5KIDA

Tightening the recognition of tetravalent zr and th complexes by the siderophore-binding mammalian protein siderocalin for theranostic applications
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
173
structure length
173
Chain Sequence
SDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGSQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil gelatinase-associated lipocalin
publication title Engineered Recognition of Tetravalent Zirconium and Thorium by Chelator-Protein Systems: Toward Flexible Radiotherapy and Imaging Platforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 40
structure length 173
sequence length 173
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 5kidA00
5IO6A 4D6BA 3KQ0A 2AH7X 2QM9A 2CBSA 3KFFA 2O62A 4ORSA 3VG2A 4YKMA 2WQ9A 3NPOA 1SXXA 4YMYA 5BVSA 3VG5A 1GT5A 4IB6A 3NR3A 1U0XA 5LJDA 1HMSA 3APWA 3VG4A 4QGWA 3STMX 1X71A 1SXUA 2AT3X 2WR6A 2MM3A 4TNNA 2NNEA 2OZQA 2EU7X 2LKKA 5HTEA 3DSZA 1I06A 1MDCA 1PEEA 3C77X 2A3FX 3ELXA 3DTQA 5D8JA 2Q2MA 4A1YA 4ZJ0A 3NQ9A 5HBSA 4TQ2A 2R73A 2WUTA 1IKEA 3CQNA 1HQPA 2RD7C 3FA7A 3HWFA 2AKQA 4I9RA 1D3SA 1OEJA 1UZ2X 3MVFA 1G85A 3BRNA 1OBUA 1JYJA 1TOUA 1R0UA 3P6CA 4GKCA 1VYGA 4IBAA 4AW8A 5HZQA 2L9CA 3BU9A 2POAA 1AB0A 4OMXA 1QG5A 1U17A 4YDBA 5EDBA 3S26A 1IFCA 1LPJA 2G79A 4ALBA 3F8AA 4XMEA 2K23A 2A0AA 3QKGA 5EZ2A 5KICA 1DZKA 5IO7A 3U03A 4I3CA 2KTDA 1VPRA 4NYQA 1A2DA 3PH6A 5DPQA 3OJYC 3BX7A 3KFGA 3C76X 5EPQA 2A2GA 1BM5A 5CE4A 2OVEA 3D95A 4NYRA 1LIFA 1ZNDA 2P8GA 1CRBA 1QY2A 4HPBA 2AL0X 4K19A 5KHPA 1P6PA 3I0AA 3L4RA 5H9KA 5HWZA 2Q2PA 3EM0A 3PPTA 1QFVA 1L6MA 5LJEA 4XMGA 2RCQA 4EDEA 5AQ6A 3BU1A 3AKMA 5H9LA 1UREA 2A13A 4ZR2A 4AZMA 1G74A 4I3DA 2WSJA 3UEVA 1QWDA 2ANSA 2N93A 1BWYA 1S2PA 3PECA 3APUA 4GNYA 4QGVA 1RBPA 4OS3A 4ZHDA 1FTPA 1LICA 3BLGA 2FTBA 1JYDA 5FAZA 4WFVA 3ELZA 4AZQA 3CBCA 4Y0QA 1I05A 1MX8A 1IW2A 1KGLA 4EXZA 1E02A 1EIIA 3WVMA 5K06A 1DF3A 3B2KA 4MVIA 5HZ8A 2CBRA 1BJ7A 4IB7A 1SY0A 3MBTA 3EBKA 3VG3A 4Y0PA 3U0DA 1QABE 5H8TA 4BVMA 1ZNHA 1LFOA 1XKIA 4OMWA 4ORYA 3WJEA 1LKEA 3P6HA 1DZMA 2F73A 1I04A 1MVGA 1CJ5A 1ALBA 5IO5A 5FENA 1X8QA 4GRJA 2CZUA 1S44A 5HCCC 3APXA 2NP1A 4OS8A 1BSOA 4UU2A 5H9NA 3BY0A 1A18A 3P6FA 5HAEA 2AMMX 1ACDA 1LIEA 2JU7A 4KIIA 1IIUA 1T68X 2RA6A 3UEWA 4HPCA 4ORXA 1Z24A 2FR3A 3NADA 4O9SA 4XMDA 1BRQA 3FA8A 4QGXA 3U9PC 3CWKA 4ZFXA 1QY1A 5LJKA 4YBUA 3AKNA 4NNTA 1DC9A 5LJGA 3TF6A 4ZHFA 5HCDC 1BEBA 1TW4A 3B2HA 4A60A 1IFBA 1OPAA 1BSQA 1E06A 1YP7A 2AT8X 2PY1A 3WJBA 2X45A 1YUPA 4ZHGA 2HZRA 3ZUOA 5L8IA 2FS7A 2W2FA 1KZXA 3EBWA 4NP1A 2NNDA 4YCHA 1FDQA 1KQXA 5LKFA 4QAEA 3D97A 3FELA 2XKLA 3RSWA 5LJCA 4A1HA 4MVLA 1ZNEA 1T8VA 4QZTA 3HWEA 1GXAA 5D4AA 5HA0A 5HA1A 5F6ZA 1FENA 2FWVA 2K62A 1YWAA 2ALLX 3WJGA 4ZH9A 4M6SA 1FE3A 1MX7A 4ORUA 2W2BA 1X8NA 4QYPA 5B29A 4YGHA 4YDAA 2MJIA 1DZPA 3RZYA 1FELA 3STKA 3KZAA 1PBOA 3FIQA 4R0BA 4AZNA 1G7NA 1DFVA 2W2AA 3O19A 1NGLA 3ZQ3A 5KIDA 3FLLA 4ORWA 2AT0X 5H9AA 5EDCA 3D96A 2RCTA 3CBSA 4PSQA 5EEEA 4YKOA 5F6BA 3WJCA 2L5PA 3HK1A 4GH7A 1OBQA 3FA9A 5HZ9A 4GNWA 2Q9SA 2R56A 4IAWA 4TKBA 4ZHCA 3BS2A 3P6GA 1B0OA 1EUOA 5BVQA 3FEKA 3GAQA 4CK4A 2RQ0A 2OVDA 2GC9A 4EEJA 1O8VA 1XCAA 4N7CA 1NP4A 2X46A 4XMCA 3NQ3A 1ML7A 2FR2A 3FMZA 4HFOA 4RUUA 3TGCA 1AELA 1ICMA 3VG7A 1O1UA 3I17A 2CM9A 1A57A 1TVQA 1KT7A 2KT4B 2L67A 3CQRA 5HTDA 2OFRX 5HZ6A 1FEMA 1KXOA 1TOWA 4DQ4A 1KQWA 3T1DA 2XSTA 4AZOA 4LKPA 1BLRA 2G78A 1ZNLA 4A8ZA 1ADLA 3SAOA 4N7DA 1EPBA 2GJ5A 5JR8A 1KOIA 3VG6A 1YIVA 3C78X 3FR5A 4ZCBA 1DV9A 1SXWA 3Q6LA 4DQ3A 3CR6A 1GGLA 1X8UA 1EIOA 1DZJA 3UEUA 2OVAA 3IA8A 4D6AA 3TGBA 1B56A 4QZUA 2ASNX 1X8PA 2HYSA 1GT4A 1TXLA 4WFUA 1GX9A 4ZH6A 1CBRA 2DM5A 3NX1A 4YFQA 4M7MA 3TGAA 1QFTA 1HN2A 2Q39A 4GETA 1ZNGA 2JU8A 5F1EA 1YWDA 1KT5A 5C0NA 1HBPA 2CM4A 4RUNA 2FT9A 4XMFA 3WJDA 1EXSA 3STNA 4AYHA 1VYFA 1GX8A 1CBQA 1SY1A 2FLJA 2WEWA 1YWCA 1RLBE 4YGGA 3KFHA 2A2UA 2WQAE 3WJFA 4ARHA 3FA6A 1PM1X 4LZUA 4YCEA 4HPDA 1KZWA 4UU3A 4AZRA 1ZRYA 1ICNA 2OFMX 1GT3A 1O1VA 3WXQA 1OEKA 3JS1A 4ZGUA 4I9SA 4EFGA 1BSYA 1G5WA 3PH5A 1N0SA 4ORRA 1YWBA 2NNQA 1HBQA 1MUPA 3K3LA 1KT3A 3NP1A 3IFBA 4MVKA 3P6EA 4NLIA 4OS0A 5DG4A 2CZTA 2HMBA 3ZUIA 4YFRA 1SY2A 4XMHA 4LZVA 3FR2A 1JBHA 3B2JA 2E4JA 1JV4A 2HNXA 3PP6A 1JZUA 1LIDA 1YP6A 2G7BA 1LIBA 2MO5A 1BBPA 1ERBA 3FR4A 4ALOA 4I3BA 3O2YA 2ACOA 4HPAA 2WWPA 3CMPA 4TKHA 3TZSA 5BVTA 1JJJA 3WBGA 2FRSA 2ACPX 4ES7A 4YBPA 5LJHA 2WEXA 1ERXA 5D45A 5FFHA 3EMMA 5HCEC 2HLVA 5LKEA 4ODDA 2AT5X 4IB8A 2IFBA 5F58A 1S7DA 1SY3A 1NP1A 1QY0A 2QO4A 1E00A 3APVA 1QQSA 4LKTA 1SA8A 2LB6A 1KT6A 4BQUA 1AQBA 1H91A 5L8OA 5HZ5A 2HZQA 3UEXA 5D47A 1EW3A 2LBAA 3B2LA 4YFPA 1EPAA 1HMRA 1LF7A 3FW5A 1IKJA 1U18A 2YG2A 1X8OA 4QYNA 4TJZA 2R74A 2FS6A 4GE1A 5LJBA 5D48A 3F9DA 1GKAA 1KT4A 2Q4NA 3B2IA 4Y0RA 3P6DA 1CBSA 1D2UA 3G7XA 1EQDA 3EYCA 5EEDA 3FEPA 1PMPA 1GM6A 2LFOA 3FW4A 3FENA 2BLGA 1X89A 2L68A 1EALA 1SXYA 3HWGA 4NNSA 4YH0A 1AVGI 3NX2A 4NLJA 1B8EA 4IMNA 1JJXA 2LBVA 2JU3A 4ZHHA 2QO6A 4Y0SA 4IAXA 1GT1A 1GKAB 1T0VA 5L8NA 4TKJA 4YGZA 2QO5A 3HWDA 4IB9A 4TLJA 2JN3A 3KFIA 1HMTA 1CBIA 1E5PA 1OBPA 2QOSC 1OEEA 4IMOA 3PEDA 3BSZE 2AT6X 4AZPA 1B4MA 1LNMA 2GTFX 5B27A 1OPBA 3BX8A 3O22A 1BRPA 4BOEA 4WBKA 1A3YA 1I4UA 2JOZA 1ZNKA 3JSQA 3BDRA 5F7GA
chains in the Genus database with same CATH superfamily
2OF8A 3S60A 5IO6A 4D6BA 1STPA 3KQ0A 2AH7X 3T6LA 2QM9A 2RTIB 2CBSA 3KFFA 2O62A 3BDRA 4ORSA 3VG2A 3ZW2A 4YKMA 4CPFA 4O4UA 2WQ9A 3NPOA 2JW1A 1SXXA 1VWKB 4YMYA 5BVSA 1PTSA 1NQNA 1Y55X 4Y59A 3VG5A 2IZHB 1K24A 1GT5A 1VWLB 4IB6A 1UYOX 4L3RA 3NR3A 1U0XA 5LJDA 2BS6A 2G5LA 1HMSA 1Y9TA 1STSB 2OVSA 2X8FA 3APWA 4QGWA 3VG4A 3STMX 4Z2OA 1X71A 1SXUA 2AT3X 2FHLA 2WR6A 1VWQB 2MM3A 4TNNA 3RDSA 3RDMA 2NNEA 2OY1O 2OZQA 3ZI8A 3HTYA 2EU7X 2LKKA 5HTEA 3DSZA 1I06A 1MDCA 2GTLN 1PEEA 2MF6A 2A3FX 3C77X 3DTQA 3ELXA 2Q2MA 4KT5A 5D8JA 4A1YA 3NQ9A 4ZJ0A 5HBSA 4TQ2A 2R73A 3VGWA 1JMXA 3WYQA 5B5FA 2WUTA 1IKEA 3CQNA 1HQPA 2RD7C 2VFBA 1SWEA 2X8TA 2AKQA 3FA7A 3HWFA 1D3SA 1OEJA 1UZ2X 4GGTA 3MVFA 2GH7A 4I9RA 3WZPA 1G85A 3BRNA 1OBUA 1JYJA 2DJGA 4U8UM 1TOUA 1VWEB 1LDOA 1R0UA 3P6CA 4GKCA 3RBYA 1VYGA 4IBAA 4AW8A 5HZQA 2L9CA 3BU9A 2POAA 2ZSCA 1AB0A 1HY2A 2VFCA 4OMXA 1QG5A 1U17A 4YDBA 5EDBA 3S26A 1IFCA 1LPJA 2G79A 4ALBA 3F8AA 3FDCA 2K23A 2A0AA 3HOLA 3QKGA 4XMEA 5EZ2A 2BT9A 5KICA 1DZKA 1JIWI 5IO7A 1EIIA 1JMZA 2HKDA 3U03A 4I3CA 5K68A 3EW1A 4FBOA 1KL3A 1SWOA 3V8UA 2IZLB 2KTDA 2X56A 3VE2A 4JGLA 1VPRA 1VWCB 4NYQA 1A2DA 3PH6A 5DPQA 3OJYC 5BYPA 3BX7A 3KFGA 4MISA 3C76X 5EPQA 1VWHB 2A2GA 1BM5A 5CE4A 2OVEA 3D95A 2CAMA 4NYRA 1SWAA 2OY7A 1LIFA 1ZNDA 2P8GA 1CRBA 1QY2A 2KW1A 1SWKA 4HPBA 2AL0X 4OKAA 5JD2A 3X00A 4K19A 5KHPA 2RTJA 1P6PA 3I0AA 3N91A 3L4RA 5H9KA 1SWSA 2Q2PA 5HWZA 3EM0A 5K06A 3PPTA 1QFVA 1L6MA 5LJEA 4XMGA 3P02A 2RCQA 4EDEA 3LHNA 3BU1A 5AQ6A 3AKMA 4Z2PA 5H9LA 1UREA 2A13A 2WPUA 1LELA 4ZR2A 4AZMA 2RTMA 1G74A 4I3DA 2WSJA 3UEVA 1QWDA 2ANSA 4BX7A 2N93A 2VDFA 1BWYA 1S2PA 3PECA 3APUA 4GNYA 2UYWA 1RBPA 4CPIA 4QGVA 2RTGB 4OS3A 4Z6JA 4ZHDA 1FTPA 1LICA 3BLGA 2FTBA 1JYDA 5FAZA 3OD9A 4WFVA 2MHDA 3ELZA 4AZQA 4MIRA 2C1SA 4I95A 3AUMO 3CBCA 4Y0QA 1I05A 1MX8A 1IW2A 1KGLA 2KD2A 4IRWA 4O4XA 4I6SA 1AVDA 1E02A 1MOYA 2RTOB 3WVMA 4CSBA 4EXZA 3B2KA 4MVIA 3F6ZB 5HZ8A 2CBRA 4COTA 1BJ7A 2OFBA 3RKGA 4IB7A 1SY0A 3H3IA 1VWFB 2ZAIA 3MBTA 3EBKA 3VG3A 1PBYA 4Y0PA 3U0DA 1QABE 5H8TA 4BVMA 1ZNHA 1LFOA 2IZGB 1NC9A 1VWJB 1XKIA 4ID2A 4OMWA 4ORYA 3WJEA 2IZBA 1LKEA 3P6HA 4O49A 1DZMA 4CPEA 5FQ6E 1WBIA 3RWXA 2IZFB 2RTNB 4L1NA 2F73A 1I04A 1MVGA 1HXZA 1N9MA 1SWBA 4O3ZA 1NBXA 1CJ5A 1ALBA 3CKFA 1SREA 5FENA 4EQAC 5IO5A 2KTSA 1X8QA 1I9HA 4GRJA 4GZVA 2CZUA 1S44A 5HCCC 3WZNA 3APXA 1W6FA 2IZAA 2NP1A 4OS8A 2A5CA 1BSOA 1NQMA 2OY8A 3BY0A 4UU2A 5H9NA 1A18A 3MM0A 3SLTA 1W4TA 2GTLO 1KL4A 3VHIA 3P6FA 2OY5O 2RTQB 2AMMX 1ACDA 1LIEA 2JU7A 4KIIA 1SRGA 5HAEA 1IIUA 1T68X 2RA6A 3UEWA 4HPCA 4ORXA 1OSPO 1Z24A 2FR3A 3NADA 4Y5DA 4O9SA 4XMDA 1BRQA 5B5GA 1SMPI 3FA8A 4QGXA 5AJCA 3U9PC 4BJ8A 5B10O 4EKVA 5FQ7E 3CWKA 4ZFXA 4O3WA 4U8UO 4Z2VA 1QY1A 4BX5B 4YBUA 5LJKA 3AKNA 1VWIB 1SLGB 3T2XA 4NNTA 1DC9A 4KC8A 5LJGA 3TF6A 4ZHFA 5HCDC 1BEBA 1TW4A 3B2HA 4NV8A 4A60A 1IFBA 1SWCA 5F2BA 3MG5A 1OPAA 1BSQA 1E06A 1YP7A 2AT8X 2PY1A 3WJBA 4GD9A 2C1QA 1YUPA 2X45A 4ZHGA 2HZRA 3RE6A 3SLOA 3S5VA 3ZUOA 2RTEB 5L8IA 2FS7A 1N9YA 2W2FA 1KZXA 3EBWA 4NP1A 2NNDA 4YCHA 4U8UN 1FDQA 1KQXA 2FHNX 5LKFA 4QAEA 3LV4A 3D97A 1SRFA 3FELA 3RY1A 2BHVA 2XKLA 4BBOA 3RSWA 5LJCA 4A1HA 4MVLA 1VWRB 1ZNEA 2RTLA 3PQUA 4DNEA 1T8VA 2X34A 3HWEA 4QZTA 1GXAA 5D4AA 1N4JA 5HA0A 5HA1A 5F6ZA 4CV7A 2OF9A 3WZOA 3VHMA 1FENA 1SWUA 2FWVA 1YWAA 1LCVA 2K62A 5IRUA 3VPJE 1DF3A 2ALLX 3WJGA 3MX7A 1VWBB 4ZH9A 4M6SA 1FE3A 1MX7A 4ORUA 1SRHA 4LQZA 2W2BA 1X8NA 4QQ1A 4QYPA 5B29A 4YGHA 1SWNA 2MJIA 4YDAA 3PK2A 1DZPA 3RZYA 1MM9A 4CDEA 2X32A 4U46A 1RXHA 4FBRA 1MK5A 1FELA 3WOVA 2M4LA 3STKA 3KZAA 1PBOA 4Z27A 4KC7A 3NQKA 3FIQA 1STRB 1SWDA 4R0BA 4AZNA 4DCBA 1G7NA 3D4RA 2QCBA 2OYBO 1DFVA 2W2AA 3O19A 4MVEA 1NGLA 3ZQ3A 5KIDA 3FLLA 4ORWA 2AT0X 5H9AA 5EDCA 2IZKA 3D96A 2RCTA 3CBSA 4GDAA 4PSQA 5EEEA 4GU8A 4YKOA 5F6BA 2L5PA 3WJCA 3HK1A 4GH7A 4BX6A 1OBQA 3FA9A 3SLJA 5HZ9A 4GNWA 2Q9SA 3D9WA 5CSEA 2R56A 4IAWA 4TKBA 4ZHCA 3BS2A 3P6GA 1B0OA 1EUOA 2ZAGA 5BVQA 5CHKA 3FEKA 3GAQA 1VWGB 4CK4A 2RQ0A 4FQBB 2OVDA 2GC9A 4EEJA 1O8VA 1SWFA 5B2AO 1XCAA 4N7CA 2AVIA 1IJ8A 4NW4A 4C5PA 1NP4A 2X46A 2IZCB 4XMCA 3NQ3A 3WZQA 1ML7A 2FR2A 3FMZA 3Q34A 4HFOA 4RUUA 1DF8A 3TGCA 1AELA 1ICMA 2IZEB 2OL8O 3VG7A 1O1UA 3I17A 1Y9LA 1RSUB 2CM9A 1A57A 4Z28A 1TVQA 1KT7A 2KT4B 2L67A 4O4OA 3CQRA 5HTDA 2OFRX 3AEHA 2X4MA 3HOEA 1FEMA 1KXOA 5HZ6A 2RTKA 2A5BA 1TOWA 4DQ4A 1KQWA 3T1DA 4B55A 2XSTA 4OELA 4LKPA 4AZOA 1RAVA 4BX7B 1BLRA 1VWPB 2G78A 1ZNLA 4A8ZA 1ADLA 3SAOA 4N7DA 1EPBA 1RSTB 2GJ5A 4HWMA 2X55A 5JR8A 4GGRA 2OFAA 1KOIA 3VG6A 1YIVA 2Y32A 3C78X 3FR5A 1LCWA 4ZCBA 1E2TA 1SXWA 3Q6LA 3RDOA 4GGZA 4DQ3A 3CR6A 5AEOA 1GGLA 2MWHA 1X8UA 2RTHB 1DZJA 3HPEA 1EIOA 3UEUA 2FKJA 1SLEB 2OVAA 3T2WA 3T6FA 3IA8A 4D6AA 3TGBA 1B56A 2I5VO 4QZUA 2ASNX 1X8PA 2HYSA 1GT4A 2AF5A 1TXLA 1W5RA 1GX9A 1K3BA 2QMIA 1CBRA 2DM5A 4WFUA 4ZH6A 3E3CA 3NX1A 4YFQA 4M7MA 3TGAA 1QFTA 4ML7B 2BS5A 1HN2A 2Q39A 5B11O 4GETA 1ZNGA 2JU8A 1VWMB 1YWDA 5F1EA 4KCAA 3PQSA 3RE5A 3KVNA 5CYBA 1KT5A 5C0NA 1EI5A 1HBPA 3ZW0A 3VE1A 2CM4A 2RN4A 2FT9A 3FYFA 2IZDB 4GUZA 4RUNA 4XMFA 3WJDA 2QOMA 1EXSA 3STNA 4AYHA 1VYFA 1GX8A 1CBQA 1SY1A 3RDQA 2FLJA 4GK9A 3SZIA 1DV9A 1VWAB 4YVBA 1HXLA 2WEWA 1YWCA 1RLBE 1MEPA 4YGGA 3KFHA 3SZHA 2BSZA 2A2UA 2WQAE 3WJFA 4ARHA 3FA6A 1PM1X 1RXJA 4LZUA 1WUBA 4YCEA 4HPDA 1KZWA 4UU3A 4AZRA 1ZRYA 1ICNA 1UYNX 2G8CO 2OFMX 2RTRB 4O4SA 1GT3A 1O1VA 2IZJA 2RTPB 3WXQA 1OEKA 3JS1A 4ZGUA 4I9SA 4BCSA 5K67A 4WHIA 4ZGFA 2LA7A 1JJUA 3GE2A 1BSYA 4EFGA 5L3YA 5AJBA 1G5WA 3SZJA 3PH5A 1N0SA 4ORRA 1JQPA 2GTLM 3FIDA 1YWBA 2NNQA 1HBQA 1MUPA 1KL5A 3K3LA 4GDZA 1KT3A 2Y3FA 3IFBA 3NP1A 4MVKA 3ZW0B 3P6EA 1LDQA 4NLIA 4OS0A 5DG4A 2CZTA 3RY2A 2HMBA 3SOTA 3ZUIA 3JQOA 4JHQA 1SWGA 4YFRA 5IRWA 1SY2A 3ZZVA 1VWDB 4XMHA 3VHHA 4LZVA 3FR2A 4U3QA 4CPHA 3S5XA 1JBHA 2RTFB 3B2JA 1Y53X 4MEEA 2E4JA 1JV4A 2HNXA 2OL6O 3PP6A 1JZUA 1LIDA 1YP6A 2G7BA 3QQ2A 1LIBA 4JO6A 3NBXX 1SWQA 2MO5A 1BBPA 1SWPA 2PI3O 5B3MO 1ERBA 3FR4A 4OEMA 1SRJA 3RDUA 4ALOA 3PDFA 1N43A 3O2YA 4GJVA 4I3BA 2ACOA 1FJ1E 2WWPA 3CMPA 4HPAA 4ON1A 4TKHA 3TZSA 5BVTA 5IXGA 4GJSA 1JJJA 3WBGA 2UZ2A 2FRSA 4CDCA 2ACPX 4ES7A 4YBPA 5LJHA 2A8GA 5FQ8E 2WEXA 1ERXA 5D45A 5FFHA 2C4IA 1VWNB 3EMMA 2HLVA 5HCEC 5IRAA 3RDXA 4ODDA 5LKEA 1SLDB 2AT5X 4IB8A 2IFBA 4CDFA 5F58A 1S7DA 4CPHB 1SY3A 3OE3A 1NP1A 1QY0A 1SWHA 2F09A 1E00A 2QO4A 4KH8A 3APVA 1QQSA 4CDDA 4LKTA 1SA8A 2LB6A 1KT6A 4BQUA 1AQBA 1H91A 5L8OA 5HZ5A 2HZQA 3UEXA 1SWJA 5D47A 1EW3A 2LBAA 3B2LA 1VWOB 2FGSA 1EPAA 3CKGA 1HMRA 1LUQA 4INNA 4YFPA 3UAQA 1Y0GA 4QRLA 2JMBA 1SWLA 3EW2A 1LF7A 2BC3A 3ZW1A 3FW5A 1N7YA 1IKJA 1U18A 2YG2A 1X8OA 4O3YA 4QYNA 4TJZA 2RTCB 2Z4HA 2R74A 1SLFB 2FS6A 4GE1A 5LJBA 5D48A 3F9DA 1GKAA 1HQQA 1KFFA 1KT4A 2RTBB 2Q4NA 2Y3EA 2YMSA 1GX3A 4NV7A 3ZWEA 4BX6B 3B2IA 4Y0RA 3P6DA 1NDJA 2DJFA 1CBSA 1D2UA 3G7XA 1EQDA 3EYCA 5EEDA 2X8SA 3FEPA 1PMPA 1GM6A 2LFOA 3FW4A 1SRIA 3FENA 2BLGA 2IZIA 4I60A 1X89A 2L68A 1EALA 1SXYA 3HWGA 4NNSA 2I5ZO 1AVGI 3NX2A 4NLJA 1B8EA 4YH0A 3ZW1B 4IMNA 1AVEA 2JGSA 2Z4IA 1JJXA 2LBVA 2OL7A 2FKGA 2JU3A 3P24A 4ZHHA 3OBLA 4PJ2A 2QO6A 4Y0SA 4BGFA 4IAXA 1GT1A 3WYPA 1GKAB 1T0VA 1VYOA 4O3XB 5L8NA 4TKJA 3EC5A 4YGZA 2QO5A 3HWDA 4IB9A 4TLJA 2JN3A 1Y52X 2RTDB 3KFIA 1HMTA 1CBIA 1E5PA 1OBPA 2QOSC 1OEEA 4QNIA 4IMOA 3PEDA 3BSZE 4FGIB 4BX5A 2AT6X 1SWRA 3LTWA 4AZPA 1B4MA 2RTAA 1LNMA 2GTFX 4IABA 1OPBA 3BX8A 5B27A 1I78A 1BRPA 3O22A 4JNJA 4WBKA 3VU1A 4U9CA 1A3YA 4BOEA 1I4UA 4FBVA 2JOZA 1ZNKA 1RXKA 1SWTA 3JSQA 2F01A 1LCZA 5F7GA
chains in the Genus database with same CATH topology
3S60A 5IO6A 4D6BA 3KQ0A 2AH7X 2QM9A 2CBSA 3KFFA 2O62A 4ORSA 3VG2A 3ZW2A 4YKMA 4O4UA 2WQ9A 3NPOA 2JW1A 1SXXA 4YMYA 5BVSA 3VG5A 1GT5A 4IB6A 4L3RA 3NR3A 1U0XA 5LJDA 2BS6A 1HMSA 1Y9TA 3APWA 2OVSA 2X8FA 4QGWA 3VG4A 3STMX 1X71A 1SXUA 2AT3X 2WR6A 2MM3A 4TNNA 3ZI8A 2NNEA 2OZQA 3HTYA 2EU7X 2LKKA 5HTEA 3DSZA 1I06A 1MDCA 2GTLN 1PEEA 3C77X 2A3FX 3ELXA 3DTQA 4KT5A 2Q2MA 5D8JA 4A1YA 4ZJ0A 3NQ9A 5HBSA 4TQ2A 2R73A 2WUTA 1IKEA 3CQNA 1HQPA 2RD7C 3FA7A 2X8TA 3HWFA 2AKQA 4I9RA 4INNA 1D3SA 1OEJA 1UZ2X 3MVFA 1G85A 3BRNA 1OBUA 1JYJA 4U8UM 1TOUA 1R0UA 3P6CA 4GKCA 3RBYA 1VYGA 4IBAA 4AW8A 5HZQA 2L9CA 3BU9A 2POAA 1AB0A 4OMXA 1QG5A 1U17A 4YDBA 5EDBA 3S26A 1IFCA 1LPJA 2G79A 4ALBA 3F8AA 4XMEA 2K23A 2A0AA 3HOLA 3QKGA 5EZ2A 2BT9A 5KICA 1DZKA 1JIWI 5IO7A 3U03A 4I3CA 4FBOA 3V8UA 2KTDA 3VE2A 4JGLA 1VPRA 4NYQA 1A2DA 3PH6A 5DPQA 3OJYC 5BYPA 3BX7A 3KFGA 4MISA 3C76X 5EPQA 2A2GA 1BM5A 5CE4A 2OVEA 3D95A 4NYRA 1LIFA 1ZNDA 2P8GA 1CRBA 1QY2A 2KW1A 4HPBA 2AL0X 4K19A 5KHPA 1P6PA 3I0AA 3N91A 3L4RA 5H9KA 5HWZA 2Q2PA 3EM0A 3PPTA 1QFVA 1L6MA 5LJEA 4XMGA 3P02A 2RCQA 4EDEA 3LHNA 3BU1A 5AQ6A 3AKMA 5H9LA 1UREA 2A13A 4ZR2A 4AZMA 1G74A 4I3DA 2WSJA 3UEVA 1QWDA 2ANSA 2N93A 1BWYA 1S2PA 3PECA 3APUA 4GNYA 4QGVA 1RBPA 4OS3A 4ZHDA 1FTPA 1LICA 3BLGA 2FTBA 1JYDA 5FAZA 3OD9A 4WFVA 2MHDA 3ELZA 4AZQA 4MIRA 4I95A 3CBCA 4Y0QA 1I05A 1MX8A 1IW2A 1KGLA 2KD2A 4O4XA 4I6SA 1E02A 4CSBA 4EXZA 3WVMA 5K06A 1DF3A 1EIIA 3B2KA 4MVIA 3F6ZB 5HZ8A 2CBRA 4COTA 1BJ7A 3RKGA 4IB7A 1SY0A 3H3IA 2ZAIA 3MBTA 3EBKA 3VG3A 4Y0PA 3U0DA 1QABE 5H8TA 4BVMA 1ZNHA 1LFOA 1XKIA 4ID2A 4OMWA 4ORYA 3WJEA 1LKEA 3P6HA 4O49A 1DZMA 5FQ6E 3RWXA 4L1NA 2F73A 1I04A 1MVGA 4O3ZA 1CJ5A 1ALBA 5IO5A 5FENA 4EQAC 2KTSA 1X8QA 4GRJA 4GZVA 2CZUA 1S44A 5HCCC 3APXA 2NP1A 4OS8A 1BSOA 4UU2A 5H9NA 3BY0A 1A18A 2GTLO 3P6FA 5HAEA 2AMMX 1ACDA 1LIEA 2JU7A 4KIIA 1IIUA 1T68X 2RA6A 3UEWA 4HPCA 4ORXA 1Z24A 2FR3A 3NADA 4O9SA 4XMDA 1BRQA 1SMPI 3FA8A 4QGXA 5AJCA 3U9PC 5FQ7E 3CWKA 4ZFXA 4O3WA 4U8UO 1QY1A 5LJKA 4YBUA 3AKNA 4NNTA 1DC9A 4KC8A 5LJGA 3TF6A 4ZHFA 5HCDC 1BEBA 1TW4A 3B2HA 4A60A 1IFBA 1OPAA 1BSQA 1E06A 1YP7A 2AT8X 2PY1A 3WJBA 2X45A 1YUPA 4ZHGA 2HZRA 3S5VA 3ZUOA 5L8IA 2FS7A 2W2FA 1KZXA 3EBWA 4NP1A 2NNDA 4YCHA 4U8UN 1FDQA 1KQXA 5LKFA 4QAEA 3LV4A 3D97A 3FELA 2BHVA 2XKLA 3RSWA 5LJCA 4A1HA 4MVLA 1ZNEA 3PQUA 1T8VA 4QZTA 3HWEA 1GXAA 5D4AA 5HA0A 5HA1A 5F6ZA 4CV7A 1FENA 2FWVA 2K62A 1YWAA 3VPJE 2ALLX 3WJGA 3MX7A 4ZH9A 4M6SA 1FE3A 1MX7A 4ORUA 4LQZA 2W2BA 1X8NA 4QQ1A 4QYPA 5B29A 4YGHA 4YDAA 2MJIA 1DZPA 3RZYA 4FBRA 1FELA 3WOVA 2M4LA 3STKA 3KZAA 1PBOA 4KC7A 3NQKA 3FIQA 4R0BA 4AZNA 1G7NA 3D4RA 1DFVA 2W2AA 3O19A 4MVEA 1NGLA 3ZQ3A 5KIDA 3FLLA 4ORWA 2AT0X 5H9AA 5EDCA 3D96A 2RCTA 3CBSA 4PSQA 5EEEA 4GU8A 4YKOA 5F6BA 2L5PA 3WJCA 3HK1A 4GH7A 1OBQA 3FA9A 5HZ9A 4GNWA 2Q9SA 2R56A 4IAWA 4TKBA 4ZHCA 3BS2A 3P6GA 1B0OA 1EUOA 2ZAGA 5BVQA 3FEKA 3GAQA 4CK4A 2RQ0A 4FQBB 2OVDA 2GC9A 4EEJA 1O8VA 1XCAA 4N7CA 4NW4A 1NP4A 2X46A 4XMCA 3NQ3A 1ML7A 2FR2A 3FMZA 4HFOA 4RUUA 3TGCA 1AELA 1ICMA 3VG7A 1O1UA 3I17A 1Y9LA 2CM9A 1A57A 1TVQA 1KT7A 2KT4B 2L67A 4O4OA 3CQRA 5HTDA 2OFRX 5HZ6A 3HOEA 1FEMA 1KXOA 1TOWA 4DQ4A 1KQWA 3T1DA 2XSTA 4AZOA 4LKPA 1BLRA 2G78A 1ZNLA 4A8ZA 1ADLA 3SAOA 4N7DA 1EPBA 2GJ5A 4HWMA 5JR8A 1KOIA 3VG6A 1YIVA 3C78X 3FR5A 4ZCBA 1DV9A 1SXWA 3Q6LA 4DQ3A 3CR6A 5AEOA 1GGLA 2MWHA 1X8UA 1EIOA 1DZJA 3UEUA 2OVAA 3IA8A 4D6AA 3TGBA 1B56A 4QZUA 2ASNX 1X8PA 2HYSA 1GT4A 1TXLA 2QMIA 1GX9A 4WFUA 4ZH6A 1CBRA 2DM5A 3E3CA 3NX1A 4YFQA 4M7MA 3TGAA 1QFTA 4ML7B 2BS5A 1HN2A 2Q39A 4GETA 1ZNGA 2JU8A 5F1EA 1YWDA 4KCAA 3PQSA 5CYBA 1KT5A 5C0NA 1EI5A 1HBPA 3ZW0A 3VE1A 2CM4A 2RN4A 2FT9A 3FYFA 4RUNA 4XMFA 3WJDA 1EXSA 3STNA 4AYHA 1VYFA 1GX8A 1CBQA 1SY1A 2FLJA 4GK9A 2WEWA 1YWCA 1RLBE 4YGGA 3KFHA 2A2UA 2WQAE 3WJFA 4ARHA 3FA6A 1PM1X 4LZUA 4YCEA 4HPDA 1KZWA 4UU3A 4AZRA 1ZRYA 1ICNA 2OFMX 4O4SA 1GT3A 1O1VA 3WXQA 1OEKA 3JS1A 4ZGUA 4I9SA 4WHIA 4ZGFA 2LA7A 3GE2A 4EFGA 1BSYA 1G5WA 5AJBA 3PH5A 1N0SA 4ORRA 3VU1A 2GTLM 4GDZA 1YWBA 2NNQA 1HBQA 1MUPA 3K3LA 1KT3A 3NP1A 3IFBA 4MVKA 3ZW0B 3P6EA 4NLIA 4OS0A 5DG4A 2CZTA 2HMBA 3SOTA 3ZUIA 3JQOA 4YFRA 1SY2A 3ZZVA 4XMHA 4LZVA 3FR2A 4U3QA 3S5XA 1JBHA 3B2JA 2E4JA 1JV4A 2HNXA 3PP6A 1JZUA 1LIDA 1YP6A 2G7BA 1LIBA 3NBXX 2MO5A 1BBPA 1ERBA 3FR4A 4ALOA 4I3BA 3O2YA 2ACOA 4HPAA 2WWPA 3CMPA 4ON1A 4TKHA 3TZSA 5BVTA 1JJJA 3WBGA 2FRSA 2ACPX 4ES7A 4YBPA 5LJHA 5FQ8E 2WEXA 1ERXA 5D45A 5FFHA 3EMMA 5HCEC 2HLVA 5LKEA 4ODDA 2AT5X 4IB8A 2IFBA 5F58A 1S7DA 1SY3A 3OE3A 1NP1A 1QY0A 2F09A 1E00A 2QO4A 4KH8A 3APVA 1QQSA 4LKTA 1SA8A 2LB6A 1KT6A 4BQUA 1AQBA 1H91A 5L8OA 5HZ5A 2HZQA 3UEXA 5D47A 1EW3A 2LBAA 3B2LA 4YFPA 3UAQA 1EPAA 1HMRA 4QRLA 2JMBA 1LF7A 3ZW1A 3FW5A 1IKJA 1U18A 2YG2A 1X8OA 4O3YA 4QYNA 4TJZA 2Z4HA 2R74A 2FS6A 4GE1A 5LJBA 5D48A 3F9DA 1GKAA 1KT4A 2YMSA 2Q4NA 3ZWEA 3B2IA 4Y0RA 3P6DA 1CBSA 1D2UA 3G7XA 1EQDA 3EYCA 5EEDA 2X8SA 3FEPA 1PMPA 1GM6A 2LFOA 3FW4A 3FENA 2BLGA 1X89A 2L68A 1EALA 1SXYA 3HWGA 4NNSA 4YH0A 1AVGI 3NX2A 4NLJA 1B8EA 3ZW1B 4IMNA 2Z4IA 1JJXA 2LBVA 2JU3A 3P24A 4ZHHA 3OBLA 4PJ2A 2QO6A 4Y0SA 4IAXA 1GT1A 1GKAB 1T0VA 5L8NA 4O3XB 4TKJA 4YGZA 2QO5A 3HWDA 4IB9A 4TLJA 2JN3A 3KFIA 1HMTA 1CBIA 1E5PA 1OBPA 2QOSC 1OEEA 4QNIA 4IMOA 3PEDA 3BSZE 4FGIB 2AT6X 4AZPA 1B4MA 1LNMA 2GTFX 4IABA 1OPBA 3BX8A 5B27A 3O22A 1BRPA 4BOEA 4WBKA 4U9CA 1A3YA 1I4UA 4FBVA 2JOZA 1ZNKA 3JSQA 3BDRA 5F7GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IO6 A;  4D6B A;  3KQ0 A;  2AH7 X;  2QM9 A;  2CBS A;  3KFF A;  2O62 A;  4ORS A;  3VG2 A;  4YKM A;  2WQ9 A;  3NPO A;  1SXX A;  4YMY A;  5BVS A;  3VG5 A;  1GT5 A;  4IB6 A;  3NR3 A;  1U0X A;  5LJD A;  1HMS A;  3APW A;  3VG4 A;  4QGW A;  3STM X;  1X71 A;  1SXU A;  2AT3 X;  2WR6 A;  2MM3 A;  4TNN A;  2NNE A;  2OZQ A;  2EU7 X;  2LKK A;  5HTE A;  3DSZ A;  1I06 A;  1MDC A;  1PEE A;  3C77 X;  2A3F X;  3ELX A;  3DTQ A;  5D8J A;  2Q2M A;  4A1Y A;  4ZJ0 A;  3NQ9 A;  5HBS A;  4TQ2 A;  2R73 A;  2WUT A;  1IKE A;  3CQN A;  1HQP A;  2RD7 C;  3FA7 A;  3HWF A;  2AKQ A;  4I9R A;  1D3S A;  1OEJ A;  1UZ2 X;  3MVF A;  1G85 A;  3BRN A;  1OBU A;  1JYJ A;  1TOU A;  1R0U A;  3P6C A;  4GKC A;  1VYG A;  4IBA A;  4AW8 A;  5HZQ A;  2L9C A;  3BU9 A;  2POA A;  1AB0 A;  4OMX A;  1QG5 A;  1U17 A;  4YDB A;  5EDB A;  3S26 A;  1IFC A;  1LPJ A;  2G79 A;  4ALB A;  3F8A A;  4XME A;  2K23 A;  2A0A A;  3QKG A;  5EZ2 A;  5KIC A;  1DZK A;  5IO7 A;  3U03 A;  4I3C A;  2KTD A;  1VPR A;  4NYQ A;  1A2D A;  3PH6 A;  5DPQ A;  3OJY C;  3BX7 A;  3KFG A;  3C76 X;  5EPQ A;  2A2G A;  1BM5 A;  5CE4 A;  2OVE A;  3D95 A;  4NYR A;  1LIF A;  1ZND A;  2P8G A;  1CRB A;  1QY2 A;  4HPB A;  2AL0 X;  4K19 A;  5KHP A;  1P6P A;  3I0A A;  3L4R A;  5H9K A;  5HWZ A;  2Q2P A;  3EM0 A;  3PPT A;  1QFV A;  1L6M A;  5LJE A;  4XMG A;  2RCQ A;  4EDE A;  5AQ6 A;  3BU1 A;  3AKM A;  5H9L A;  1URE A;  2A13 A;  4ZR2 A;  4AZM A;  1G74 A;  4I3D A;  2WSJ A;  3UEV A;  1QWD A;  2ANS A;  2N93 A;  1BWY A;  1S2P A;  3PEC A;  3APU A;  4GNY A;  4QGV A;  1RBP A;  4OS3 A;  4ZHD A;  1FTP A;  1LIC A;  3BLG A;  2FTB A;  1JYD A;  5FAZ A;  4WFV A;  3ELZ A;  4AZQ A;  3CBC A;  4Y0Q A;  1I05 A;  1MX8 A;  1IW2 A;  1KGL A;  4EXZ A;  1E02 A;  1EII A;  3WVM A;  5K06 A;  1DF3 A;  3B2K A;  4MVI A;  5HZ8 A;  2CBR A;  1BJ7 A;  4IB7 A;  1SY0 A;  3MBT A;  3EBK A;  3VG3 A;  4Y0P A;  3U0D A;  1QAB E;  5H8T A;  4BVM A;  1ZNH A;  1LFO A;  1XKI A;  4OMW A;  4ORY A;  3WJE A;  1LKE A;  3P6H A;  1DZM A;  2F73 A;  1I04 A;  1MVG A;  1CJ5 A;  1ALB A;  5IO5 A;  5FEN A;  1X8Q A;  4GRJ A;  2CZU A;  1S44 A;  5HCC C;  3APX A;  2NP1 A;  4OS8 A;  1BSO A;  4UU2 A;  5H9N A;  3BY0 A;  1A18 A;  3P6F A;  5HAE A;  2AMM X;  1ACD A;  1LIE A;  2JU7 A;  4KII A;  1IIU A;  1T68 X;  2RA6 A;  3UEW A;  4HPC A;  4ORX A;  1Z24 A;  2FR3 A;  3NAD A;  4O9S A;  4XMD A;  1BRQ A;  3FA8 A;  4QGX A;  3U9P C;  3CWK A;  4ZFX A;  1QY1 A;  5LJK A;  4YBU A;  3AKN A;  4NNT A;  1DC9 A;  5LJG A;  3TF6 A;  4ZHF A;  5HCD C;  1BEB A;  1TW4 A;  3B2H A;  4A60 A;  1IFB A;  1OPA A;  1BSQ A;  1E06 A;  1YP7 A;  2AT8 X;  2PY1 A;  3WJB A;  2X45 A;  1YUP A;  4ZHG A;  2HZR A;  3ZUO A;  5L8I A;  2FS7 A;  2W2F A;  1KZX A;  3EBW A;  4NP1 A;  2NND A;  4YCH A;  1FDQ A;  1KQX A;  5LKF A;  4QAE A;  3D97 A;  3FEL A;  2XKL A;  3RSW A;  5LJC A;  4A1H A;  4MVL A;  1ZNE A;  1T8V A;  4QZT A;  3HWE A;  1GXA A;  5D4A A;  5HA0 A;  5HA1 A;  5F6Z A;  1FEN A;  2FWV A;  2K62 A;  1YWA A;  2ALL X;  3WJG A;  4ZH9 A;  4M6S A;  1FE3 A;  1MX7 A;  4ORU A;  2W2B A;  1X8N A;  4QYP A;  5B29 A;  4YGH A;  4YDA A;  2MJI A;  1DZP A;  3RZY A;  1FEL A;  3STK A;  3KZA A;  1PBO A;  3FIQ A;  4R0B A;  4AZN A;  1G7N A;  1DFV A;  2W2A A;  3O19 A;  1NGL A;  3ZQ3 A;  5KID A;  3FLL A;  4ORW A;  2AT0 X;  5H9A A;  5EDC A;  3D96 A;  2RCT A;  3CBS A;  4PSQ A;  5EEE A;  4YKO A;  5F6B A;  3WJC A;  2L5P A;  3HK1 A;  4GH7 A;  1OBQ A;  3FA9 A;  5HZ9 A;  4GNW A;  2Q9S A;  2R56 A;  4IAW A;  4TKB A;  4ZHC A;  3BS2 A;  3P6G A;  1B0O A;  1EUO A;  5BVQ A;  3FEK A;  3GAQ A;  4CK4 A;  2RQ0 A;  2OVD A;  2GC9 A;  4EEJ A;  1O8V A;  1XCA A;  4N7C A;  1NP4 A;  2X46 A;  4XMC A;  3NQ3 A;  1ML7 A;  2FR2 A;  3FMZ A;  4HFO A;  4RUU A;  3TGC A;  1AEL A;  1ICM A;  3VG7 A;  1O1U A;  3I17 A;  2CM9 A;  1A57 A;  1TVQ A;  1KT7 A;  2KT4 B;  2L67 A;  3CQR A;  5HTD A;  2OFR X;  5HZ6 A;  1FEM A;  1KXO A;  1TOW A;  4DQ4 A;  1KQW A;  3T1D A;  2XST A;  4AZO A;  4LKP A;  1BLR A;  2G78 A;  1ZNL A;  4A8Z A;  1ADL A;  3SAO A;  4N7D A;  1EPB A;  2GJ5 A;  5JR8 A;  1KOI A;  3VG6 A;  1YIV A;  3C78 X;  3FR5 A;  4ZCB A;  1DV9 A;  1SXW A;  3Q6L A;  4DQ3 A;  3CR6 A;  1GGL A;  1X8U A;  1EIO A;  1DZJ A;  3UEU A;  2OVA A;  3IA8 A;  4D6A A;  3TGB A;  1B56 A;  4QZU A;  2ASN X;  1X8P A;  2HYS A;  1GT4 A;  1TXL A;  4WFU A;  1GX9 A;  4ZH6 A;  1CBR A;  2DM5 A;  3NX1 A;  4YFQ A;  4M7M A;  3TGA A;  1QFT A;  1HN2 A;  2Q39 A;  4GET A;  1ZNG A;  2JU8 A;  5F1E A;  1YWD A;  1KT5 A;  5C0N A;  1HBP A;  2CM4 A;  4RUN A;  2FT9 A;  4XMF A;  3WJD A;  1EXS A;  3STN A;  4AYH A;  1VYF A;  1GX8 A;  1CBQ A;  1SY1 A;  2FLJ A;  2WEW A;  1YWC A;  1RLB E;  4YGG A;  3KFH A;  2A2U A;  2WQA E;  3WJF A;  4ARH A;  3FA6 A;  1PM1 X;  4LZU A;  4YCE A;  4HPD A;  1KZW A;  4UU3 A;  4AZR A;  1ZRY A;  1ICN A;  2OFM X;  1GT3 A;  1O1V A;  3WXQ A;  1OEK A;  3JS1 A;  4ZGU A;  4I9S A;  4EFG A;  1BSY A;  1G5W A;  3PH5 A;  1N0S A;  4ORR A;  1YWB A;  2NNQ A;  1HBQ A;  1MUP A;  3K3L A;  1KT3 A;  3NP1 A;  3IFB A;  4MVK A;  3P6E A;  4NLI A;  4OS0 A;  5DG4 A;  2CZT A;  2HMB A;  3ZUI A;  4YFR A;  1SY2 A;  4XMH A;  4LZV A;  3FR2 A;  1JBH A;  3B2J A;  2E4J A;  1JV4 A;  2HNX A;  3PP6 A;  1JZU A;  1LID A;  1YP6 A;  2G7B A;  1LIB A;  2MO5 A;  1BBP A;  1ERB A;  3FR4 A;  4ALO A;  4I3B A;  3O2Y A;  2ACO A;  4HPA A;  2WWP A;  3CMP A;  4TKH A;  3TZS A;  5BVT A;  1JJJ A;  3WBG A;  2FRS A;  2ACP X;  4ES7 A;  4YBP A;  5LJH A;  2WEX A;  1ERX A;  5D45 A;  5FFH A;  3EMM A;  5HCE C;  2HLV A;  5LKE A;  4ODD A;  2AT5 X;  4IB8 A;  2IFB A;  5F58 A;  1S7D A;  1SY3 A;  1NP1 A;  1QY0 A;  2QO4 A;  1E00 A;  3APV A;  1QQS A;  4LKT A;  1SA8 A;  2LB6 A;  1KT6 A;  4BQU A;  1AQB A;  1H91 A;  5L8O A;  5HZ5 A;  2HZQ A;  3UEX A;  5D47 A;  1EW3 A;  2LBA A;  3B2L A;  4YFP A;  1EPA A;  1HMR A;  1LF7 A;  3FW5 A;  1IKJ A;  1U18 A;  2YG2 A;  1X8O A;  4QYN A;  4TJZ A;  2R74 A;  2FS6 A;  4GE1 A;  5LJB A;  5D48 A;  3F9D A;  1GKA A;  1KT4 A;  2Q4N A;  3B2I A;  4Y0R A;  3P6D A;  1CBS A;  1D2U A;  3G7X A;  1EQD A;  3EYC A;  5EED A;  3FEP A;  1PMP A;  1GM6 A;  2LFO A;  3FW4 A;  3FEN A;  2BLG A;  1X89 A;  2L68 A;  1EAL A;  1SXY A;  3HWG A;  4NNS A;  4YH0 A;  1AVG I;  3NX2 A;  4NLJ A;  1B8E A;  4IMN A;  1JJX A;  2LBV A;  2JU3 A;  4ZHH A;  2QO6 A;  4Y0S A;  4IAX A;  1GT1 A;  1GKA B;  1T0V A;  5L8N A;  4TKJ A;  4YGZ A;  2QO5 A;  3HWD A;  4IB9 A;  4TLJ A;  2JN3 A;  3KFI A;  1HMT A;  1CBI A;  1E5P A;  1OBP A;  2QOS C;  1OEE A;  4IMO A;  3PED A;  3BSZ E;  2AT6 X;  4AZP A;  1B4M A;  1LNM A;  2GTF X;  5B27 A;  1OPB A;  3BX8 A;  3O22 A;  1BRP A;  4BOE A;  4WBK A;  1A3Y A;  1I4U A;  2JOZ A;  1ZNK A;  3JSQ A;  3BDR A;  5F7G A; 
#chains in the Genus database with same CATH topology
 2OF8 A;  3S60 A;  5IO6 A;  4D6B A;  1STP A;  3KQ0 A;  2AH7 X;  3T6L A;  2QM9 A;  2RTI B;  2CBS A;  3KFF A;  2O62 A;  3BDR A;  4ORS A;  3VG2 A;  3ZW2 A;  4YKM A;  4CPF A;  4O4U A;  2WQ9 A;  3NPO A;  2JW1 A;  1SXX A;  1VWK B;  4YMY A;  5BVS A;  1PTS A;  1NQN A;  1Y55 X;  4Y59 A;  3VG5 A;  2IZH B;  1K24 A;  1GT5 A;  1VWL B;  4IB6 A;  1UYO X;  4L3R A;  3NR3 A;  1U0X A;  5LJD A;  2BS6 A;  2G5L A;  1HMS A;  1Y9T A;  1STS B;  2OVS A;  2X8F A;  3APW A;  4QGW A;  3VG4 A;  3STM X;  4Z2O A;  1X71 A;  1SXU A;  2AT3 X;  2FHL A;  2WR6 A;  1VWQ B;  2MM3 A;  4TNN A;  3RDS A;  3RDM A;  2NNE A;  2OY1 O;  2OZQ A;  3ZI8 A;  3HTY A;  2EU7 X;  2LKK A;  5HTE A;  3DSZ A;  1I06 A;  1MDC A;  2GTL N;  1PEE A;  2MF6 A;  2A3F X;  3C77 X;  3DTQ A;  3ELX A;  2Q2M A;  4KT5 A;  5D8J A;  4A1Y A;  3NQ9 A;  4ZJ0 A;  5HBS A;  4TQ2 A;  2R73 A;  3VGW A;  1JMX A;  3WYQ A;  5B5F A;  2WUT A;  1IKE A;  3CQN A;  1HQP A;  2RD7 C;  2VFB A;  1SWE A;  2X8T A;  2AKQ A;  3FA7 A;  3HWF A;  1D3S A;  1OEJ A;  1UZ2 X;  4GGT A;  3MVF A;  2GH7 A;  4I9R A;  3WZP A;  1G85 A;  3BRN A;  1OBU A;  1JYJ A;  2DJG A;  4U8U M;  1TOU A;  1VWE B;  1LDO A;  1R0U A;  3P6C A;  4GKC A;  3RBY A;  1VYG A;  4IBA A;  4AW8 A;  5HZQ A;  2L9C A;  3BU9 A;  2POA A;  2ZSC A;  1AB0 A;  1HY2 A;  2VFC A;  4OMX A;  1QG5 A;  1U17 A;  4YDB A;  5EDB A;  3S26 A;  1IFC A;  1LPJ A;  2G79 A;  4ALB A;  3F8A A;  3FDC A;  2K23 A;  2A0A A;  3HOL A;  3QKG A;  4XME A;  5EZ2 A;  2BT9 A;  5KIC A;  1DZK A;  1JIW I;  5IO7 A;  1EII A;  1JMZ A;  2HKD A;  3U03 A;  4I3C A;  5K68 A;  3EW1 A;  4FBO A;  1KL3 A;  1SWO A;  3V8U A;  2IZL B;  2KTD A;  2X56 A;  3VE2 A;  4JGL A;  1VPR A;  1VWC B;  4NYQ A;  1A2D A;  3PH6 A;  5DPQ A;  3OJY C;  5BYP A;  3BX7 A;  3KFG A;  4MIS A;  3C76 X;  5EPQ A;  1VWH B;  2A2G A;  1BM5 A;  5CE4 A;  2OVE A;  3D95 A;  2CAM A;  4NYR A;  1SWA A;  2OY7 A;  1LIF A;  1ZND A;  2P8G A;  1CRB A;  1QY2 A;  2KW1 A;  1SWK A;  4HPB A;  2AL0 X;  4OKA A;  5JD2 A;  3X00 A;  4K19 A;  5KHP A;  2RTJ A;  1P6P A;  3I0A A;  3N91 A;  3L4R A;  5H9K A;  1SWS A;  2Q2P A;  5HWZ A;  3EM0 A;  5K06 A;  3PPT A;  1QFV A;  1L6M A;  5LJE A;  4XMG A;  3P02 A;  2RCQ A;  4EDE A;  3LHN A;  3BU1 A;  5AQ6 A;  3AKM A;  4Z2P A;  5H9L A;  1URE A;  2A13 A;  2WPU A;  1LEL A;  4ZR2 A;  4AZM A;  2RTM A;  1G74 A;  4I3D A;  2WSJ A;  3UEV A;  1QWD A;  2ANS A;  4BX7 A;  2N93 A;  2VDF A;  1BWY A;  1S2P A;  3PEC A;  3APU A;  4GNY A;  2UYW A;  1RBP A;  4CPI A;  4QGV A;  2RTG B;  4OS3 A;  4Z6J A;  4ZHD A;  1FTP A;  1LIC A;  3BLG A;  2FTB A;  1JYD A;  5FAZ A;  3OD9 A;  4WFV A;  2MHD A;  3ELZ A;  4AZQ A;  4MIR A;  2C1S A;  4I95 A;  3AUM O;  3CBC A;  4Y0Q A;  1I05 A;  1MX8 A;  1IW2 A;  1KGL A;  2KD2 A;  4IRW A;  4O4X A;  4I6S A;  1AVD A;  1E02 A;  1MOY A;  2RTO B;  3WVM A;  4CSB A;  4EXZ A;  3B2K A;  4MVI A;  3F6Z B;  5HZ8 A;  2CBR A;  4COT A;  1BJ7 A;  2OFB A;  3RKG A;  4IB7 A;  1SY0 A;  3H3I A;  1VWF B;  2ZAI A;  3MBT A;  3EBK A;  3VG3 A;  1PBY A;  4Y0P A;  3U0D A;  1QAB E;  5H8T A;  4BVM A;  1ZNH A;  1LFO A;  2IZG B;  1NC9 A;  1VWJ B;  1XKI A;  4ID2 A;  4OMW A;  4ORY A;  3WJE A;  2IZB A;  1LKE A;  3P6H A;  4O49 A;  1DZM A;  4CPE A;  5FQ6 E;  1WBI A;  3RWX A;  2IZF B;  2RTN B;  4L1N A;  2F73 A;  1I04 A;  1MVG A;  1HXZ A;  1N9M A;  1SWB A;  4O3Z A;  1NBX A;  1CJ5 A;  1ALB A;  3CKF A;  1SRE A;  5FEN A;  4EQA C;  5IO5 A;  2KTS A;  1X8Q A;  1I9H A;  4GRJ A;  4GZV A;  2CZU A;  1S44 A;  5HCC C;  3WZN A;  3APX A;  1W6F A;  2IZA A;  2NP1 A;  4OS8 A;  2A5C A;  1BSO A;  1NQM A;  2OY8 A;  3BY0 A;  4UU2 A;  5H9N A;  1A18 A;  3MM0 A;  3SLT A;  1W4T A;  2GTL O;  1KL4 A;  3VHI A;  3P6F A;  2OY5 O;  2RTQ B;  2AMM X;  1ACD A;  1LIE A;  2JU7 A;  4KII A;  1SRG A;  5HAE A;  1IIU A;  1T68 X;  2RA6 A;  3UEW A;  4HPC A;  4ORX A;  1OSP O;  1Z24 A;  2FR3 A;  3NAD A;  4Y5D A;  4O9S A;  4XMD A;  1BRQ A;  5B5G A;  1SMP I;  3FA8 A;  4QGX A;  5AJC A;  3U9P C;  4BJ8 A;  5B10 O;  4EKV A;  5FQ7 E;  3CWK A;  4ZFX A;  4O3W A;  4U8U O;  4Z2V A;  1QY1 A;  4BX5 B;  4YBU A;  5LJK A;  3AKN A;  1VWI B;  1SLG B;  3T2X A;  4NNT A;  1DC9 A;  4KC8 A;  5LJG A;  3TF6 A;  4ZHF A;  5HCD C;  1BEB A;  1TW4 A;  3B2H A;  4NV8 A;  4A60 A;  1IFB A;  1SWC A;  5F2B A;  3MG5 A;  1OPA A;  1BSQ A;  1E06 A;  1YP7 A;  2AT8 X;  2PY1 A;  3WJB A;  4GD9 A;  2C1Q A;  1YUP A;  2X45 A;  4ZHG A;  2HZR A;  3RE6 A;  3SLO A;  3S5V A;  3ZUO A;  2RTE B;  5L8I A;  2FS7 A;  1N9Y A;  2W2F A;  1KZX A;  3EBW A;  4NP1 A;  2NND A;  4YCH A;  4U8U N;  1FDQ A;  1KQX A;  2FHN X;  5LKF A;  4QAE A;  3LV4 A;  3D97 A;  1SRF A;  3FEL A;  3RY1 A;  2BHV A;  2XKL A;  4BBO A;  3RSW A;  5LJC A;  4A1H A;  4MVL A;  1VWR B;  1ZNE A;  2RTL A;  3PQU A;  4DNE A;  1T8V A;  2X34 A;  3HWE A;  4QZT A;  1GXA A;  5D4A A;  1N4J A;  5HA0 A;  5HA1 A;  5F6Z A;  4CV7 A;  2OF9 A;  3WZO A;  3VHM A;  1FEN A;  1SWU A;  2FWV A;  1YWA A;  1LCV A;  2K62 A;  5IRU A;  3VPJ E;  1DF3 A;  2ALL X;  3WJG A;  3MX7 A;  1VWB B;  4ZH9 A;  4M6S A;  1FE3 A;  1MX7 A;  4ORU A;  1SRH A;  4LQZ A;  2W2B A;  1X8N A;  4QQ1 A;  4QYP A;  5B29 A;  4YGH A;  1SWN A;  2MJI A;  4YDA A;  3PK2 A;  1DZP A;  3RZY A;  1MM9 A;  4CDE A;  2X32 A;  4U46 A;  1RXH A;  4FBR A;  1MK5 A;  1FEL A;  3WOV A;  2M4L A;  3STK A;  3KZA A;  1PBO A;  4Z27 A;  4KC7 A;  3NQK A;  3FIQ A;  1STR B;  1SWD A;  4R0B A;  4AZN A;  4DCB A;  1G7N A;  3D4R A;  2QCB A;  2OYB O;  1DFV A;  2W2A A;  3O19 A;  4MVE A;  1NGL A;  3ZQ3 A;  5KID A;  3FLL A;  4ORW A;  2AT0 X;  5H9A A;  5EDC A;  2IZK A;  3D96 A;  2RCT A;  3CBS A;  4GDA A;  4PSQ A;  5EEE A;  4GU8 A;  4YKO A;  5F6B A;  2L5P A;  3WJC A;  3HK1 A;  4GH7 A;  4BX6 A;  1OBQ A;  3FA9 A;  3SLJ A;  5HZ9 A;  4GNW A;  2Q9S A;  3D9W A;  5CSE A;  2R56 A;  4IAW A;  4TKB A;  4ZHC A;  3BS2 A;  3P6G A;  1B0O A;  1EUO A;  2ZAG A;  5BVQ A;  5CHK A;  3FEK A;  3GAQ A;  1VWG B;  4CK4 A;  2RQ0 A;  4FQB B;  2OVD A;  2GC9 A;  4EEJ A;  1O8V A;  1SWF A;  5B2A O;  1XCA A;  4N7C A;  2AVI A;  1IJ8 A;  4NW4 A;  4C5P A;  1NP4 A;  2X46 A;  2IZC B;  4XMC A;  3NQ3 A;  3WZQ A;  1ML7 A;  2FR2 A;  3FMZ A;  3Q34 A;  4HFO A;  4RUU A;  1DF8 A;  3TGC A;  1AEL A;  1ICM A;  2IZE B;  2OL8 O;  3VG7 A;  1O1U A;  3I17 A;  1Y9L A;  1RSU B;  2CM9 A;  1A57 A;  4Z28 A;  1TVQ A;  1KT7 A;  2KT4 B;  2L67 A;  4O4O A;  3CQR A;  5HTD A;  2OFR X;  3AEH A;  2X4M A;  3HOE A;  1FEM A;  1KXO A;  5HZ6 A;  2RTK A;  2A5B A;  1TOW A;  4DQ4 A;  1KQW A;  3T1D A;  4B55 A;  2XST A;  4OEL A;  4LKP A;  4AZO A;  1RAV A;  4BX7 B;  1BLR A;  1VWP B;  2G78 A;  1ZNL A;  4A8Z A;  1ADL A;  3SAO A;  4N7D A;  1EPB A;  1RST B;  2GJ5 A;  4HWM A;  2X55 A;  5JR8 A;  4GGR A;  2OFA A;  1KOI A;  3VG6 A;  1YIV A;  2Y32 A;  3C78 X;  3FR5 A;  1LCW A;  4ZCB A;  1E2T A;  1SXW A;  3Q6L A;  3RDO A;  4GGZ A;  4DQ3 A;  3CR6 A;  5AEO A;  1GGL A;  2MWH A;  1X8U A;  2RTH B;  1DZJ A;  3HPE A;  1EIO A;  3UEU A;  2FKJ A;  1SLE B;  2OVA A;  3T2W A;  3T6F A;  3IA8 A;  4D6A A;  3TGB A;  1B56 A;  2I5V O;  4QZU A;  2ASN X;  1X8P A;  2HYS A;  1GT4 A;  2AF5 A;  1TXL A;  1W5R A;  1GX9 A;  1K3B A;  2QMI A;  1CBR A;  2DM5 A;  4WFU A;  4ZH6 A;  3E3C A;  3NX1 A;  4YFQ A;  4M7M A;  3TGA A;  1QFT A;  4ML7 B;  2BS5 A;  1HN2 A;  2Q39 A;  5B11 O;  4GET A;  1ZNG A;  2JU8 A;  1VWM B;  1YWD A;  5F1E A;  4KCA A;  3PQS A;  3RE5 A;  3KVN A;  5CYB A;  1KT5 A;  5C0N A;  1EI5 A;  1HBP A;  3ZW0 A;  3VE1 A;  2CM4 A;  2RN4 A;  2FT9 A;  3FYF A;  2IZD B;  4GUZ A;  4RUN A;  4XMF A;  3WJD A;  2QOM A;  1EXS A;  3STN A;  4AYH A;  1VYF A;  1GX8 A;  1CBQ A;  1SY1 A;  3RDQ A;  2FLJ A;  4GK9 A;  3SZI A;  1DV9 A;  1VWA B;  4YVB A;  1HXL A;  2WEW A;  1YWC A;  1RLB E;  1MEP A;  4YGG A;  3KFH A;  3SZH A;  2BSZ A;  2A2U A;  2WQA E;  3WJF A;  4ARH A;  3FA6 A;  1PM1 X;  1RXJ A;  4LZU A;  1WUB A;  4YCE A;  4HPD A;  1KZW A;  4UU3 A;  4AZR A;  1ZRY A;  1ICN A;  1UYN X;  2G8C O;  2OFM X;  2RTR B;  4O4S A;  1GT3 A;  1O1V A;  2IZJ A;  2RTP B;  3WXQ A;  1OEK A;  3JS1 A;  4ZGU A;  4I9S A;  4BCS A;  5K67 A;  4WHI A;  4ZGF A;  2LA7 A;  1JJU A;  3GE2 A;  1BSY A;  4EFG A;  5L3Y A;  5AJB A;  1G5W A;  3SZJ A;  3PH5 A;  1N0S A;  4ORR A;  1JQP A;  2GTL M;  3FID A;  1YWB A;  2NNQ A;  1HBQ A;  1MUP A;  1KL5 A;  3K3L A;  4GDZ A;  1KT3 A;  2Y3F A;  3IFB A;  3NP1 A;  4MVK A;  3ZW0 B;  3P6E A;  1LDQ A;  4NLI A;  4OS0 A;  5DG4 A;  2CZT A;  3RY2 A;  2HMB A;  3SOT A;  3ZUI A;  3JQO A;  4JHQ A;  1SWG A;  4YFR A;  5IRW A;  1SY2 A;  3ZZV A;  1VWD B;  4XMH A;  3VHH A;  4LZV A;  3FR2 A;  4U3Q A;  4CPH A;  3S5X A;  1JBH A;  2RTF B;  3B2J A;  1Y53 X;  4MEE A;  2E4J A;  1JV4 A;  2HNX A;  2OL6 O;  3PP6 A;  1JZU A;  1LID A;  1YP6 A;  2G7B A;  3QQ2 A;  1LIB A;  4JO6 A;  3NBX X;  1SWQ A;  2MO5 A;  1BBP A;  1SWP A;  2PI3 O;  5B3M O;  1ERB A;  3FR4 A;  4OEM A;  1SRJ A;  3RDU A;  4ALO A;  3PDF A;  1N43 A;  3O2Y A;  4GJV A;  4I3B A;  2ACO A;  1FJ1 E;  2WWP A;  3CMP A;  4HPA A;  4ON1 A;  4TKH A;  3TZS A;  5BVT A;  5IXG A;  4GJS A;  1JJJ A;  3WBG A;  2UZ2 A;  2FRS A;  4CDC A;  2ACP X;  4ES7 A;  4YBP A;  5LJH A;  2A8G A;  5FQ8 E;  2WEX A;  1ERX A;  5D45 A;  5FFH A;  2C4I A;  1VWN B;  3EMM A;  2HLV A;  5HCE C;  5IRA A;  3RDX A;  4ODD A;  5LKE A;  1SLD B;  2AT5 X;  4IB8 A;  2IFB A;  4CDF A;  5F58 A;  1S7D A;  4CPH B;  1SY3 A;  3OE3 A;  1NP1 A;  1QY0 A;  1SWH A;  2F09 A;  1E00 A;  2QO4 A;  4KH8 A;  3APV A;  1QQS A;  4CDD A;  4LKT A;  1SA8 A;  2LB6 A;  1KT6 A;  4BQU A;  1AQB A;  1H91 A;  5L8O A;  5HZ5 A;  2HZQ A;  3UEX A;  1SWJ A;  5D47 A;  1EW3 A;  2LBA A;  3B2L A;  1VWO B;  2FGS A;  1EPA A;  3CKG A;  1HMR A;  1LUQ A;  4INN A;  4YFP A;  3UAQ A;  1Y0G A;  4QRL A;  2JMB A;  1SWL A;  3EW2 A;  1LF7 A;  2BC3 A;  3ZW1 A;  3FW5 A;  1N7Y A;  1IKJ A;  1U18 A;  2YG2 A;  1X8O A;  4O3Y A;  4QYN A;  4TJZ A;  2RTC B;  2Z4H A;  2R74 A;  1SLF B;  2FS6 A;  4GE1 A;  5LJB A;  5D48 A;  3F9D A;  1GKA A;  1HQQ A;  1KFF A;  1KT4 A;  2RTB B;  2Q4N A;  2Y3E A;  2YMS A;  1GX3 A;  4NV7 A;  3ZWE A;  4BX6 B;  3B2I A;  4Y0R A;  3P6D A;  1NDJ A;  2DJF A;  1CBS A;  1D2U A;  3G7X A;  1EQD A;  3EYC A;  5EED A;  2X8S A;  3FEP A;  1PMP A;  1GM6 A;  2LFO A;  3FW4 A;  1SRI A;  3FEN A;  2BLG A;  2IZI A;  4I60 A;  1X89 A;  2L68 A;  1EAL A;  1SXY A;  3HWG A;  4NNS A;  2I5Z O;  1AVG I;  3NX2 A;  4NLJ A;  1B8E A;  4YH0 A;  3ZW1 B;  4IMN A;  1AVE A;  2JGS A;  2Z4I A;  1JJX A;  2LBV A;  2OL7 A;  2FKG A;  2JU3 A;  3P24 A;  4ZHH A;  3OBL A;  4PJ2 A;  2QO6 A;  4Y0S A;  4BGF A;  4IAX A;  1GT1 A;  3WYP A;  1GKA B;  1T0V A;  1VYO A;  4O3X B;  5L8N A;  4TKJ A;  3EC5 A;  4YGZ A;  2QO5 A;  3HWD A;  4IB9 A;  4TLJ A;  2JN3 A;  1Y52 X;  2RTD B;  3KFI A;  1HMT A;  1CBI A;  1E5P A;  1OBP A;  2QOS C;  1OEE A;  4QNI A;  4IMO A;  3PED A;  3BSZ E;  4FGI B;  4BX5 A;  2AT6 X;  1SWR A;  3LTW A;  4AZP A;  1B4M A;  2RTA A;  1LNM A;  2GTF X;  4IAB A;  1OPB A;  3BX8 A;  5B27 A;  1I78 A;  1BRP A;  3O22 A;  4JNJ A;  4WBK A;  3VU1 A;  4U9C A;  1A3Y A;  4BOE A;  1I4U A;  4FBV A;  2JOZ A;  1ZNK A;  1RXK A;  1SWT A;  3JSQ A;  2F01 A;  1LCZ A;  5F7G A; 
#chains in the Genus database with same CATH homology
 3S60 A;  5IO6 A;  4D6B A;  3KQ0 A;  2AH7 X;  2QM9 A;  2CBS A;  3KFF A;  2O62 A;  4ORS A;  3VG2 A;  3ZW2 A;  4YKM A;  4O4U A;  2WQ9 A;  3NPO A;  2JW1 A;  1SXX A;  4YMY A;  5BVS A;  3VG5 A;  1GT5 A;  4IB6 A;  4L3R A;  3NR3 A;  1U0X A;  5LJD A;  2BS6 A;  1HMS A;  1Y9T A;  3APW A;  2OVS A;  2X8F A;  4QGW A;  3VG4 A;  3STM X;  1X71 A;  1SXU A;  2AT3 X;  2WR6 A;  2MM3 A;  4TNN A;  3ZI8 A;  2NNE A;  2OZQ A;  3HTY A;  2EU7 X;  2LKK A;  5HTE A;  3DSZ A;  1I06 A;  1MDC A;  2GTL N;  1PEE A;  3C77 X;  2A3F X;  3ELX A;  3DTQ A;  4KT5 A;  2Q2M A;  5D8J A;  4A1Y A;  4ZJ0 A;  3NQ9 A;  5HBS A;  4TQ2 A;  2R73 A;  2WUT A;  1IKE A;  3CQN A;  1HQP A;  2RD7 C;  3FA7 A;  2X8T A;  3HWF A;  2AKQ A;  4I9R A;  4INN A;  1D3S A;  1OEJ A;  1UZ2 X;  3MVF A;  1G85 A;  3BRN A;  1OBU A;  1JYJ A;  4U8U M;  1TOU A;  1R0U A;  3P6C A;  4GKC A;  3RBY A;  1VYG A;  4IBA A;  4AW8 A;  5HZQ A;  2L9C A;  3BU9 A;  2POA A;  1AB0 A;  4OMX A;  1QG5 A;  1U17 A;  4YDB A;  5EDB A;  3S26 A;  1IFC A;  1LPJ A;  2G79 A;  4ALB A;  3F8A A;  4XME A;  2K23 A;  2A0A A;  3HOL A;  3QKG A;  5EZ2 A;  2BT9 A;  5KIC A;  1DZK A;  1JIW I;  5IO7 A;  3U03 A;  4I3C A;  4FBO A;  3V8U A;  2KTD A;  3VE2 A;  4JGL A;  1VPR A;  4NYQ A;  1A2D A;  3PH6 A;  5DPQ A;  3OJY C;  5BYP A;  3BX7 A;  3KFG A;  4MIS A;  3C76 X;  5EPQ A;  2A2G A;  1BM5 A;  5CE4 A;  2OVE A;  3D95 A;  4NYR A;  1LIF A;  1ZND A;  2P8G A;  1CRB A;  1QY2 A;  2KW1 A;  4HPB A;  2AL0 X;  4K19 A;  5KHP A;  1P6P A;  3I0A A;  3N91 A;  3L4R A;  5H9K A;  5HWZ A;  2Q2P A;  3EM0 A;  3PPT A;  1QFV A;  1L6M A;  5LJE A;  4XMG A;  3P02 A;  2RCQ A;  4EDE A;  3LHN A;  3BU1 A;  5AQ6 A;  3AKM A;  5H9L A;  1URE A;  2A13 A;  4ZR2 A;  4AZM A;  1G74 A;  4I3D A;  2WSJ A;  3UEV A;  1QWD A;  2ANS A;  2N93 A;  1BWY A;  1S2P A;  3PEC A;  3APU A;  4GNY A;  4QGV A;  1RBP A;  4OS3 A;  4ZHD A;  1FTP A;  1LIC A;  3BLG A;  2FTB A;  1JYD A;  5FAZ A;  3OD9 A;  4WFV A;  2MHD A;  3ELZ A;  4AZQ A;  4MIR A;  4I95 A;  3CBC A;  4Y0Q A;  1I05 A;  1MX8 A;  1IW2 A;  1KGL A;  2KD2 A;  4O4X A;  4I6S A;  1E02 A;  4CSB A;  4EXZ A;  3WVM A;  5K06 A;  1DF3 A;  1EII A;  3B2K A;  4MVI A;  3F6Z B;  5HZ8 A;  2CBR A;  4COT A;  1BJ7 A;  3RKG A;  4IB7 A;  1SY0 A;  3H3I A;  2ZAI A;  3MBT A;  3EBK A;  3VG3 A;  4Y0P A;  3U0D A;  1QAB E;  5H8T A;  4BVM A;  1ZNH A;  1LFO A;  1XKI A;  4ID2 A;  4OMW A;  4ORY A;  3WJE A;  1LKE A;  3P6H A;  4O49 A;  1DZM A;  5FQ6 E;  3RWX A;  4L1N A;  2F73 A;  1I04 A;  1MVG A;  4O3Z A;  1CJ5 A;  1ALB A;  5IO5 A;  5FEN A;  4EQA C;  2KTS A;  1X8Q A;  4GRJ A;  4GZV A;  2CZU A;  1S44 A;  5HCC C;  3APX A;  2NP1 A;  4OS8 A;  1BSO A;  4UU2 A;  5H9N A;  3BY0 A;  1A18 A;  2GTL O;  3P6F A;  5HAE A;  2AMM X;  1ACD A;  1LIE A;  2JU7 A;  4KII A;  1IIU A;  1T68 X;  2RA6 A;  3UEW A;  4HPC A;  4ORX A;  1Z24 A;  2FR3 A;  3NAD A;  4O9S A;  4XMD A;  1BRQ A;  1SMP I;  3FA8 A;  4QGX A;  5AJC A;  3U9P C;  5FQ7 E;  3CWK A;  4ZFX A;  4O3W A;  4U8U O;  1QY1 A;  5LJK A;  4YBU A;  3AKN A;  4NNT A;  1DC9 A;  4KC8 A;  5LJG A;  3TF6 A;  4ZHF A;  5HCD C;  1BEB A;  1TW4 A;  3B2H A;  4A60 A;  1IFB A;  1OPA A;  1BSQ A;  1E06 A;  1YP7 A;  2AT8 X;  2PY1 A;  3WJB A;  2X45 A;  1YUP A;  4ZHG A;  2HZR A;  3S5V A;  3ZUO A;  5L8I A;  2FS7 A;  2W2F A;  1KZX A;  3EBW A;  4NP1 A;  2NND A;  4YCH A;  4U8U N;  1FDQ A;  1KQX A;  5LKF A;  4QAE A;  3LV4 A;  3D97 A;  3FEL A;  2BHV A;  2XKL A;  3RSW A;  5LJC A;  4A1H A;  4MVL A;  1ZNE A;  3PQU A;  1T8V A;  4QZT A;  3HWE A;  1GXA A;  5D4A A;  5HA0 A;  5HA1 A;  5F6Z A;  4CV7 A;  1FEN A;  2FWV A;  2K62 A;  1YWA A;  3VPJ E;  2ALL X;  3WJG A;  3MX7 A;  4ZH9 A;  4M6S A;  1FE3 A;  1MX7 A;  4ORU A;  4LQZ A;  2W2B A;  1X8N A;  4QQ1 A;  4QYP A;  5B29 A;  4YGH A;  4YDA A;  2MJI A;  1DZP A;  3RZY A;  4FBR A;  1FEL A;  3WOV A;  2M4L A;  3STK A;  3KZA A;  1PBO A;  4KC7 A;  3NQK A;  3FIQ A;  4R0B A;  4AZN A;  1G7N A;  3D4R A;  1DFV A;  2W2A A;  3O19 A;  4MVE A;  1NGL A;  3ZQ3 A;  5KID A;  3FLL A;  4ORW A;  2AT0 X;  5H9A A;  5EDC A;  3D96 A;  2RCT A;  3CBS A;  4PSQ A;  5EEE A;  4GU8 A;  4YKO A;  5F6B A;  2L5P A;  3WJC A;  3HK1 A;  4GH7 A;  1OBQ A;  3FA9 A;  5HZ9 A;  4GNW A;  2Q9S A;  2R56 A;  4IAW A;  4TKB A;  4ZHC A;  3BS2 A;  3P6G A;  1B0O A;  1EUO A;  2ZAG A;  5BVQ A;  3FEK A;  3GAQ A;  4CK4 A;  2RQ0 A;  4FQB B;  2OVD A;  2GC9 A;  4EEJ A;  1O8V A;  1XCA A;  4N7C A;  4NW4 A;  1NP4 A;  2X46 A;  4XMC A;  3NQ3 A;  1ML7 A;  2FR2 A;  3FMZ A;  4HFO A;  4RUU A;  3TGC A;  1AEL A;  1ICM A;  3VG7 A;  1O1U A;  3I17 A;  1Y9L A;  2CM9 A;  1A57 A;  1TVQ A;  1KT7 A;  2KT4 B;  2L67 A;  4O4O A;  3CQR A;  5HTD A;  2OFR X;  5HZ6 A;  3HOE A;  1FEM A;  1KXO A;  1TOW A;  4DQ4 A;  1KQW A;  3T1D A;  2XST A;  4AZO A;  4LKP A;  1BLR A;  2G78 A;  1ZNL A;  4A8Z A;  1ADL A;  3SAO A;  4N7D A;  1EPB A;  2GJ5 A;  4HWM A;  5JR8 A;  1KOI A;  3VG6 A;  1YIV A;  3C78 X;  3FR5 A;  4ZCB A;  1DV9 A;  1SXW A;  3Q6L A;  4DQ3 A;  3CR6 A;  5AEO A;  1GGL A;  2MWH A;  1X8U A;  1EIO A;  1DZJ A;  3UEU A;  2OVA A;  3IA8 A;  4D6A A;  3TGB A;  1B56 A;  4QZU A;  2ASN X;  1X8P A;  2HYS A;  1GT4 A;  1TXL A;  2QMI A;  1GX9 A;  4WFU A;  4ZH6 A;  1CBR A;  2DM5 A;  3E3C A;  3NX1 A;  4YFQ A;  4M7M A;  3TGA A;  1QFT A;  4ML7 B;  2BS5 A;  1HN2 A;  2Q39 A;  4GET A;  1ZNG A;  2JU8 A;  5F1E A;  1YWD A;  4KCA A;  3PQS A;  5CYB A;  1KT5 A;  5C0N A;  1EI5 A;  1HBP A;  3ZW0 A;  3VE1 A;  2CM4 A;  2RN4 A;  2FT9 A;  3FYF A;  4RUN A;  4XMF A;  3WJD A;  1EXS A;  3STN A;  4AYH A;  1VYF A;  1GX8 A;  1CBQ A;  1SY1 A;  2FLJ A;  4GK9 A;  2WEW A;  1YWC A;  1RLB E;  4YGG A;  3KFH A;  2A2U A;  2WQA E;  3WJF A;  4ARH A;  3FA6 A;  1PM1 X;  4LZU A;  4YCE A;  4HPD A;  1KZW A;  4UU3 A;  4AZR A;  1ZRY A;  1ICN A;  2OFM X;  4O4S A;  1GT3 A;  1O1V A;  3WXQ A;  1OEK A;  3JS1 A;  4ZGU A;  4I9S A;  4WHI A;  4ZGF A;  2LA7 A;  3GE2 A;  4EFG A;  1BSY A;  1G5W A;  5AJB A;  3PH5 A;  1N0S A;  4ORR A;  3VU1 A;  2GTL M;  4GDZ A;  1YWB A;  2NNQ A;  1HBQ A;  1MUP A;  3K3L A;  1KT3 A;  3NP1 A;  3IFB A;  4MVK A;  3ZW0 B;  3P6E A;  4NLI A;  4OS0 A;  5DG4 A;  2CZT A;  2HMB A;  3SOT A;  3ZUI A;  3JQO A;  4YFR A;  1SY2 A;  3ZZV A;  4XMH A;  4LZV A;  3FR2 A;  4U3Q A;  3S5X A;  1JBH A;  3B2J A;  2E4J A;  1JV4 A;  2HNX A;  3PP6 A;  1JZU A;  1LID A;  1YP6 A;  2G7B A;  1LIB A;  3NBX X;  2MO5 A;  1BBP A;  1ERB A;  3FR4 A;  4ALO A;  4I3B A;  3O2Y A;  2ACO A;  4HPA A;  2WWP A;  3CMP A;  4ON1 A;  4TKH A;  3TZS A;  5BVT A;  1JJJ A;  3WBG A;  2FRS A;  2ACP X;  4ES7 A;  4YBP A;  5LJH A;  5FQ8 E;  2WEX A;  1ERX A;  5D45 A;  5FFH A;  3EMM A;  5HCE C;  2HLV A;  5LKE A;  4ODD A;  2AT5 X;  4IB8 A;  2IFB A;  5F58 A;  1S7D A;  1SY3 A;  3OE3 A;  1NP1 A;  1QY0 A;  2F09 A;  1E00 A;  2QO4 A;  4KH8 A;  3APV A;  1QQS A;  4LKT A;  1SA8 A;  2LB6 A;  1KT6 A;  4BQU A;  1AQB A;  1H91 A;  5L8O A;  5HZ5 A;  2HZQ A;  3UEX A;  5D47 A;  1EW3 A;  2LBA A;  3B2L A;  4YFP A;  3UAQ A;  1EPA A;  1HMR A;  4QRL A;  2JMB A;  1LF7 A;  3ZW1 A;  3FW5 A;  1IKJ A;  1U18 A;  2YG2 A;  1X8O A;  4O3Y A;  4QYN A;  4TJZ A;  2Z4H A;  2R74 A;  2FS6 A;  4GE1 A;  5LJB A;  5D48 A;  3F9D A;  1GKA A;  1KT4 A;  2YMS A;  2Q4N A;  3ZWE A;  3B2I A;  4Y0R A;  3P6D A;  1CBS A;  1D2U A;  3G7X A;  1EQD A;  3EYC A;  5EED A;  2X8S A;  3FEP A;  1PMP A;  1GM6 A;  2LFO A;  3FW4 A;  3FEN A;  2BLG A;  1X89 A;  2L68 A;  1EAL A;  1SXY A;  3HWG A;  4NNS A;  4YH0 A;  1AVG I;  3NX2 A;  4NLJ A;  1B8E A;  3ZW1 B;  4IMN A;  2Z4I A;  1JJX A;  2LBV A;  2JU3 A;  3P24 A;  4ZHH A;  3OBL A;  4PJ2 A;  2QO6 A;  4Y0S A;  4IAX A;  1GT1 A;  1GKA B;  1T0V A;  5L8N A;  4O3X B;  4TKJ A;  4YGZ A;  2QO5 A;  3HWD A;  4IB9 A;  4TLJ A;  2JN3 A;  3KFI A;  1HMT A;  1CBI A;  1E5P A;  1OBP A;  2QOS C;  1OEE A;  4QNI A;  4IMO A;  3PED A;  3BSZ E;  4FGI B;  2AT6 X;  4AZP A;  1B4M A;  1LNM A;  2GTF X;  4IAB A;  1OPB A;  3BX8 A;  5B27 A;  3O22 A;  1BRP A;  4BOE A;  4WBK A;  4U9C A;  1A3Y A;  1I4U A;  4FBV A;  2JOZ A;  1ZNK A;  3JSQ A;  3BDR A;  5F7G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...