4ZH6A 5HWZA 1S7DA 4ORXA 1YWCA 3TF6A 1B56A 1QWDA 1LF7A 3CBSA 3U0DA 1T8VA 4UU2A 1EUOA 1MX7A 1QQSA 4XMHA 3D97A 4XMEA 2CM9A 1DZKA 3FEPA 4EFGA 1IKEA 3O19A 4K19A 1BBPA 3KFGA 1OBPA 1YUPA 3I17A 3P6GA 5KHPA 1ACDA 1YP7A 4QAEA 1E5PA 4ZH9A 4LKTA 3DTQA 1PEEA 1KT7A 1SXUA 1MUPA 2CZUA 3QKGA 1GKAA 2X46A 4GH7A 5HZ9A 4IMOA 1ADLA 2G78A 3C76X 3P6HA 1I4UA 5BVTA 1ZNLA 5L8OA 3CQRA 2XSTA 3VG4A 1BSQA 1GX8A 1NGLA 2A13A 4ORYA 3EBKA 3EMMA 1I06A 1X8PA 4XMGA 5KIDA 1D3SA 2FS6A 2GC9A 1XKIA 5C0NA 2IFBA 1ERXA 1LNMA 2K62A 4TKBA 1X8OA 1PM1X 3WJBA 1SXXA 1KT4A 3BSZE 3NPOA 1O1VA 2NNQA 5F1EA 3WJGA 3BRNA 5FFHA 1AVGI 1JYDA 4KIIA 4M6SA 3AKMA 2CBSA 4IMNA 1Z24A 2Q4NA 3PH6A 1DZJA 4HPDA 2Q2PA 3FA8A 1BWYA 1NP1A 4QYPA 1CBIA 1EIOA 3B2KA 1JZUA 2F73A 5IO7A 4A1HA 1BRPA 2AKQA 2QO5A 1IIUA 3FELA 2L68A 1E00A 5B29A 1S44A 1QY1A 2JU7A 2AT6X 3FR4A 2Q9SA 4NLJA 1LIEA 3FENA 3U9PC 4R0BA 1VYGA 2HMBA 2FS7A 3HWEA 3T1DA 1G5WA 1EPBA 3ZUOA 4AZNA 1QABE 4ORRA 1BM5A 1TOWA 3WJDA 2L67A 1ICNA 2LBVA 3OJYC 5JR8A 4ZHFA 4ARHA 2X45A 2GJ5A 4D6AA 5HZQA 2RA6A 4I3DA 4OMWA 2ASNX 4NP1A 1BJ7A 2NNDA 1U0XA 3HK1A 1FEMA 1UREA 3NQ3A 1DV9A 3UEWA 4HPAA 4HPBA 3IFBA 4GNWA 1GM6A 4ORUA 3WJEA 4AW8A 3NX1A 2FTBA 3MVFA 5H9NA 1NP4A 2KTDA 1HQPA 2P8GA 1SY3A 3P6FA 1OEJA 3UEXA 3BX8A 1OPAA 3U03A 1G7NA 1B0OA 2QM9A 4ES7A 1R0UA 1X89A 1A57A 1ZNEA 2OZQA 5HCDC 5EDBA 3CMPA 2GTFX 4ZHCA 1AELA 2RCQA 2HLVA 2MO5A 3FA6A 2LKKA 4GE1A 4YFQA 3ZQ3A 1KGLA 1LPJA 4WFUA 3P6EA 4BVMA 5LJHA 5FENA 1T0VA 4QGWA 4WBKA 5LKFA 3B2IA 3AKNA 1I05A 3CQNA 5HCEC 2WWPA 4MVKA 1ALBA 1KQXA 2CM4A 4TNNA 1DF3A 4A1YA 3KFFA 2YG2A 1KXOA 4NYRA 3UEUA 3APXA 5LJDA 3FLLA 1A3YA 1JV4A 3GAQA 5LJEA 2QO6A 2WEWA 2EU7X 4NNTA 4IAWA 3BX7A 2O62A 1YP6A 3KZAA 2W2BA 3S26A 2R73A 4IB8A 1L6MA 1LIFA 3MBTA 4NYQA 3SAOA 4XMFA 1GKAB 4MVLA 2AT5X 3Q6LA 1KT3A 5DG4A 2LFOA 1HMSA 4WFVA 3JSQA 2CBRA 1ZNDA 1CBRA 3FR5A 3NP1A 3RZYA 1BRQA 4AZQA 2G79A 3IA8A 5HCCC 4XMCA
chains in the Genus database with same CATH superfamily
3FR2A 1O8VA 1RXHA 2RTPB 2ANSA 2GH7A 2Z4HA 1PBYA 4ALOA 2FLJA 4EXZA 2MWHA 2QCBA 1HXLA 4GGRA 1LICA 2ZAGA 4YGZA 2BS6A 1NQMA 2G5LA 4GU8A 3JS1A 1ERBA 2QO4A 2WQAE 3SZJA 1U17A 3P6DA 1U18A 5HCCC 1B4MA 3VPJE 3NQ9A 1GT3A 1KQWA 3F6ZB 3RY1A 4ZHGA 1VPRA 1SRIA 3TGAA 4L3RA 4AZOA 5D4AA 2IZEB 3VU1A 1E02A 1JYJA 3OD9A 2X8TA 2RTGB 5D47A 3Q34A 1Y9TA 3VGWA 3S5VA 1FTPA 2FR2A 1TW4A 5LJGA 2E4JA 4YGGA 1G85A 2RTLA 2QOMA 4IAXA 1JBHA 3T6FA 1SWLA 1FDQA 1JMZA 4ML7B 1SY1A 1K24A 3FYFA 1SWTA 3ELXA 4NV8A 2HNXA 5B11O 5BVQA 3UAQA 4QRLA 4GKCA 3STNA 3VG7A 3WYQA 4A60A 3SLJA 4AZRA 2OVDA 3AEHA 2OVEA 4MISA 3PH5A 3PPTA 4B55A 2A2GA 3RKGA 4OMXA 1MX8A 4Z2VA 4A8ZA 2WUTA 3EBWA 5B5FA 2JU3A 2WQ9A 4PSQA 1PBOA 2F01A 1CBQA 1GX3A 2RTQB 4JGLA 2MJIA 4TQ2A 3STMX 1N9YA 1RBPA 2KT4B 1CRBA 1ML7A 2Q2MA 2R74A 1SWGA 4GETA 4I3BA 4PJ2A 5B5GA 3RSWA 2OVAA 1LIDA 3V8UA 1HXZA 2OFAA 1H91A 5HAEA 1SLEB 5H8TA 1OBQA 5HTEA 1RSTB 1AB0A 1S2PA 1YWDA 1CBSA 4Y0PA 2FHLA 5EEDA 2AH7X 5HZ8A 4OS0A 1EXSA 1SXWA 5B10O 2AT0X 4COTA 1FJ1E 3WZOA 1BEBA 3PEDA 1KT6A 1LDQA 1QFTA 5F6BA 4ZJ0A 3KFHA 1BWYA 2Y3FA 5H9AA 1SY0A 3DSZA 3HWGA 1LCZA 1JJUA 1QY0A 5BVSA 4CPEA 2PY1A 3C78X 5LJCA 2X32A 4N7DA 3JQOA 4INNA 3SZIA 2OY7A 4YH0A 1EIIA 3B2LA 3FW5A 2L5PA 1TVQA 4O3YA 3HWFA 5K68A 4GGTA 4JHQA 1QFVA 4OEMA 3QQ2A 4Z27A 5IO5A 4RUNA 3WVMA 1KOIA 1JIWI 2IZJA 4FBOA 3WYPA 1Y0GA 3BU1A 4I3CA 2N93A 3B2JA 1VWDB 3SLTA 2ZSCA 4TKHA 5FQ6E 4N7CA 1Y52X 2LB6A 3APUA 5HZ5A 2FGSA 5IO6A 3BLGA 4C5PA 5HA0A 1PMPA 1T68X 4LKPA 1OEEA 4YDBA 3F9DA 4AZPA 2A2UA 2W2FA 1ICMA 1GT4A 2JMBA 2MM3A 3UEVA 3FEKA 1I04A 2R56A 3ZI8A 2RTRB 3D9WA 5AQ6A 1YWBA 2ACPX 4ZHHA 1GGLA 2BLGA 4QZTA 4U8UO 1STPA 3D95A 4ODDA 3D96A 1HMTA 4YKMA 5EPQA 3FDCA 2RTAA 4QZUA 2BS5A 2Q39A 3OBLA 3P6CA 5H9LA 4CSBA 3BY0A 5K06A 4OS3A 2I5ZO 3ZZVA 1I9HA 2HZQA 2KD2A 5JD2A 4JNJA 1E2TA 1VYOA 2A3FX 2AT8X 1EPAA 3ELZA 4GRJA 1HY2A 2AMMX 4TJZA 3VG3A 3ZUIA 3MM0A 3VG5A 2JU8A 4KC8A 5H9KA 3NX2A 2IZCB 3G7XA 3KQ0A 3MX7A 2C1SA 1RLBE 2IZGB 4KC7A 4QGXA 4Y59A 5EEEA 1VWQB 4UU3A 4AZMA 3L4RA 3ZW0A 2AT3X 4QYNA 1W5RA 3BU9A 1PTSA 1B8EA 1MM9A 2IZAA 1RSUB 2JW1A 3F8AA 4XMDA 4FBRA 4ORSA 5EZ2A 3RDSA 5L8NA 1GT5A 1SREA 4ZGUA 4AYHA 3PP6A 1E06A 4EEJA 2VDFA 3EYCA 1KZWA 1HBQA 3C77X 5FAZA 3WJFA 4YCHA 2ALLX 3WOVA 3CWKA 3TGBA 2OFBA 4YCEA 1HMRA 5KICA 1KZXA 1IFCA 1BSOA 3WBGA 3I0AA 5D48A 2RQ0A 3RDUA 3WZQA 5D8JA 5B2AO 4OELA 2HYSA 5IXGA 4QGVA 2FT9A 2BT9A 3FW4A 3OE3A 4EDEA 1LKEA 1FELA 2A0AA 2JN3A 2L9CA 4NLIA 1HQQA 4KCAA 1AQBA 5HA1A 1O1UA 4O4OA 4FBVA 1ZNGA 4ZR2A 2OY5O 2OY1O 4YBUA 2WR6A 3TGCA 2K23A 1N43A 2XKLA 1K3BA 3O22A 1FENA 2RCTA 3FA9A 4CV7A 2GTLO 4HPCA 4O9SA 2FWVA 3RWXA 2IZBA 1DZMA 4ZHDA 1OEKA 1TXLA 2AL0X 5B27A 4GNYA 4TKJA 1A2DA 2PI3O 5F6ZA 4BCSA 4CPFA 2HZRA 4Y0RA 4BGFA 4YVBA 1FE3A 3CR6A 4Y0QA 1N7YA 2JOZA 1SWJA 5D45A 1YIVA 3O2YA 4IRWA 5EDCA 2W2AA 4YGHA 5HZ6A 3NR3A 4YBPA 4GGZA 4D6BA 2WSJA 4ZFXA 2ACOA 2RD7C 4NV7A 3CBCA 4YFPA 1D2UA 1DFVA 4AZNA 1YWAA 2RTIB 4MVIA 1DC9A 1X8NA 4BOEA 1VWNB 1LDOA 1GX9A 3RDOA 3FIQA 1Y9LA 2YMSA 3N91A 3APWA 3VG2A 4ZGFA 1ZNKA 1P6PA 4IB7A 4Y0SA 3VHMA 5DPQA 1IFBA 2DM5A 5LJBA 1VWPB 1JJXA 1SWNA 4ZCBA 1GT1A 1VWMB 3T2WA 4U8UM 4U8UN 5CE4A 4WHIA 4IB9A 2RTJA 2RTNB 1LFOA 1RXKA 1CJ5A 1GXAA 3VG6A 1X71A 1DZPA 1OPBA 1HBPA 3FMZA 3HWDA 2Y3EA 1IKJA 3HOEA 4I9SA 1RXJA 1EW3A 1VWFB 4CDEA 1SXYA 5K67A 3EM0A 3P02A 5LKEA 4YKOA 5L8IA 4ORWA 3ZW1A 2UZ2A 1OBUA 5LJKA 2POAA 4TLJA 4L1NA 5HTDA 1MK5A 2G8CO 2VFBA 1VYFA 3NBXX 1NQNA 1LIBA 4IBAA 4IABA 3ZWEA 1MVGA 1TOUA 4LQZA 1JJJA 3PQUA 4CDFA 4BQUA 1MDCA 2KW1A 1SY2A 2OFRX 3APVA 1X8UA 1G74A 2IZFB 2AF5A 1KT5A 1A18A 2OFMX 2WEXA 4LZUA 1EALA 2ZAIA 1ZNHA 1SLFB 4YFRA 4O3ZA 1Y53X 5HBSA 1SLDB 3FA7A 2F09A 4HFOA 1N0SA 4CK4A 3BDRA 3WXQA 1N9MA 2FR3A 3LHNA 4I9RA 2LBAA 2CAMA 2CZTA 2G7BA 4NNSA 4OKAA 2QOSC 1SRFA 2DJGA 3CKFA 3K3LA 1QG5A 2NP1A 3B2HA 1UYOX 4LZVA 3TZSA 2NNEA 4O4XA 2IZKA 1IW2A 2FRSA 2RN4A 1BSYA 2X55A 4GDZA 4QQ1A 1BLRA 3STKA 1ZRYA 5F58A 3WJCA 1EQDA 4IB6A 4DQ4A 1VWRB 4Y5DA 4DQ3A 1VWHB 1XCAA 1X8QA 4M7MA 4RUUA 5F7GA 2FKJA 1QY2A 2OL8O 3LTWA 1HN2A 3NADA 1SA8A 3BS2A 4Z28A 4YMYA 4YDAA 3KFIA 4BX7A 4ALBA 1UZ2X 4OS8A 2BHVA 4CPHA 3CKGA 3FIDA 3PECA 4ID2A 5IRUA 1S7DA 1DF8A 4ZH6A 5HWZA 4ORXA 4BX6A 1YWCA 4BX6B 3TF6A 2OL7A 1STRB 3ZW0B 1B56A 2GTLN 3WZNA 1KFFA 1QWDA 2OVSA 1LF7A 1SWKA 1SLGB 3CBSA 1MEPA 4GJSA 4QNIA 1N4JA 1T8VA 4JO6A 3U0DA 4UU2A 4GZVA 1SWBA 3AUMO 2X56A 4O4UA 1KL4A 2RTCB 2RTEB 3SOTA 2RTMA 1EUOA 3RDXA 1MX7A 1QQSA 4XMHA 3D97A 5L3YA 5FQ8E 4KH8A 4XMEA 4CDCA 2CM9A 1DZKA 1SRGA 4DNEA 3FEPA 2FHNX 2AVIA 4EFGA 1IKEA 1SWAA 2LA7A 2UYWA 3O19A 4K19A 2RTOB 1BBPA 2OYBO 2OL6O 3KFGA 1OBPA 1SMPI 1YUPA 3I17A 3P6GA 2RTFB 1ACDA 5KHPA 1WBIA 1YP7A 5F2BA 4QAEA 3RE5A 1E5PA 4ZH9A 2I5VO 4LKTA 3DTQA 1PEEA 1KT7A 1SXUA 1MUPA 2CZUA 3QKGA 1VWKB 1GKAA 2X46A 1VWOB 4GH7A 1SWHA 5HZ9A 1JQPA 4IMOA 1ADLA 1NDJA 1VWEB 2X8SA 5AJBA 2G78A 3C76X 3P6HA 1I4UA 3GE2A 1ZNLA 2IZHB 5BVTA 5FQ7E 3PK2A 2A5CA 1VWIB 5L8OA 3CQRA 3KVNA 2IZDB 2XSTA 2C1QA 4GDAA 3VG4A 4MVEA 1BSQA 1GX8A 1SWFA 1NGLA 1UYNX 2A13A 4ORYA 2MHDA 3EBKA 3EMMA 1I06A 1X8PA 4XMGA 2X8FA 5KIDA 2A5BA 1D3SA 4GK9A 2FS6A 2GC9A 1XKIA 5C0NA 2IFBA 1ERXA 1LELA 1LNMA 2K62A 4TKBA 1X8OA 3P24A 1PM1X 3WJBA 1SXXA 1KT4A 1LUQA 3BSZE 1O1VA 2NNQA 3NPOA 5F1EA 3WJGA 3BRNA 5FFHA 3SLOA 3PDFA 1AVGI 1JYDA 3RDMA 4KIIA 3RY2A 4M6SA 1VWJB 3AKMA 3S60A 1OSPO 4FGIB 2CBSA 4IMNA 1Z24A 2Q4NA 5AEOA 3PH6A 1DZJA 4HPDA 2Q2PA 3FA8A 4GJVA 1NP1A 4HWMA 4I6SA 4GD9A 4QYPA 3RBYA 1CBIA 1EIOA 3B2KA 1KL3A 3T6LA 1JZUA 2F73A 5IO7A 4A1HA 1BRPA 2AKQA 2RTHB 2QO5A 1IIUA 3FELA 2L68A 2OF8A 1E00A 5B29A 1S44A 3HOLA 2M4LA 4Z2PA 1QY1A 2JU7A 2AT6X 3FR4A 4U46A 2Q9SA 4NLJA 1LIEA 3FENA 3U9PC 4R0BA 1VYGA 1SWUA 2HMBA 2FS7A 3HWEA 4MIRA 4O3XB 3T1DA 2C4IA 1G5WA 2FKGA 1EPBA 3NQKA 2BC3A 1QABE 4MEEA 4O4SA 1W4TA 1TOWA 2OF9A 4ORRA 2X4MA 2L67A 1ICNA 2LBVA 3WJDA 3OJYC 5JR8A 4ZHFA 4ARHA 2X45A 2GJ5A 4D6AA 2RTKA 3VE2A 5HZQA 2RA6A 4I3DA 4OMWA 2ASNX 4NP1A 3ZW1B 1BJ7A 2NNDA 1U0XA 4O3WA 3HK1A 1FEMA 1UREA 2IZLB 3NQ3A 1DV9A 5CHKA 4CDDA 3UEWA 4HPAA 2KTSA 1VWAB 4HPBA 4KT5A 3IFBA 4GNWA 1GM6A 4ORUA 3WJEA 4AW8A 2JGSA 4FQBB 3NX1A 1NC9A 2FTBA 3LV4A 3MVFA 1LCVA 5H9NA 3SZHA 3ZW2A 1NP4A 2KTDA 1HQPA 2P8GA 1SY3A 1W6FA 3P6FA 4O49A 1OEJA 5B3MO 3T2XA 3BX8A 1OPAA 3UEXA 1JMXA 1SWSA 1G7NA 3VE1A 3WZPA 3U03A 1B0OA 2QM9A 4ES7A 1R0UA 1X89A 1A57A 1ZNEA 3X00A 2OZQA 1VWBB 5HCDC 2OY8A 5EDBA 3CMPA 2GTFX 4ZHCA 3RDQA 2RCQA 1AELA 1SWPA 2HLVA 2MO5A 3FA6A 4CPIA 2LKKA 4GE1A 4YFQA 3RE6A 3ZQ3A 1LPJA 4EQAC 1KGLA 4WFUA 3P6EA 4BBOA 5AJCA 4BVMA 4BX5B 4BX5A 4DCBA 5FENA 5LJHA 3EW1A 1NBXA 1VWLB 3H3IA 1T0VA 4QGWA 1WUBA 4WBKA 5LKFA 3B2IA 3AKNA 1I05A 3CQNA 2HKDA 3E3CA 5HCEC 4Z6JA 2WWPA 4MVKA 4BX7B 1SWQA 3VHIA 4CPHB 1ALBA 1KQXA 2CM4A 4TNNA 1DF3A 4A1YA 1SRJA 3KFFA 2YG2A 2GTLM 1KXOA 3ZUOA 4ON1A 4NYRA 3UEUA 3APXA 1VWGB 2QMIA 5LJDA 4EKVA 1KL5A 3FLLA 1A3YA 1I78A 1AVEA 2VFCA 1JV4A 3EC5A 1STSB 3GAQA 4I95A 4U9CA 5LJEA 4Z2OA 1SWEA 1SWCA 1VWCB 2QO6A 5CSEA 2WPUA 2WEWA 2EU7X 4NNTA 4IAWA 2RTDB 4GUZA 3BX7A 2O62A 2RTBB 1YP6A 2Y32A 1BM5A 3KZAA 2W2BA 4BJ8A 1LCWA 3EW2A 1Y55X 5BYPA 1EI5A 1SRHA 3S26A 2R73A 2A8GA 4IB8A 1L6MA 1LIFA 3MBTA 4NYQA 3SAOA 3VHHA 4XMFA 1GKAB 5IRWA 4MVLA 2AT5X 3PQSA 4NW4A 3Q6LA 3S5XA 1KT3A 5CYBA 2MF6A 2DJFA 5DG4A 3MG5A 2LFOA 1HMSA 1IJ8A 1AVDA 4WFVA 2X34A 1SWDA 3JSQA 3HPEA 2CBRA 1RAVA 1CBRA 1ZNDA 2BSZA 4I60A 4U3QA 1SWRA 5IRAA 3HTYA 3D4RA 3FR5A 1MOYA 3NP1A 3RZYA 1BRQA 4AZQA 2G79A 2Z4IA 3IA8A 2IZIA 1SWOA 4XMCA
chains in the Genus database with same CATH topology
3FR2A 1O8VA 2Z4HA 4ALOA 2ANSA 4EXZA 2FLJA 2MWHA 1LICA 2ZAGA 4YGZA 2BS6A 4GU8A 3JS1A 1ERBA 2QO4A 2WQAE 1B4MA 1U17A 3P6DA 1U18A 3VPJE 3NQ9A 1GT3A 1KQWA 3F6ZB 4ZHGA 1VPRA 3TGAA 4L3RA 4AZOA 5D4AA 3VU1A 1E02A 1JYJA 3OD9A 2X8TA 5D47A 1Y9TA 3S5VA 1FTPA 2FR2A 1TW4A 5LJGA 2E4JA 4YGGA 1G85A 4IAXA 1JBHA 1FDQA 4ML7B 1SY1A 3FYFA 3ELXA 5BVQA 3UAQA 2HNXA 4QRLA 4GKCA 3STNA 3VG7A 4A60A 4AZRA 2OVDA 2OVEA 4MISA 3PH5A 3PPTA 2A2GA 3RKGA 4OMXA 1MX8A 4A8ZA 2WUTA 3EBWA 2JU3A 2WQ9A 4PSQA 1PBOA 1CBQA 4JGLA 2MJIA 4TQ2A 3STMX 1RBPA 2KT4B 1CRBA 1ML7A 2Q2MA 2R74A 4GETA 4I3BA 4PJ2A 3RSWA 3V8UA 2OVAA 1LIDA 1H91A 5HAEA 5H8TA 1OBQA 5HTEA 1AB0A 1S2PA 1YWDA 1CBSA 4Y0PA 5EEDA 2AH7X 5HZ8A 4OS0A 1EXSA 1SXWA 2AT0X 4COTA 1BEBA 3PEDA 1KT6A 1QFTA 5F6BA 4ZJ0A 3KFHA 5H9AA 1SY0A 3DSZA 3HWGA 1QY0A 5BVSA 2PY1A 3C78X 5LJCA 4N7DA 3JQOA 4INNA 4YH0A 1EIIA 3B2LA 3FW5A 2L5PA 1TVQA 4O3YA 3HWFA 1QFVA 5IO5A 4RUNA 3WVMA 1KOIA 1JIWI 4FBOA 3BU1A 4I3CA 2N93A 3B2JA 4TKHA 5FQ6E 4N7CA 2LB6A 3APUA 5HZ5A 5IO6A 3BLGA 5HA0A 1PMPA 1T68X 4LKPA 1OEEA 4YDBA 3F9DA 2A2UA 2W2FA 1ICMA 1GT4A 2JMBA 2MM3A 3UEVA 3FEKA 1I04A 2R56A 3ZI8A 5AQ6A 1YWBA 2ACPX 4ZHHA 1GGLA 2BLGA 4QZTA 4U8UO 3D95A 4ODDA 3D96A 1HMTA 4YKMA 5EPQA 4QZUA 2BS5A 2Q39A 3OBLA 3P6CA 5H9LA 4CSBA 3BY0A 5K06A 4OS3A 3ZZVA 2HZQA 2KD2A 2AT8X 2A3FX 4GRJA 4TJZA 1EPAA 3ELZA 3VG3A 3ZUIA 2AMMX 3VG5A 2JU8A 4KC8A 5H9KA 3NX2A 3G7XA 3KQ0A 3MX7A 4KC7A 5EEEA 1RLBE 4AZPA 4QGXA 4AZMA 4UU3A 3L4RA 3ZW0A 2AT3X 4QYNA 3BU9A 1B8EA 2JW1A 3F8AA 4FBRA 4XMDA 4ORSA 5EZ2A 5L8NA 1GT5A 4ZGUA 4AYHA 3PP6A 1E06A 4EEJA 3EYCA 1KZWA 1HBQA 3C77X 5FAZA 3WJFA 4YCHA 2ALLX 3WOVA 3CWKA 3TGBA 4YCEA 1HMRA 5KICA 1KZXA 1IFCA 1BSOA 3WBGA 3I0AA 5D48A 2RQ0A 5D8JA 2HYSA 4QGVA 2FT9A 2BT9A 3FW4A 3OE3A 4EDEA 1LKEA 1FELA 2A0AA 2JN3A 2L9CA 4NLIA 4KCAA 1AQBA 5HA1A 1O1UA 4O4OA 4FBVA 1ZNGA 4ZR2A 4YBUA 2WR6A 3TGCA 2K23A 2XKLA 3O22A 1FENA 2RCTA 3FA9A 4CV7A 2GTLO 4HPCA 4O9SA 2FWVA 3RWXA 1DZMA 4ZHDA 1OEKA 1TXLA 2AL0X 5B27A 4GNYA 4TKJA 1A2DA 5F6ZA 2HZRA 4Y0RA 1FE3A 3CR6A 4Y0QA 2JOZA 5D45A 1YIVA 3O2YA 5EDCA 2W2AA 4YGHA 5HZ6A 3NR3A 4YBPA 4D6BA 2WSJA 4ZFXA 2ACOA 2RD7C 3CBCA 4YFPA 1D2UA 1DFVA 1YWAA 4MVIA 1DC9A 1X8NA 4BOEA 1GX9A 3FIQA 1Y9LA 2YMSA 3N91A 3APWA 3VG2A 4ZGFA 1ZNKA 1P6PA 4IB7A 4Y0SA 5LJBA 5DPQA 1IFBA 2DM5A 1JJXA 4ZCBA 1GT1A 4U8UM 4U8UN 5CE4A 4WHIA 4IB9A 1LFOA 1CJ5A 1GXAA 3VG6A 1X71A 1DZPA 1OPBA 1HBPA 3FMZA 3HWDA 1IKJA 3HOEA 4I9SA 1EW3A 1SXYA 3EM0A 3P02A 5LKEA 4YKOA 5L8IA 4ORWA 3ZW1A 1OBUA 5LJKA 2POAA 4TLJA 4L1NA 5HTDA 3NBXX 1VYFA 1LIBA 4IBAA 4IABA 3ZWEA 1MVGA 1TOUA 4LQZA 1JJJA 3PQUA 4BQUA 1MDCA 2KW1A 1SY2A 2OFRX 3APVA 1X8UA 1G74A 2OFMX 1KT5A 1A18A 2WEXA 4LZUA 1EALA 2ZAIA 1ZNHA 4YFRA 4O3ZA 5HBSA 3FA7A 2F09A 4HFOA 1N0SA 4CK4A 3BDRA 3WXQA 2FR3A 3LHNA 4I9RA 2LBAA 2CZTA 2G7BA 4NNSA 2QOSC 3K3LA 1QG5A 2NP1A 3B2HA 4LZVA 3TZSA 2NNEA 4O4XA 1IW2A 2FRSA 2RN4A 1BSYA 4QQ1A 4GDZA 1BLRA 3STKA 1ZRYA 5F58A 3WJCA 1EQDA 4IB6A 4DQ4A 4DQ3A 1XCAA 1X8QA 4M7MA 4RUUA 5F7GA 1QY2A 1HN2A 3NADA 1SA8A 3BS2A 4YMYA 4YDAA 3KFIA 4ALBA 1UZ2X 4OS8A 2BHVA 3PECA 4ID2A 4ZH6A 5HWZA 1S7DA 4ORXA 1YWCA 3TF6A 3ZW0B 1B56A 2GTLN 2OVSA 1QWDA 1LF7A 3CBSA 4QNIA 3U0DA 1T8VA 4UU2A 4GZVA 4O4UA 3SOTA 1EUOA 1MX7A 1QQSA 4XMHA 3D97A 5FQ8E 4KH8A 4XMEA 2CM9A 1DZKA 3FEPA 4EFGA 1IKEA 2LA7A 3O19A 4K19A 1BBPA 3KFGA 1OBPA 1SMPI 1YUPA 3I17A 3P6GA 5KHPA 1ACDA 1YP7A 4QAEA 1E5PA 4ZH9A 4LKTA 3DTQA 1PEEA 1KT7A 1SXUA 1MUPA 2CZUA 3QKGA 1GKAA 2X46A 4GH7A 5HZ9A 4IMOA 1ADLA 2X8SA 5AJBA 2G78A 3C76X 3P6HA 1I4UA 3GE2A 1ZNLA 5BVTA 5FQ7E 5L8OA 3CQRA 2XSTA 3VG4A 4MVEA 1BSQA 1GX8A 1NGLA 2A13A 4ORYA 2MHDA 3EBKA 3EMMA 1I06A 1X8PA 4XMGA 2X8FA 5KIDA 1D3SA 4GK9A 2FS6A 2GC9A 1XKIA 5C0NA 2IFBA 1ERXA 1LNMA 2K62A 4TKBA 1X8OA 3P24A 1PM1X 3WJBA 1SXXA 1KT4A 3BSZE 3NPOA 1O1VA 2NNQA 5F1EA 3WJGA 3BRNA 5FFHA 1AVGI 1JYDA 4KIIA 4M6SA 3AKMA 3S60A 4FGIB 2CBSA 4IMNA 1Z24A 2Q4NA 5AEOA 3PH6A 1DZJA 4HPDA 2Q2PA 3FA8A 4HWMA 1NP1A 3RBYA 4I6SA 1BWYA 4QYPA 1CBIA 1EIOA 3B2KA 1JZUA 2F73A 5IO7A 4A1HA 1BRPA 2AKQA 2QO5A 1IIUA 3FELA 2L68A 1E00A 5B29A 1S44A 3HOLA 2M4LA 1QY1A 2JU7A 2AT6X 3FR4A 2Q9SA 4NLJA 1LIEA 3FENA 3U9PC 4R0BA 1VYGA 2HMBA 2FS7A 3HWEA 4MIRA 4O3XB 3T1DA 1G5WA 1EPBA 3NQKA 3ZUOA 1QABE 4ORRA 4O4SA 4AZNA 1TOWA 3WJDA 1BM5A 2L67A 1ICNA 2LBVA 3OJYC 5JR8A 4ZHFA 4ARHA 2X45A 2GJ5A 4D6AA 3VE2A 5HZQA 2RA6A 4I3DA 4OMWA 2ASNX 4NP1A 3ZW1B 1BJ7A 2NNDA 1U0XA 4O3WA 3HK1A 1FEMA 1UREA 3NQ3A 1DV9A 3UEWA 4HPAA 2KTSA 4HPBA 4KT5A 3IFBA 4GNWA 1GM6A 4ORUA 3WJEA 4AW8A 4FQBB 3NX1A 2FTBA 3MVFA 3LV4A 5H9NA 3ZW2A 1NP4A 2KTDA 1HQPA 2P8GA 1SY3A 3P6FA 4O49A 1OEJA 3UEXA 3BX8A 1OPAA 3VE1A 3U03A 1G7NA 1B0OA 2QM9A 4ES7A 1R0UA 1X89A 1A57A 1ZNEA 2OZQA 5HCDC 5EDBA 3CMPA 2GTFX 4ZHCA 1AELA 2RCQA 2HLVA 2MO5A 3FA6A 2LKKA 4GE1A 4YFQA 3ZQ3A 4EQAC 1LPJA 1KGLA 4WFUA 3P6EA 4BVMA 5AJCA 5LJHA 5FENA 3H3IA 1T0VA 4QGWA 4WBKA 5LKFA 3B2IA 3AKNA 1I05A 3CQNA 5HCEC 3E3CA 2WWPA 4MVKA 1ALBA 1KQXA 2CM4A 4TNNA 1DF3A 4A1YA 3KFFA 2YG2A 2GTLM 1KXOA 4ON1A 4NYRA 3UEUA 3APXA 2QMIA 5LJDA 3FLLA 1A3YA 1JV4A 4I95A 3GAQA 4U9CA 5LJEA 2QO6A 2WEWA 2EU7X 4NNTA 4IAWA 3BX7A 2O62A 1YP6A 3KZAA 2W2BA 5BYPA 1EI5A 3S26A 2R73A 4IB8A 1L6MA 1LIFA 3MBTA 4NYQA 3SAOA 4XMFA 1GKAB 4MVLA 2AT5X 3PQSA 4NW4A 3Q6LA 3S5XA 1KT3A 5CYBA 5DG4A 2LFOA 1HMSA 4WFVA 3JSQA 2CBRA 1ZNDA 1CBRA 4U3QA 3HTYA 3D4RA 3FR5A 3NP1A 3RZYA 1BRQA 4AZQA 2G79A 2Z4IA 3IA8A 5HCCC 4XMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FR2 A;  1O8V A;  4ALO A;  2ANS A;  4EXZ A;  2FLJ A;  1LIC A;  4YGZ A;  3JS1 A;  1ERB A;  2QO4 A;  2WQA E;  1B4M A;  1U17 A;  3P6D A;  1U18 A;  3NQ9 A;  1GT3 A;  1KQW A;  4ZHG A;  1VPR A;  3TGA A;  4AZO A;  5D4A A;  1E02 A;  1JYJ A;  5D47 A;  1FTP A;  2FR2 A;  1TW4 A;  5LJG A;  2E4J A;  4YGG A;  1G85 A;  4IAX A;  1JBH A;  1FDQ A;  1SY1 A;  3ELX A;  5BVQ A;  2HNX A;  4AZR A;  4GKC A;  3STN A;  3VG7 A;  4A60 A;  2OVD A;  2OVE A;  3PH5 A;  3PPT A;  2A2G A;  4OMX A;  1MX8 A;  4A8Z A;  2WUT A;  3EBW A;  2JU3 A;  2WQ9 A;  4PSQ A;  1PBO A;  1CBQ A;  2MJI A;  4TQ2 A;  3STM X;  1RBP A;  2KT4 B;  1CRB A;  1ML7 A;  2Q2M A;  2R74 A;  4GET A;  4I3B A;  3RSW A;  2OVA A;  1LID A;  1H91 A;  5HAE A;  5H8T A;  1OBQ A;  5HTE A;  1AB0 A;  1S2P A;  1YWD A;  1CBS A;  4Y0P A;  5EED A;  2AH7 X;  5HZ8 A;  4OS0 A;  1EXS A;  1SXW A;  2AT0 X;  1BEB A;  3PED A;  1KT6 A;  1QFT A;  5F6B A;  4ZJ0 A;  3KFH A;  5H9A A;  1SY0 A;  3DSZ A;  3HWG A;  1QY0 A;  5BVS A;  2PY1 A;  3C78 X;  5LJC A;  4N7D A;  4YH0 A;  1EII A;  3B2L A;  3FW5 A;  2L5P A;  1TVQ A;  3HWF A;  1QFV A;  5IO5 A;  4RUN A;  3WVM A;  1KOI A;  3BU1 A;  4I3C A;  2N93 A;  3B2J A;  4TKH A;  4N7C A;  2LB6 A;  3APU A;  5HZ5 A;  5IO6 A;  3BLG A;  5HA0 A;  1PMP A;  1T68 X;  4LKP A;  1OEE A;  4YDB A;  3F9D A;  2A2U A;  2W2F A;  1ICM A;  1GT4 A;  2MM3 A;  3UEV A;  3FEK A;  1I04 A;  2R56 A;  5AQ6 A;  1YWB A;  2ACP X;  4ZHH A;  1GGL A;  2BLG A;  4QZT A;  3D95 A;  4ODD A;  3D96 A;  1HMT A;  4YKM A;  5EPQ A;  4QZU A;  2Q39 A;  3P6C A;  5H9L A;  3BY0 A;  5K06 A;  4OS3 A;  2HZQ A;  2AT8 X;  2A3F X;  4GRJ A;  4TJZ A;  1EPA A;  3ELZ A;  3VG3 A;  3ZUI A;  2AMM X;  3VG5 A;  2JU8 A;  5H9K A;  3NX2 A;  3G7X A;  3KQ0 A;  5EEE A;  4AZP A;  1RLB E;  4QGX A;  4AZM A;  4UU3 A;  3L4R A;  2AT3 X;  4QYN A;  3BU9 A;  1B8E A;  3F8A A;  4XMD A;  4ORS A;  5EZ2 A;  5L8N A;  1GT5 A;  4ZGU A;  4AYH A;  3PP6 A;  1E06 A;  4EEJ A;  3EYC A;  1KZW A;  1HBQ A;  3C77 X;  5FAZ A;  3WJF A;  4YCH A;  2ALL X;  3TGB A;  3CWK A;  4YCE A;  1HMR A;  5KIC A;  1KZX A;  1IFC A;  1BSO A;  3WBG A;  3I0A A;  5D48 A;  2RQ0 A;  5D8J A;  2HYS A;  4QGV A;  2FT9 A;  3FW4 A;  4EDE A;  1LKE A;  1FEL A;  2A0A A;  2JN3 A;  2L9C A;  4NLI A;  1AQB A;  5HA1 A;  1O1U A;  1ZNG A;  4ZR2 A;  4YBU A;  2WR6 A;  3TGC A;  2K23 A;  2XKL A;  3O22 A;  1FEN A;  2RCT A;  3FA9 A;  4O9S A;  4HPC A;  2FWV A;  1DZM A;  4ZHD A;  1OEK A;  1TXL A;  2AL0 X;  5B27 A;  4GNY A;  4TKJ A;  1A2D A;  5F6Z A;  2HZR A;  4Y0R A;  1FE3 A;  3CR6 A;  4Y0Q A;  2JOZ A;  5D45 A;  1YIV A;  3O2Y A;  5EDC A;  2W2A A;  4YGH A;  5HZ6 A;  3NR3 A;  4YBP A;  4D6B A;  2WSJ A;  4ZFX A;  2ACO A;  2RD7 C;  3CBC A;  4YFP A;  1D2U A;  1DFV A;  1YWA A;  4MVI A;  1DC9 A;  1X8N A;  4BOE A;  1GX9 A;  3FIQ A;  3APW A;  3VG2 A;  1ZNK A;  1P6P A;  4IB7 A;  4Y0S A;  5LJB A;  5DPQ A;  1IFB A;  2DM5 A;  1JJX A;  4ZCB A;  1GT1 A;  5CE4 A;  4IB9 A;  1LFO A;  1CJ5 A;  1GXA A;  3VG6 A;  1X71 A;  1DZP A;  1OPB A;  1HBP A;  3FMZ A;  3HWD A;  1IKJ A;  4I9S A;  1EW3 A;  1SXY A;  3EM0 A;  5LKE A;  4YKO A;  5L8I A;  4ORW A;  1OBU A;  5LJK A;  2POA A;  4TLJ A;  5HTD A;  1VYF A;  1LIB A;  4IBA A;  1MVG A;  1TOU A;  1JJJ A;  4BQU A;  1MDC A;  3APV A;  1SY2 A;  2OFR X;  1X8U A;  1G74 A;  2OFM X;  1KT5 A;  1A18 A;  2WEX A;  4LZU A;  1EAL A;  1ZNH A;  4YFR A;  5HBS A;  3FA7 A;  4HFO A;  1N0S A;  4CK4 A;  3BDR A;  3WXQ A;  2FR3 A;  4I9R A;  2LBA A;  2CZT A;  2G7B A;  4NNS A;  2QOS C;  3K3L A;  1QG5 A;  2NP1 A;  3B2H A;  4LZV A;  3TZS A;  2NNE A;  1IW2 A;  2FRS A;  1BSY A;  1BLR A;  3STK A;  1ZRY A;  5F58 A;  3WJC A;  1EQD A;  4IB6 A;  4DQ4 A;  4DQ3 A;  1XCA A;  1X8Q A;  4M7M A;  4RUU A;  5F7G A;  1QY2 A;  1HN2 A;  3NAD A;  1SA8 A;  3BS2 A;  4YMY A;  4YDA A;  3KFI A;  4ALB A;  1UZ2 X;  4OS8 A;  3PEC A;  4ZH6 A;  5HWZ A;  1S7D A;  4ORX A;  1YWC A;  3TF6 A;  1B56 A;  1QWD A;  1LF7 A;  3CBS A;  3U0D A;  1T8V A;  4UU2 A;  1EUO A;  1MX7 A;  1QQS A;  4XMH A;  3D97 A;  4XME A;  2CM9 A;  1DZK A;  3FEP A;  4EFG A;  1IKE A;  3O19 A;  4K19 A;  1BBP A;  3KFG A;  1OBP A;  1YUP A;  3I17 A;  3P6G A;  5KHP A;  1ACD A;  1YP7 A;  4QAE A;  1E5P A;  4ZH9 A;  4LKT A;  3DTQ A;  1PEE A;  1KT7 A;  1SXU A;  1MUP A;  2CZU A;  3QKG A;  1GKA A;  2X46 A;  4GH7 A;  5HZ9 A;  4IMO A;  1ADL A;  2G78 A;  3C76 X;  3P6H A;  1I4U A;  5BVT A;  1ZNL A;  5L8O A;  3CQR A;  2XST A;  3VG4 A;  1BSQ A;  1GX8 A;  1NGL A;  2A13 A;  4ORY A;  3EBK A;  3EMM A;  1I06 A;  1X8P A;  4XMG A;  5KID A;  1D3S A;  2FS6 A;  2GC9 A;  1XKI A;  5C0N A;  2IFB A;  1ERX A;  1LNM A;  2K62 A;  4TKB A;  1X8O A;  1PM1 X;  3WJB A;  1SXX A;  1KT4 A;  3BSZ E;  3NPO A;  1O1V A;  2NNQ A;  5F1E A;  3WJG A;  3BRN A;  5FFH A;  1AVG I;  1JYD A;  4KII A;  4M6S A;  3AKM A;  2CBS A;  4IMN A;  1Z24 A;  2Q4N A;  3PH6 A;  1DZJ A;  4HPD A;  2Q2P A;  3FA8 A;  1BWY A;  1NP1 A;  4QYP A;  1CBI A;  1EIO A;  3B2K A;  1JZU A;  2F73 A;  5IO7 A;  4A1H A;  1BRP A;  2AKQ A;  2QO5 A;  1IIU A;  3FEL A;  2L68 A;  1E00 A;  5B29 A;  1S44 A;  1QY1 A;  2JU7 A;  2AT6 X;  3FR4 A;  2Q9S A;  4NLJ A;  1LIE A;  3FEN A;  3U9P C;  4R0B A;  1VYG A;  2HMB A;  2FS7 A;  3HWE A;  3T1D A;  1G5W A;  1EPB A;  3ZUO A;  4AZN A;  1QAB E;  4ORR A;  1BM5 A;  1TOW A;  3WJD A;  2L67 A;  1ICN A;  2LBV A;  3OJY C;  5JR8 A;  4ZHF A;  4ARH A;  2X45 A;  2GJ5 A;  4D6A A;  5HZQ A;  2RA6 A;  4I3D A;  4OMW A;  2ASN X;  4NP1 A;  1BJ7 A;  2NND A;  1U0X A;  3HK1 A;  1FEM A;  1URE A;  3NQ3 A;  1DV9 A;  3UEW A;  4HPA A;  4HPB A;  3IFB A;  4GNW A;  1GM6 A;  4ORU A;  3WJE A;  4AW8 A;  3NX1 A;  2FTB A;  3MVF A;  5H9N A;  1NP4 A;  2KTD A;  1HQP A;  2P8G A;  1SY3 A;  3P6F A;  1OEJ A;  3UEX A;  3BX8 A;  1OPA A;  3U03 A;  1G7N A;  1B0O A;  2QM9 A;  4ES7 A;  1R0U A;  1X89 A;  1A57 A;  1ZNE A;  2OZQ A;  5HCD C;  5EDB A;  3CMP A;  2GTF X;  4ZHC A;  1AEL A;  2RCQ A;  2HLV A;  2MO5 A;  3FA6 A;  2LKK A;  4GE1 A;  4YFQ A;  3ZQ3 A;  1KGL A;  1LPJ A;  4WFU A;  3P6E A;  4BVM A;  5LJH A;  5FEN A;  1T0V A;  4QGW A;  4WBK A;  5LKF A;  3B2I A;  3AKN A;  1I05 A;  3CQN A;  5HCE C;  2WWP A;  4MVK A;  1ALB A;  1KQX A;  2CM4 A;  4TNN A;  1DF3 A;  4A1Y A;  3KFF A;  2YG2 A;  1KXO A;  4NYR A;  3UEU A;  3APX A;  5LJD A;  3FLL A;  1A3Y A;  1JV4 A;  3GAQ A;  5LJE A;  2QO6 A;  2WEW A;  2EU7 X;  4NNT A;  4IAW A;  3BX7 A;  2O62 A;  1YP6 A;  3KZA A;  2W2B A;  3S26 A;  2R73 A;  4IB8 A;  1L6M A;  1LIF A;  3MBT A;  4NYQ A;  3SAO A;  4XMF A;  1GKA B;  4MVL A;  2AT5 X;  3Q6L A;  1KT3 A;  5DG4 A;  2LFO A;  1HMS A;  4WFV A;  3JSQ A;  2CBR A;  1ZND A;  1CBR A;  3FR5 A;  3NP1 A;  3RZY A;  1BRQ A;  4AZQ A;  2G79 A;  3IA8 A;  5HCC C;  4XMC A; 
#chains in the Genus database with same CATH topology
 3FR2 A;  1O8V A;  1RXH A;  2RTP B;  2ANS A;  2GH7 A;  2Z4H A;  1PBY A;  4ALO A;  2FLJ A;  4EXZ A;  2MWH A;  2QCB A;  1HXL A;  4GGR A;  1LIC A;  2ZAG A;  4YGZ A;  2BS6 A;  1NQM A;  2G5L A;  4GU8 A;  3JS1 A;  1ERB A;  2QO4 A;  2WQA E;  3SZJ A;  1U17 A;  3P6D A;  1U18 A;  5HCC C;  1B4M A;  3VPJ E;  3NQ9 A;  1GT3 A;  1KQW A;  3F6Z B;  3RY1 A;  4ZHG A;  1VPR A;  1SRI A;  3TGA A;  4L3R A;  4AZO A;  5D4A A;  2IZE B;  3VU1 A;  1E02 A;  1JYJ A;  3OD9 A;  2X8T A;  2RTG B;  5D47 A;  3Q34 A;  1Y9T A;  3VGW A;  3S5V A;  1FTP A;  2FR2 A;  1TW4 A;  5LJG A;  2E4J A;  4YGG A;  1G85 A;  2RTL A;  2QOM A;  4IAX A;  1JBH A;  3T6F A;  1SWL A;  1FDQ A;  1JMZ A;  4ML7 B;  1SY1 A;  1K24 A;  3FYF A;  1SWT A;  3ELX A;  4NV8 A;  2HNX A;  5B11 O;  5BVQ A;  3UAQ A;  4QRL A;  4GKC A;  3STN A;  3VG7 A;  3WYQ A;  4A60 A;  3SLJ A;  4AZR A;  2OVD A;  3AEH A;  2OVE A;  4MIS A;  3PH5 A;  3PPT A;  4B55 A;  2A2G A;  3RKG A;  4OMX A;  1MX8 A;  4Z2V A;  4A8Z A;  2WUT A;  3EBW A;  5B5F A;  2JU3 A;  2WQ9 A;  4PSQ A;  1PBO A;  2F01 A;  1CBQ A;  1GX3 A;  2RTQ B;  4JGL A;  2MJI A;  4TQ2 A;  3STM X;  1N9Y A;  1RBP A;  2KT4 B;  1CRB A;  1ML7 A;  2Q2M A;  2R74 A;  1SWG A;  4GET A;  4I3B A;  4PJ2 A;  5B5G A;  3RSW A;  2OVA A;  1LID A;  3V8U A;  1HXZ A;  2OFA A;  1H91 A;  5HAE A;  1SLE B;  5H8T A;  1OBQ A;  5HTE A;  1RST B;  1AB0 A;  1S2P A;  1YWD A;  1CBS A;  4Y0P A;  2FHL A;  5EED A;  2AH7 X;  5HZ8 A;  4OS0 A;  1EXS A;  1SXW A;  5B10 O;  2AT0 X;  4COT A;  1FJ1 E;  3WZO A;  1BEB A;  3PED A;  1KT6 A;  1LDQ A;  1QFT A;  5F6B A;  4ZJ0 A;  3KFH A;  1BWY A;  2Y3F A;  5H9A A;  1SY0 A;  3DSZ A;  3HWG A;  1LCZ A;  1JJU A;  1QY0 A;  5BVS A;  4CPE A;  2PY1 A;  3C78 X;  5LJC A;  2X32 A;  4N7D A;  3JQO A;  4INN A;  3SZI A;  2OY7 A;  4YH0 A;  1EII A;  3B2L A;  3FW5 A;  2L5P A;  1TVQ A;  4O3Y A;  3HWF A;  5K68 A;  4GGT A;  4JHQ A;  1QFV A;  4OEM A;  3QQ2 A;  4Z27 A;  5IO5 A;  4RUN A;  3WVM A;  1KOI A;  1JIW I;  2IZJ A;  4FBO A;  3WYP A;  1Y0G A;  3BU1 A;  4I3C A;  2N93 A;  3B2J A;  1VWD B;  3SLT A;  2ZSC A;  4TKH A;  5FQ6 E;  4N7C A;  1Y52 X;  2LB6 A;  3APU A;  5HZ5 A;  2FGS A;  5IO6 A;  3BLG A;  4C5P A;  5HA0 A;  1PMP A;  1T68 X;  4LKP A;  1OEE A;  4YDB A;  3F9D A;  4AZP A;  2A2U A;  2W2F A;  1ICM A;  1GT4 A;  2JMB A;  2MM3 A;  3UEV A;  3FEK A;  1I04 A;  2R56 A;  3ZI8 A;  2RTR B;  3D9W A;  5AQ6 A;  1YWB A;  2ACP X;  4ZHH A;  1GGL A;  2BLG A;  4QZT A;  4U8U O;  1STP A;  3D95 A;  4ODD A;  3D96 A;  1HMT A;  4YKM A;  5EPQ A;  3FDC A;  2RTA A;  4QZU A;  2BS5 A;  2Q39 A;  3OBL A;  3P6C A;  5H9L A;  4CSB A;  3BY0 A;  5K06 A;  4OS3 A;  2I5Z O;  3ZZV A;  1I9H A;  2HZQ A;  2KD2 A;  5JD2 A;  4JNJ A;  1E2T A;  1VYO A;  2A3F X;  2AT8 X;  1EPA A;  3ELZ A;  4GRJ A;  1HY2 A;  2AMM X;  4TJZ A;  3VG3 A;  3ZUI A;  3MM0 A;  3VG5 A;  2JU8 A;  4KC8 A;  5H9K A;  3NX2 A;  2IZC B;  3G7X A;  3KQ0 A;  3MX7 A;  2C1S A;  1RLB E;  2IZG B;  4KC7 A;  4QGX A;  4Y59 A;  5EEE A;  1VWQ B;  4UU3 A;  4AZM A;  3L4R A;  3ZW0 A;  2AT3 X;  4QYN A;  1W5R A;  3BU9 A;  1PTS A;  1B8E A;  1MM9 A;  2IZA A;  1RSU B;  2JW1 A;  3F8A A;  4XMD A;  4FBR A;  4ORS A;  5EZ2 A;  3RDS A;  5L8N A;  1GT5 A;  1SRE A;  4ZGU A;  4AYH A;  3PP6 A;  1E06 A;  4EEJ A;  2VDF A;  3EYC A;  1KZW A;  1HBQ A;  3C77 X;  5FAZ A;  3WJF A;  4YCH A;  2ALL X;  3WOV A;  3CWK A;  3TGB A;  2OFB A;  4YCE A;  1HMR A;  5KIC A;  1KZX A;  1IFC A;  1BSO A;  3WBG A;  3I0A A;  5D48 A;  2RQ0 A;  3RDU A;  3WZQ A;  5D8J A;  5B2A O;  4OEL A;  2HYS A;  5IXG A;  4QGV A;  2FT9 A;  2BT9 A;  3FW4 A;  3OE3 A;  4EDE A;  1LKE A;  1FEL A;  2A0A A;  2JN3 A;  2L9C A;  4NLI A;  1HQQ A;  4KCA A;  1AQB A;  5HA1 A;  1O1U A;  4O4O A;  4FBV A;  1ZNG A;  4ZR2 A;  2OY5 O;  2OY1 O;  4YBU A;  2WR6 A;  3TGC A;  2K23 A;  1N43 A;  2XKL A;  1K3B A;  3O22 A;  1FEN A;  2RCT A;  3FA9 A;  4CV7 A;  2GTL O;  4HPC A;  4O9S A;  2FWV A;  3RWX A;  2IZB A;  1DZM A;  4ZHD A;  1OEK A;  1TXL A;  2AL0 X;  5B27 A;  4GNY A;  4TKJ A;  1A2D A;  2PI3 O;  5F6Z A;  4BCS A;  4CPF A;  2HZR A;  4Y0R A;  4BGF A;  4YVB A;  1FE3 A;  3CR6 A;  4Y0Q A;  1N7Y A;  2JOZ A;  1SWJ A;  5D45 A;  1YIV A;  3O2Y A;  4IRW A;  5EDC A;  2W2A A;  4YGH A;  5HZ6 A;  3NR3 A;  4YBP A;  4GGZ A;  4D6B A;  2WSJ A;  4ZFX A;  2ACO A;  2RD7 C;  4NV7 A;  3CBC A;  4YFP A;  1D2U A;  1DFV A;  4AZN A;  1YWA A;  2RTI B;  4MVI A;  1DC9 A;  1X8N A;  4BOE A;  1VWN B;  1LDO A;  1GX9 A;  3RDO A;  3FIQ A;  1Y9L A;  2YMS A;  3N91 A;  3APW A;  3VG2 A;  4ZGF A;  1ZNK A;  1P6P A;  4IB7 A;  4Y0S A;  3VHM A;  5DPQ A;  1IFB A;  2DM5 A;  5LJB A;  1VWP B;  1JJX A;  1SWN A;  4ZCB A;  1GT1 A;  1VWM B;  3T2W A;  4U8U M;  4U8U N;  5CE4 A;  4WHI A;  4IB9 A;  2RTJ A;  2RTN B;  1LFO A;  1RXK A;  1CJ5 A;  1GXA A;  3VG6 A;  1X71 A;  1DZP A;  1OPB A;  1HBP A;  3FMZ A;  3HWD A;  2Y3E A;  1IKJ A;  3HOE A;  4I9S A;  1RXJ A;  1EW3 A;  1VWF B;  4CDE A;  1SXY A;  5K67 A;  3EM0 A;  3P02 A;  5LKE A;  4YKO A;  5L8I A;  4ORW A;  3ZW1 A;  2UZ2 A;  1OBU A;  5LJK A;  2POA A;  4TLJ A;  4L1N A;  5HTD A;  1MK5 A;  2G8C O;  2VFB A;  1VYF A;  3NBX X;  1NQN A;  1LIB A;  4IBA A;  4IAB A;  3ZWE A;  1MVG A;  1TOU A;  4LQZ A;  1JJJ A;  3PQU A;  4CDF A;  4BQU A;  1MDC A;  2KW1 A;  1SY2 A;  2OFR X;  3APV A;  1X8U A;  1G74 A;  2IZF B;  2AF5 A;  1KT5 A;  1A18 A;  2OFM X;  2WEX A;  4LZU A;  1EAL A;  2ZAI A;  1ZNH A;  1SLF B;  4YFR A;  4O3Z A;  1Y53 X;  5HBS A;  1SLD B;  3FA7 A;  2F09 A;  4HFO A;  1N0S A;  4CK4 A;  3BDR A;  3WXQ A;  1N9M A;  2FR3 A;  3LHN A;  4I9R A;  2LBA A;  2CAM A;  2CZT A;  2G7B A;  4NNS A;  4OKA A;  2QOS C;  1SRF A;  2DJG A;  3CKF A;  3K3L A;  1QG5 A;  2NP1 A;  3B2H A;  1UYO X;  4LZV A;  3TZS A;  2NNE A;  4O4X A;  2IZK A;  1IW2 A;  2FRS A;  2RN4 A;  1BSY A;  2X55 A;  4GDZ A;  4QQ1 A;  1BLR A;  3STK A;  1ZRY A;  5F58 A;  3WJC A;  1EQD A;  4IB6 A;  4DQ4 A;  1VWR B;  4Y5D A;  4DQ3 A;  1VWH B;  1XCA A;  1X8Q A;  4M7M A;  4RUU A;  5F7G A;  2FKJ A;  1QY2 A;  2OL8 O;  3LTW A;  1HN2 A;  3NAD A;  1SA8 A;  3BS2 A;  4Z28 A;  4YMY A;  4YDA A;  3KFI A;  4BX7 A;  4ALB A;  1UZ2 X;  4OS8 A;  2BHV A;  4CPH A;  3CKG A;  3FID A;  3PEC A;  4ID2 A;  5IRU A;  1S7D A;  1DF8 A;  4ZH6 A;  5HWZ A;  4ORX A;  4BX6 A;  1YWC A;  4BX6 B;  3TF6 A;  2OL7 A;  1STR B;  3ZW0 B;  1B56 A;  2GTL N;  3WZN A;  1KFF A;  1QWD A;  2OVS A;  1LF7 A;  1SWK A;  1SLG B;  3CBS A;  1MEP A;  4GJS A;  4QNI A;  1N4J A;  1T8V A;  4JO6 A;  3U0D A;  4UU2 A;  4GZV A;  1SWB A;  3AUM O;  2X56 A;  4O4U A;  1KL4 A;  2RTC B;  2RTE B;  3SOT A;  2RTM A;  1EUO A;  3RDX A;  1MX7 A;  1QQS A;  4XMH A;  3D97 A;  5L3Y A;  5FQ8 E;  4KH8 A;  4XME A;  4CDC A;  2CM9 A;  1DZK A;  1SRG A;  4DNE A;  3FEP A;  2FHN X;  2AVI A;  4EFG A;  1IKE A;  1SWA A;  2LA7 A;  2UYW A;  3O19 A;  4K19 A;  2RTO B;  1BBP A;  2OYB O;  2OL6 O;  3KFG A;  1OBP A;  1SMP I;  1YUP A;  3I17 A;  3P6G A;  2RTF B;  1ACD A;  5KHP A;  1WBI A;  1YP7 A;  5F2B A;  4QAE A;  3RE5 A;  1E5P A;  4ZH9 A;  2I5V O;  4LKT A;  3DTQ A;  1PEE A;  1KT7 A;  1SXU A;  1MUP A;  2CZU A;  3QKG A;  1VWK B;  1GKA A;  2X46 A;  1VWO B;  4GH7 A;  1SWH A;  5HZ9 A;  1JQP A;  4IMO A;  1ADL A;  1NDJ A;  1VWE B;  2X8S A;  5AJB A;  2G78 A;  3C76 X;  3P6H A;  1I4U A;  3GE2 A;  1ZNL A;  2IZH B;  5BVT A;  5FQ7 E;  3PK2 A;  2A5C A;  1VWI B;  5L8O A;  3CQR A;  3KVN A;  2IZD B;  2XST A;  2C1Q A;  4GDA A;  3VG4 A;  4MVE A;  1BSQ A;  1GX8 A;  1SWF A;  1NGL A;  1UYN X;  2A13 A;  4ORY A;  2MHD A;  3EBK A;  3EMM A;  1I06 A;  1X8P A;  4XMG A;  2X8F A;  5KID A;  2A5B A;  1D3S A;  4GK9 A;  2FS6 A;  2GC9 A;  1XKI A;  5C0N A;  2IFB A;  1ERX A;  1LEL A;  1LNM A;  2K62 A;  4TKB A;  1X8O A;  3P24 A;  1PM1 X;  3WJB A;  1SXX A;  1KT4 A;  1LUQ A;  3BSZ E;  1O1V A;  2NNQ A;  3NPO A;  5F1E A;  3WJG A;  3BRN A;  5FFH A;  3SLO A;  3PDF A;  1AVG I;  1JYD A;  3RDM A;  4KII A;  3RY2 A;  4M6S A;  1VWJ B;  3AKM A;  3S60 A;  1OSP O;  4FGI B;  2CBS A;  4IMN A;  1Z24 A;  2Q4N A;  5AEO A;  3PH6 A;  1DZJ A;  4HPD A;  2Q2P A;  3FA8 A;  4GJV A;  1NP1 A;  4HWM A;  4I6S A;  4GD9 A;  4QYP A;  3RBY A;  1CBI A;  1EIO A;  3B2K A;  1KL3 A;  3T6L A;  1JZU A;  2F73 A;  5IO7 A;  4A1H A;  1BRP A;  2AKQ A;  2RTH B;  2QO5 A;  1IIU A;  3FEL A;  2L68 A;  2OF8 A;  1E00 A;  5B29 A;  1S44 A;  3HOL A;  2M4L A;  4Z2P A;  1QY1 A;  2JU7 A;  2AT6 X;  3FR4 A;  4U46 A;  2Q9S A;  4NLJ A;  1LIE A;  3FEN A;  3U9P C;  4R0B A;  1VYG A;  1SWU A;  2HMB A;  2FS7 A;  3HWE A;  4MIR A;  4O3X B;  3T1D A;  2C4I A;  1G5W A;  2FKG A;  1EPB A;  3NQK A;  2BC3 A;  1QAB E;  4MEE A;  4O4S A;  1W4T A;  1TOW A;  2OF9 A;  4ORR A;  2X4M A;  2L67 A;  1ICN A;  2LBV A;  3WJD A;  3OJY C;  5JR8 A;  4ZHF A;  4ARH A;  2X45 A;  2GJ5 A;  4D6A A;  2RTK A;  3VE2 A;  5HZQ A;  2RA6 A;  4I3D A;  4OMW A;  2ASN X;  4NP1 A;  3ZW1 B;  1BJ7 A;  2NND A;  1U0X A;  4O3W A;  3HK1 A;  1FEM A;  1URE A;  2IZL B;  3NQ3 A;  1DV9 A;  5CHK A;  4CDD A;  3UEW A;  4HPA A;  2KTS A;  1VWA B;  4HPB A;  4KT5 A;  3IFB A;  4GNW A;  1GM6 A;  4ORU A;  3WJE A;  4AW8 A;  2JGS A;  4FQB B;  3NX1 A;  1NC9 A;  2FTB A;  3LV4 A;  3MVF A;  1LCV A;  5H9N A;  3SZH A;  3ZW2 A;  1NP4 A;  2KTD A;  1HQP A;  2P8G A;  1SY3 A;  1W6F A;  3P6F A;  4O49 A;  1OEJ A;  5B3M O;  3T2X A;  3BX8 A;  1OPA A;  3UEX A;  1JMX A;  1SWS A;  1G7N A;  3VE1 A;  3WZP A;  3U03 A;  1B0O A;  2QM9 A;  4ES7 A;  1R0U A;  1X89 A;  1A57 A;  1ZNE A;  3X00 A;  2OZQ A;  1VWB B;  5HCD C;  2OY8 A;  5EDB A;  3CMP A;  2GTF X;  4ZHC A;  3RDQ A;  2RCQ A;  1AEL A;  1SWP A;  2HLV A;  2MO5 A;  3FA6 A;  4CPI A;  2LKK A;  4GE1 A;  4YFQ A;  3RE6 A;  3ZQ3 A;  1LPJ A;  4EQA C;  1KGL A;  4WFU A;  3P6E A;  4BBO A;  5AJC A;  4BVM A;  4BX5 B;  4BX5 A;  4DCB A;  5FEN A;  5LJH A;  3EW1 A;  1NBX A;  1VWL B;  3H3I A;  1T0V A;  4QGW A;  1WUB A;  4WBK A;  5LKF A;  3B2I A;  3AKN A;  1I05 A;  3CQN A;  2HKD A;  3E3C A;  5HCE C;  4Z6J A;  2WWP A;  4MVK A;  4BX7 B;  1SWQ A;  3VHI A;  4CPH B;  1ALB A;  1KQX A;  2CM4 A;  4TNN A;  1DF3 A;  4A1Y A;  1SRJ A;  3KFF A;  2YG2 A;  2GTL M;  1KXO A;  3ZUO A;  4ON1 A;  4NYR A;  3UEU A;  3APX A;  1VWG B;  2QMI A;  5LJD A;  4EKV A;  1KL5 A;  3FLL A;  1A3Y A;  1I78 A;  1AVE A;  2VFC A;  1JV4 A;  3EC5 A;  1STS B;  3GAQ A;  4I95 A;  4U9C A;  5LJE A;  4Z2O A;  1SWE A;  1SWC A;  1VWC B;  2QO6 A;  5CSE A;  2WPU A;  2WEW A;  2EU7 X;  4NNT A;  4IAW A;  2RTD B;  4GUZ A;  3BX7 A;  2O62 A;  2RTB B;  1YP6 A;  2Y32 A;  1BM5 A;  3KZA A;  2W2B A;  4BJ8 A;  1LCW A;  3EW2 A;  1Y55 X;  5BYP A;  1EI5 A;  1SRH A;  3S26 A;  2R73 A;  2A8G A;  4IB8 A;  1L6M A;  1LIF A;  3MBT A;  4NYQ A;  3SAO A;  3VHH A;  4XMF A;  1GKA B;  5IRW A;  4MVL A;  2AT5 X;  3PQS A;  4NW4 A;  3Q6L A;  3S5X A;  1KT3 A;  5CYB A;  2MF6 A;  2DJF A;  5DG4 A;  3MG5 A;  2LFO A;  1HMS A;  1IJ8 A;  1AVD A;  4WFV A;  2X34 A;  1SWD A;  3JSQ A;  3HPE A;  2CBR A;  1RAV A;  1CBR A;  1ZND A;  2BSZ A;  4I60 A;  4U3Q A;  1SWR A;  5IRA A;  3HTY A;  3D4R A;  3FR5 A;  1MOY A;  3NP1 A;  3RZY A;  1BRQ A;  4AZQ A;  2G79 A;  2Z4I A;  3IA8 A;  2IZI A;  1SWO A;  4XMC A; 
#chains in the Genus database with same CATH homology
 3FR2 A;  1O8V A;  2Z4H A;  4ALO A;  2ANS A;  4EXZ A;  2FLJ A;  2MWH A;  1LIC A;  2ZAG A;  4YGZ A;  2BS6 A;  4GU8 A;  3JS1 A;  1ERB A;  2QO4 A;  2WQA E;  1B4M A;  1U17 A;  3P6D A;  1U18 A;  3VPJ E;  3NQ9 A;  1GT3 A;  1KQW A;  3F6Z B;  4ZHG A;  1VPR A;  3TGA A;  4L3R A;  4AZO A;  5D4A A;  3VU1 A;  1E02 A;  1JYJ A;  3OD9 A;  2X8T A;  5D47 A;  1Y9T A;  3S5V A;  1FTP A;  2FR2 A;  1TW4 A;  5LJG A;  2E4J A;  4YGG A;  1G85 A;  4IAX A;  1JBH A;  1FDQ A;  4ML7 B;  1SY1 A;  3FYF A;  3ELX A;  5BVQ A;  3UAQ A;  2HNX A;  4QRL A;  4GKC A;  3STN A;  3VG7 A;  4A60 A;  4AZR A;  2OVD A;  2OVE A;  4MIS A;  3PH5 A;  3PPT A;  2A2G A;  3RKG A;  4OMX A;  1MX8 A;  4A8Z A;  2WUT A;  3EBW A;  2JU3 A;  2WQ9 A;  4PSQ A;  1PBO A;  1CBQ A;  4JGL A;  2MJI A;  4TQ2 A;  3STM X;  1RBP A;  2KT4 B;  1CRB A;  1ML7 A;  2Q2M A;  2R74 A;  4GET A;  4I3B A;  4PJ2 A;  3RSW A;  3V8U A;  2OVA A;  1LID A;  1H91 A;  5HAE A;  5H8T A;  1OBQ A;  5HTE A;  1AB0 A;  1S2P A;  1YWD A;  1CBS A;  4Y0P A;  5EED A;  2AH7 X;  5HZ8 A;  4OS0 A;  1EXS A;  1SXW A;  2AT0 X;  4COT A;  1BEB A;  3PED A;  1KT6 A;  1QFT A;  5F6B A;  4ZJ0 A;  3KFH A;  5H9A A;  1SY0 A;  3DSZ A;  3HWG A;  1QY0 A;  5BVS A;  2PY1 A;  3C78 X;  5LJC A;  4N7D A;  3JQO A;  4INN A;  4YH0 A;  1EII A;  3B2L A;  3FW5 A;  2L5P A;  1TVQ A;  4O3Y A;  3HWF A;  1QFV A;  5IO5 A;  4RUN A;  3WVM A;  1KOI A;  1JIW I;  4FBO A;  3BU1 A;  4I3C A;  2N93 A;  3B2J A;  4TKH A;  5FQ6 E;  4N7C A;  2LB6 A;  3APU A;  5HZ5 A;  5IO6 A;  3BLG A;  5HA0 A;  1PMP A;  1T68 X;  4LKP A;  1OEE A;  4YDB A;  3F9D A;  2A2U A;  2W2F A;  1ICM A;  1GT4 A;  2JMB A;  2MM3 A;  3UEV A;  3FEK A;  1I04 A;  2R56 A;  3ZI8 A;  5AQ6 A;  1YWB A;  2ACP X;  4ZHH A;  1GGL A;  2BLG A;  4QZT A;  4U8U O;  3D95 A;  4ODD A;  3D96 A;  1HMT A;  4YKM A;  5EPQ A;  4QZU A;  2BS5 A;  2Q39 A;  3OBL A;  3P6C A;  5H9L A;  4CSB A;  3BY0 A;  5K06 A;  4OS3 A;  3ZZV A;  2HZQ A;  2KD2 A;  2AT8 X;  2A3F X;  4GRJ A;  4TJZ A;  1EPA A;  3ELZ A;  3VG3 A;  3ZUI A;  2AMM X;  3VG5 A;  2JU8 A;  4KC8 A;  5H9K A;  3NX2 A;  3G7X A;  3KQ0 A;  3MX7 A;  4KC7 A;  5EEE A;  1RLB E;  4AZP A;  4QGX A;  4AZM A;  4UU3 A;  3L4R A;  3ZW0 A;  2AT3 X;  4QYN A;  3BU9 A;  1B8E A;  2JW1 A;  3F8A A;  4FBR A;  4XMD A;  4ORS A;  5EZ2 A;  5L8N A;  1GT5 A;  4ZGU A;  4AYH A;  3PP6 A;  1E06 A;  4EEJ A;  3EYC A;  1KZW A;  1HBQ A;  3C77 X;  5FAZ A;  3WJF A;  4YCH A;  2ALL X;  3WOV A;  3CWK A;  3TGB A;  4YCE A;  1HMR A;  5KIC A;  1KZX A;  1IFC A;  1BSO A;  3WBG A;  3I0A A;  5D48 A;  2RQ0 A;  5D8J A;  2HYS A;  4QGV A;  2FT9 A;  2BT9 A;  3FW4 A;  3OE3 A;  4EDE A;  1LKE A;  1FEL A;  2A0A A;  2JN3 A;  2L9C A;  4NLI A;  4KCA A;  1AQB A;  5HA1 A;  1O1U A;  4O4O A;  4FBV A;  1ZNG A;  4ZR2 A;  4YBU A;  2WR6 A;  3TGC A;  2K23 A;  2XKL A;  3O22 A;  1FEN A;  2RCT A;  3FA9 A;  4CV7 A;  2GTL O;  4HPC A;  4O9S A;  2FWV A;  3RWX A;  1DZM A;  4ZHD A;  1OEK A;  1TXL A;  2AL0 X;  5B27 A;  4GNY A;  4TKJ A;  1A2D A;  5F6Z A;  2HZR A;  4Y0R A;  1FE3 A;  3CR6 A;  4Y0Q A;  2JOZ A;  5D45 A;  1YIV A;  3O2Y A;  5EDC A;  2W2A A;  4YGH A;  5HZ6 A;  3NR3 A;  4YBP A;  4D6B A;  2WSJ A;  4ZFX A;  2ACO A;  2RD7 C;  3CBC A;  4YFP A;  1D2U A;  1DFV A;  1YWA A;  4MVI A;  1DC9 A;  1X8N A;  4BOE A;  1GX9 A;  3FIQ A;  1Y9L A;  2YMS A;  3N91 A;  3APW A;  3VG2 A;  4ZGF A;  1ZNK A;  1P6P A;  4IB7 A;  4Y0S A;  5LJB A;  5DPQ A;  1IFB A;  2DM5 A;  1JJX A;  4ZCB A;  1GT1 A;  4U8U M;  4U8U N;  5CE4 A;  4WHI A;  4IB9 A;  1LFO A;  1CJ5 A;  1GXA A;  3VG6 A;  1X71 A;  1DZP A;  1OPB A;  1HBP A;  3FMZ A;  3HWD A;  1IKJ A;  3HOE A;  4I9S A;  1EW3 A;  1SXY A;  3EM0 A;  3P02 A;  5LKE A;  4YKO A;  5L8I A;  4ORW A;  3ZW1 A;  1OBU A;  5LJK A;  2POA A;  4TLJ A;  4L1N A;  5HTD A;  3NBX X;  1VYF A;  1LIB A;  4IBA A;  4IAB A;  3ZWE A;  1MVG A;  1TOU A;  4LQZ A;  1JJJ A;  3PQU A;  4BQU A;  1MDC A;  2KW1 A;  1SY2 A;  2OFR X;  3APV A;  1X8U A;  1G74 A;  2OFM X;  1KT5 A;  1A18 A;  2WEX A;  4LZU A;  1EAL A;  2ZAI A;  1ZNH A;  4YFR A;  4O3Z A;  5HBS A;  3FA7 A;  2F09 A;  4HFO A;  1N0S A;  4CK4 A;  3BDR A;  3WXQ A;  2FR3 A;  3LHN A;  4I9R A;  2LBA A;  2CZT A;  2G7B A;  4NNS A;  2QOS C;  3K3L A;  1QG5 A;  2NP1 A;  3B2H A;  4LZV A;  3TZS A;  2NNE A;  4O4X A;  1IW2 A;  2FRS A;  2RN4 A;  1BSY A;  4QQ1 A;  4GDZ A;  1BLR A;  3STK A;  1ZRY A;  5F58 A;  3WJC A;  1EQD A;  4IB6 A;  4DQ4 A;  4DQ3 A;  1XCA A;  1X8Q A;  4M7M A;  4RUU A;  5F7G A;  1QY2 A;  1HN2 A;  3NAD A;  1SA8 A;  3BS2 A;  4YMY A;  4YDA A;  3KFI A;  4ALB A;  1UZ2 X;  4OS8 A;  2BHV A;  3PEC A;  4ID2 A;  4ZH6 A;  5HWZ A;  1S7D A;  4ORX A;  1YWC A;  3TF6 A;  3ZW0 B;  1B56 A;  2GTL N;  2OVS A;  1QWD A;  1LF7 A;  3CBS A;  4QNI A;  3U0D A;  1T8V A;  4UU2 A;  4GZV A;  4O4U A;  3SOT A;  1EUO A;  1MX7 A;  1QQS A;  4XMH A;  3D97 A;  5FQ8 E;  4KH8 A;  4XME A;  2CM9 A;  1DZK A;  3FEP A;  4EFG A;  1IKE A;  2LA7 A;  3O19 A;  4K19 A;  1BBP A;  3KFG A;  1OBP A;  1SMP I;  1YUP A;  3I17 A;  3P6G A;  5KHP A;  1ACD A;  1YP7 A;  4QAE A;  1E5P A;  4ZH9 A;  4LKT A;  3DTQ A;  1PEE A;  1KT7 A;  1SXU A;  1MUP A;  2CZU A;  3QKG A;  1GKA A;  2X46 A;  4GH7 A;  5HZ9 A;  4IMO A;  1ADL A;  2X8S A;  5AJB A;  2G78 A;  3C76 X;  3P6H A;  1I4U A;  3GE2 A;  1ZNL A;  5BVT A;  5FQ7 E;  5L8O A;  3CQR A;  2XST A;  3VG4 A;  4MVE A;  1BSQ A;  1GX8 A;  1NGL A;  2A13 A;  4ORY A;  2MHD A;  3EBK A;  3EMM A;  1I06 A;  1X8P A;  4XMG A;  2X8F A;  5KID A;  1D3S A;  4GK9 A;  2FS6 A;  2GC9 A;  1XKI A;  5C0N A;  2IFB A;  1ERX A;  1LNM A;  2K62 A;  4TKB A;  1X8O A;  3P24 A;  1PM1 X;  3WJB A;  1SXX A;  1KT4 A;  3BSZ E;  3NPO A;  1O1V A;  2NNQ A;  5F1E A;  3WJG A;  3BRN A;  5FFH A;  1AVG I;  1JYD A;  4KII A;  4M6S A;  3AKM A;  3S60 A;  4FGI B;  2CBS A;  4IMN A;  1Z24 A;  2Q4N A;  5AEO A;  3PH6 A;  1DZJ A;  4HPD A;  2Q2P A;  3FA8 A;  4HWM A;  1NP1 A;  3RBY A;  4I6S A;  1BWY A;  4QYP A;  1CBI A;  1EIO A;  3B2K A;  1JZU A;  2F73 A;  5IO7 A;  4A1H A;  1BRP A;  2AKQ A;  2QO5 A;  1IIU A;  3FEL A;  2L68 A;  1E00 A;  5B29 A;  1S44 A;  3HOL A;  2M4L A;  1QY1 A;  2JU7 A;  2AT6 X;  3FR4 A;  2Q9S A;  4NLJ A;  1LIE A;  3FEN A;  3U9P C;  4R0B A;  1VYG A;  2HMB A;  2FS7 A;  3HWE A;  4MIR A;  4O3X B;  3T1D A;  1G5W A;  1EPB A;  3NQK A;  3ZUO A;  1QAB E;  4ORR A;  4O4S A;  4AZN A;  1TOW A;  3WJD A;  1BM5 A;  2L67 A;  1ICN A;  2LBV A;  3OJY C;  5JR8 A;  4ZHF A;  4ARH A;  2X45 A;  2GJ5 A;  4D6A A;  3VE2 A;  5HZQ A;  2RA6 A;  4I3D A;  4OMW A;  2ASN X;  4NP1 A;  3ZW1 B;  1BJ7 A;  2NND A;  1U0X A;  4O3W A;  3HK1 A;  1FEM A;  1URE A;  3NQ3 A;  1DV9 A;  3UEW A;  4HPA A;  2KTS A;  4HPB A;  4KT5 A;  3IFB A;  4GNW A;  1GM6 A;  4ORU A;  3WJE A;  4AW8 A;  4FQB B;  3NX1 A;  2FTB A;  3MVF A;  3LV4 A;  5H9N A;  3ZW2 A;  1NP4 A;  2KTD A;  1HQP A;  2P8G A;  1SY3 A;  3P6F A;  4O49 A;  1OEJ A;  3UEX A;  3BX8 A;  1OPA A;  3VE1 A;  3U03 A;  1G7N A;  1B0O A;  2QM9 A;  4ES7 A;  1R0U A;  1X89 A;  1A57 A;  1ZNE A;  2OZQ A;  5HCD C;  5EDB A;  3CMP A;  2GTF X;  4ZHC A;  1AEL A;  2RCQ A;  2HLV A;  2MO5 A;  3FA6 A;  2LKK A;  4GE1 A;  4YFQ A;  3ZQ3 A;  4EQA C;  1LPJ A;  1KGL A;  4WFU A;  3P6E A;  4BVM A;  5AJC A;  5LJH A;  5FEN A;  3H3I A;  1T0V A;  4QGW A;  4WBK A;  5LKF A;  3B2I A;  3AKN A;  1I05 A;  3CQN A;  5HCE C;  3E3C A;  2WWP A;  4MVK A;  1ALB A;  1KQX A;  2CM4 A;  4TNN A;  1DF3 A;  4A1Y A;  3KFF A;  2YG2 A;  2GTL M;  1KXO A;  4ON1 A;  4NYR A;  3UEU A;  3APX A;  2QMI A;  5LJD A;  3FLL A;  1A3Y A;  1JV4 A;  4I95 A;  3GAQ A;  4U9C A;  5LJE A;  2QO6 A;  2WEW A;  2EU7 X;  4NNT A;  4IAW A;  3BX7 A;  2O62 A;  1YP6 A;  3KZA A;  2W2B A;  5BYP A;  1EI5 A;  3S26 A;  2R73 A;  4IB8 A;  1L6M A;  1LIF A;  3MBT A;  4NYQ A;  3SAO A;  4XMF A;  1GKA B;  4MVL A;  2AT5 X;  3PQS A;  4NW4 A;  3Q6L A;  3S5X A;  1KT3 A;  5CYB A;  5DG4 A;  2LFO A;  1HMS A;  4WFV A;  3JSQ A;  2CBR A;  1ZND A;  1CBR A;  4U3Q A;  3HTY A;  3D4R A;  3FR5 A;  3NP1 A;  3RZY A;  1BRQ A;  4AZQ A;  2G79 A;  2Z4I A;  3IA8 A;  5HCC C;  4XMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...