5KICA

Long-sought stabilization of berkelium(iv) in solution: an anomaly within the heavy actinide series
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
173
structure length
173
Chain Sequence
SDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chelation and stabilization of berkelium in oxidation state +IV.
pubmed doi rcsb
molecule keywords Neutrophil gelatinase-associated lipocalin
molecule tags Transport protein
source organism Homo sapiens
total genus 41
structure length 173
sequence length 173
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5kicA00
3AKMA 1KT5A 3UEVA 5H9AA 2WR6A 1GKAB 2KTDA 3EBWA 1G74A 3KFHA 1DC9A 3BSZE 2QO4A 3Q6LA 3RSWA 1FE3A 2HNXA 5F1EA 3ZQ3A 3O22A 4QGXA 4D6AA 1GM6A 4ZHHA 4ZHGA 2RCTA 3VG5A 1EUOA 3BY0A 2FTBA 1R0UA 3VG3A 1FEMA 1ADLA 1BJ7A 5D47A 3FMZA 2HMBA 1YUPA 5B27A 4TKHA 1JYJA 3BRNA 1CJ5A 2ACOA 3NADA 1YP7A 1CBRA 3WJFA 1SY2A 1DF3A 3ZUIA 1NP1A 3UEXA 5HZ5A 3ZUOA 3BX7A 3EYCA 3EBKA 2N93A 3B2HA 2L5PA 1SXUA 4I3CA 3FA7A 2NNDA 1SXYA 3WVMA 4I9SA 1X89A 3CQRA 4UU3A 3NP1A 4AZOA 1E5PA 2IFBA 4HFOA 2NP1A 1KQXA 4M6SA 3HWEA 2L67A 4QZUA 4GNYA 5EDCA 1SXWA 1SY0A 2MJIA 2FWVA 3WJEA 1A2DA 3P6GA 5HA0A 3FA9A 4EEJA 1FTPA 2FR2A 1Z24A 2AMMX 4TKJA 2BLGA 2FR3A 4WFVA 2P8GA 5HCDC 3BLGA 1OEJA 1ZNKA 4NLJA 1JV4A 1ZNDA 1TW4A 2F73A 2WEWA 3FW4A 4RUNA 5H9NA 3U03A 1B8EA 4LZUA 1JYDA 4ZGUA 2K62A 1RLBE 3C76X 4MVLA 3P6HA 1IFBA 2FS7A 2ASNX 1LF7A 4YGGA 5B29A 1VYFA 1TOUA 3P6FA 1A57A 2MO5A 3FR4A 1LIFA 3JSQA 4QGVA 4YBPA 5IO7A 4AZPA 2WEXA 1HMTA 1O8VA 1LIEA 1UREA 1G5WA 1AVGI 3VG6A 2AH7X 3IA8A 1CBQA 4AZNA 5HWZA 4MVKA 5IO5A 5LJGA 3FEKA 4ZJ0A 1X8NA 1HN2A 1DZKA 2K23A 1LIBA 3EMMA 2AKQA 1YWBA 3PECA 2L68A 4XMFA 1OPBA 1GX8A 1PBOA 2FT9A 2WSJA 3APWA 1ERBA 3GAQA 1A18A 3PEDA 1GT4A 3APVA 1BM5A 1QY1A 3PH6A 5CE4A 5HBSA 3APXA 2OVDA 1FELA 2AT6X 1LKEA 5LJCA 5HZ8A 5C0NA 3B2JA 1PEEA 1X8PA 1OBPA 5DG4A 1KXOA 1OEEA 2HZRA 4IB9A 4YH0A 4ZR2A 3NQ3A 4YFQA 5FFHA 4IMNA 1G7NA 4AW8A 1A3YA 1GT3A 1GX9A 3F9DA 4EDEA 1JJXA 3OJYC 1VPRA 1ZNEA 4YGHA 4K19A 2AT3X 4XMHA 1DZJA 3FLLA 2A3FX 2AT0X 1ALBA 5LKFA 1CBIA 3CR6A 2OFMX 1LIDA 3O2YA 5HCEC 2Q2PA 5HZQA 2CBSA 1AB0A 1YWDA 4IB6A 2A13A 3FENA 4N7DA 1KZWA 1IKEA 5IO6A 3KFGA 3B2LA 3BDRA 2POAA 1JZUA 3G7XA 4YKOA 1L6MA 3TZSA 4IAWA 4EXZA 4ARHA 1EIOA 2RA6A 4R0BA 4I9RA 3U0DA 1I04A 1LICA 1QFTA 2R56A 2WQAE 5F6ZA 4YCEA 1BWYA 1JBHA 3PP6A 2HYSA 5LJBA 4AZMA 1KGLA 4XMEA 2CZTA 4WFUA 4M7MA 3T1DA 2W2BA 3AKNA 2YG2A 1XCAA 1EPBA 5F6BA 1GT5A 5LKEA 4I3DA 1BSQA 1QY2A 4GE1A 2CBRA 3IFBA 5L8IA 5KICA 5D8JA 2LB6A 4YDAA 2CZUA 2QOSC 3KQ0A 4BQUA 2LBAA 2FLJA 4MVIA 1BRQA 4ZHDA 1SXXA 5LJDA 5KHPA 1G85A 1DZMA 3WXQA 2PY1A 3BX8A 3O19A 1ZNHA 2EU7X 1T0VA 3C78X 4YGZA 3CBSA 1DV9A 2AT8X 4Y0PA 1MUPA 4ES7A 5HAEA 1O1VA 4ORXA 2HLVA 4HPDA 5BVQA 1TVQA 3D95A 3B2IA 2KT4B 4ALOA 2ALLX 3HK1A 4GNWA 1BBPA 1OPAA 3VG4A 5D48A 4AZRA 1B4MA 1CRBA 1EQDA 4HPBA 4QAEA 2ANSA 3CMPA 3WBGA 3KFFA 4LKPA 5AQ6A 3ELXA 1SY3A 4NNTA 1E00A 3FA8A 2Q4NA 4TLJA 3BU1A 2X45A 2OVAA 4A1HA 2AL0X 1KT7A 3FR2A 1OBUA 2MM3A 4OS0A 1ML7A 1PM1X 2A2GA 4QYNA 2E4JA 4Y0RA 5FENA 4A8ZA 1B56A 4QGWA 4YFRA 1QFVA 1D2UA 3UEUA 2JOZA 2G78A 1I05A 3FEPA 4OMWA 3KZAA 5D45A 1U18A 5L8OA 1LPJA 4YFPA 4IB7A 3DSZA 4Y0SA 1JJJA 1UZ2X 2JU7A 4ORUA 1QWDA 5K06A 2CM9A 1X8UA 3QKGA 4NYRA 3CQNA 2L9CA 2W2AA 2RD7C 4NLIA 1IIUA 2W2FA 2GJ5A 5L8NA 3EM0A 3UEWA 4QYPA 1ZNGA 2LBVA 2G79A 4YBUA 5HTEA 3I0AA 3WJCA 4ZHFA 1LFOA 4QZTA 3KFIA 1VYGA 1S2PA 1YWCA 4YDBA 3APUA 5F7GA 2R73A 3RZYA 1QQSA 1YIVA 1HMRA 4A1YA 2WQ9A 4GETA 3L4RA 3PH5A 1SA8A 4IMOA 5EEDA 1D3SA 2LKKA 5LJEA 1ICMA 3D97A 1QG5A 1N0SA 2OVEA 3B2KA 1OBQA 1BSOA 5BVSA 5JR8A 2O62A 2QM9A 3ELZA 4N7CA 4TQ2A 1HMSA 4HPAA 4DQ4A 1T68X 4ORWA 1T8VA 1BRPA 1KT6A 5HA1A 3TGBA 5LJKA 1HBPA 3DTQA 1TXLA 5EZ2A 2A0AA 2NNEA 2ACPX 1X8QA 1X8OA 4XMCA 1GGLA 1P6PA 1IKJA 4Y0QA 3MBTA 3NX2A 4OMXA 2G7BA 3HWDA 1EPAA 2RQ0A 5H9KA 5DPQA 2NNQA 4HPCA 4BOEA 1MX8A 3WJBA 2AT5X 1CBSA 3FIQA 3U9PC 1ERXA 2LFOA 5HTDA 1KOIA 2R74A 3HWGA 5LJHA 1I06A 1YWAA 4YCHA 1DZPA 2GTFX 3PPTA 1S44A 3P6EA 4ORRA 2DM5A 1S7DA 1EW3A 4IAXA 4GH7A 1ACDA 5D4AA 4IB8A 2XSTA 1HBQA 4GRJA 1XKIA 1ICNA 2OZQA 4ALBA 1MX7A 1EALA 1BSYA 4CK4A 1U17A 5KIDA 4ZH6A 1I4UA 1PMPA 4ZCBA 2Q39A 4TKBA 1KQWA 1KT4A 1NP4A 3STKA 3VG2A 3VG7A 2Q2MA 1LNMA 3TGAA 4D6BA 3NR3A 3WJGA 4I3BA 1TOWA 4NP1A 2GC9A 3CBCA 1MVGA 5EPQA 5BVTA 3NPOA 1GKAA 1O1UA 4AZQA 4O9SA 3FA6A 5F58A 3NQ9A 3MVFA 2FS6A 2Q9SA 1QABE 1AQBA 4KIIA 1HQPA 2XKLA 4GKCA 4TJZA 5EDBA 4ORYA 5HCCC 1IFCA 1KT3A 3P6DA 2WUTA 1DFVA 3STNA 4ZH9A 2JU8A 2OFRX 2JU3A 1ZRYA 3TF6A 2HZQA 3P6CA 1BEBA 4ORSA 1FDQA 1MDCA 1E02A 1U0XA 3BU9A 1X71A 1B0OA 3D96A 4OS8A 4UU2A 4ZHCA 3FR5A 5H9LA 4WBKA 4EFGA 1BLRA 1E06A 4BVMA 3F8AA 1NGLA 4RUUA 4XMGA 2QO5A 3FW5A 5EEEA 2A2UA 3FELA 4PSQA 2JN3A 1OEKA 4YMYA 3BS2A 3C77X 3S26A 3CWKA 1QY0A 2RCQA 2X46A 4DQ3A 1RBPA 4YKMA 5HZ6A 5HZ9A 4LZVA 1EXSA 2QO6A 3SAOA 4AYHA 1IW2A 3I17A 2FRSA 3JS1A 4IBAA 3WJDA 1EIIA 1GT1A 2WWPA 1YP6A 2CM4A 3TGCA 4TNNA 4NYQA 1KZXA 4XMDA 4LKTA 1H91A 4A60A 5H8TA 1ZNLA 4ODDA 1AELA 1GXAA 3K3LA 4NNSA 3NX1A 1SY1A 4OS3A 1FENA 5FAZA 3HWFA 4ZFXA 3STMX
chains in the Genus database with same CATH superfamily
3AKMA 1KT5A 3UEVA 5H9AA 2WR6A 1GKAB 2KTDA 1AVEA 1G74A 1WUBA 3EBWA 3KFHA 1MM9A 4ZGFA 1DC9A 1N43A 3BSZE 2QO4A 3Q6LA 3RSWA 1FE3A 1VWBB 2HNXA 2YMSA 2C1SA 5F1EA 3ZQ3A 2OY1O 3O22A 1PTSA 4QGXA 1GM6A 4D6AA 4ZHHA 4ZHGA 2RCTA 3VG5A 1EUOA 3BY0A 2FTBA 1R0UA 3VG3A 1JMXA 1FEMA 5B5FA 1ADLA 1BJ7A 1VWQB 3FMZA 5D47A 3S5XA 1STPA 3PQSA 4CDCA 2HMBA 1YUPA 5B27A 1LCVA 1JYJA 4TKHA 2X8SA 3BRNA 1CJ5A 2C1QA 5AJBA 2ACOA 5CHKA 3NADA 1JIWI 2OL6O 1KL3A 1YP7A 1CBRA 3WJFA 1SY2A 1DF3A 3ZUIA 1NP1A 3UEXA 5HZ5A 2QOMA 3ZUOA 3BX7A 3VPJE 3EYCA 2RTMA 2RTGB 2GTLM 2N93A 3B2HA 3EBKA 5FQ6E 2L5PA 1SXUA 1SWBA 4I3CA 4CDDA 2IZEB 3FA7A 2NNDA 1VWJB 3VHIA 1SXYA 3WVMA 5IRWA 4I9SA 1X89A 3CQRA 3NBXX 3NP1A 4UU3A 4AZOA 1E5PA 2IFBA 4HFOA 2NP1A 1KQXA 4M6SA 3HWEA 2L67A 1LELA 2DJGA 4QZUA 4GNYA 2Z4IA 5EDCA 2MWHA 1SXWA 1SWUA 1SY0A 2MJIA 2X55A 2FWVA 3WJEA 1A2DA 3P6GA 4OELA 2BS5A 5HA0A 1UYOX 1SWSA 3FA9A 1FTPA 4EEJA 3EW2A 2FR2A 4JGLA 1Z24A 1HY2A 2AMMX 2RTEB 4MIRA 2BLGA 4MEEA 4O49A 4TKJA 4OEMA 5AEOA 2FR3A 3P02A 4WFVA 2P8GA 1W6FA 3BLGA 3HTYA 5HCDC 1OEJA 1ZNKA 3AUMO 1JV4A 1ZNDA 4NLJA 2FGSA 1KFFA 1TW4A 2F73A 2WEWA 2IZJA 3FW4A 4QRLA 4RUNA 1B8EA 4LZUA 5H9NA 3U03A 1JYDA 3ZW2A 3D9WA 2RN4A 4ZGUA 2K62A 1RLBE 2RTFB 5CSEA 2RTKA 4Y5DA 3C76X 4MVLA 2LA7A 1VWEB 3MG5A 3VGWA 3EW1A 3P6HA 4DNEA 1IFBA 2FS7A 5HTDA 2RTPB 4O4UA 2ASNX 1LF7A 4YGGA 5B29A 3QQ2A 1VYFA 4U8UO 5IRAA 1TOUA 2ZSCA 3P6FA 4ML7B 1NDJA 1A57A 4CDEA 2OF9A 2WPUA 2MO5A 4OKAA 3FR4A 1LIFA 3JSQA 4QGVA 4YBPA 4GGRA 1JJUA 2IZBA 4WHIA 5IO7A 4AZPA 2WEXA 1HMTA 1O8VA 5BYPA 1LIEA 3OD9A 1UREA 1G5WA 2CAMA 5B3MO 1AVGI 4KCAA 3VG6A 2AH7X 3IA8A 4CSBA 1CBQA 4AZNA 2M4LA 5HWZA 4MVKA 5IO5A 3NQKA 3FEKA 5LJGA 1HXLA 4DCBA 1X8NA 1HN2A 1DZKA 2K23A 4ZJ0A 1LIBA 3EMMA 2AKQA 4BGFA 1YWBA 3PECA 2L68A 4XMFA 1OPBA 1GX8A 2G5LA 1PBOA 2FT9A 2WSJA 3APWA 1ERBA 3GAQA 3SLJA 4CPIA 4Z2VA 1A18A 3PEDA 1SWRA 1GT4A 3APVA 1BM5A 2Y3FA 1QY1A 3PH6A 3T2WA 2VDFA 5CE4A 5HBSA 2ZAIA 3APXA 5B11O 2AF5A 2OVDA 4U8UN 2RTQB 1FELA 2AT6X 1LKEA 3PDFA 5LJCA 5HZ8A 5C0NA 3ZW0A 2JGSA 3LTWA 3VE1A 2UZ2A 3B2JA 1PEEA 4BX6A 3RDMA 1X8PA 2Z4HA 1OBPA 5DG4A 2A5CA 1LUQA 4O3YA 1KXOA 1OEEA 2HZRA 2OFAA 4IB9A 4YH0A 1RXKA 3NQ3A 4YFQA 4ZR2A 4IMNA 1G7NA 3D4RA 5FFHA 3ZI8A 4AW8A 1A3YA 1GT3A 1GX9A 1UYNX 1VWAB 1VWIB 3F9DA 3RE5A 4EDEA 1JJXA 3VHMA 3OJYC 1VPRA 1ZNEA 4YGHA 2OYBO 4K19A 2AT3X 2IZDB 4XMHA 3U9PC 1SLEB 1SWFA 1SWOA 4JHQA 4EQAC 1DZJA 3FLLA 2F01A 2A3FX 2AT0X 1ALBA 4JNJA 1CBIA 5F2BA 5LKFA 3CR6A 3T6FA 2OFMX 1Y52X 2BC3A 1LIDA 3O2YA 1OSPO 1I78A 1STRB 2Q2PA 4U3QA 5HCEC 2CBSA 4LQZA 5B10O 1AB0A 1YWDA 5HZQA 4IB6A 2A13A 3FENA 4N7DA 1KZWA 1IKEA 5IO6A 3KFGA 3B2LA 3BDRA 2VFCA 2POAA 1JZUA 2FKGA 3G7XA 4YKOA 1L6MA 4CV7A 4IAWA 3TZSA 4EXZA 4ARHA 1EIOA 2RA6A 4R0BA 4NV7A 4I9RA 4Z2PA 1VWOB 3U0DA 3WYQA 1I04A 1LICA 1QFTA 2R56A 2WQAE 1VWGB 4YCEA 5F6ZA 1BWYA 1JBHA 3PP6A 2HYSA 4GK9A 5LJBA 4AZMA 1LDOA 4BX5B 1KGLA 4XMEA 1SWKA 2CZTA 4GGZA 4WFUA 4M7MA 2KD2A 2W2BA 3T1DA 4O4XA 3ZZVA 3ZW1B 1N7YA 3AKNA 3KVNA 2YG2A 1XCAA 1EPBA 5F6BA 1GT5A 3EC5A 1MEPA 5LKEA 2ZAGA 4I3DA 1BSQA 1QY2A 4GE1A 2CBRA 3IFBA 5L8IA 2OFBA 4COTA 3VU1A 1KL5A 5KICA 5D8JA 2LB6A 4YDAA 2CZUA 3AEHA 2QOSC 3KQ0A 1K3BA 4BQUA 2LBAA 2FLJA 4MVIA 1SWLA 1BRQA 4ZHDA 1SXXA 4BCSA 4O3WA 5LJDA 3RDUA 3MX7A 5KHPA 1G85A 1DZMA 2I5ZO 3WXQA 2PY1A 2RTJA 3BX8A 3O19A 1ZNHA 2EU7X 4CDFA 1T0VA 3C78X 4YGZA 3CBSA 3ZW0B 2AT8X 4Y0PA 1MUPA 1SRIA 4BX6B 4ES7A 5HAEA 1O1VA 4ORXA 2HLVA 4HPDA 1RSTB 1TVQA 3HPEA 5BVQA 3D95A 3ZWEA 3B2IA 2KT4B 1DF8A 4ALOA 2ALLX 1VYOA 3HK1A 4GNWA 2I5VO 2RTIB 1BBPA 1OPAA 1LCZA 5B2AO 3VG4A 5D48A 4AZRA 4GD9A 1B4MA 1CRBA 1EQDA 4HPBA 5K67A 4QAEA 3WZPA 1SWQA 1SRFA 5AJCA 2ANSA 3CMPA 4I60A 3WBGA 4Z2OA 4IABA 3KFFA 4LKPA 4MISA 5AQ6A 3ELXA 4Z6JA 1JMZA 1SY3A 2PI3O 2RTNB 1E00A 3FA8A 2Q4NA 4NNTA 3BU1A 4NP1A 4QQ1A 4TLJA 2X45A 2DJFA 2OVAA 3OE3A 4A1HA 2AL0X 1KT7A 3FR2A 3RDQA 1OBUA 4BJ8A 2MM3A 2OL8O 1ML7A 1PM1X 4OS0A 3HOLA 2A2GA 4QYNA 2E4JA 4Y0RA 5CYBA 5FENA 4U8UM 1B56A 1WBIA 4QGWA 4A8ZA 3CKGA 3MM0A 5FQ7E 4YFRA 1QFVA 1D2UA 3UEUA 4BX5A 1I9HA 2IZAA 2JOZA 5K68A 2QMIA 2G78A 2GH7A 4FBVA 4Z28A 1RXHA 3ZW1A 1I05A 1N9YA 3FEPA 4GDZA 4FBRA 3H3IA 1SWGA 2X8FA 1SREA 4OMWA 3KZAA 5D45A 1U18A 5L8OA 3PQUA 1LPJA 3F6ZB 4YFPA 3S5VA 3WYPA 4CPHB 4IB7A 3DSZA 4Y0SA 4KH8A 1JJJA 2IZHB 1UZ2X 1Y0GA 1HQQA 2JU7A 4I95A 4ORUA 2FKJA 3CKFA 2OF8A 2OL7A 1QWDA 5K06A 2CM9A 2X4MA 1X8UA 3QKGA 4NYRA 1JQPA 3CQNA 1W4TA 4U9CA 2L9CA 3FDCA 2W2AA 5B5GA 2RD7C 4NLIA 1IIUA 1RSUB 2W2FA 2GJ5A 5L8NA 4ON1A 3EM0A 3UEWA 4QYPA 3T6LA 1SLDB 1ZNGA 2LBVA 3WZQA 3X00A 2G79A 1GX3A 4Y59A 4YBUA 5HTEA 3I0AA 3WJCA 4ZHFA 1LFOA 4QZTA 1E2TA 3KFIA 1VYGA 1S2PA 2X32A 3PK2A 1EIIA 1YWCA 4FBOA 2JMBA 3APUA 4YDBA 5F7GA 1DV9A 2R73A 1SWAA 2OY8A 1SWTA 4KC7A 3RZYA 1QQSA 1YIVA 2VFBA 1HMRA 1SMPI 2IZCB 2IZGB 4A1YA 2WQ9A 1SWNA 2F09A 3L4RA 3PH5A 4GETA 3SOTA 3T2XA 1SA8A 3RDOA 2X34A 2X56A 4IMOA 5EEDA 3RWXA 1D3SA 4EKVA 2LKKA 5LJEA 1ICMA 1Y9TA 1QG5A 3D97A 1N0SA 2OVEA 3B2KA 1OBQA 1BSOA 2IZLB 5BVSA 4IRWA 4GJVA 2O62A 2QM9A 5FQ8E 4B55A 1MOYA 1SWPA 3ELZA 5JR8A 2JW1A 4GZVA 2OY7A 4N7CA 4FGIB 2UYWA 4I6SA 1VWPB 4TQ2A 1HMSA 4HPAA 4DQ4A 2X8TA 2KW1A 1T68X 4ORWA 4U46A 3RDXA 3WZNA 1T8VA 3RBYA 1BRPA 1KT6A 1SWHA 5HA1A 5LJKA 3TGBA 1HBPA 1PBYA 3DTQA 1TXLA 2G8CO 1FJ1E 5EZ2A 2A0AA 2NNEA 2ACPX 1IJ8A 1X8QA 1Y9LA 1W5RA 4C5PA 4FQBB 1X8OA 4BX7A 4XMCA 2GTLO 1LCWA 1GGLA 1P6PA 4GGTA 3SLOA 3VE2A 1IKJA 1SWDA 4O4OA 4Y0QA 3FYFA 3RY2A 4CPHA 1SRGA 3MBTA 3NX2A 4L1NA 4OMXA 2KTSA 2OVSA 2IZFB 2G7BA 3HWDA 1EPAA 3UAQA 2RQ0A 5H9KA 4NW4A 4GDAA 5DPQA 2NNQA 4HPCA 4BOEA 2RTDB 2RTBB 3SLTA 1MX8A 1NQNA 3WJBA 1SLGB 2AT5X 2BS6A 1CBSA 1VWFB 2FHNX 1ERXA 1Y55X 1SRJA 1KOIA 2LFOA 2R74A 3FIQA 1I06A 1YWAA 3HWGA 1DZPA 2GTFX 3PPTA 1S44A 4YCHA 3WOVA 3P6EA 3Q34A 4ORRA 3S60A 2DM5A 4PJ2A 2IZIA 3JQOA 1RXJA 1EW3A 1S7DA 4GH7A 4IAXA 1ACDA 5D4AA 4IB8A 1SRHA 2XSTA 1HBQA 4GRJA 1VWRB 1XKIA 2Y3EA 4GJSA 1ICNA 2BHVA 2OZQA 4ALBA 1MX7A 1EALA 1BSYA 1VWMB 1U17A 4CK4A 1VWDB 5KIDA 1STSB 2QCBA 4ZH6A 1I4UA 1AVDA 1PMPA 2GTLN 2Y32A 2OY5O 4ZCBA 2FHLA 2Q39A 3RY1A 1KQWA 4TKBA 5IXGA 1KT4A 2A8GA 3HOEA 1NP4A 2RTLA 3STKA 3VG2A 2HKDA 4HWMA 3VG7A 2Q2MA 1SWJA 4YVBA 1LNMA 3TGAA 4D6BA 4CPEA 3NR3A 3WJGA 4I3BA 1VWKB 1SWCA 1TOWA 2GC9A 3CBCA 1MVGA 1N4JA 2MHDA 3P24A 3NPOA 1GKAA 1O1UA 3LHNA 5EPQA 4KT5A 4AZQA 5BVTA 4O9SA 2BT9A 1NQMA 3FA6A 5F58A 3NQ9A 3WZOA 3MVFA 4ID2A 4CPFA 2A5BA 2FS6A 2Q9SA 5LJHA 1QABE 1AQBA 4KIIA 1HQPA 2XKLA 4GKCA 1MK5A 4GU8A 4ORYA 1RAVA 3FIDA 4TJZA 5EDBA 5HCCC 1IFCA 1KT3A 2IZKA 4O4SA 3P6DA 2WUTA 4MVEA 1DFVA 4BX7B 3STNA 2RTHB 4ZH9A 2JU8A 2OFRX 3SZJA 2JU3A 1KL4A 1ZRYA 2RTAA 3TF6A 4AYHA 3SZHA 2HZQA 3P6CA 1N9MA 1Y53X 1BEBA 3E3CA 4ORSA 1FDQA 1MDCA 1E02A 3VHHA 1U0XA 3RDSA 1K24A 1X71A 1B0OA 3BU9A 3D96A 4OS8A 4UU2A 4ZHCA 3FR5A 5H9LA 1HXZA 3LV4A 1VWHB 4L3RA 4QNIA 1NC9A 3OBLA 4WBKA 4EFGA 1BLRA 1E06A 2RTRB 3F8AA 4INNA 4JO6A 1VWCB 1NGLA 4BVMA 4RUUA 4XMGA 1SLFB 2QO5A 3RE6A 3FW5A 3N91A 5EEEA 2A2UA 5L3YA 3FELA 4PSQA 2JN3A 1OEKA 4YMYA 2BSZA 3BS2A 3C77X 2C4IA 2RTCB 1SWEA 3S26A 3CWKA 1QY0A 2RCQA 2X46A 5IRUA 4DQ3A 1RBPA 1LDQA 4O3ZA 4YKMA 5HZ6A 5HZ9A 4LZVA 1NBXA 1EXSA 2QO6A 3GE2A 3SAOA 1IW2A 3I17A 2AVIA 2FRSA 3JS1A 4IBAA 5JD2A 1GT1A 3WJDA 2WWPA 4Z27A 1YP6A 3RKGA 2CM4A 2RTOB 3TGCA 4TNNA 1EI5A 4NYQA 4XMDA 1VWNB 1KZXA 4LKTA 1H91A 3V8UA 4A60A 5H8TA 1ZNLA 4ODDA 4NV8A 1GXAA 4O3XB 3K3LA 4BBOA 1AELA 4KC8A 2MF6A 1SY1A 3NX1A 1FENA 1VWLB 4GUZA 4NNSA 4OS3A 5FAZA 3HWFA 3SZIA 4ZFXA 3STMX
chains in the Genus database with same CATH topology
3AKMA 1KT5A 3UEVA 5H9AA 2WR6A 1GKAB 2KTDA 3EBWA 1G74A 3KFHA 4ZGFA 1DC9A 3BSZE 2QO4A 3Q6LA 3RSWA 1FE3A 2YMSA 2HNXA 5F1EA 3ZQ3A 3O22A 4QGXA 4D6AA 1GM6A 4ZHHA 4ZHGA 2RCTA 3VG5A 1EUOA 3BY0A 2FTBA 1R0UA 3VG3A 1FEMA 1ADLA 1BJ7A 5D47A 3FMZA 3PQSA 2HMBA 1YUPA 5B27A 4TKHA 1JYJA 2X8SA 3BRNA 1CJ5A 5AJBA 2ACOA 3NADA 1JIWI 1YP7A 1CBRA 3WJFA 1SY2A 1DF3A 3ZUIA 1NP1A 3UEXA 5HZ5A 3ZUOA 3BX7A 3VPJE 3EYCA 3EBKA 2GTLM 2N93A 3B2HA 5FQ6E 2L5PA 1SXUA 4I3CA 3FA7A 2NNDA 1SXYA 3WVMA 4I9SA 1X89A 3CQRA 3NBXX 3NP1A 4UU3A 4AZOA 1E5PA 2IFBA 4HFOA 2NP1A 1KQXA 4M6SA 3HWEA 2L67A 4QZUA 4GNYA 2Z4IA 5EDCA 2MWHA 1SXWA 1SY0A 2MJIA 2FWVA 3WJEA 1A2DA 3P6GA 2BS5A 5HA0A 3FA9A 4EEJA 1FTPA 2FR2A 4JGLA 1Z24A 4MIRA 2AMMX 4O49A 4TKJA 2BLGA 5AEOA 2FR3A 3P02A 4WFVA 2P8GA 5HCDC 3BLGA 3HTYA 1OEJA 1ZNKA 4NLJA 1JV4A 1ZNDA 1TW4A 2F73A 2WEWA 3FW4A 4QRLA 4RUNA 5H9NA 1B8EA 4LZUA 3U03A 1JYDA 3ZW2A 2RN4A 4ZGUA 2K62A 1RLBE 3C76X 4MVLA 2LA7A 3P6HA 1IFBA 2FS7A 4O4UA 2ASNX 1LF7A 4YGGA 5B29A 1VYFA 4U8UO 1TOUA 3P6FA 4ML7B 1A57A 2MO5A 3FR4A 1LIFA 3JSQA 4QGVA 4YBPA 5IO7A 4WHIA 4AZPA 2WEXA 1HMTA 1O8VA 5BYPA 1LIEA 3OD9A 1UREA 1G5WA 1AVGI 4KCAA 3VG6A 2AH7X 3IA8A 4CSBA 1CBQA 4AZNA 2M4LA 5HWZA 4MVKA 5IO5A 3NQKA 3FEKA 5LJGA 4ZJ0A 1X8NA 1HN2A 1DZKA 2K23A 1LIBA 3EMMA 2AKQA 1YWBA 3PECA 2L68A 4XMFA 1OPBA 1GX8A 1PBOA 2FT9A 2WSJA 3APWA 1ERBA 3GAQA 1A18A 3PEDA 1GT4A 3APVA 1BM5A 1QY1A 3PH6A 5CE4A 5HBSA 2ZAIA 3APXA 2OVDA 4U8UN 1FELA 2AT6X 1LKEA 5LJCA 5HZ8A 5C0NA 3ZW0A 3VE1A 3B2JA 1PEEA 1X8PA 2Z4HA 1OBPA 5DG4A 4O3YA 1KXOA 1OEEA 2HZRA 4IB9A 4YH0A 4ZR2A 3NQ3A 4YFQA 5FFHA 4IMNA 1G7NA 3D4RA 3ZI8A 4AW8A 1A3YA 1GT3A 1GX9A 3F9DA 4EDEA 1JJXA 3OJYC 1VPRA 1ZNEA 4YGHA 4K19A 2AT3X 4XMHA 4EQAC 1DZJA 3FLLA 2A3FX 2AT0X 1ALBA 5LKFA 1CBIA 3CR6A 2OFMX 1LIDA 3O2YA 5HCEC 2Q2PA 5HZQA 4U3QA 2CBSA 4LQZA 1AB0A 1YWDA 4IB6A 2A13A 3FENA 4N7DA 1KZWA 1IKEA 5IO6A 3KFGA 3B2LA 3BDRA 2POAA 1JZUA 3G7XA 4YKOA 1L6MA 4CV7A 4IAWA 3TZSA 4EXZA 4ARHA 1EIOA 2RA6A 4R0BA 4I9RA 3U0DA 1I04A 1LICA 1QFTA 2R56A 2WQAE 5F6ZA 4YCEA 1BWYA 1JBHA 3PP6A 2HYSA 4GK9A 5LJBA 4AZMA 1KGLA 4XMEA 2CZTA 4WFUA 4M7MA 2KD2A 2W2BA 3T1DA 4O4XA 3ZZVA 3ZW1B 3AKNA 2YG2A 1XCAA 1EPBA 5F6BA 1GT5A 5LKEA 2ZAGA 4I3DA 1BSQA 1QY2A 4GE1A 2CBRA 3IFBA 5L8IA 4COTA 3VU1A 5KICA 5D8JA 2LB6A 4YDAA 2CZUA 2QOSC 3KQ0A 4BQUA 2LBAA 2FLJA 4MVIA 1BRQA 4ZHDA 1SXXA 4O3WA 5LJDA 5KHPA 3MX7A 1G85A 1DZMA 3WXQA 2PY1A 3BX8A 3O19A 1ZNHA 2EU7X 1T0VA 3C78X 4YGZA 3CBSA 3ZW0B 2AT8X 4Y0PA 1MUPA 1DV9A 4ES7A 5HAEA 1O1VA 4ORXA 2HLVA 4HPDA 5BVQA 1TVQA 3D95A 3ZWEA 3B2IA 2KT4B 4ALOA 2ALLX 3HK1A 4GNWA 1BBPA 1OPAA 3VG4A 5D48A 4AZRA 1B4MA 1CRBA 1EQDA 4HPBA 4QAEA 5AJCA 2ANSA 3CMPA 3WBGA 4IABA 3KFFA 4LKPA 4MISA 5AQ6A 3ELXA 1SY3A 4NNTA 1E00A 3FA8A 2Q4NA 4QQ1A 3BU1A 4TLJA 2X45A 2OVAA 3OE3A 4A1HA 2AL0X 1KT7A 3FR2A 1OBUA 2MM3A 4OS0A 1ML7A 1PM1X 3HOLA 2A2GA 4QYNA 2E4JA 4Y0RA 5CYBA 5FENA 4U8UM 1B56A 4QGWA 4A8ZA 5FQ7E 4YFRA 1QFVA 1D2UA 3UEUA 2JOZA 2QMIA 2G78A 4FBVA 3ZW1A 1I05A 3FEPA 4GDZA 4FBRA 3H3IA 2X8FA 4OMWA 3KZAA 5D45A 1U18A 5L8OA 3PQUA 1LPJA 3F6ZB 4YFPA 3S5VA 4IB7A 3DSZA 4Y0SA 4KH8A 1JJJA 1UZ2X 2JU7A 4I95A 4ORUA 1QWDA 5K06A 2CM9A 1X8UA 3QKGA 4NYRA 3CQNA 4U9CA 2L9CA 2W2AA 2RD7C 4NLIA 1IIUA 2W2FA 2GJ5A 5L8NA 4ON1A 3EM0A 3UEWA 4QYPA 1ZNGA 2LBVA 2G79A 4YBUA 5HTEA 3I0AA 3WJCA 4ZHFA 1LFOA 4QZTA 3KFIA 1VYGA 1S2PA 1YWCA 4FBOA 2JMBA 3APUA 4YDBA 5F7GA 2R73A 3RZYA 4KC7A 1QQSA 1YIVA 1HMRA 1SMPI 4A1YA 2WQ9A 4GETA 2F09A 3L4RA 3PH5A 3SOTA 1SA8A 4IMOA 5EEDA 3RWXA 1D3SA 2LKKA 5LJEA 1ICMA 1Y9TA 1QG5A 3D97A 1N0SA 2OVEA 3B2KA 1OBQA 1BSOA 5BVSA 5FQ8E 5JR8A 2O62A 2QM9A 3ELZA 2JW1A 4GZVA 4N7CA 4FGIB 4I6SA 4TQ2A 1HMSA 4HPAA 4DQ4A 2X8TA 2KW1A 1T68X 4ORWA 1T8VA 3RBYA 1BRPA 1KT6A 5HA1A 3TGBA 5LJKA 1HBPA 3DTQA 1TXLA 5EZ2A 2A0AA 2NNEA 2ACPX 1X8QA 1Y9LA 4FQBB 1X8OA 4XMCA 2GTLO 1GGLA 1P6PA 3VE2A 1IKJA 4Y0QA 4O4OA 3FYFA 3MBTA 3NX2A 4L1NA 4OMXA 2KTSA 2OVSA 2G7BA 3HWDA 1EPAA 3UAQA 2RQ0A 5H9KA 4NW4A 5DPQA 2NNQA 4HPCA 4BOEA 1MX8A 3WJBA 2AT5X 2BS6A 1CBSA 3FIQA 3U9PC 1ERXA 2LFOA 5HTDA 1KOIA 2R74A 3HWGA 5LJHA 1I06A 1YWAA 4YCHA 1DZPA 2GTFX 3PPTA 1S44A 3WOVA 3P6EA 4ORRA 3S60A 2DM5A 4PJ2A 3JQOA 1S7DA 1EW3A 4IAXA 4GH7A 1ACDA 5D4AA 4IB8A 2XSTA 1HBQA 4GRJA 1XKIA 1ICNA 2BHVA 2OZQA 4ALBA 1MX7A 1EALA 1BSYA 4CK4A 1U17A 5KIDA 4ZH6A 1I4UA 1PMPA 2GTLN 4ZCBA 2Q39A 4TKBA 1KQWA 1KT4A 3HOEA 1NP4A 3STKA 3VG2A 3VG7A 4HWMA 2Q2MA 1LNMA 3TGAA 4D6BA 3NR3A 3WJGA 4I3BA 3P24A 1TOWA 4NP1A 2GC9A 3CBCA 1MVGA 2MHDA 5EPQA 5BVTA 3NPOA 1GKAA 1O1UA 3LHNA 4KT5A 4AZQA 4O9SA 2BT9A 3FA6A 5F58A 3NQ9A 3MVFA 4ID2A 2FS6A 2Q9SA 1QABE 1AQBA 4KIIA 1HQPA 2XKLA 4GKCA 4GU8A 4TJZA 4ORYA 5EDBA 5HCCC 1IFCA 1KT3A 4O4SA 3P6DA 2WUTA 4MVEA 1DFVA 3STNA 4ZH9A 2JU8A 2OFRX 2JU3A 1ZRYA 3TF6A 2HZQA 3P6CA 1BEBA 3E3CA 4ORSA 1FDQA 1MDCA 1E02A 1U0XA 3BU9A 1X71A 1B0OA 3D96A 4OS8A 4UU2A 4ZHCA 3FR5A 5H9LA 3LV4A 4L3RA 4QNIA 3OBLA 4WBKA 4EFGA 1BLRA 1E06A 4INNA 3F8AA 4BVMA 1NGLA 4RUUA 4XMGA 2QO5A 3FW5A 3N91A 5EEEA 2A2UA 3FELA 4PSQA 2JN3A 1OEKA 4YMYA 3BS2A 3C77X 3S26A 3CWKA 1QY0A 2RCQA 2X46A 4DQ3A 1RBPA 4O3ZA 4YKMA 5HZ6A 5HZ9A 4LZVA 1EXSA 2QO6A 3GE2A 3SAOA 1IW2A 3I17A 2FRSA 3JS1A 4IBAA 3WJDA 4AYHA 1GT1A 1EIIA 2WWPA 1YP6A 3RKGA 2CM4A 3TGCA 4TNNA 1EI5A 4NYQA 4XMDA 1KZXA 4LKTA 1H91A 3V8UA 4A60A 5H8TA 1ZNLA 4ODDA 1AELA 1GXAA 4O3XB 3K3LA 4KC8A 3NX1A 1SY1A 4NNSA 1FENA 4OS3A 5FAZA 3S5XA 3HWFA 4ZFXA 3STMX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AKM A;  1KT5 A;  3UEV A;  5H9A A;  2WR6 A;  1GKA B;  2KTD A;  3EBW A;  1G74 A;  3KFH A;  1DC9 A;  3BSZ E;  2QO4 A;  3Q6L A;  3RSW A;  1FE3 A;  2HNX A;  5F1E A;  3ZQ3 A;  3O22 A;  4QGX A;  4D6A A;  1GM6 A;  4ZHH A;  4ZHG A;  2RCT A;  3VG5 A;  1EUO A;  3BY0 A;  2FTB A;  1R0U A;  3VG3 A;  1FEM A;  1ADL A;  1BJ7 A;  5D47 A;  3FMZ A;  2HMB A;  1YUP A;  5B27 A;  4TKH A;  1JYJ A;  3BRN A;  1CJ5 A;  2ACO A;  3NAD A;  1YP7 A;  1CBR A;  3WJF A;  1SY2 A;  1DF3 A;  3ZUI A;  1NP1 A;  3UEX A;  5HZ5 A;  3ZUO A;  3BX7 A;  3EYC A;  3EBK A;  2N93 A;  3B2H A;  2L5P A;  1SXU A;  4I3C A;  3FA7 A;  2NND A;  1SXY A;  3WVM A;  4I9S A;  1X89 A;  3CQR A;  4UU3 A;  3NP1 A;  4AZO A;  1E5P A;  2IFB A;  4HFO A;  2NP1 A;  1KQX A;  4M6S A;  3HWE A;  2L67 A;  4QZU A;  4GNY A;  5EDC A;  1SXW A;  1SY0 A;  2MJI A;  2FWV A;  3WJE A;  1A2D A;  3P6G A;  5HA0 A;  3FA9 A;  4EEJ A;  1FTP A;  2FR2 A;  1Z24 A;  2AMM X;  4TKJ A;  2BLG A;  2FR3 A;  4WFV A;  2P8G A;  5HCD C;  3BLG A;  1OEJ A;  1ZNK A;  4NLJ A;  1JV4 A;  1ZND A;  1TW4 A;  2F73 A;  2WEW A;  3FW4 A;  4RUN A;  5H9N A;  3U03 A;  1B8E A;  4LZU A;  1JYD A;  4ZGU A;  2K62 A;  1RLB E;  3C76 X;  4MVL A;  3P6H A;  1IFB A;  2FS7 A;  2ASN X;  1LF7 A;  4YGG A;  5B29 A;  1VYF A;  1TOU A;  3P6F A;  1A57 A;  2MO5 A;  3FR4 A;  1LIF A;  3JSQ A;  4QGV A;  4YBP A;  5IO7 A;  4AZP A;  2WEX A;  1HMT A;  1O8V A;  1LIE A;  1URE A;  1G5W A;  1AVG I;  3VG6 A;  2AH7 X;  3IA8 A;  1CBQ A;  4AZN A;  5HWZ A;  4MVK A;  5IO5 A;  5LJG A;  3FEK A;  4ZJ0 A;  1X8N A;  1HN2 A;  1DZK A;  2K23 A;  1LIB A;  3EMM A;  2AKQ A;  1YWB A;  3PEC A;  2L68 A;  4XMF A;  1OPB A;  1GX8 A;  1PBO A;  2FT9 A;  2WSJ A;  3APW A;  1ERB A;  3GAQ A;  1A18 A;  3PED A;  1GT4 A;  3APV A;  1BM5 A;  1QY1 A;  3PH6 A;  5CE4 A;  5HBS A;  3APX A;  2OVD A;  1FEL A;  2AT6 X;  1LKE A;  5LJC A;  5HZ8 A;  5C0N A;  3B2J A;  1PEE A;  1X8P A;  1OBP A;  5DG4 A;  1KXO A;  1OEE A;  2HZR A;  4IB9 A;  4YH0 A;  4ZR2 A;  3NQ3 A;  4YFQ A;  5FFH A;  4IMN A;  1G7N A;  4AW8 A;  1A3Y A;  1GT3 A;  1GX9 A;  3F9D A;  4EDE A;  1JJX A;  3OJY C;  1VPR A;  1ZNE A;  4YGH A;  4K19 A;  2AT3 X;  4XMH A;  1DZJ A;  3FLL A;  2A3F X;  2AT0 X;  1ALB A;  5LKF A;  1CBI A;  3CR6 A;  2OFM X;  1LID A;  3O2Y A;  5HCE C;  2Q2P A;  5HZQ A;  2CBS A;  1AB0 A;  1YWD A;  4IB6 A;  2A13 A;  3FEN A;  4N7D A;  1KZW A;  1IKE A;  5IO6 A;  3KFG A;  3B2L A;  3BDR A;  2POA A;  1JZU A;  3G7X A;  4YKO A;  1L6M A;  3TZS A;  4IAW A;  4EXZ A;  4ARH A;  1EIO A;  2RA6 A;  4R0B A;  4I9R A;  3U0D A;  1I04 A;  1LIC A;  1QFT A;  2R56 A;  2WQA E;  5F6Z A;  4YCE A;  1BWY A;  1JBH A;  3PP6 A;  2HYS A;  5LJB A;  4AZM A;  1KGL A;  4XME A;  2CZT A;  4WFU A;  4M7M A;  3T1D A;  2W2B A;  3AKN A;  2YG2 A;  1XCA A;  1EPB A;  5F6B A;  1GT5 A;  5LKE A;  4I3D A;  1BSQ A;  1QY2 A;  4GE1 A;  2CBR A;  3IFB A;  5L8I A;  5KIC A;  5D8J A;  2LB6 A;  4YDA A;  2CZU A;  2QOS C;  3KQ0 A;  4BQU A;  2LBA A;  2FLJ A;  4MVI A;  1BRQ A;  4ZHD A;  1SXX A;  5LJD A;  5KHP A;  1G85 A;  1DZM A;  3WXQ A;  2PY1 A;  3BX8 A;  3O19 A;  1ZNH A;  2EU7 X;  1T0V A;  3C78 X;  4YGZ A;  3CBS A;  1DV9 A;  2AT8 X;  4Y0P A;  1MUP A;  4ES7 A;  5HAE A;  1O1V A;  4ORX A;  2HLV A;  4HPD A;  5BVQ A;  1TVQ A;  3D95 A;  3B2I A;  2KT4 B;  4ALO A;  2ALL X;  3HK1 A;  4GNW A;  1BBP A;  1OPA A;  3VG4 A;  5D48 A;  4AZR A;  1B4M A;  1CRB A;  1EQD A;  4HPB A;  4QAE A;  2ANS A;  3CMP A;  3WBG A;  3KFF A;  4LKP A;  5AQ6 A;  3ELX A;  1SY3 A;  4NNT A;  1E00 A;  3FA8 A;  2Q4N A;  4TLJ A;  3BU1 A;  2X45 A;  2OVA A;  4A1H A;  2AL0 X;  1KT7 A;  3FR2 A;  1OBU A;  2MM3 A;  4OS0 A;  1ML7 A;  1PM1 X;  2A2G A;  4QYN A;  2E4J A;  4Y0R A;  5FEN A;  4A8Z A;  1B56 A;  4QGW A;  4YFR A;  1QFV A;  1D2U A;  3UEU A;  2JOZ A;  2G78 A;  1I05 A;  3FEP A;  4OMW A;  3KZA A;  5D45 A;  1U18 A;  5L8O A;  1LPJ A;  4YFP A;  4IB7 A;  3DSZ A;  4Y0S A;  1JJJ A;  1UZ2 X;  2JU7 A;  4ORU A;  1QWD A;  5K06 A;  2CM9 A;  1X8U A;  3QKG A;  4NYR A;  3CQN A;  2L9C A;  2W2A A;  2RD7 C;  4NLI A;  1IIU A;  2W2F A;  2GJ5 A;  5L8N A;  3EM0 A;  3UEW A;  4QYP A;  1ZNG A;  2LBV A;  2G79 A;  4YBU A;  5HTE A;  3I0A A;  3WJC A;  4ZHF A;  1LFO A;  4QZT A;  3KFI A;  1VYG A;  1S2P A;  1YWC A;  4YDB A;  3APU A;  5F7G A;  2R73 A;  3RZY A;  1QQS A;  1YIV A;  1HMR A;  4A1Y A;  2WQ9 A;  4GET A;  3L4R A;  3PH5 A;  1SA8 A;  4IMO A;  5EED A;  1D3S A;  2LKK A;  5LJE A;  1ICM A;  3D97 A;  1QG5 A;  1N0S A;  2OVE A;  3B2K A;  1OBQ A;  1BSO A;  5BVS A;  5JR8 A;  2O62 A;  2QM9 A;  3ELZ A;  4N7C A;  4TQ2 A;  1HMS A;  4HPA A;  4DQ4 A;  1T68 X;  4ORW A;  1T8V A;  1BRP A;  1KT6 A;  5HA1 A;  3TGB A;  5LJK A;  1HBP A;  3DTQ A;  1TXL A;  5EZ2 A;  2A0A A;  2NNE A;  2ACP X;  1X8Q A;  1X8O A;  4XMC A;  1GGL A;  1P6P A;  1IKJ A;  4Y0Q A;  3MBT A;  3NX2 A;  4OMX A;  2G7B A;  3HWD A;  1EPA A;  2RQ0 A;  5H9K A;  5DPQ A;  2NNQ A;  4HPC A;  4BOE A;  1MX8 A;  3WJB A;  2AT5 X;  1CBS A;  3FIQ A;  3U9P C;  1ERX A;  2LFO A;  5HTD A;  1KOI A;  2R74 A;  3HWG A;  5LJH A;  1I06 A;  1YWA A;  4YCH A;  1DZP A;  2GTF X;  3PPT A;  1S44 A;  3P6E A;  4ORR A;  2DM5 A;  1S7D A;  1EW3 A;  4IAX A;  4GH7 A;  1ACD A;  5D4A A;  4IB8 A;  2XST A;  1HBQ A;  4GRJ A;  1XKI A;  1ICN A;  2OZQ A;  4ALB A;  1MX7 A;  1EAL A;  1BSY A;  4CK4 A;  1U17 A;  5KID A;  4ZH6 A;  1I4U A;  1PMP A;  4ZCB A;  2Q39 A;  4TKB A;  1KQW A;  1KT4 A;  1NP4 A;  3STK A;  3VG2 A;  3VG7 A;  2Q2M A;  1LNM A;  3TGA A;  4D6B A;  3NR3 A;  3WJG A;  4I3B A;  1TOW A;  4NP1 A;  2GC9 A;  3CBC A;  1MVG A;  5EPQ A;  5BVT A;  3NPO A;  1GKA A;  1O1U A;  4AZQ A;  4O9S A;  3FA6 A;  5F58 A;  3NQ9 A;  3MVF A;  2FS6 A;  2Q9S A;  1QAB E;  1AQB A;  4KII A;  1HQP A;  2XKL A;  4GKC A;  4TJZ A;  5EDB A;  4ORY A;  5HCC C;  1IFC A;  1KT3 A;  3P6D A;  2WUT A;  1DFV A;  3STN A;  4ZH9 A;  2JU8 A;  2OFR X;  2JU3 A;  1ZRY A;  3TF6 A;  2HZQ A;  3P6C A;  1BEB A;  4ORS A;  1FDQ A;  1MDC A;  1E02 A;  1U0X A;  3BU9 A;  1X71 A;  1B0O A;  3D96 A;  4OS8 A;  4UU2 A;  4ZHC A;  3FR5 A;  5H9L A;  4WBK A;  4EFG A;  1BLR A;  1E06 A;  4BVM A;  3F8A A;  1NGL A;  4RUU A;  4XMG A;  2QO5 A;  3FW5 A;  5EEE A;  2A2U A;  3FEL A;  4PSQ A;  2JN3 A;  1OEK A;  4YMY A;  3BS2 A;  3C77 X;  3S26 A;  3CWK A;  1QY0 A;  2RCQ A;  2X46 A;  4DQ3 A;  1RBP A;  4YKM A;  5HZ6 A;  5HZ9 A;  4LZV A;  1EXS A;  2QO6 A;  3SAO A;  4AYH A;  1IW2 A;  3I17 A;  2FRS A;  3JS1 A;  4IBA A;  3WJD A;  1EII A;  1GT1 A;  2WWP A;  1YP6 A;  2CM4 A;  3TGC A;  4TNN A;  4NYQ A;  1KZX A;  4XMD A;  4LKT A;  1H91 A;  4A60 A;  5H8T A;  1ZNL A;  4ODD A;  1AEL A;  1GXA A;  3K3L A;  4NNS A;  3NX1 A;  1SY1 A;  4OS3 A;  1FEN A;  5FAZ A;  3HWF A;  4ZFX A;  3STM X; 
#chains in the Genus database with same CATH topology
 3AKM A;  1KT5 A;  3UEV A;  5H9A A;  2WR6 A;  1GKA B;  2KTD A;  1AVE A;  1G74 A;  1WUB A;  3EBW A;  3KFH A;  1MM9 A;  4ZGF A;  1DC9 A;  1N43 A;  3BSZ E;  2QO4 A;  3Q6L A;  3RSW A;  1FE3 A;  1VWB B;  2HNX A;  2YMS A;  2C1S A;  5F1E A;  3ZQ3 A;  2OY1 O;  3O22 A;  1PTS A;  4QGX A;  1GM6 A;  4D6A A;  4ZHH A;  4ZHG A;  2RCT A;  3VG5 A;  1EUO A;  3BY0 A;  2FTB A;  1R0U A;  3VG3 A;  1JMX A;  1FEM A;  5B5F A;  1ADL A;  1BJ7 A;  1VWQ B;  3FMZ A;  5D47 A;  3S5X A;  1STP A;  3PQS A;  4CDC A;  2HMB A;  1YUP A;  5B27 A;  1LCV A;  1JYJ A;  4TKH A;  2X8S A;  3BRN A;  1CJ5 A;  2C1Q A;  5AJB A;  2ACO A;  5CHK A;  3NAD A;  1JIW I;  2OL6 O;  1KL3 A;  1YP7 A;  1CBR A;  3WJF A;  1SY2 A;  1DF3 A;  3ZUI A;  1NP1 A;  3UEX A;  5HZ5 A;  2QOM A;  3ZUO A;  3BX7 A;  3VPJ E;  3EYC A;  2RTM A;  2RTG B;  2GTL M;  2N93 A;  3B2H A;  3EBK A;  5FQ6 E;  2L5P A;  1SXU A;  1SWB A;  4I3C A;  4CDD A;  2IZE B;  3FA7 A;  2NND A;  1VWJ B;  3VHI A;  1SXY A;  3WVM A;  5IRW A;  4I9S A;  1X89 A;  3CQR A;  3NBX X;  3NP1 A;  4UU3 A;  4AZO A;  1E5P A;  2IFB A;  4HFO A;  2NP1 A;  1KQX A;  4M6S A;  3HWE A;  2L67 A;  1LEL A;  2DJG A;  4QZU A;  4GNY A;  2Z4I A;  5EDC A;  2MWH A;  1SXW A;  1SWU A;  1SY0 A;  2MJI A;  2X55 A;  2FWV A;  3WJE A;  1A2D A;  3P6G A;  4OEL A;  2BS5 A;  5HA0 A;  1UYO X;  1SWS A;  3FA9 A;  1FTP A;  4EEJ A;  3EW2 A;  2FR2 A;  4JGL A;  1Z24 A;  1HY2 A;  2AMM X;  2RTE B;  4MIR A;  2BLG A;  4MEE A;  4O49 A;  4TKJ A;  4OEM A;  5AEO A;  2FR3 A;  3P02 A;  4WFV A;  2P8G A;  1W6F A;  3BLG A;  3HTY A;  5HCD C;  1OEJ A;  1ZNK A;  3AUM O;  1JV4 A;  1ZND A;  4NLJ A;  2FGS A;  1KFF A;  1TW4 A;  2F73 A;  2WEW A;  2IZJ A;  3FW4 A;  4QRL A;  4RUN A;  1B8E A;  4LZU A;  5H9N A;  3U03 A;  1JYD A;  3ZW2 A;  3D9W A;  2RN4 A;  4ZGU A;  2K62 A;  1RLB E;  2RTF B;  5CSE A;  2RTK A;  4Y5D A;  3C76 X;  4MVL A;  2LA7 A;  1VWE B;  3MG5 A;  3VGW A;  3EW1 A;  3P6H A;  4DNE A;  1IFB A;  2FS7 A;  5HTD A;  2RTP B;  4O4U A;  2ASN X;  1LF7 A;  4YGG A;  5B29 A;  3QQ2 A;  1VYF A;  4U8U O;  5IRA A;  1TOU A;  2ZSC A;  3P6F A;  4ML7 B;  1NDJ A;  1A57 A;  4CDE A;  2OF9 A;  2WPU A;  2MO5 A;  4OKA A;  3FR4 A;  1LIF A;  3JSQ A;  4QGV A;  4YBP A;  4GGR A;  1JJU A;  2IZB A;  4WHI A;  5IO7 A;  4AZP A;  2WEX A;  1HMT A;  1O8V A;  5BYP A;  1LIE A;  3OD9 A;  1URE A;  1G5W A;  2CAM A;  5B3M O;  1AVG I;  4KCA A;  3VG6 A;  2AH7 X;  3IA8 A;  4CSB A;  1CBQ A;  4AZN A;  2M4L A;  5HWZ A;  4MVK A;  5IO5 A;  3NQK A;  3FEK A;  5LJG A;  1HXL A;  4DCB A;  1X8N A;  1HN2 A;  1DZK A;  2K23 A;  4ZJ0 A;  1LIB A;  3EMM A;  2AKQ A;  4BGF A;  1YWB A;  3PEC A;  2L68 A;  4XMF A;  1OPB A;  1GX8 A;  2G5L A;  1PBO A;  2FT9 A;  2WSJ A;  3APW A;  1ERB A;  3GAQ A;  3SLJ A;  4CPI A;  4Z2V A;  1A18 A;  3PED A;  1SWR A;  1GT4 A;  3APV A;  1BM5 A;  2Y3F A;  1QY1 A;  3PH6 A;  3T2W A;  2VDF A;  5CE4 A;  5HBS A;  2ZAI A;  3APX A;  5B11 O;  2AF5 A;  2OVD A;  4U8U N;  2RTQ B;  1FEL A;  2AT6 X;  1LKE A;  3PDF A;  5LJC A;  5HZ8 A;  5C0N A;  3ZW0 A;  2JGS A;  3LTW A;  3VE1 A;  2UZ2 A;  3B2J A;  1PEE A;  4BX6 A;  3RDM A;  1X8P A;  2Z4H A;  1OBP A;  5DG4 A;  2A5C A;  1LUQ A;  4O3Y A;  1KXO A;  1OEE A;  2HZR A;  2OFA A;  4IB9 A;  4YH0 A;  1RXK A;  3NQ3 A;  4YFQ A;  4ZR2 A;  4IMN A;  1G7N A;  3D4R A;  5FFH A;  3ZI8 A;  4AW8 A;  1A3Y A;  1GT3 A;  1GX9 A;  1UYN X;  1VWA B;  1VWI B;  3F9D A;  3RE5 A;  4EDE A;  1JJX A;  3VHM A;  3OJY C;  1VPR A;  1ZNE A;  4YGH A;  2OYB O;  4K19 A;  2AT3 X;  2IZD B;  4XMH A;  3U9P C;  1SLE B;  1SWF A;  1SWO A;  4JHQ A;  4EQA C;  1DZJ A;  3FLL A;  2F01 A;  2A3F X;  2AT0 X;  1ALB A;  4JNJ A;  1CBI A;  5F2B A;  5LKF A;  3CR6 A;  3T6F A;  2OFM X;  1Y52 X;  2BC3 A;  1LID A;  3O2Y A;  1OSP O;  1I78 A;  1STR B;  2Q2P A;  4U3Q A;  5HCE C;  2CBS A;  4LQZ A;  5B10 O;  1AB0 A;  1YWD A;  5HZQ A;  4IB6 A;  2A13 A;  3FEN A;  4N7D A;  1KZW A;  1IKE A;  5IO6 A;  3KFG A;  3B2L A;  3BDR A;  2VFC A;  2POA A;  1JZU A;  2FKG A;  3G7X A;  4YKO A;  1L6M A;  4CV7 A;  4IAW A;  3TZS A;  4EXZ A;  4ARH A;  1EIO A;  2RA6 A;  4R0B A;  4NV7 A;  4I9R A;  4Z2P A;  1VWO B;  3U0D A;  3WYQ A;  1I04 A;  1LIC A;  1QFT A;  2R56 A;  2WQA E;  1VWG B;  4YCE A;  5F6Z A;  1BWY A;  1JBH A;  3PP6 A;  2HYS A;  4GK9 A;  5LJB A;  4AZM A;  1LDO A;  4BX5 B;  1KGL A;  4XME A;  1SWK A;  2CZT A;  4GGZ A;  4WFU A;  4M7M A;  2KD2 A;  2W2B A;  3T1D A;  4O4X A;  3ZZV A;  3ZW1 B;  1N7Y A;  3AKN A;  3KVN A;  2YG2 A;  1XCA A;  1EPB A;  5F6B A;  1GT5 A;  3EC5 A;  1MEP A;  5LKE A;  2ZAG A;  4I3D A;  1BSQ A;  1QY2 A;  4GE1 A;  2CBR A;  3IFB A;  5L8I A;  2OFB A;  4COT A;  3VU1 A;  1KL5 A;  5KIC A;  5D8J A;  2LB6 A;  4YDA A;  2CZU A;  3AEH A;  2QOS C;  3KQ0 A;  1K3B A;  4BQU A;  2LBA A;  2FLJ A;  4MVI A;  1SWL A;  1BRQ A;  4ZHD A;  1SXX A;  4BCS A;  4O3W A;  5LJD A;  3RDU A;  3MX7 A;  5KHP A;  1G85 A;  1DZM A;  2I5Z O;  3WXQ A;  2PY1 A;  2RTJ A;  3BX8 A;  3O19 A;  1ZNH A;  2EU7 X;  4CDF A;  1T0V A;  3C78 X;  4YGZ A;  3CBS A;  3ZW0 B;  2AT8 X;  4Y0P A;  1MUP A;  1SRI A;  4BX6 B;  4ES7 A;  5HAE A;  1O1V A;  4ORX A;  2HLV A;  4HPD A;  1RST B;  1TVQ A;  3HPE A;  5BVQ A;  3D95 A;  3ZWE A;  3B2I A;  2KT4 B;  1DF8 A;  4ALO A;  2ALL X;  1VYO A;  3HK1 A;  4GNW A;  2I5V O;  2RTI B;  1BBP A;  1OPA A;  1LCZ A;  5B2A O;  3VG4 A;  5D48 A;  4AZR A;  4GD9 A;  1B4M A;  1CRB A;  1EQD A;  4HPB A;  5K67 A;  4QAE A;  3WZP A;  1SWQ A;  1SRF A;  5AJC A;  2ANS A;  3CMP A;  4I60 A;  3WBG A;  4Z2O A;  4IAB A;  3KFF A;  4LKP A;  4MIS A;  5AQ6 A;  3ELX A;  4Z6J A;  1JMZ A;  1SY3 A;  2PI3 O;  2RTN B;  1E00 A;  3FA8 A;  2Q4N A;  4NNT A;  3BU1 A;  4NP1 A;  4QQ1 A;  4TLJ A;  2X45 A;  2DJF A;  2OVA A;  3OE3 A;  4A1H A;  2AL0 X;  1KT7 A;  3FR2 A;  3RDQ A;  1OBU A;  4BJ8 A;  2MM3 A;  2OL8 O;  1ML7 A;  1PM1 X;  4OS0 A;  3HOL A;  2A2G A;  4QYN A;  2E4J A;  4Y0R A;  5CYB A;  5FEN A;  4U8U M;  1B56 A;  1WBI A;  4QGW A;  4A8Z A;  3CKG A;  3MM0 A;  5FQ7 E;  4YFR A;  1QFV A;  1D2U A;  3UEU A;  4BX5 A;  1I9H A;  2IZA A;  2JOZ A;  5K68 A;  2QMI A;  2G78 A;  2GH7 A;  4FBV A;  4Z28 A;  1RXH A;  3ZW1 A;  1I05 A;  1N9Y A;  3FEP A;  4GDZ A;  4FBR A;  3H3I A;  1SWG A;  2X8F A;  1SRE A;  4OMW A;  3KZA A;  5D45 A;  1U18 A;  5L8O A;  3PQU A;  1LPJ A;  3F6Z B;  4YFP A;  3S5V A;  3WYP A;  4CPH B;  4IB7 A;  3DSZ A;  4Y0S A;  4KH8 A;  1JJJ A;  2IZH B;  1UZ2 X;  1Y0G A;  1HQQ A;  2JU7 A;  4I95 A;  4ORU A;  2FKJ A;  3CKF A;  2OF8 A;  2OL7 A;  1QWD A;  5K06 A;  2CM9 A;  2X4M A;  1X8U A;  3QKG A;  4NYR A;  1JQP A;  3CQN A;  1W4T A;  4U9C A;  2L9C A;  3FDC A;  2W2A A;  5B5G A;  2RD7 C;  4NLI A;  1IIU A;  1RSU B;  2W2F A;  2GJ5 A;  5L8N A;  4ON1 A;  3EM0 A;  3UEW A;  4QYP A;  3T6L A;  1SLD B;  1ZNG A;  2LBV A;  3WZQ A;  3X00 A;  2G79 A;  1GX3 A;  4Y59 A;  4YBU A;  5HTE A;  3I0A A;  3WJC A;  4ZHF A;  1LFO A;  4QZT A;  1E2T A;  3KFI A;  1VYG A;  1S2P A;  2X32 A;  3PK2 A;  1EII A;  1YWC A;  4FBO A;  2JMB A;  3APU A;  4YDB A;  5F7G A;  1DV9 A;  2R73 A;  1SWA A;  2OY8 A;  1SWT A;  4KC7 A;  3RZY A;  1QQS A;  1YIV A;  2VFB A;  1HMR A;  1SMP I;  2IZC B;  2IZG B;  4A1Y A;  2WQ9 A;  1SWN A;  2F09 A;  3L4R A;  3PH5 A;  4GET A;  3SOT A;  3T2X A;  1SA8 A;  3RDO A;  2X34 A;  2X56 A;  4IMO A;  5EED A;  3RWX A;  1D3S A;  4EKV A;  2LKK A;  5LJE A;  1ICM A;  1Y9T A;  1QG5 A;  3D97 A;  1N0S A;  2OVE A;  3B2K A;  1OBQ A;  1BSO A;  2IZL B;  5BVS A;  4IRW A;  4GJV A;  2O62 A;  2QM9 A;  5FQ8 E;  4B55 A;  1MOY A;  1SWP A;  3ELZ A;  5JR8 A;  2JW1 A;  4GZV A;  2OY7 A;  4N7C A;  4FGI B;  2UYW A;  4I6S A;  1VWP B;  4TQ2 A;  1HMS A;  4HPA A;  4DQ4 A;  2X8T A;  2KW1 A;  1T68 X;  4ORW A;  4U46 A;  3RDX A;  3WZN A;  1T8V A;  3RBY A;  1BRP A;  1KT6 A;  1SWH A;  5HA1 A;  5LJK A;  3TGB A;  1HBP A;  1PBY A;  3DTQ A;  1TXL A;  2G8C O;  1FJ1 E;  5EZ2 A;  2A0A A;  2NNE A;  2ACP X;  1IJ8 A;  1X8Q A;  1Y9L A;  1W5R A;  4C5P A;  4FQB B;  1X8O A;  4BX7 A;  4XMC A;  2GTL O;  1LCW A;  1GGL A;  1P6P A;  4GGT A;  3SLO A;  3VE2 A;  1IKJ A;  1SWD A;  4O4O A;  4Y0Q A;  3FYF A;  3RY2 A;  4CPH A;  1SRG A;  3MBT A;  3NX2 A;  4L1N A;  4OMX A;  2KTS A;  2OVS A;  2IZF B;  2G7B A;  3HWD A;  1EPA A;  3UAQ A;  2RQ0 A;  5H9K A;  4NW4 A;  4GDA A;  5DPQ A;  2NNQ A;  4HPC A;  4BOE A;  2RTD B;  2RTB B;  3SLT A;  1MX8 A;  1NQN A;  3WJB A;  1SLG B;  2AT5 X;  2BS6 A;  1CBS A;  1VWF B;  2FHN X;  1ERX A;  1Y55 X;  1SRJ A;  1KOI A;  2LFO A;  2R74 A;  3FIQ A;  1I06 A;  1YWA A;  3HWG A;  1DZP A;  2GTF X;  3PPT A;  1S44 A;  4YCH A;  3WOV A;  3P6E A;  3Q34 A;  4ORR A;  3S60 A;  2DM5 A;  4PJ2 A;  2IZI A;  3JQO A;  1RXJ A;  1EW3 A;  1S7D A;  4GH7 A;  4IAX A;  1ACD A;  5D4A A;  4IB8 A;  1SRH A;  2XST A;  1HBQ A;  4GRJ A;  1VWR B;  1XKI A;  2Y3E A;  4GJS A;  1ICN A;  2BHV A;  2OZQ A;  4ALB A;  1MX7 A;  1EAL A;  1BSY A;  1VWM B;  1U17 A;  4CK4 A;  1VWD B;  5KID A;  1STS B;  2QCB A;  4ZH6 A;  1I4U A;  1AVD A;  1PMP A;  2GTL N;  2Y32 A;  2OY5 O;  4ZCB A;  2FHL A;  2Q39 A;  3RY1 A;  1KQW A;  4TKB A;  5IXG A;  1KT4 A;  2A8G A;  3HOE A;  1NP4 A;  2RTL A;  3STK A;  3VG2 A;  2HKD A;  4HWM A;  3VG7 A;  2Q2M A;  1SWJ A;  4YVB A;  1LNM A;  3TGA A;  4D6B A;  4CPE A;  3NR3 A;  3WJG A;  4I3B A;  1VWK B;  1SWC A;  1TOW A;  2GC9 A;  3CBC A;  1MVG A;  1N4J A;  2MHD A;  3P24 A;  3NPO A;  1GKA A;  1O1U A;  3LHN A;  5EPQ A;  4KT5 A;  4AZQ A;  5BVT A;  4O9S A;  2BT9 A;  1NQM A;  3FA6 A;  5F58 A;  3NQ9 A;  3WZO A;  3MVF A;  4ID2 A;  4CPF A;  2A5B A;  2FS6 A;  2Q9S A;  5LJH A;  1QAB E;  1AQB A;  4KII A;  1HQP A;  2XKL A;  4GKC A;  1MK5 A;  4GU8 A;  4ORY A;  1RAV A;  3FID A;  4TJZ A;  5EDB A;  5HCC C;  1IFC A;  1KT3 A;  2IZK A;  4O4S A;  3P6D A;  2WUT A;  4MVE A;  1DFV A;  4BX7 B;  3STN A;  2RTH B;  4ZH9 A;  2JU8 A;  2OFR X;  3SZJ A;  2JU3 A;  1KL4 A;  1ZRY A;  2RTA A;  3TF6 A;  4AYH A;  3SZH A;  2HZQ A;  3P6C A;  1N9M A;  1Y53 X;  1BEB A;  3E3C A;  4ORS A;  1FDQ A;  1MDC A;  1E02 A;  3VHH A;  1U0X A;  3RDS A;  1K24 A;  1X71 A;  1B0O A;  3BU9 A;  3D96 A;  4OS8 A;  4UU2 A;  4ZHC A;  3FR5 A;  5H9L A;  1HXZ A;  3LV4 A;  1VWH B;  4L3R A;  4QNI A;  1NC9 A;  3OBL A;  4WBK A;  4EFG A;  1BLR A;  1E06 A;  2RTR B;  3F8A A;  4INN A;  4JO6 A;  1VWC B;  1NGL A;  4BVM A;  4RUU A;  4XMG A;  1SLF B;  2QO5 A;  3RE6 A;  3FW5 A;  3N91 A;  5EEE A;  2A2U A;  5L3Y A;  3FEL A;  4PSQ A;  2JN3 A;  1OEK A;  4YMY A;  2BSZ A;  3BS2 A;  3C77 X;  2C4I A;  2RTC B;  1SWE A;  3S26 A;  3CWK A;  1QY0 A;  2RCQ A;  2X46 A;  5IRU A;  4DQ3 A;  1RBP A;  1LDQ A;  4O3Z A;  4YKM A;  5HZ6 A;  5HZ9 A;  4LZV A;  1NBX A;  1EXS A;  2QO6 A;  3GE2 A;  3SAO A;  1IW2 A;  3I17 A;  2AVI A;  2FRS A;  3JS1 A;  4IBA A;  5JD2 A;  1GT1 A;  3WJD A;  2WWP A;  4Z27 A;  1YP6 A;  3RKG A;  2CM4 A;  2RTO B;  3TGC A;  4TNN A;  1EI5 A;  4NYQ A;  4XMD A;  1VWN B;  1KZX A;  4LKT A;  1H91 A;  3V8U A;  4A60 A;  5H8T A;  1ZNL A;  4ODD A;  4NV8 A;  1GXA A;  4O3X B;  3K3L A;  4BBO A;  1AEL A;  4KC8 A;  2MF6 A;  1SY1 A;  3NX1 A;  1FEN A;  1VWL B;  4GUZ A;  4NNS A;  4OS3 A;  5FAZ A;  3HWF A;  3SZI A;  4ZFX A;  3STM X; 
#chains in the Genus database with same CATH homology
 3AKM A;  1KT5 A;  3UEV A;  5H9A A;  2WR6 A;  1GKA B;  2KTD A;  3EBW A;  1G74 A;  3KFH A;  4ZGF A;  1DC9 A;  3BSZ E;  2QO4 A;  3Q6L A;  3RSW A;  1FE3 A;  2YMS A;  2HNX A;  5F1E A;  3ZQ3 A;  3O22 A;  4QGX A;  4D6A A;  1GM6 A;  4ZHH A;  4ZHG A;  2RCT A;  3VG5 A;  1EUO A;  3BY0 A;  2FTB A;  1R0U A;  3VG3 A;  1FEM A;  1ADL A;  1BJ7 A;  5D47 A;  3FMZ A;  3PQS A;  2HMB A;  1YUP A;  5B27 A;  4TKH A;  1JYJ A;  2X8S A;  3BRN A;  1CJ5 A;  5AJB A;  2ACO A;  3NAD A;  1JIW I;  1YP7 A;  1CBR A;  3WJF A;  1SY2 A;  1DF3 A;  3ZUI A;  1NP1 A;  3UEX A;  5HZ5 A;  3ZUO A;  3BX7 A;  3VPJ E;  3EYC A;  3EBK A;  2GTL M;  2N93 A;  3B2H A;  5FQ6 E;  2L5P A;  1SXU A;  4I3C A;  3FA7 A;  2NND A;  1SXY A;  3WVM A;  4I9S A;  1X89 A;  3CQR A;  3NBX X;  3NP1 A;  4UU3 A;  4AZO A;  1E5P A;  2IFB A;  4HFO A;  2NP1 A;  1KQX A;  4M6S A;  3HWE A;  2L67 A;  4QZU A;  4GNY A;  2Z4I A;  5EDC A;  2MWH A;  1SXW A;  1SY0 A;  2MJI A;  2FWV A;  3WJE A;  1A2D A;  3P6G A;  2BS5 A;  5HA0 A;  3FA9 A;  4EEJ A;  1FTP A;  2FR2 A;  4JGL A;  1Z24 A;  4MIR A;  2AMM X;  4O49 A;  4TKJ A;  2BLG A;  5AEO A;  2FR3 A;  3P02 A;  4WFV A;  2P8G A;  5HCD C;  3BLG A;  3HTY A;  1OEJ A;  1ZNK A;  4NLJ A;  1JV4 A;  1ZND A;  1TW4 A;  2F73 A;  2WEW A;  3FW4 A;  4QRL A;  4RUN A;  5H9N A;  1B8E A;  4LZU A;  3U03 A;  1JYD A;  3ZW2 A;  2RN4 A;  4ZGU A;  2K62 A;  1RLB E;  3C76 X;  4MVL A;  2LA7 A;  3P6H A;  1IFB A;  2FS7 A;  4O4U A;  2ASN X;  1LF7 A;  4YGG A;  5B29 A;  1VYF A;  4U8U O;  1TOU A;  3P6F A;  4ML7 B;  1A57 A;  2MO5 A;  3FR4 A;  1LIF A;  3JSQ A;  4QGV A;  4YBP A;  5IO7 A;  4WHI A;  4AZP A;  2WEX A;  1HMT A;  1O8V A;  5BYP A;  1LIE A;  3OD9 A;  1URE A;  1G5W A;  1AVG I;  4KCA A;  3VG6 A;  2AH7 X;  3IA8 A;  4CSB A;  1CBQ A;  4AZN A;  2M4L A;  5HWZ A;  4MVK A;  5IO5 A;  3NQK A;  3FEK A;  5LJG A;  4ZJ0 A;  1X8N A;  1HN2 A;  1DZK A;  2K23 A;  1LIB A;  3EMM A;  2AKQ A;  1YWB A;  3PEC A;  2L68 A;  4XMF A;  1OPB A;  1GX8 A;  1PBO A;  2FT9 A;  2WSJ A;  3APW A;  1ERB A;  3GAQ A;  1A18 A;  3PED A;  1GT4 A;  3APV A;  1BM5 A;  1QY1 A;  3PH6 A;  5CE4 A;  5HBS A;  2ZAI A;  3APX A;  2OVD A;  4U8U N;  1FEL A;  2AT6 X;  1LKE A;  5LJC A;  5HZ8 A;  5C0N A;  3ZW0 A;  3VE1 A;  3B2J A;  1PEE A;  1X8P A;  2Z4H A;  1OBP A;  5DG4 A;  4O3Y A;  1KXO A;  1OEE A;  2HZR A;  4IB9 A;  4YH0 A;  4ZR2 A;  3NQ3 A;  4YFQ A;  5FFH A;  4IMN A;  1G7N A;  3D4R A;  3ZI8 A;  4AW8 A;  1A3Y A;  1GT3 A;  1GX9 A;  3F9D A;  4EDE A;  1JJX A;  3OJY C;  1VPR A;  1ZNE A;  4YGH A;  4K19 A;  2AT3 X;  4XMH A;  4EQA C;  1DZJ A;  3FLL A;  2A3F X;  2AT0 X;  1ALB A;  5LKF A;  1CBI A;  3CR6 A;  2OFM X;  1LID A;  3O2Y A;  5HCE C;  2Q2P A;  5HZQ A;  4U3Q A;  2CBS A;  4LQZ A;  1AB0 A;  1YWD A;  4IB6 A;  2A13 A;  3FEN A;  4N7D A;  1KZW A;  1IKE A;  5IO6 A;  3KFG A;  3B2L A;  3BDR A;  2POA A;  1JZU A;  3G7X A;  4YKO A;  1L6M A;  4CV7 A;  4IAW A;  3TZS A;  4EXZ A;  4ARH A;  1EIO A;  2RA6 A;  4R0B A;  4I9R A;  3U0D A;  1I04 A;  1LIC A;  1QFT A;  2R56 A;  2WQA E;  5F6Z A;  4YCE A;  1BWY A;  1JBH A;  3PP6 A;  2HYS A;  4GK9 A;  5LJB A;  4AZM A;  1KGL A;  4XME A;  2CZT A;  4WFU A;  4M7M A;  2KD2 A;  2W2B A;  3T1D A;  4O4X A;  3ZZV A;  3ZW1 B;  3AKN A;  2YG2 A;  1XCA A;  1EPB A;  5F6B A;  1GT5 A;  5LKE A;  2ZAG A;  4I3D A;  1BSQ A;  1QY2 A;  4GE1 A;  2CBR A;  3IFB A;  5L8I A;  4COT A;  3VU1 A;  5KIC A;  5D8J A;  2LB6 A;  4YDA A;  2CZU A;  2QOS C;  3KQ0 A;  4BQU A;  2LBA A;  2FLJ A;  4MVI A;  1BRQ A;  4ZHD A;  1SXX A;  4O3W A;  5LJD A;  5KHP A;  3MX7 A;  1G85 A;  1DZM A;  3WXQ A;  2PY1 A;  3BX8 A;  3O19 A;  1ZNH A;  2EU7 X;  1T0V A;  3C78 X;  4YGZ A;  3CBS A;  3ZW0 B;  2AT8 X;  4Y0P A;  1MUP A;  1DV9 A;  4ES7 A;  5HAE A;  1O1V A;  4ORX A;  2HLV A;  4HPD A;  5BVQ A;  1TVQ A;  3D95 A;  3ZWE A;  3B2I A;  2KT4 B;  4ALO A;  2ALL X;  3HK1 A;  4GNW A;  1BBP A;  1OPA A;  3VG4 A;  5D48 A;  4AZR A;  1B4M A;  1CRB A;  1EQD A;  4HPB A;  4QAE A;  5AJC A;  2ANS A;  3CMP A;  3WBG A;  4IAB A;  3KFF A;  4LKP A;  4MIS A;  5AQ6 A;  3ELX A;  1SY3 A;  4NNT A;  1E00 A;  3FA8 A;  2Q4N A;  4QQ1 A;  3BU1 A;  4TLJ A;  2X45 A;  2OVA A;  3OE3 A;  4A1H A;  2AL0 X;  1KT7 A;  3FR2 A;  1OBU A;  2MM3 A;  4OS0 A;  1ML7 A;  1PM1 X;  3HOL A;  2A2G A;  4QYN A;  2E4J A;  4Y0R A;  5CYB A;  5FEN A;  4U8U M;  1B56 A;  4QGW A;  4A8Z A;  5FQ7 E;  4YFR A;  1QFV A;  1D2U A;  3UEU A;  2JOZ A;  2QMI A;  2G78 A;  4FBV A;  3ZW1 A;  1I05 A;  3FEP A;  4GDZ A;  4FBR A;  3H3I A;  2X8F A;  4OMW A;  3KZA A;  5D45 A;  1U18 A;  5L8O A;  3PQU A;  1LPJ A;  3F6Z B;  4YFP A;  3S5V A;  4IB7 A;  3DSZ A;  4Y0S A;  4KH8 A;  1JJJ A;  1UZ2 X;  2JU7 A;  4I95 A;  4ORU A;  1QWD A;  5K06 A;  2CM9 A;  1X8U A;  3QKG A;  4NYR A;  3CQN A;  4U9C A;  2L9C A;  2W2A A;  2RD7 C;  4NLI A;  1IIU A;  2W2F A;  2GJ5 A;  5L8N A;  4ON1 A;  3EM0 A;  3UEW A;  4QYP A;  1ZNG A;  2LBV A;  2G79 A;  4YBU A;  5HTE A;  3I0A A;  3WJC A;  4ZHF A;  1LFO A;  4QZT A;  3KFI A;  1VYG A;  1S2P A;  1YWC A;  4FBO A;  2JMB A;  3APU A;  4YDB A;  5F7G A;  2R73 A;  3RZY A;  4KC7 A;  1QQS A;  1YIV A;  1HMR A;  1SMP I;  4A1Y A;  2WQ9 A;  4GET A;  2F09 A;  3L4R A;  3PH5 A;  3SOT A;  1SA8 A;  4IMO A;  5EED A;  3RWX A;  1D3S A;  2LKK A;  5LJE A;  1ICM A;  1Y9T A;  1QG5 A;  3D97 A;  1N0S A;  2OVE A;  3B2K A;  1OBQ A;  1BSO A;  5BVS A;  5FQ8 E;  5JR8 A;  2O62 A;  2QM9 A;  3ELZ A;  2JW1 A;  4GZV A;  4N7C A;  4FGI B;  4I6S A;  4TQ2 A;  1HMS A;  4HPA A;  4DQ4 A;  2X8T A;  2KW1 A;  1T68 X;  4ORW A;  1T8V A;  3RBY A;  1BRP A;  1KT6 A;  5HA1 A;  3TGB A;  5LJK A;  1HBP A;  3DTQ A;  1TXL A;  5EZ2 A;  2A0A A;  2NNE A;  2ACP X;  1X8Q A;  1Y9L A;  4FQB B;  1X8O A;  4XMC A;  2GTL O;  1GGL A;  1P6P A;  3VE2 A;  1IKJ A;  4Y0Q A;  4O4O A;  3FYF A;  3MBT A;  3NX2 A;  4L1N A;  4OMX A;  2KTS A;  2OVS A;  2G7B A;  3HWD A;  1EPA A;  3UAQ A;  2RQ0 A;  5H9K A;  4NW4 A;  5DPQ A;  2NNQ A;  4HPC A;  4BOE A;  1MX8 A;  3WJB A;  2AT5 X;  2BS6 A;  1CBS A;  3FIQ A;  3U9P C;  1ERX A;  2LFO A;  5HTD A;  1KOI A;  2R74 A;  3HWG A;  5LJH A;  1I06 A;  1YWA A;  4YCH A;  1DZP A;  2GTF X;  3PPT A;  1S44 A;  3WOV A;  3P6E A;  4ORR A;  3S60 A;  2DM5 A;  4PJ2 A;  3JQO A;  1S7D A;  1EW3 A;  4IAX A;  4GH7 A;  1ACD A;  5D4A A;  4IB8 A;  2XST A;  1HBQ A;  4GRJ A;  1XKI A;  1ICN A;  2BHV A;  2OZQ A;  4ALB A;  1MX7 A;  1EAL A;  1BSY A;  4CK4 A;  1U17 A;  5KID A;  4ZH6 A;  1I4U A;  1PMP A;  2GTL N;  4ZCB A;  2Q39 A;  4TKB A;  1KQW A;  1KT4 A;  3HOE A;  1NP4 A;  3STK A;  3VG2 A;  3VG7 A;  4HWM A;  2Q2M A;  1LNM A;  3TGA A;  4D6B A;  3NR3 A;  3WJG A;  4I3B A;  3P24 A;  1TOW A;  4NP1 A;  2GC9 A;  3CBC A;  1MVG A;  2MHD A;  5EPQ A;  5BVT A;  3NPO A;  1GKA A;  1O1U A;  3LHN A;  4KT5 A;  4AZQ A;  4O9S A;  2BT9 A;  3FA6 A;  5F58 A;  3NQ9 A;  3MVF A;  4ID2 A;  2FS6 A;  2Q9S A;  1QAB E;  1AQB A;  4KII A;  1HQP A;  2XKL A;  4GKC A;  4GU8 A;  4TJZ A;  4ORY A;  5EDB A;  5HCC C;  1IFC A;  1KT3 A;  4O4S A;  3P6D A;  2WUT A;  4MVE A;  1DFV A;  3STN A;  4ZH9 A;  2JU8 A;  2OFR X;  2JU3 A;  1ZRY A;  3TF6 A;  2HZQ A;  3P6C A;  1BEB A;  3E3C A;  4ORS A;  1FDQ A;  1MDC A;  1E02 A;  1U0X A;  3BU9 A;  1X71 A;  1B0O A;  3D96 A;  4OS8 A;  4UU2 A;  4ZHC A;  3FR5 A;  5H9L A;  3LV4 A;  4L3R A;  4QNI A;  3OBL A;  4WBK A;  4EFG A;  1BLR A;  1E06 A;  4INN A;  3F8A A;  4BVM A;  1NGL A;  4RUU A;  4XMG A;  2QO5 A;  3FW5 A;  3N91 A;  5EEE A;  2A2U A;  3FEL A;  4PSQ A;  2JN3 A;  1OEK A;  4YMY A;  3BS2 A;  3C77 X;  3S26 A;  3CWK A;  1QY0 A;  2RCQ A;  2X46 A;  4DQ3 A;  1RBP A;  4O3Z A;  4YKM A;  5HZ6 A;  5HZ9 A;  4LZV A;  1EXS A;  2QO6 A;  3GE2 A;  3SAO A;  1IW2 A;  3I17 A;  2FRS A;  3JS1 A;  4IBA A;  3WJD A;  4AYH A;  1GT1 A;  1EII A;  2WWP A;  1YP6 A;  3RKG A;  2CM4 A;  3TGC A;  4TNN A;  1EI5 A;  4NYQ A;  4XMD A;  1KZX A;  4LKT A;  1H91 A;  3V8U A;  4A60 A;  5H8T A;  1ZNL A;  4ODD A;  1AEL A;  1GXA A;  4O3X B;  3K3L A;  4KC8 A;  3NX1 A;  1SY1 A;  4NNS A;  1FEN A;  4OS3 A;  5FAZ A;  3S5X A;  3HWF A;  4ZFX A;  3STM X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...