5KIXA

Crystal structure of staphylococcal nuclease variant delta+phs i92e at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYEYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I92E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5kixA00
3HEJA 2PZTA 1NUCA 5CV9A 1EYAA 3SXHA 5C4HA 5C6AA 2F0JA 1IHZA 2PW7A 4LAAA 3NXWA 4HMJA 2KQ3A 3TP7A 1A2UA 4K14A 5M9OA 1SYDA 4ID6A 5CR3A 1SNCA 2F0EA 3MHBA 4EQOA 1NSNS 2F0OA 4HMIA 1AEXA 1SNMA 2F0VA 2RDFA 4KHVA 4ODGA 4KD3A 3SR1A 2F3WA 4K8JA 4DU9A 5KIXA 5KRUA 1EY6A 4DFAA 5HGTA 3E5SA 3SK4A 3DHQA 3TP8A 5KGUA 3NQTA 3P1HA 5JAVA 1EY7A 1ENCA 3BDLA 1STBA 2NUCA 5J1ZA 4B9XA 1SYGA 2RKSA 3MXPA 5C3XA 2SNMA 4NMZA 1KDCA 3TMEA 4NKLA 3C1FA 1SYCA 4RKLA 1EZ6A 5NUCA 3ERQA 4IUNA 4I65A 4N9PA 1STYA 1A2TA 2PZWA 1EY9A 2OEOA 3NK9A 3C1EA 4K2KA 4NDXA 3OMGA 4PNYA 5JOBA 5IGFA 4N9TA 4S3SA 4K5VA 3U9OA 5EKLA 4ZUJA 5C5LA 3VA5A 3NHHA 4IALA 3SHLA 4MIUA 4QF4A 2F0TA 3ITPA 4DGZA 2EYHA 4NP5A 4ZQ3A 5IIFA 2EYMA 2F0MA 4PMCA 3S9WA 3QOJA 1JORA 4WRDA 1SNDA 5EKKA 4J1MA 4IZ8A 2EYOA 5J39A 3D4WA 3T16A 4RKBA 2EY2A 5CV4A 5CV6A 1KAAA 1F2ZA 4K8IA 4ME5A 3SK6A 2F0WA 2EYJA 1A3TA 2O4XA 3EJIA 5I9PA 5IGBA 2F0DA 5CV5A 4F7XA 1STAA 1STGA 4B9WA 2F0SA 1SYEA 4KV6A 1JOKA 2EYLA 2KHSA 2EY6A 3EVQA 4ZUIA 1EYDA 5C3WA 2EY1A 5IOCA 5IODA 4KTAA 3NP8A 4QB4A 5F2DA 3SK5A 1EY8A 2SOBA 1EQVA 5CV7A 3BDCA 2PYKA 3MVVA 4KY6A 5C5MA 1STHA 2EY5A 3OWFA 4K2LA 2F0KA 3D6CA 1U9RA 3OMCA 4K6DA 5K5PA 1SNPA 1A3VA 2OXPA 1SNQA 5IGEA 4HTHA 1KDBA 4KY7A 4E6IA 5ISRA 4KD4A 5E1FA 1RKNA 1A3UA 2F0HA 2F0PA 1F2MA 2PQEA 4K5XA 1EYCA 3H6MA 4R8NA 2HQEA 1TT2A 3MZ5A 3SK8A 4DF7A 4PMBA 5IGDA 3V2TA 2OF1A 2F0UA 4F8MA 2PZUA 2EXZA 1STNA 1JOQA 3TP5A 1EY5A 2ENBA 2EYPA 4WORA 5CGKA 5J22A 3HZXA 3NUCA 3T13A 4YIJA 4EQPA 5IGGA 1TR5A 5KYLA 3TP6A 3MEHA 4J6HA 2F0QA 2PW5A 2F0FA 2WACA 2QDBA 4H7BA 5HURA 5I9OA 5KEEA 3R3OA 5DAUA 3QOLA 1SNOA 1II3A 3PMFA 4TRDA 3D4DA 1F2YA 2SNSA 3RUZA 5CV8A 1EZ8A 1KDAA 5CC4A 5IGCA 1JOOA 1ENAA 4KY5A 5E3FA 1SYFA 2F3VA 4K5WA 5C4ZA 3D8GA 4QMGA 2F0GA 2EYFA 4G57A 4KJOA 5I6WA 5I6YA 5KYIA 1EY0A 1KABA 3QB3A 2F0LA 2M00A 5DEHA 2F0NA 4KJNA 4EVOA 2RBMA 3EROA 2LKVA 3LX0A 1EY4A 2F0IA 3P75A 4OL7A 1TQOA 3DMUA 3OSOA 5EGTA 1SYBA 4EQNA
chains in the Genus database with same CATH superfamily
1C4QA 4IJHA 3GTKB 1DOKA 5GROA 4DV5L 2PMZB 1XPOA 4ID6A 4GKKL 1SDFA 1NSNS 2JEBI 1LYLA 3K59A 1K28A 4LFCL 4OEMB 3CQZB 2RHQB 4IOAA 3S2HH 2ICEC 1QZHA 2XWJB 1K0SA 2R7ZB 2JA5B 2R93H 2RCFA 4B9XA 1Q86C 1VQDA 4A3IH 4IFDG 3K81C 2AUJD 5D65A 1H9SB 4JBKA 5GAHC 2L4NA 1H9RA 4RKLA 3QJYA 1T5EA 4BBRB 4I65A 1HFNA 2KJXA 1J6QA 1EOVA 2D62A 3C1EA 1OXUA 2LY7A 3S1MB 1TS2A 5C5LA 4JBJA 3SHLA 2NVTH 1LV9A 4A3FG 3F1ZA 1BCPB 3PIPA 1QJOA 2A68C 1MHWC 4AYBG 1R9TH 1SE2A 1N32L 3D4WA 3TRZA 1E3PA 1Z7TA 5A2QL 1M1KC 4YY3Q 3HFZB 4OIKA 4ME5A 2Z9HA 4HIDA 2PNHA 5CV5A 2B2TC 3LNNA 3R2TA 1PRTD 1STGA 1KRSA 1HNXL 5C4XH 3LWEA 4ZUIA 5H1SE 4KKSA 1H9SA 2IWHA 4CBVA 2FMMA 4DAYA 1UEAB 5C5MA 2UUBQ 4YHHQ 1WTWA 4LJZC 2XSCA 1WCMB 4E6IA 1DOMA 1WTVA 5E1FA 1S5DD 1JICA 2JA8G 4H0LC 1OO9B 3Q23A 3BG3A 4PMBA 2D9UA 3CC2A 3HOYG 3W5OA 1G8ZD 2EVBA 1CFMA 5CGKA 4Z9CB 1FGUA 2XRQD 3FHWA 1NR4A 2BA1A 4EQPA 4YIJA 2KUMA 1LTLA 1DJRD 4V190 2UXCQ 3RN5A 1PH1A 5KEEA 2XTIA 3HOXH 4DV0L 5G3LF 3W2DA 2SNSA 1KDAA 2B29A 4KN4C 3M4QA 3M4OB 4MHEA 5C4ZA 3G71A 3S2DB 3H15A 3CCUA 3I4NB 3M4PA 3QB3A 4B08A 4PG3A 2WIIB 1XMOL 1S40A 1CA6A 1I6HH 3PCOB 1WVLA 5M3MG 2LMCB 1B7YB 3HOUB 4J15A 3CC7A 5IYCH 5LMNW 1WTRA 1PRTF 1ZEQX 4XQNA 1SNMA 2KVMA 3NTHA 4KHVA 4XT3B 1N34Q 1C0AA 3G7LA 4L5RC 2JJQA 5I2YA 2KENA 3E0EA 3K5MA 1TWAH 4C1NI 4JI6L 1EY7A 2I46A 2AUKA 1G2TA 5I2XA 4JV5L 4MNOA 4B3RQ 1IYVA 3OHXC 3SVMA 2Z4HA 3I2ZA 2FJ2A 2BCOA 4G4KA 4QJFA 1T9HA 2NVQH 5NUCA 3M4YA 1M4VA 3HOVH 2OTJA 3PIO3 5D14A 2XWBB 5LMUQ 5I4DA 3UDXA 1CQFA 1NAPA 3I4LA 4JI2L 5IT9E 3U9OA 4X65Q 2E2IB 5IP9G 3S17B 1RHPA 2EIFA 3V96A 3HOWG 2JXMB 1SNDA 1F77A 3KLRA 1R4PB 1HRJA 4ILWA 4LFAL 4P73A 2EJMA 5CV4A 2F0WA 3UDIA 1WTPA 1WJJA 1PTOF 4A3EB 3J81j 3PUWA 2KHIA 4RHRA 2VS1A 4LF5L 4DV7L 2PI2E 4K0KL 1VMPA 1O80A 3SDZA 1KIXA 1E1TA 1DOLA 3ICEA 2KECA 5M5WB 2ZJQA 4DF7A 1HQRD 2PZUA 4HIMA 4IO9A 4A3MG 1JOQA 1E1OA 1XXGA 2ZXOA 2QGQA 1V1OA 4R4OA 1GOZA 5FLMH 2A74C 1HNWQ 3NENA 2GVAA 4J6HA 1IZ6A 1U4MA 3QOLA 2ASBA 3PMFA 1CM9A 3RLFA 2N88A 2UUCQ 4OWWB 3H09A 1SYFA 3K7AB 2CQOA 3GV6A 3D8GA 2B2VC 4GS3A 3RR5A 2M00A 1SFOH 3KJOA 4P72A 2LKVA 4UAIA 4JI0L 4JCVE 4B9WA 4KMUC 1S4ZA 1UUPA 4ME3A 1EOTA 1BR9A 2GVBA 3W3AA 3CCMA 1ICWA 3I3CA 5CYUA 4K14A 1SYDA 5CR3A 4XYQA 2WB1B 4C56C 1EIHA 1YNJD 2H4OA 4DK1A 1WFQA 1U5KA 4DU9A 4CHTB 2JA8H 1K8OA 4NXMQ 1Y1VB 1JWSD 2R7ZG 4CKBA 3CPWA 1TKWB 3E6ZX 3NQTA 1TY2A 1X54A 2IY5B 5M3FH 2NUCA 4BBRG 1LTBD 4OIJA 3PO3B 2YYZA 1PFNA 2DN8A 2IX0A 5D3IB 3IL8A 4U673 1SRUA 1B50A 3Q0AA 1Q8KA 3NQIA 3A5ZB 4NDXA 1I4RA 1T5XD 4N9TA 4DV3Q 4K5VA 4YWMA 1EQRA 4LUVA 1XNRL 4PMCA 2VQFQ 3RN2A 4XQQA 3TREA 3KLWA 4UP8A 1A15A 4HAEA 4GOPC 4POGA 2R7FA 3KDFB 1DCZA 1WI5A 3EA6A 4QGUA 5EJWA 4L5QA 4JI5L 1BNZA 2F52A 4JI8L 3DEOA 3S1NB 5HY6A 3HOZB 4FP5D 1WD1A 2K5NA 3K80C 4GLXA 4X3UA 1RTOA 1XX8A 3P7JA 3CF5A 1IBKL 4A3BB 2LXKA 2D0OA 4YWKA 2VY3A 1JJ2A 2F0HA 1BCPD 3GQBA 3DXJC 5AFWA 1ZXTA 5BR8Q 2F1MA 1HR0L 1YNXA 3V2TA 3J80c 5IP9H 1DZ1A 1S5FD 2B39A 1Q90A 2AQ1B 3TS0A 2PW5A 2M2LA 3FKIG 3T1YL 4DR7Q 1FNVA 3NE5B 2QF7A 1GUSA 1L1OA 1ONLA 5M5YB 2Q2UA 1F2YA 4UHVA 5CV8A 1EZ8A 1EEID 3C2PA 3J7AF 4HSPA 3I4NG 2MJ8A 5C3EH 3E0JA 4EVOA 3DM3A 1EY4A 4H44C 4UDUC 1PH6A 3HOUG 3D4RA 5IOCA 4EQNA 4B3TL 4B3ML 1QWYA 1L0YB 2IHEA 4OGQC 2NYZD 2D0PA 2KQ3A 3Q6SA 4IPGA 4PZ8A 1SMYD 3L3OC 1CHQD 2F0OA 4ODGA 4DR3Q 1VQIA 1AW7A 4DFAA 3DHQA 4HEDA 1HNZQ 1TS3A 3A8IE 2RSOA 1U4PA 3VR5A 1KLUD 4QUCA 4DK3C 3R2IA 1STBA 1TU2B 1XTCD 1NTGA 1UE6A 4OX9Q 5C3XA 3MEFA 2ID0A 2SNMA 4P71A 2UXBQ 3K58A 2JA7B 1GUNA 2R92G 1GKHA 3CRKC 3R93A 3VDYA 4YY3L 2PZWA 2MQHA 4ZK9B 3OWEB 4DUZL 2GN5A 1W3SA 3UE1A 3NHHA 2NWGA 1PA6A 4A3KB 3ITPA 4DGZA 4X64Q 1JORA 3CHBD 3GTKH 4BA2I 3VR3A 1CK1A 3FVQA 2E2JB 2R3ZA 1HJPA 5EBDA 2UUBL 4YHHL 1OTCA 4MTNA 1PRTB 2EYJA 5IGBA 2J7ZA 3CQZH 3GV3A 3SE0A 3CC4A 4DAMA 2PQAA 2XN9C 4JK1C 2WAQG 3A74A 2KHSA 1M8AA 4LF8L 1BCPC 2K14A 1EYDA 1AZPA 5KNCA 2JA5H 1SN8A 5CV7A 4MTKA 1YJWA 2BE5D 2X6GA 1STEA 2A6HD 5JJKA 5C0XI 5ELBA 1GHKA 1KL9A 4BBRH 3KOJA 4ZCKA 5DLQE 1PH3A 2UXCL 4OO1I 1IYUA 4OONA 4FF3A 1I5FA 2ICIA 4A3FB 3S1MH 1LTGD 2DJFC 2KBNA 4LF6Q 4AYBB 2VZAA 1VCIA 3A56A 2IW3A 2OQ0A 2RHSB 1TS4A 1YVCA 1BBXC 4APVA 2R7DA 1Q8IA 1CSPA 1CTMA 4NXNL 2J0TD 1PTOB 1PYWD 4IQZA 3NBHA 2F3VA 3KBXA 1A0IA 3GP7A 1K8GA 1AH9A 2HQLA 4BBSG 2K28A 3LX0A 5C4JB 1YJ9A 2JSOA 2AMCB 4I7AA 5K36G 1WCMH 1K83B 2PZTA 4YCUA 1EYAA 4LF9L 1NY4A 3STBD 1S5ED 2WB1G 2Y0SB 1GM5A 4B3RL 4DNTB 3HOYB 2C5CA 5C44B 4EQOA 3F2BA 4FDBA 4FNFA 4K8JA 3PF5A 2BH8A 1AE3A 3SEBA 4X62L 1PFMA 1BQQT 3U4ZA 2E5LQ 3TN2A 1ET9A 3J80L 3ULPA 3IFDA 5IWAQ 3PO3G 3NSWA 1TWHB 1ASYA 1CKNB 3K7UC 3DLLA 2QCPX 4G7ZC 3D6WA 1GJXA 1PDQA 3M4OH 5BN3A 2KCTA 3S2DH 3ND8A 5M3MB 2UXDQ 3A0JA 3T1HQ 3MXNB 5C0XG 3TS2A 4DUYQ 3VYTA 4WRDA 1MSHA 3HOUH 4OO1G 3FPUB 3J7ZC 5DNFA 2PCFB 3HS0C 4RKBA 1EU4A 2EY2A 2A6HC 4R4CA 1F2ZA 1X3EA 3A55A 3MXUA 2F0SA 3UI2A 3GTGB 2VUMG 1CKNA 4RGNA 1DONA 1VQ5A 2QEXA 5C3WA 3HKZE 2VXWA 5F2DA 3JC66 4NPSA 4HJ7A 2A1AA 3PUYA 3H3VC 3HKSA 3MWYW 4FXDA 1V8QA 2Z6BA 3OWFA 2H5XA 2RSNA 1VDZA 2N3SA 1SNQA 3MXNA 4OHJA 4KY7A 3VA7A 1HTPA 4JI4Q 3HOWB 2XRSD 1TWCB 2E2IH 3I56A 2HDMA 3PUVA 3S17H 1VQMA 3ERSX 2D5DA 2N55A 3TP5A 1O7LA 4WJ3M 5J22A 1F9QA 3T13A 3W1GA 3H3VH 4LUZA 2H1EA 1SSOA 1F9SA 2KCMA 4DNIA 2IJ0A 2WV6D 2JP1A 3EQLC 4IJLA 5TSSA 3STBC 4A3EH 1LABA 4P75A 3SGIA 2NVXB 1QG7A 5IYBG 2UUAQ 2PMZE 4TQUS 1IBLL 4LF7Q 2EOTA 1B9MA 4R4TA 4NXML 4NW2A 2NZOA 1K9MC 4QIWB 3L2PA 2A5HA 4YCWA 2R61A 3DUZA 2F3IA 4LAAA 3J80E 2A6EC 1WTXA 4A3MB 1GUOA 1NJIC 5M5WH 4A3LG 4DR4Q 1NBWA 2F3WA 2X69A 1LO5D 1EU3A 3GD7A 1JE5A 1QVGA 3S14B 3OW2A 3GO5A 4R9WA 3A5UA 2IX3A 2JA7G 2L5TA 3BDLA 3NTKA 1AZQA 5FO9B 1FGBD 2VQFL 1DM0B 3ERQA 1O78A 4IOCA 1HA5A 1Q46A 2WFWA 3K7AH 1A2TA 1VQBA 3NK9A 1VQNA 5J3BA 5JOBA 4A3KG 1V1PB 4ZAIA 2RQXA 1X9NA 1B9NA 4N8FA 4C3JG 1EFID 5LL6S 1MKHA 1B3AA 1VQ4A 3EFXD 5A35A 2EYOA 3T16A 1D8LA 1DXMA 3HG9A 5CBAE 2K5VA 4R4IA 4KHPL 1Y1VH 4WFN3 4ZKCB 5BR8L 1Z47A 5G3LD 1RD9D 1VQEA 3MA2B 4ALPA 4C2MH 3K0XA 3PO2H 3PO3H 2EY5A 5EPLA 3RD4A 4DV6L 1XPUA 1Q81C 2VB3X 4K6DA 4RH6A 5K5PA 1V1PA 2HHHL 4GNXB 1V1QA 1L1OC 2HQEA 4BY1B 3MZ5A 4DNRB 1F2LA 2Z6KA 5ELDA 1FJGQ 1X3FA 4JG2A 1XMQL 2WKCA 5ELEA 1STNA 5C0XH 1E2WA 1Y69U 3DWQA 3TP6A 1ET6A 4IN3A 1SJHD 1BBUA 1BKBA 5IE8A 4M1UB 3J81E 2VNUD 3J80i 1G6ZA 2JN4A 1E2VA 1HHVA 3KJPA 2HIVA 2KOLA 3S1NH 2TMPA 4LNQA 3HOZH 4KK7A 5FOBB 4DR3L 2E8GA 2KEEA 1IKLA 2Z8LA 1VQJA 2JQOA 3BS1A 3I4MB 4GNXA 2Y0SG 1L0XB 2F4VQ 2VQEQ 4KKUA 3ZYYX 4A3BH 4AQYL 5C44G 3MAQA 2EJGC 4HSVA 3TP7A 1SR3A 5KRUA 2BDNA 1ILQA 5JJLA 5ELFA 3TP8A 1TWGB 3FKIB 1CT1D 3ER0A 1G291 3TBIB 1PTOD 2CKZB 1HUNA 3KF6B 3BVZA 4QUFA 4X6AH 5M5YH 2CHBD 2NTTA 3HP3A 1KC8C 1K8MA 4X66Q 1XNQL 3WOEA 4YWLA 1D1IA 5AJ3Q 3BJUA 4RWSC 2ZXPA 1K3RA 1RODA 4B3SQ 5IYBH 1KNEA 2Q2HA 2EYHA 3S9WA 1HFGA 2L0CA 2PNRC 1IBMQ 4IZ8A 3BZDB 3C46A 4DV1Q 1IW7D 2XNAC 1MBYA 1EYGA 1H9KA 4F88A 3KF6A 2JA6G 4IPDA 1UE7A 4LF6L 2R92B 5A2QE 2NZHA 1YNND 2JA7H 4GLAC 1XJVA 1PRTC 3WDNA 3D6CA 1N33Q 3RLOA 3K5OA 1SNPA 1A3VA 2OXPA 3BZKA 5IGEA 4H02A 2N78A 5BN4A 3J81i 4RGOS 2B8GA 2Q8IB 3S1QB 1F9PA 1GD7A 2NN6I 4RFBA 4KKTA 3H0GG 4IUQA 1BOSA 1D5XC 1SMXA 2EXZA 2L11A 4WORA 4DR1Q 2E2JH 3TDQA 4C3HG 1S5BD 1TXYA 1BO0A 2WAQB 1J5EL 4WJ4A 3CAMA 1I50B 5LL6X 1SNOA 3CCSA 1SLJA 1VF7A 4IFDH 4BS9A 4DV2L 2QW7A 3AMUA 4LUOA 2F0GA 2YU9B 4R8IA 1KABA 1Q7YC 2WB1E 3U58A 3EIVA 2J4XA 3SXHA 4Q0FA 5IWAL 4GZYC 4TVAB 3IKJA 1PTOC 1Y1WB 4A3FH 3K0YA 3E9IA 4PQXA 1EY6A 1KRTA 1YJNA 1B1ZA 2V1CC 3W1BA 2UXDL 4XT1B 4JI7Q 2Z4IA 3P20A 5JAVA 1R4QB 3QO2A 4DUYL 2JA9A 3K6OA 3KFUA 4NMZA 3RZDB 1PTOH 1QVCA 4BBSB 3WOFA 1JQYD 1VMCA 1IW7C 1HPCA 5JEAJ 2OEOA 3VYUA 1A6XA 4S3SA 4HCSA 5C4JH 2BH2A 2FMCA 1U0LA 4R1JA 2K03A 2K6AA 1K83H 1YHAA 2LFNA 3QOJA 1KLGD 3RZOB 1NR2A 3A54A 2MUYA 3HOYH 4J1MA 2MP1A 5C44H 1KAAA 3M9BA 2NN6G 1I94L 1VQCA 3A7LA 4C1NK 2UU9Q 2IHFA 2ZM6L 4H13C 4A76A 1X3GA 4DAPA 4F87A 2K5QA 1FNUA 4BWGB 1TWHH 2R93B 2ZTDA 4CDDC 4L63B 4LF4Q 1VS0A 2NVYB 4BY1G 3N52A 1F9RA 1YEZA 5M3MH 3U50C 3IAYA 4C3IG 3G6JB 4L6TB 2NZ1D 4UY8C 1SBBB 4DV4Q 4LF7L 1QZGA 4A93B 5IGGA 1PZID 1TR5A 1LTAD 2ZTCA 2K04A 2VUMB 4JW0A 1KAWA 1Q1BA 1YHBA 3CCRA 3GTQB 2EQSA 2F03A 2B63G 3GTGH 4HR7B 2L1BA 5C4XB 1Y14B 2E2HB 1C9OA 4QMGA 2ZJPA 3I4MG 4DV5Q 2F0NA 4GLVB 2HDLA 1I3QB 4GKKQ 1RJTA 4OL7A 1PH5A 4OELB 5EGTA 4QQBX 5IYDG 5C6AA 1B70B 3J7AV 2F0JA 4PV1C 2PW7A 3S16B 2B2YA 3KDFA 3HOWH 1TWCH 1I4HA 2RDFA 1G91A 3O13A 5KIXA 3OTOQ 4JYAQ 1YBYA 2O5IC 1CA5A 1PXUA 2FHTA 1WTQA 3FP9A 1IKMA 4PMWA 2C9OA 3URYA 3A7AB 1B2TA 2K50A 1ENCA 1CZGA 3L9AX 1SYGA 1YNJC 5JVH3 3KF8B 1SYCA 2B2UA 4L5TA 2NVXH 1B44D 1RDPD 3OMGA 1XWEA 5ELOA 2IPKD 2D2CC 1EL0A 3ND9A 2IL8A 2ZJRA 4A3MH 4A3DG 1HNXQ 2BOSA 5COYA 1CKMA 1BUVT 1ML0D 4CDFC 4JC0A 4KI0A 3F2DA 3S14H 3TZDA 4DAVA 3GTJB 2EY6A 4UPAA 2Z6KC 4A3JB 1HTLD 3KF8A 1SJED 1Q12A 1X55A 2HT1A 2PYKA 4AYBE 1BF4A 1MGSA 2F0KA 1PHJA 3H91A 1QOHA 3S15B 3VR4A 1EUJA 1KDBA 5EBCA 1GUTA 1ICFB 3OW7A 4C3JB 3F8TA 2DUDA 3I55A 2CFMA 2DY8A 1CQVA 2HCIA 4BXXG 2RA4A 4GNXC 2R7ZH 3FMCA 4DXGA 4DPGA 5EQ0A 4ZKBB 2K52A 1IL2A 3GTMB 1XMOQ 5IGCA 2L15A 3BVMA 4KY5A 3GTLB 1LUZA 1H95A 4G57A 2E74C 2A19A 1NE3A 1D5ZC 3DMUA 1Y1WG 4X3TA 4IUUA 3M3YB 3UDFA 1P8LA 4ZYSA 1FNWA 4JI6Q 1NMFA 1SNCA 3CCVA 1PH2A 4X66L 3A8JE 4JV5Q 2F0VA 3N6RA 3KLSA 5AJ3L 1G51A 1VQFA 3CW2C 4JPBW 3P1HA 3MTSA 1OXVA 5JVG3 4B3SL 1SMYC 1ZYRD 1A62A 2N49A 5J1ZA 5JJZA 1N34L 4LFBQ 4RAUC 1CI3M 5FO7B 4JI2Q 2G9HD 3TMEA 4XTCS 1IBML 1UE5A 2RCNA 4CDCC 5IP7G 1KTKA 5EKIA 4DV1L 4DR2Q 3PIP3 4LW1A 4K2KA 3L7ZC 2MPMA 3PV0A 4LFAQ 1MSGA 3VA5A 3I4MH 4RGTA 4MIUA 3GTOB 1DYQA 3VYRA 1I4GA 5LMUL 1KXLA 1WOCA 4X65L 1Y8NB 4JBWA 2IX1A 5CORA 3IRBA 4K8IA 4LF5Q 1CZWA 4DA2A 4DV7Q 3CD6A 3AFQA 1STAA 1TWGH 3FKIH 1E0BA 2R93G 3EVQA 4CJ1B 1TIID 1IXRA 2JE6I 3I4NH 3D3RA 4UP9A 3BDCA 3MVVA 4EQ5A 1STHA 4K2LA 4ZLTF 1S72A 4DKAC 1SE4A 3I70A 2K1BA 4I7ZC 3QWNA 4HTHA 2LXJA 4IUTA 1UE1A 5ISRA 1EYCA 3KBGA 3SK8A 2BE5C 1UNSA 1JB7A 1JWUD 3PUZA 4A93G 1XYIA 2CWAA 1GO3E 4PZ7A 1PLFA 5IT9c 4RG1A 4Y7NB 4WJWA 2XGTA 2NB0A 2JA6B 2QDBA 1EIFA 2WKDA 5I9OA 3L0OA 3ULLA 4QIWE 2RF4A 5DAUA 5C4XG 4OWXB 1FL0A 3I7FA 1B3QA 5M5XB 2L12A 4JI0Q 1HNWL 1I4XA 2R92H 1UAPA 1W6JA 1J9OA 1YI2A 1PH9A 4HJ8A 1PYSB 1PVOA 1L0WA 2JK8A 2UUCL 1JE4A 1VQ8A 4V0BA 4JI3Q 4HJ5A 3A8KE 1PFSA 5C4HA 4GOPB 3H0GB 1ZYRC 3K8AA 3S1QH 3UDGA 4M8AA 3MHBA 4C3HB 3MFGA 4A3GB 1G6PA 3Q8DA 3BVGA 1S3OA 3TZUA 3HOXG 1KD1C 2VW9A 2I5LX 2K4KA 3CKIB 4BXXH 4A3CG 4FF1A 4ULLA 2AWOA 1I50H 2CQAA 3K5LA 1EWCA 2MO1A 3CPFA 1X32A 2LSSA 2B8FA 3NWTA 1B8AA 1TWFB 2I5HA 2YU9H 3U4VA 1P16A 1CKOA 5CMDA 2A8VA 5EKLA 2UU9L 3D31A 4NP5A 1YIJA 2F4IA 1WYDA 1EQTA 5IYCG 2L9HA 1Y1WH 4JI5Q 4DV3L 3DWAA 4JOIA 2OQKA 4JI8Q 3QR8A 1ZKOA 3ULJA 3LGJA 5FKAC 5ELNA 4A3JG 2A69D 5KNBA 1UEBA 3NELA 2JEAI 4OXPA 1IBKQ 2IT1A 1OXTA 2WP8J 3I72A 3SK5A 1BDOA 2E75C 2KCCA 1HR0Q 4X3KA 1JCKB 4DV4L 2I0QA 1Z9FA 4BBSH 3CMAA 2OWOA 2N8NA 2HD3A 3GDEA 5K36H 2F0PA 1SXTA 1RF2D 1TT2A 1HZAA 1MIUA 1D5MC 3J7YW 1W2BA 3T1YQ 2DNCA 2K7VA 5KNDA 3OIPA 1EY5A 4G7HC 3RZOH 4RCNA 1X56A 4XQJA 4R4QA 5JPMC 1LTTD 2PPBC 5DM73 4PZ6A 1Q1EA 2WACA 4RHSA 2RDGA 1GUWA 2B2YC 3JAMc 2GA4B 1SE8A 4B3TQ 3M85A 4B3MQ 4G7OC 5E7NA 4CKCA 1D7QA 4JYAL 3OTOL 4GN4B 4DR7L 1DD2A 1MJCA 2TSSA 1L2FA 3P75A 1DGSA 2NVYH 3OSOA 4DAYB 3MEHA 3AYHB 1RIPA 1JJGA 4C3IB 1W6KA 2ATWA 1N36Q 1A2UA 5M9OA 4QCLA 2B2UC 4OO1H 1D6EC 4HMIA 3B6YA 3RNUA 1QCBD 5FLMG 5D3DA 5T1IA 1EQQA 2K33A 4A93H 2B63B 5BN5A 2VUMH 5IT9L 1UWVA 3GTPB 3MXPA 2OTLA 3BU2A 4DUZQ 3GTQH 4A4IA 1HNZL 4O1NA 1EFWA 1WTHA 4HIOA 2E2HH 1AN8A 4OX9L 1TY0A 5IGFA 2UXBL 1MD2D 4ZUJA 1I3QH 1XTDA 2KA7A 1ESFA 2A69C 1JT8A 2F0MA 3KUPA 5EKKA 3PSIA 1LT6D 2LS01 3S16H 1XPRA 1PH8A 5J39A 3J7A5 2K75A 4LF8Q 3DEPA 1N8RC 1JJCB 1QB5D 2Q8TA 4P2CB 4X64L 1A3TA 5ELCA 2BDOA 2RVLA 2VL6A 5M3FG 4DR5Q 5IODA 2EY1A 3NPPA 2V4DA 3CCQA 1EY8A 1EQVA 1E7ZA 1WD0A 3I73A 5EAYA 4A3CH 2P5ZX 1N9WA 1U9RA 2XVSA 4GN5A 4U68A 1RKNA 2FINB 2EPBA 4R8NA 3G4SA 2WAQE 1HZ9A 5FLXc 4A3DB 1H9MA 1VQLA 2ZTEA 2O2LD 4A3LH 2ENBA 3OYYA 4NXNQ 4DN4M 1PZJD 4HCEA 1RL2A 4HJAA 3IFTA 5HGQA 3MC0B 1SE3A 2DJGC 3U9SA 3KLSX 1A63A 3R3OA 2L55A 4TRDA 3GTJH 4OWTB 4A3JH 5E3FA 2XIWA 1BBWA 2JYOA 4K5WA 4LF9Q 3BYTB 5I6YA 1QILA 3ONAB 2Z0SA 4BY7B 2Q2TA 1I6VC 2F0IA 3HGBA 4A3KH 2FFKB 3S15H 1NUCA 1X65A 3K5NA 3AB9A 3OOCA 1IYJB 4X62Q 4LFBL 4C3JH 3VR6A 2EE1A 5FJ8G 1LTSD 4XXEA 4GKJQ 4A3GG 1NNXA 2A73B 4IUVA 4KD3A 5HGTA 4DR2L 1VF5C 1Z6HA 3SK4A 3PUXA 5E4WC 1K0RA 1X3PA 4J8QA 1QNUA 1GUGA 3DM1A 2M9VA 1EIGA 2B3GA 2X6LA 4NKLA 3GTMH 5GAEC 1ENFA 2E5LL 1BXTA 2QILA 5C3EG 2NTSA 3GTLH 4KHZA 3JAML 3S1RB 2YV5A 1U4RA 1U4LA 3HKZG 5LMNQ 4ZQ3A 1JR0D 5IIFA 2YTYA 3M3YH 2K5WA 2RDHA 5FK9C 3T1HL 5L37A 4ABNA 1PV4A 4N8X1 3SK6A 2I07B 5CBEE 1Y8PB 2MNAA 1HUMA 2YTVA 1VQOA 1Q3LA 1C7YA 2EYLA 1S5CD 1VQAA 1K3BC 1Y8OB 1M90C 3RMHA 5T1GA 1ESRA 1O7ZA 1ASZA 3M7GA 1PFBA 1QE6A 3AQQA 4YCVA 2KHJA 3WWVA 4FF2A 3T51B 4CJ2C 4FYDA 1V9PA 1YNNC 2B2WA 4X3SA 3GTOH 3EBEA 2OF1A 2CWPA 3T53B 2DY7A 2EYPA 4FVMA 4O2DA 3S2HB 3HZXA 4EX5A 4L5SA 3RLNA 4JI4L 1GVPA 4JI1Q 1PZKD 2F0FA 4CKEA 4JI3L 1IBLQ 4A3IB 5DM63 3RUZA 1HZCA 3R8BA 4AH6A 2JA5G 2FXQA 2SEBD 2ZXRA 4DR6Q 3DWPA 2WINB 5I6WA 4C2MB 3PO2B 1SEBD 2DGYA 1TQOA 2NVTB 1SYBA 5E4XA 3HEJA 3CCJA 1OXSC 3H94A 2UUAL 3NXWA 2PI2A 4QY7A 3G6EA 1R9TB 1RTNA 2CW0D 2F0EA 1VQPA 1AEXA 3PF4A 1FD7D 4QL5A 3E5SA 5FLXL 3KYHC 1EWIA 4Y7NH 3D0FA 1YITA 3JAME 1TVXA 1X6OA 5JPNC 2JA6H 1NMGA 4DR4L 4KN7C 1SROA 2K01A 2RKSA 1GXDC 3LWUA 3C3LA 1KDCA 1VQHA 1QNKA 4JOIC 5M5XH 1EZ6A 4FF4A 4POFA 3FDTA 1L1OB 4LFCQ 2EZVA 4CDEC 1V43A 4FXGC 1WCMG 1PMRA 4IALA 4FXKC 2K32A 3H3VI 1HCZA 4KHPQ 3H0GH 3QIAA 5GQOA 3CXCA 3K57A 2CVRA 5CV6A 4C3HH 5FJ8H 1PH7A 1OXXK 4A3GH 3HOXB 1VQKA 4CGYB 1SYEA 5C0XJ 4DV6Q 2MFIA 3Q24A 2K5HA 2HHHQ 2QEJC 1N32Q 1B4OA 4KY6A 3TQYA 1I6HB 1XMQQ 3PIOA 4NB3A 1TWFH 2B2TA 3ZJYC 3X3NA 1JWMD 2Z1CA 3H6MA 1RCVD 4MZ9A 4GN3B 1QVFA 5JJIA 2MO0A 2HCCA 1I4QA 2G9DA 1LLRD 2E76C 4BA1I 3X3MA 1QUQB 1TWAB 3NUCA 1K73C 2ALYB 3CRLC 1FJGL 5IY0A 4H7BA 4K6LA 1AE2A 3D4DA 1N36L 2NVQB 2ZT9C 1O7IA 3HOVB 2CW0C 4BY7G 2PQAB 4AQYQ 2PO4A 1LACA 4HIKA 5KGUA 2F0LA 1NCVA 1CHPD 3Q22A 2RBMA 3CCEA 1ILPA 2QDLA 4LK1C 3JAMi 3PQIA 4IPHA 5FLXE 1BCPF 2OT2A 4DV0Q 1IHZA 2CH4A 3EN2A 1C8CA 5EPJA 4DK6C 2K05A 2AWNA 4HN7A 4DK0A 3SR1A 1JB3A 1QUQA 2F4VL 2VQEL 5JEAG 2NN6H 2R6GA 1KNAA 2Q8RE 1XNQQ 1A8VA 5GADC 2Y0SE 1LT4D 1IL8A 4A3EG 2EXDA 3F2CA 1YZ6A 1KQSA 1KHIA 2OCEA 3J81c 3NEMA 4AIMA 1EY9A 4IURA 4PNYA 4BY1H 3NBHB 2CH4W 2YTXA 1HH2P 4DR5L 4LMQD 3FEWX 3CCLA 4MN3A 3FPPA 4C3IH 1CUKA 1D2BA 3E3XA 5FO8B 2HUGA 1O7YA 3G48A 4RCOA 1HA6A 1H9JA 1X3QA 1EWHA 4EGVA 1G2SA 2F0DA 4RA8A 4Y52H 1JOKA 2QKIC 4TKOB 1Q82C 3OIQA 2B63H 3NP8A 4QB4A 3GTPH 2SOBA 1LM0A 1SFOB 3HRZC 3OMCA 1MI2A 4IFDJ 4HJ9A 2PQEA 4K5XA 1WTOA 5IYDH 3T56B 3BZCA 1J5EQ 1N33L 1LTRD 5GAGC 4F8MA 2JA8B 3PGZA 3I8ZA 1LTID 4K0KQ 1I4PA 1EIYB 4A3IG 5M3FB 2AHOB 2EJFC 4DV2Q 4JVZA 2KEDA 1Y1VG 4O42A 1VQ7A 3BDOA 1II3A 4DR1L 5CC4A 2KCNA 1K8AC 1JOOA 1ENAA 4GKJL 1EEFD 3PO2G 2A6ED 2O5JC 1EY0A 5DEHA 4KJNA 3FRPB 4RGMA 1BVSA 1HXYD 5CV9A 3VR2A 3CU7A 2G5DA 4RMFA 4HMJA 3UE0A 1E2ZA 1LT5D 1AFPA 3S24A 4A3DH 1VQ6A 2B2VA 2C35B 2NBFA 1LT3D 3OPOA 4KLKA 1B53A 3AFPA 4XYOA 4CJ0B 5LMNL 1JMCA 3NWSA 1JC7A 1PYBA 3C1FA 3MFYA 1MJEA 1SAPA 3HOZG 4JI7L 4IUNA 1FVIA 1TS5A 4N9PA 1STYA 3KK7A 1HR0W 4BY7H 5LHY1 4A3BG 4FO2A 4QF4A 4L8JA 2F0TA 4UP7A 4ZRZA 1I94Q 2BA0A 1FYCA 2EYMA 1C48A 4LWCA 2EDGA 2ZM6Q 3VYSA 3NBIA 1AP0A 2AQ3B 4IFDI 4TSSA 2O4XA 3EJIA 4F7XA 3AEVA 4KV6A 4DXFA 3TSSA 1XNRQ 5JEAH 2B2WC 4KTAA 2AQ2B 2A68D 5C3EB 1J8IA 1VQGA 4GOPA 3V05A 4JI1L 1VQ9A 1HQMC 1YHQA 3T4AC 2HIXA 3HKZB 3I90A 4KD4A 3S1RH 1A3UA 1F2MA 1PH4A 3QG1A 2ES2A 4LF4L 1CSQA 1FR3A 1HZBA 3TEHB 3J81L 5IGDA 2F0UA 2QA4A 4IPCA 3CP0A 4DR6L 3AU7A 2Q2IA 2DNEA 4XDXA 2MGSA 1GHJA 2CCZA 2SDFA 1E22A 5KYLA 3I91A 4Q5VA 5EPKA 2F0QA 4IUPA 2K5DA 5HURA 2AKWB 3E9HA 3HOVG 3MXGA 3RZDH 4P74A 4JBMA 2I5MX 4O0AA 1D1KA 2E2DC 3CMEA 2EYFA 3NTIA 3BYYB 4KJOA 4XIGS 5KYIA 4A75A 5IP7H 3I4OA 3M7NA 3EROA 2MHVA 1E24A 3F2UA 2VB2X 5I9PA
chains in the Genus database with same CATH topology
1C4QA 3GTKB 1DOKA 2PMZB 4ID6A 1SDFA 1NSNS 2JEBI 3K59A 3CQZB 2ICEC 2XWJB 2R7ZB 2JA5B 4B9XA 4IFDG 2AUJD 5D65A 1H9SB 2L4NA 1H9RA 4RKLA 3QJYA 1T5EA 4BBRB 4I65A 1HFNA 2KJXA 2D62A 3C1EA 1OXUA 2LY7A 3S1MB 1TS2A 5C5LA 3SHLA 1LV9A 1BCPB 1QJOA 2A68C 1SE2A 3D4WA 1Z7TA 5A2QL 4OIKA 4ME5A 5CV5A 2B2TC 3LNNA 3R2TA 1PRTD 1STGA 3LWEA 4ZUIA 4KKSA 1H9SA 2IWHA 4CBVA 2FMMA 4DAYA 1UEAB 5C5MA 1WTWA 4LJZC 2XSCA 1WCMB 4E6IA 1DOMA 1WTVA 5E1FA 1S5DD 1JICA 4H0LC 1OO9B 3Q23A 3BG3A 4PMBA 2D9UA 1G8ZD 2EVBA 1CFMA 5CGKA 4Z9CB 2XRQD 1NR4A 2BA1A 4EQPA 4YIJA 2KUMA 1DJRD 4V190 5KEEA 5G3LF 3W2DA 2SNSA 1KDAA 4KN4C 3M4OB 4MHEA 5C4ZA 3S2DB 3I4NB 3QB3A 4B08A 2WIIB 1CA6A 1WVLA 2LMCB 3HOUB 1WTRA 1PRTF 1ZEQX 4XQNA 1SNMA 2KVMA 3NTHA 4KHVA 4XT3B 3G7LA 5I2YA 3K5MA 4C1NI 1EY7A 2I46A 2AUKA 1G2TA 5I2XA 1IYVA 3OHXC 3SVMA 2Z4HA 2FJ2A 2BCOA 4G4KA 5NUCA 3M4YA 1M4VA 3PIO3 5D14A 2XWBB 5I4DA 1CQFA 1NAPA 3I4LA 5IT9E 3U9OA 2E2IB 3S17B 1RHPA 3V96A 2JXMB 1SNDA 1F77A 3KLRA 1R4PB 1HRJA 4ILWA 2EJMA 5CV4A 2F0WA 1WTPA 1PTOF 4A3EB 3PUWA 4RHRA 1VMPA 1O80A 3SDZA 1DOLA 2KECA 5M5WB 4DF7A 1HQRD 2PZUA 1JOQA 1XXGA 2ZXOA 1V1OA 1GOZA 2A74C 4J6HA 1U4MA 3QOLA 3PMFA 1CM9A 3RLFA 2N88A 3H09A 1SYFA 3K7AB 3GV6A 3D8GA 2B2VC 2M00A 2LKVA 4UAIA 4B9WA 4KMUC 1S4ZA 1UUPA 1EOTA 1BR9A 3W3AA 1ICWA 3I3CA 5CYUA 4K14A 1SYDA 5CR3A 4XYQA 2WB1B 4C56C 1EIHA 1YNJD 2H4OA 4DK1A 4DU9A 4CHTB 1K8OA 1Y1VB 1JWSD 4CKBA 1TKWB 3E6ZX 3NQTA 1TY2A 2NUCA 1LTBD 4OIJA 3PO3B 2YYZA 1PFNA 2DN8A 2IX0A 5D3IB 3IL8A 4U673 1B50A 3Q0AA 3NQIA 4NDXA 1I4RA 1T5XD 4N9TA 4K5VA 4PMCA 4XQQA 1A15A 4HAEA 1DCZA 3EA6A 5EJWA 1BNZA 3DEOA 3S1NB 3HOZB 4FP5D 1WD1A 4X3UA 1RTOA 1XX8A 3P7JA 4A3BB 2F0HA 1BCPD 3GQBA 3DXJC 5AFWA 1ZXTA 2F1MA 3V2TA 1DZ1A 1S5FD 2B39A 1Q90A 2AQ1B 2PW5A 2M2LA 1FNVA 3NE5B 2QF7A 1GUSA 1ONLA 5M5YB 1F2YA 5CV8A 1EZ8A 1EEID 3C2PA 3J7AF 4HSPA 2MJ8A 3E0JA 4EVOA 1EY4A 4H44C 4UDUC 3D4RA 5IOCA 4EQNA 1QWYA 1L0YB 4OGQC 2NYZD 2KQ3A 3Q6SA 1SMYD 3L3OC 1CHQD 2F0OA 4ODGA 1AW7A 4DFAA 3DHQA 4HEDA 1TS3A 3A8IE 2RSOA 1U4PA 3VR5A 1KLUD 4QUCA 3R2IA 1STBA 1TU2B 1XTCD 5C3XA 2ID0A 2SNMA 2JA7B 3K58A 1GUNA 3CRKC 3R93A 2PZWA 4ZK9B 3OWEB 3NHHA 2NWGA 4A3KB 3ITPA 4DGZA 1JORA 3CHBD 4BA2I 3VR3A 1CK1A 3FVQA 2E2JB 2R3ZA 5EBDA 1PRTB 2EYJA 5IGBA 2J7ZA 3GV3A 3SE0A 2XN9C 4JK1C 2KHSA 1M8AA 1BCPC 1EYDA 1AZPA 5KNCA 5CV7A 2BE5D 2X6GA 1STEA 2A6HD 5C0XI 5ELBA 1GHKA 4OO1I 1IYUA 4FF3A 2ICIA 4A3FB 1LTGD 4AYBB 1VCIA 3A56A 2IW3A 1TS4A 1BBXC 1Q8IA 1CTMA 2J0TD 1PTOB 1PYWD 4IQZA 3NBHA 2F3VA 3KBXA 3GP7A 2K28A 3LX0A 5C4JB 2JSOA 5K36G 1K83B 2PZTA 1EYAA 1S5ED 2Y0SB 4DNTB 3HOYB 2C5CA 5C44B 4EQOA 4FNFA 4K8JA 3SEBA 1PFMA 1BQQT 3TN2A 1ET9A 3J80L 3IFDA 3NSWA 1TWHB 1GJXA 2QCPX 4G7ZC 3D6WA 1PDQA 5BN3A 3ND8A 5M3MB 5C0XG 3VYTA 4WRDA 1MSHA 4OO1G 3FPUB 5DNFA 2PCFB 3HS0C 4RKBA 1EU4A 2EY2A 2A6HC 1F2ZA 3A55A 3MXUA 2F0SA 3UI2A 3GTGB 4RGNA 1DONA 5C3WA 2VXWA 5F2DA 3PUYA 3H3VC 3MWYW 4FXDA 1V8QA 3OWFA 2RSNA 1VDZA 1SNQA 3MXNA 4OHJA 4KY7A 3VA7A 1HTPA 3HOWB 2XRSD 1TWCB 2HDMA 3PUVA 2D5DA 2N55A 3TP5A 1O7LA 5J22A 1F9QA 3T13A 2H1EA 1SSOA 1F9SA 2IJ0A 2WV6D 2JP1A 3EQLC 5TSSA 1LABA 2NVXB 1QG7A 4TQUS 2EOTA 1B9MA 4NW2A 4QIWB 2A5HA 2R61A 3DUZA 4LAAA 3J80E 2A6EC 1WTXA 4A3MB 1GUOA 2F3WA 2X69A 1LO5D 1EU3A 3GD7A 3S14B 3GO5A 4R9WA 2IX3A 2L5TA 3BDLA 3NTKA 1AZQA 5FO9B 1FGBD 1DM0B 3ERQA 1O78A 1HA5A 1A2TA 3NK9A 5JOBA 1V1PB 4ZAIA 2RQXA 1B9NA 4C3JG 1EFID 5LL6S 1B3AA 3EFXD 5A35A 2EYOA 3T16A 5CBAE 1DXMA 3HG9A 4WFN3 4ZKCB 1Z47A 5G3LD 1RD9D 3MA2B 2EY5A 5EPLA 3RD4A 2VB3X 4K6DA 4RH6A 5K5PA 1V1PA 2HQEA 4BY1B 3MZ5A 4DNRB 1F2LA 5ELDA 2WKCA 5ELEA 1STNA 5C0XH 1E2WA 1Y69U 3DWQA 3TP6A 1ET6A 4IN3A 1SJHD 4M1UB 3J81E 2VNUD 1G6ZA 1E2VA 1HHVA 2KOLA 2TMPA 4KK7A 5FOBB 2KEEA 1IKLA 2Z8LA 3BS1A 3I4MB 1L0XB 4KKUA 3ZYYX 3MAQA 2EJGC 4HSVA 3TP7A 5KRUA 2BDNA 1ILQA 3TP8A 5ELFA 1TWGB 3FKIB 1CT1D 1G291 3TBIB 1PTOD 1HUNA 3BVZA 4QUFA 2CHBD 2NTTA 3HP3A 1K8MA 3WOEA 1D1IA 4RWSC 2ZXPA 1RODA 1KNEA 2EYHA 3S9WA 1HFGA 2L0CA 2PNRC 4IZ8A 3BZDB 3C46A 1IW7D 2XNAC 1MBYA 1H9KA 4F88A 2R92B 5A2QE 1YNND 1PRTC 3WDNA 3D6CA 3K5OA 1SNPA 1A3VA 2OXPA 5IGEA 5BN4A 4RGOS 2B8GA 2Q8IB 3S1QB 1F9PA 2NN6I 4RFBA 4KKTA 4IUQA 1BOSA 1D5XC 2L11A 2EXZA 4WORA 3TDQA 4C3HG 1S5BD 1BO0A 2WAQB 1I50B 5LL6X 1SNOA 4IFDH 1VF7A 4BS9A 3AMUA 2F0GA 2YU9B 4R8IA 1KABA 2J4XA 3SXHA 4Q0FA 4GZYC 3IKJA 1PTOC 1Y1WB 3K0YA 4PQXA 1EY6A 1B1ZA 4XT1B 2Z4IA 3P20A 5JAVA 1R4QB 3QO2A 3K6OA 4NMZA 3RZDB 1PTOH 4BBSB 3WOFA 1JQYD 1VMCA 1IW7C 1HPCA 5JEAJ 2OEOA 3VYUA 1A6XA 4S3SA 4HCSA 2FMCA 2K03A 2K6AA 2LFNA 3QOJA 1KLGD 3RZOB 1NR2A 3A54A 2MUYA 4J1MA 2MP1A 1KAAA 2NN6G 3A7LA 4C1NK 4H13C 4DAPA 4F87A 2K5QA 1FNUA 4BWGB 2R93B 4L63B 2NVYB 3N52A 1F9RA 3IAYA 4C3IG 3G6JB 4L6TB 2NZ1D 1SBBB 4A93B 5IGGA 1PZID 1TR5A 1LTAD 2K04A 2VUMB 1Q1BA 3GTQB 2F03A 4HR7B 2L1BA 5C4XB 2E2HB 4QMGA 2F0NA 2HDLA 1I3QB 1RJTA 4OL7A 5EGTA 5C6AA 3J7AV 2F0JA 4PV1C 2PW7A 3S16B 2B2YA 1I4HA 2RDFA 1G91A 3O13A 5KIXA 2O5IC 1CA5A 1PXUA 2FHTA 1WTQA 1IKMA 4PMWA 2C9OA 3URYA 3A7AB 1B2TA 1ENCA 1CZGA 3L9AX 1SYGA 1YNJC 5JVH3 1SYCA 2B2UA 1B44D 1RDPD 3OMGA 1XWEA 2IPKD 2D2CC 1EL0A 3ND9A 2IL8A 2BOSA 5COYA 1BUVT 1ML0D 4KI0A 3TZDA 4DAVA 3GTJB 2EY6A 4A3JB 1HTLD 3KF8A 1SJED 1Q12A 2PYKA 1BF4A 1MGSA 2F0KA 3H91A 1QOHA 3S15B 3VR4A 1KDBA 5EBCA 1GUTA 3OW7A 4C3JB 2DY8A 1CQVA 2HCIA 2RA4A 3FMCA 4DXGA 5EQ0A 4ZKBB 3GTMB 5IGCA 3BVMA 4KY5A 3GTLB 4G57A 2E74C 1D5ZC 3DMUA 4X3TA 4IUUA 3M3YB 4ZYSA 1FNWA 1SNCA 3A8JE 2F0VA 3N6RA 3KLSA 3P1HA 3MTSA 1OXVA 5JVG3 1SMYC 1ZYRD 5J1ZA 5JJZA 4RAUC 1CI3M 5FO7B 2G9HD 3TMEA 4XTCS 1KTKA 5EKIA 3PIP3 4K2KA 3L7ZC 2MPMA 3PV0A 1MSGA 3VA5A 4RGTA 4MIUA 3GTOB 1DYQA 3VYRA 1I4GA 1Y8NB 4JBWA 2IX1A 5CORA 4K8IA 1CZWA 4DA2A 1STAA 1E0BA 3EVQA 4CJ1B 1TIID 2JE6I 3D3RA 3BDCA 3MVVA 1STHA 4K2LA 4ZLTF 1SE4A 3I70A 2K1BA 4I7ZC 3QWNA 4HTHA 4IUTA 5ISRA 1EYCA 3KBGA 3SK8A 2BE5C 1UNSA 1JWUD 3PUZA 1XYIA 1PLFA 4Y7NB 4WJWA 2NB0A 2JA6B 2QDBA 2WKDA 5I9OA 5DAUA 5M5XB 2L12A 1I4XA 1UAPA 1W6JA 1J9OA 1JE4A 4V0BA 3A8KE 5C4HA 3H0GB 1ZYRC 4M8AA 3MHBA 4C3HB 3MFGA 4A3GB 3BVGA 3TZUA 3CKIB 4FF1A 4ULLA 2AWOA 2CQAA 3K5LA 1EWCA 1X32A 2B8FA 3NWTA 1TWFB 5CMDA 5EKLA 3D31A 4NP5A 2F4IA 1EQTA 2L9HA 3DWAA 1ZKOA 5FKAC 2A69D 5KNBA 2JEAI 2IT1A 1OXTA 2WP8J 3I72A 3SK5A 1BDOA 2E75C 2KCCA 4X3KA 1JCKB 5K36H 2F0PA 1SXTA 1RF2D 1TT2A 1D5MC 3J7YW 2DNCA 2K7VA 5KNDA 3OIPA 1EY5A 4G7HC 4RCNA 4XQJA 5JPMC 1LTTD 2PPBC 5DM73 1Q1EA 2WACA 4RHSA 2RDGA 1GUWA 2B2YC 2GA4B 3M85A 4G7OC 4CKCA 1DD2A 2TSSA 3P75A 3OSOA 3MEHA 4C3IB 1W6KA 1A2UA 5M9OA 4QCLA 2B2UC 4OO1H 1D6EC 4HMIA 1QCBD 5D3DA 5T1IA 2K33A 2B63B 5BN5A 5IT9L 3GTPB 3MXPA 4O1NA 1AN8A 1TY0A 5IGFA 1MD2D 4ZUJA 2KA7A 1ESFA 2A69C 2F0MA 3KUPA 5EKKA 1LT6D 2LS01 5J39A 3DEPA 1QB5D 2Q8TA 4P2CB 1A3TA 5ELCA 2BDOA 2RVLA 5IODA 2EY1A 3NPPA 2V4DA 1EY8A 1EQVA 1WD0A 3I73A 1U9RA 2XVSA 4U68A 1RKNA 2FINB 2EPBA 4R8NA 4A3DB 1H9MA 2O2LD 2ENBA 4DN4M 1PZJD 4HCEA 3IFTA 3MC0B 1SE3A 3U9SA 3KLSX 3R3OA 2L55A 4TRDA 5E3FA 2XIWA 2JYOA 4K5WA 3BYTB 5I6YA 1QILA 3ONAB 4BY7B 1I6VC 2F0IA 3HGBA 2FFKB 1NUCA 3K5NA 3AB9A 3OOCA 3VR6A 2EE1A 1LTSD 4XXEA 2A73B 4IUVA 4KD3A 5HGTA 1VF5C 1Z6HA 3SK4A 3PUXA 5E4WC 1X3PA 4J8QA 1QNUA 1GUGA 3DM1A 2M9VA 1EIGA 2X6LA 4NKLA 1ENFA 1BXTA 2QILA 2NTSA 4KHZA 3JAML 3S1RB 1U4RA 1U4LA 4ZQ3A 1JR0D 5IIFA 2K5WA 2RDHA 5FK9C 4ABNA 3SK6A 2I07B 5CBEE 1Y8PB 1HUMA 1Q3LA 2EYLA 1S5CD 1Y8OB 3RMHA 5T1GA 1ESRA 1O7ZA 3M7GA 1PFBA 1QE6A 4FF2A 3T51B 4CJ2C 4FYDA 1YNNC 2B2WA 4X3SA 2OF1A 3T53B 2DY7A 2EYPA 4FVMA 3S2HB 3HZXA 1PZKD 2F0FA 4CKEA 4A3IB 5DM63 3RUZA 3R8BA 2SEBD 2ZXRA 3DWPA 2WINB 5I6WA 4C2MB 3PO2B 1SEBD 1TQOA 2NVTB 1SYBA 5E4XA 3HEJA 1OXSC 3H94A 3NXWA 1R9TB 1RTNA 2CW0D 2F0EA 1AEXA 1FD7D 3E5SA 5FLXL 3JAME 1TVXA 5JPNC 4KN7C 2K01A 2RKSA 1GXDC 3LWUA 3C3LA 1KDCA 1QNKA 1EZ6A 4FF4A 3FDTA 2EZVA 1V43A 4FXGC 1PMRA 4IALA 4FXKC 2K32A 1HCZA 3QIAA 3K57A 2CVRA 5CV6A 1OXXK 3HOXB 4CGYB 1SYEA 5C0XJ 3Q24A 2QEJC 1B4OA 4KY6A 1I6HB 2B2TA 3X3NA 1JWMD 2Z1CA 3H6MA 1RCVD 2HCCA 1I4QA 2G9DA 1LLRD 2E76C 4BA1I 3X3MA 1TWAB 3NUCA 3CRLC 4H7BA 4K6LA 3D4DA 2NVQB 2ZT9C 3HOVB 2CW0C 2PO4A 1LACA 5KGUA 2F0LA 1NCVA 1CHPD 3Q22A 2RBMA 1ILPA 4LK1C 5FLXE 1BCPF 2OT2A 1IHZA 1C8CA 5EPJA 2K05A 2AWNA 4HN7A 4DK0A 3SR1A 1JB3A 5JEAG 2NN6H 2R6GA 1KNAA 2Q8RE 1LT4D 1IL8A 1EY9A 4IURA 4PNYA 4LMQD 3FEWX 4MN3A 3FPPA 1D2BA 5FO8B 2HUGA 1O7YA 4RCOA 1HA6A 1H9JA 1X3QA 1EWHA 4EGVA 1G2SA 2F0DA 4RA8A 1JOKA 2QKIC 4TKOB 3OIQA 3NP8A 4QB4A 2SOBA 1SFOB 3HRZC 3OMCA 1MI2A 4IFDJ 2PQEA 4K5XA 1WTOA 3T56B 1LTRD 4F8MA 2JA8B 3I8ZA 1LTID 1I4PA 5M3FB 2EJFC 2KEDA 4O42A 3BDOA 1II3A 5CC4A 2KCNA 1JOOA 1ENAA 1EEFD 2A6ED 2O5JC 1EY0A 5DEHA 4KJNA 3FRPB 4RGMA 1HXYD 5CV9A 3VR2A 3CU7A 4HMJA 1E2ZA 1LT5D 1AFPA 2B2VA 2NBFA 1LT3D 3OPOA 1B53A 4XYOA 4CJ0B 3NWSA 1JC7A 3C1FA 3MFYA 1SAPA 4IUNA 1TS5A 4N9PA 1STYA 3KK7A 5LHY1 4FO2A 4QF4A 4L8JA 2F0TA 4ZRZA 2BA0A 1FYCA 2EYMA 1C48A 2EDGA 3VYSA 3NBIA 1AP0A 2AQ3B 4IFDI 4TSSA 2O4XA 3EJIA 4F7XA 4KV6A 4DXFA 3TSSA 5JEAH 2B2WC 4KTAA 2AQ2B 2A68D 5C3EB 1J8IA 3V05A 1HQMC 3T4AC 3HKZB 3I90A 4KD4A 1A3UA 1F2MA 3QG1A 1FR3A 3J81L 5IGDA 2F0UA 3AU7A 2DNEA 4XDXA 2MGSA 1GHJA 2SDFA 5KYLA 3I91A 4Q5VA 5EPKA 2F0QA 4IUPA 2K5DA 5HURA 3MXGA 1D1KA 2E2DC 2EYFA 3NTIA 3BYYB 4KJOA 4XIGS 5KYIA 3M7NA 3EROA 2MHVA 3F2UA 2VB2X 5I9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEJ A;  2PZT A;  1NUC A;  5CV9 A;  1EYA A;  3SXH A;  5C4H A;  5C6A A;  2F0J A;  1IHZ A;  2PW7 A;  4LAA A;  3NXW A;  4HMJ A;  2KQ3 A;  3TP7 A;  1A2U A;  4K14 A;  5M9O A;  1SYD A;  4ID6 A;  5CR3 A;  1SNC A;  2F0E A;  3MHB A;  4EQO A;  1NSN S;  2F0O A;  4HMI A;  1AEX A;  1SNM A;  2F0V A;  2RDF A;  4KHV A;  4ODG A;  4KD3 A;  3SR1 A;  2F3W A;  4K8J A;  4DU9 A;  5KIX A;  5KRU A;  1EY6 A;  4DFA A;  5HGT A;  3E5S A;  3SK4 A;  3DHQ A;  3TP8 A;  5KGU A;  3NQT A;  3P1H A;  5JAV A;  1EY7 A;  1ENC A;  3BDL A;  1STB A;  2NUC A;  5J1Z A;  4B9X A;  1SYG A;  2RKS A;  3MXP A;  5C3X A;  2SNM A;  4NMZ A;  1KDC A;  3TME A;  4NKL A;  3C1F A;  1SYC A;  4RKL A;  1EZ6 A;  5NUC A;  3ERQ A;  4IUN A;  4I65 A;  4N9P A;  1STY A;  1A2T A;  2PZW A;  1EY9 A;  2OEO A;  3NK9 A;  3C1E A;  4K2K A;  4NDX A;  3OMG A;  4PNY A;  5JOB A;  5IGF A;  4N9T A;  4S3S A;  4K5V A;  3U9O A;  5EKL A;  4ZUJ A;  5C5L A;  3VA5 A;  3NHH A;  4IAL A;  3SHL A;  4MIU A;  4QF4 A;  2F0T A;  3ITP A;  4DGZ A;  2EYH A;  4NP5 A;  4ZQ3 A;  5IIF A;  2EYM A;  2F0M A;  4PMC A;  3S9W A;  3QOJ A;  1JOR A;  4WRD A;  1SND A;  5EKK A;  4J1M A;  4IZ8 A;  2EYO A;  5J39 A;  3D4W A;  3T16 A;  4RKB A;  2EY2 A;  5CV4 A;  5CV6 A;  1KAA A;  1F2Z A;  4K8I A;  4ME5 A;  3SK6 A;  2F0W A;  2EYJ A;  1A3T A;  2O4X A;  3EJI A;  5I9P A;  5IGB A;  2F0D A;  5CV5 A;  4F7X A;  1STA A;  1STG A;  4B9W A;  2F0S A;  1SYE A;  4KV6 A;  1JOK A;  2EYL A;  2KHS A;  2EY6 A;  3EVQ A;  4ZUI A;  1EYD A;  5C3W A;  2EY1 A;  5IOC A;  5IOD A;  4KTA A;  3NP8 A;  4QB4 A;  5F2D A;  3SK5 A;  1EY8 A;  2SOB A;  1EQV A;  5CV7 A;  3BDC A;  2PYK A;  3MVV A;  4KY6 A;  5C5M A;  1STH A;  2EY5 A;  3OWF A;  4K2L A;  2F0K A;  3D6C A;  1U9R A;  3OMC A;  4K6D A;  5K5P A;  1SNP A;  1A3V A;  2OXP A;  1SNQ A;  5IGE A;  4HTH A;  1KDB A;  4KY7 A;  4E6I A;  5ISR A;  4KD4 A;  5E1F A;  1RKN A;  1A3U A;  2F0H A;  2F0P A;  1F2M A;  2PQE A;  4K5X A;  1EYC A;  3H6M A;  4R8N A;  2HQE A;  1TT2 A;  3MZ5 A;  3SK8 A;  4DF7 A;  4PMB A;  5IGD A;  3V2T A;  2OF1 A;  2F0U A;  4F8M A;  2PZU A;  2EXZ A;  1STN A;  1JOQ A;  3TP5 A;  1EY5 A;  2ENB A;  2EYP A;  4WOR A;  5CGK A;  5J22 A;  3HZX A;  3NUC A;  3T13 A;  4YIJ A;  4EQP A;  5IGG A;  1TR5 A;  5KYL A;  3TP6 A;  3MEH A;  4J6H A;  2F0Q A;  2PW5 A;  2F0F A;  2WAC A;  2QDB A;  4H7B A;  5HUR A;  5I9O A;  5KEE A;  3R3O A;  5DAU A;  3QOL A;  1SNO A;  1II3 A;  3PMF A;  4TRD A;  3D4D A;  1F2Y A;  2SNS A;  3RUZ A;  5CV8 A;  1EZ8 A;  1KDA A;  5CC4 A;  5IGC A;  1JOO A;  1ENA A;  4KY5 A;  5E3F A;  1SYF A;  2F3V A;  4K5W A;  5C4Z A;  3D8G A;  4QMG A;  2F0G A;  2EYF A;  4G57 A;  4KJO A;  5I6W A;  5I6Y A;  5KYI A;  1EY0 A;  1KAB A;  3QB3 A;  2F0L A;  2M00 A;  5DEH A;  2F0N A;  4KJN A;  4EVO A;  2RBM A;  3ERO A;  2LKV A;  3LX0 A;  1EY4 A;  2F0I A;  3P75 A;  4OL7 A;  1TQO A;  3DMU A;  3OSO A;  5EGT A;  1SYB A;  4EQN A; 
#chains in the Genus database with same CATH topology
 1C4Q A;  4IJH A;  3GTK B;  1DOK A;  5GRO A;  4DV5 L;  2PMZ B;  1XPO A;  4ID6 A;  4GKK L;  1SDF A;  1NSN S;  2JEB I;  1LYL A;  3K59 A;  1K28 A;  4LFC L;  4OEM B;  3CQZ B;  2RHQ B;  4IOA A;  3S2H H;  2ICE C;  1QZH A;  2XWJ B;  1K0S A;  2R7Z B;  2JA5 B;  2R93 H;  2RCF A;  4B9X A;  1Q86 C;  1VQD A;  4A3I H;  4IFD G;  3K81 C;  2AUJ D;  5D65 A;  1H9S B;  4JBK A;  5GAH C;  2L4N A;  1H9R A;  4RKL A;  3QJY A;  1T5E A;  4BBR B;  4I65 A;  1HFN A;  2KJX A;  1J6Q A;  1EOV A;  2D62 A;  3C1E A;  1OXU A;  2LY7 A;  3S1M B;  1TS2 A;  5C5L A;  4JBJ A;  3SHL A;  2NVT H;  1LV9 A;  4A3F G;  3F1Z A;  1BCP B;  3PIP A;  1QJO A;  2A68 C;  1MHW C;  4AYB G;  1R9T H;  1SE2 A;  1N32 L;  3D4W A;  3TRZ A;  1E3P A;  1Z7T A;  5A2Q L;  1M1K C;  4YY3 Q;  3HFZ B;  4OIK A;  4ME5 A;  2Z9H A;  4HID A;  2PNH A;  5CV5 A;  2B2T C;  3LNN A;  3R2T A;  1PRT D;  1STG A;  1KRS A;  1HNX L;  5C4X H;  3LWE A;  4ZUI A;  5H1S E;  4KKS A;  1H9S A;  2IWH A;  4CBV A;  2FMM A;  4DAY A;  1UEA B;  5C5M A;  2UUB Q;  4YHH Q;  1WTW A;  4LJZ C;  2XSC A;  1WCM B;  4E6I A;  1DOM A;  1WTV A;  5E1F A;  1S5D D;  1JIC A;  2JA8 G;  4H0L C;  1OO9 B;  3Q23 A;  3BG3 A;  4PMB A;  2D9U A;  3CC2 A;  3HOY G;  3W5O A;  1G8Z D;  2EVB A;  1CFM A;  5CGK A;  4Z9C B;  1FGU A;  2XRQ D;  3FHW A;  1NR4 A;  2BA1 A;  4EQP A;  4YIJ A;  2KUM A;  1LTL A;  1DJR D;  4V19 0;  2UXC Q;  3RN5 A;  1PH1 A;  5KEE A;  2XTI A;  3HOX H;  4DV0 L;  5G3L F;  3W2D A;  2SNS A;  1KDA A;  2B29 A;  4KN4 C;  3M4Q A;  3M4O B;  4MHE A;  5C4Z A;  3G71 A;  3S2D B;  3H15 A;  3CCU A;  3I4N B;  3M4P A;  3QB3 A;  4B08 A;  4PG3 A;  2WII B;  1XMO L;  1S40 A;  1CA6 A;  1I6H H;  3PCO B;  1WVL A;  5M3M G;  2LMC B;  1B7Y B;  3HOU B;  4J15 A;  3CC7 A;  5IYC H;  5LMN W;  1WTR A;  1PRT F;  1ZEQ X;  4XQN A;  1SNM A;  2KVM A;  3NTH A;  4KHV A;  4XT3 B;  1N34 Q;  1C0A A;  3G7L A;  4L5R C;  2JJQ A;  5I2Y A;  2KEN A;  3E0E A;  3K5M A;  1TWA H;  4C1N I;  4JI6 L;  1EY7 A;  2I46 A;  2AUK A;  1G2T A;  5I2X A;  4JV5 L;  4MNO A;  4B3R Q;  1IYV A;  3OHX C;  3SVM A;  2Z4H A;  3I2Z A;  2FJ2 A;  2BCO A;  4G4K A;  4QJF A;  1T9H A;  2NVQ H;  5NUC A;  3M4Y A;  1M4V A;  3HOV H;  2OTJ A;  3PIO 3;  5D14 A;  2XWB B;  5LMU Q;  5I4D A;  3UDX A;  1CQF A;  1NAP A;  3I4L A;  4JI2 L;  5IT9 E;  3U9O A;  4X65 Q;  2E2I B;  5IP9 G;  3S17 B;  1RHP A;  2EIF A;  3V96 A;  3HOW G;  2JXM B;  1SND A;  1F77 A;  3KLR A;  1R4P B;  1HRJ A;  4ILW A;  4LFA L;  4P73 A;  2EJM A;  5CV4 A;  2F0W A;  3UDI A;  1WTP A;  1WJJ A;  1PTO F;  4A3E B;  3J81 j;  3PUW A;  2KHI A;  4RHR A;  2VS1 A;  4LF5 L;  4DV7 L;  2PI2 E;  4K0K L;  1VMP A;  1O80 A;  3SDZ A;  1KIX A;  1E1T A;  1DOL A;  3ICE A;  2KEC A;  5M5W B;  2ZJQ A;  4DF7 A;  1HQR D;  2PZU A;  4HIM A;  4IO9 A;  4A3M G;  1JOQ A;  1E1O A;  1XXG A;  2ZXO A;  2QGQ A;  1V1O A;  4R4O A;  1GOZ A;  5FLM H;  2A74 C;  1HNW Q;  3NEN A;  2GVA A;  4J6H A;  1IZ6 A;  1U4M A;  3QOL A;  2ASB A;  3PMF A;  1CM9 A;  3RLF A;  2N88 A;  2UUC Q;  4OWW B;  3H09 A;  1SYF A;  3K7A B;  2CQO A;  3GV6 A;  3D8G A;  2B2V C;  4GS3 A;  3RR5 A;  2M00 A;  1SFO H;  3KJO A;  4P72 A;  2LKV A;  4UAI A;  4JI0 L;  4JCV E;  4B9W A;  4KMU C;  1S4Z A;  1UUP A;  4ME3 A;  1EOT A;  1BR9 A;  2GVB A;  3W3A A;  3CCM A;  1ICW A;  3I3C A;  5CYU A;  4K14 A;  1SYD A;  5CR3 A;  4XYQ A;  2WB1 B;  4C56 C;  1EIH A;  1YNJ D;  2H4O A;  4DK1 A;  1WFQ A;  1U5K A;  4DU9 A;  4CHT B;  2JA8 H;  1K8O A;  4NXM Q;  1Y1V B;  1JWS D;  2R7Z G;  4CKB A;  3CPW A;  1TKW B;  3E6Z X;  3NQT A;  1TY2 A;  1X54 A;  2IY5 B;  5M3F H;  2NUC A;  4BBR G;  1LTB D;  4OIJ A;  3PO3 B;  2YYZ A;  1PFN A;  2DN8 A;  2IX0 A;  5D3I B;  3IL8 A;  4U67 3;  1SRU A;  1B50 A;  3Q0A A;  1Q8K A;  3NQI A;  3A5Z B;  4NDX A;  1I4R A;  1T5X D;  4N9T A;  4DV3 Q;  4K5V A;  4YWM A;  1EQR A;  4LUV A;  1XNR L;  4PMC A;  2VQF Q;  3RN2 A;  4XQQ A;  3TRE A;  3KLW A;  4UP8 A;  1A15 A;  4HAE A;  4GOP C;  4POG A;  2R7F A;  3KDF B;  1DCZ A;  1WI5 A;  3EA6 A;  4QGU A;  5EJW A;  4L5Q A;  4JI5 L;  1BNZ A;  2F52 A;  4JI8 L;  3DEO A;  3S1N B;  5HY6 A;  3HOZ B;  4FP5 D;  1WD1 A;  2K5N A;  3K80 C;  4GLX A;  4X3U A;  1RTO A;  1XX8 A;  3P7J A;  3CF5 A;  1IBK L;  4A3B B;  2LXK A;  2D0O A;  4YWK A;  2VY3 A;  1JJ2 A;  2F0H A;  1BCP D;  3GQB A;  3DXJ C;  5AFW A;  1ZXT A;  5BR8 Q;  2F1M A;  1HR0 L;  1YNX A;  3V2T A;  3J80 c;  5IP9 H;  1DZ1 A;  1S5F D;  2B39 A;  1Q90 A;  2AQ1 B;  3TS0 A;  2PW5 A;  2M2L A;  3FKI G;  3T1Y L;  4DR7 Q;  1FNV A;  3NE5 B;  2QF7 A;  1GUS A;  1L1O A;  1ONL A;  5M5Y B;  2Q2U A;  1F2Y A;  4UHV A;  5CV8 A;  1EZ8 A;  1EEI D;  3C2P A;  3J7A F;  4HSP A;  3I4N G;  2MJ8 A;  5C3E H;  3E0J A;  4EVO A;  3DM3 A;  1EY4 A;  4H44 C;  4UDU C;  1PH6 A;  3HOU G;  3D4R A;  5IOC A;  4EQN A;  4B3T L;  4B3M L;  1QWY A;  1L0Y B;  2IHE A;  4OGQ C;  2NYZ D;  2D0P A;  2KQ3 A;  3Q6S A;  4IPG A;  4PZ8 A;  1SMY D;  3L3O C;  1CHQ D;  2F0O A;  4ODG A;  4DR3 Q;  1VQI A;  1AW7 A;  4DFA A;  3DHQ A;  4HED A;  1HNZ Q;  1TS3 A;  3A8I E;  2RSO A;  1U4P A;  3VR5 A;  1KLU D;  4QUC A;  4DK3 C;  3R2I A;  1STB A;  1TU2 B;  1XTC D;  1NTG A;  1UE6 A;  4OX9 Q;  5C3X A;  3MEF A;  2ID0 A;  2SNM A;  4P71 A;  2UXB Q;  3K58 A;  2JA7 B;  1GUN A;  2R92 G;  1GKH A;  3CRK C;  3R93 A;  3VDY A;  4YY3 L;  2PZW A;  2MQH A;  4ZK9 B;  3OWE B;  4DUZ L;  2GN5 A;  1W3S A;  3UE1 A;  3NHH A;  2NWG A;  1PA6 A;  4A3K B;  3ITP A;  4DGZ A;  4X64 Q;  1JOR A;  3CHB D;  3GTK H;  4BA2 I;  3VR3 A;  1CK1 A;  3FVQ A;  2E2J B;  2R3Z A;  1HJP A;  5EBD A;  2UUB L;  4YHH L;  1OTC A;  4MTN A;  1PRT B;  2EYJ A;  5IGB A;  2J7Z A;  3CQZ H;  3GV3 A;  3SE0 A;  3CC4 A;  4DAM A;  2PQA A;  2XN9 C;  4JK1 C;  2WAQ G;  3A74 A;  2KHS A;  1M8A A;  4LF8 L;  1BCP C;  2K14 A;  1EYD A;  1AZP A;  5KNC A;  2JA5 H;  1SN8 A;  5CV7 A;  4MTK A;  1YJW A;  2BE5 D;  2X6G A;  1STE A;  2A6H D;  5JJK A;  5C0X I;  5ELB A;  1GHK A;  1KL9 A;  4BBR H;  3KOJ A;  4ZCK A;  5DLQ E;  1PH3 A;  2UXC L;  4OO1 I;  1IYU A;  4OON A;  4FF3 A;  1I5F A;  2ICI A;  4A3F B;  3S1M H;  1LTG D;  2DJF C;  2KBN A;  4LF6 Q;  4AYB B;  2VZA A;  1VCI A;  3A56 A;  2IW3 A;  2OQ0 A;  2RHS B;  1TS4 A;  1YVC A;  1BBX C;  4APV A;  2R7D A;  1Q8I A;  1CSP A;  1CTM A;  4NXN L;  2J0T D;  1PTO B;  1PYW D;  4IQZ A;  3NBH A;  2F3V A;  3KBX A;  1A0I A;  3GP7 A;  1K8G A;  1AH9 A;  2HQL A;  4BBS G;  2K28 A;  3LX0 A;  5C4J B;  1YJ9 A;  2JSO A;  2AMC B;  4I7A A;  5K36 G;  1WCM H;  1K83 B;  2PZT A;  4YCU A;  1EYA A;  4LF9 L;  1NY4 A;  3STB D;  1S5E D;  2WB1 G;  2Y0S B;  1GM5 A;  4B3R L;  4DNT B;  3HOY B;  2C5C A;  5C44 B;  4EQO A;  3F2B A;  4FDB A;  4FNF A;  4K8J A;  3PF5 A;  2BH8 A;  1AE3 A;  3SEB A;  4X62 L;  1PFM A;  1BQQ T;  3U4Z A;  2E5L Q;  3TN2 A;  1ET9 A;  3J80 L;  3ULP A;  3IFD A;  5IWA Q;  3PO3 G;  3NSW A;  1TWH B;  1ASY A;  1CKN B;  3K7U C;  3DLL A;  2QCP X;  4G7Z C;  3D6W A;  1GJX A;  1PDQ A;  3M4O H;  5BN3 A;  2KCT A;  3S2D H;  3ND8 A;  5M3M B;  2UXD Q;  3A0J A;  3T1H Q;  3MXN B;  5C0X G;  3TS2 A;  4DUY Q;  3VYT A;  4WRD A;  1MSH A;  3HOU H;  4OO1 G;  3FPU B;  3J7Z C;  5DNF A;  2PCF B;  3HS0 C;  4RKB A;  1EU4 A;  2EY2 A;  2A6H C;  4R4C A;  1F2Z A;  1X3E A;  3A55 A;  3MXU A;  2F0S A;  3UI2 A;  3GTG B;  2VUM G;  1CKN A;  4RGN A;  1DON A;  1VQ5 A;  2QEX A;  5C3W A;  3HKZ E;  2VXW A;  5F2D A;  3JC6 6;  4NPS A;  4HJ7 A;  2A1A A;  3PUY A;  3H3V C;  3HKS A;  3MWY W;  4FXD A;  1V8Q A;  2Z6B A;  3OWF A;  2H5X A;  2RSN A;  1VDZ A;  2N3S A;  1SNQ A;  3MXN A;  4OHJ A;  4KY7 A;  3VA7 A;  1HTP A;  4JI4 Q;  3HOW B;  2XRS D;  1TWC B;  2E2I H;  3I56 A;  2HDM A;  3PUV A;  3S17 H;  1VQM A;  3ERS X;  2D5D A;  2N55 A;  3TP5 A;  1O7L A;  4WJ3 M;  5J22 A;  1F9Q A;  3T13 A;  3W1G A;  3H3V H;  4LUZ A;  2H1E A;  1SSO A;  1F9S A;  2KCM A;  4DNI A;  2IJ0 A;  2WV6 D;  2JP1 A;  3EQL C;  4IJL A;  5TSS A;  3STB C;  4A3E H;  1LAB A;  4P75 A;  3SGI A;  2NVX B;  1QG7 A;  5IYB G;  2UUA Q;  2PMZ E;  4TQU S;  1IBL L;  4LF7 Q;  2EOT A;  1B9M A;  4R4T A;  4NXM L;  4NW2 A;  2NZO A;  1K9M C;  4QIW B;  3L2P A;  2A5H A;  4YCW A;  2R61 A;  3DUZ A;  2F3I A;  4LAA A;  3J80 E;  2A6E C;  1WTX A;  4A3M B;  1GUO A;  1NJI C;  5M5W H;  4A3L G;  4DR4 Q;  1NBW A;  2F3W A;  2X69 A;  1LO5 D;  1EU3 A;  3GD7 A;  1JE5 A;  1QVG A;  3S14 B;  3OW2 A;  3GO5 A;  4R9W A;  3A5U A;  2IX3 A;  2JA7 G;  2L5T A;  3BDL A;  3NTK A;  1AZQ A;  5FO9 B;  1FGB D;  2VQF L;  1DM0 B;  3ERQ A;  1O78 A;  4IOC A;  1HA5 A;  1Q46 A;  2WFW A;  3K7A H;  1A2T A;  1VQB A;  3NK9 A;  1VQN A;  5J3B A;  5JOB A;  4A3K G;  1V1P B;  4ZAI A;  2RQX A;  1X9N A;  1B9N A;  4N8F A;  4C3J G;  1EFI D;  5LL6 S;  1MKH A;  1B3A A;  1VQ4 A;  3EFX D;  5A35 A;  2EYO A;  3T16 A;  1D8L A;  1DXM A;  3HG9 A;  5CBA E;  2K5V A;  4R4I A;  4KHP L;  1Y1V H;  4WFN 3;  4ZKC B;  5BR8 L;  1Z47 A;  5G3L D;  1RD9 D;  1VQE A;  3MA2 B;  4ALP A;  4C2M H;  3K0X A;  3PO2 H;  3PO3 H;  2EY5 A;  5EPL A;  3RD4 A;  4DV6 L;  1XPU A;  1Q81 C;  2VB3 X;  4K6D A;  4RH6 A;  5K5P A;  1V1P A;  2HHH L;  4GNX B;  1V1Q A;  1L1O C;  2HQE A;  4BY1 B;  3MZ5 A;  4DNR B;  1F2L A;  2Z6K A;  5ELD A;  1FJG Q;  1X3F A;  4JG2 A;  1XMQ L;  2WKC A;  5ELE A;  1STN A;  5C0X H;  1E2W A;  1Y69 U;  3DWQ A;  3TP6 A;  1ET6 A;  4IN3 A;  1SJH D;  1BBU A;  1BKB A;  5IE8 A;  4M1U B;  3J81 E;  2VNU D;  3J80 i;  1G6Z A;  2JN4 A;  1E2V A;  1HHV A;  3KJP A;  2HIV A;  2KOL A;  3S1N H;  2TMP A;  4LNQ A;  3HOZ H;  4KK7 A;  5FOB B;  4DR3 L;  2E8G A;  2KEE A;  1IKL A;  2Z8L A;  1VQJ A;  2JQO A;  3BS1 A;  3I4M B;  4GNX A;  2Y0S G;  1L0X B;  2F4V Q;  2VQE Q;  4KKU A;  3ZYY X;  4A3B H;  4AQY L;  5C44 G;  3MAQ A;  2EJG C;  4HSV A;  3TP7 A;  1SR3 A;  5KRU A;  2BDN A;  1ILQ A;  5JJL A;  5ELF A;  3TP8 A;  1TWG B;  3FKI B;  1CT1 D;  3ER0 A;  1G29 1;  3TBI B;  1PTO D;  2CKZ B;  1HUN A;  3KF6 B;  3BVZ A;  4QUF A;  4X6A H;  5M5Y H;  2CHB D;  2NTT A;  3HP3 A;  1KC8 C;  1K8M A;  4X66 Q;  1XNQ L;  3WOE A;  4YWL A;  1D1I A;  5AJ3 Q;  3BJU A;  4RWS C;  2ZXP A;  1K3R A;  1ROD A;  4B3S Q;  5IYB H;  1KNE A;  2Q2H A;  2EYH A;  3S9W A;  1HFG A;  2L0C A;  2PNR C;  1IBM Q;  4IZ8 A;  3BZD B;  3C46 A;  4DV1 Q;  1IW7 D;  2XNA C;  1MBY A;  1EYG A;  1H9K A;  4F88 A;  3KF6 A;  2JA6 G;  4IPD A;  1UE7 A;  4LF6 L;  2R92 B;  5A2Q E;  2NZH A;  1YNN D;  2JA7 H;  4GLA C;  1XJV A;  1PRT C;  3WDN A;  3D6C A;  1N33 Q;  3RLO A;  3K5O A;  1SNP A;  1A3V A;  2OXP A;  3BZK A;  5IGE A;  4H02 A;  2N78 A;  5BN4 A;  3J81 i;  4RGO S;  2B8G A;  2Q8I B;  3S1Q B;  1F9P A;  1GD7 A;  2NN6 I;  4RFB A;  4KKT A;  3H0G G;  4IUQ A;  1BOS A;  1D5X C;  1SMX A;  2EXZ A;  2L11 A;  4WOR A;  4DR1 Q;  2E2J H;  3TDQ A;  4C3H G;  1S5B D;  1TXY A;  1BO0 A;  2WAQ B;  1J5E L;  4WJ4 A;  3CAM A;  1I50 B;  5LL6 X;  1SNO A;  3CCS A;  1SLJ A;  1VF7 A;  4IFD H;  4BS9 A;  4DV2 L;  2QW7 A;  3AMU A;  4LUO A;  2F0G A;  2YU9 B;  4R8I A;  1KAB A;  1Q7Y C;  2WB1 E;  3U58 A;  3EIV A;  2J4X A;  3SXH A;  4Q0F A;  5IWA L;  4GZY C;  4TVA B;  3IKJ A;  1PTO C;  1Y1W B;  4A3F H;  3K0Y A;  3E9I A;  4PQX A;  1EY6 A;  1KRT A;  1YJN A;  1B1Z A;  2V1C C;  3W1B A;  2UXD L;  4XT1 B;  4JI7 Q;  2Z4I A;  3P20 A;  5JAV A;  1R4Q B;  3QO2 A;  4DUY L;  2JA9 A;  3K6O A;  3KFU A;  4NMZ A;  3RZD B;  1PTO H;  1QVC A;  4BBS B;  3WOF A;  1JQY D;  1VMC A;  1IW7 C;  1HPC A;  5JEA J;  2OEO A;  3VYU A;  1A6X A;  4S3S A;  4HCS A;  5C4J H;  2BH2 A;  2FMC A;  1U0L A;  4R1J A;  2K03 A;  2K6A A;  1K83 H;  1YHA A;  2LFN A;  3QOJ A;  1KLG D;  3RZO B;  1NR2 A;  3A54 A;  2MUY A;  3HOY H;  4J1M A;  2MP1 A;  5C44 H;  1KAA A;  3M9B A;  2NN6 G;  1I94 L;  1VQC A;  3A7L A;  4C1N K;  2UU9 Q;  2IHF A;  2ZM6 L;  4H13 C;  4A76 A;  1X3G A;  4DAP A;  4F87 A;  2K5Q A;  1FNU A;  4BWG B;  1TWH H;  2R93 B;  2ZTD A;  4CDD C;  4L63 B;  4LF4 Q;  1VS0 A;  2NVY B;  4BY1 G;  3N52 A;  1F9R A;  1YEZ A;  5M3M H;  3U50 C;  3IAY A;  4C3I G;  3G6J B;  4L6T B;  2NZ1 D;  4UY8 C;  1SBB B;  4DV4 Q;  4LF7 L;  1QZG A;  4A93 B;  5IGG A;  1PZI D;  1TR5 A;  1LTA D;  2ZTC A;  2K04 A;  2VUM B;  4JW0 A;  1KAW A;  1Q1B A;  1YHB A;  3CCR A;  3GTQ B;  2EQS A;  2F03 A;  2B63 G;  3GTG H;  4HR7 B;  2L1B A;  5C4X B;  1Y14 B;  2E2H B;  1C9O A;  4QMG A;  2ZJP A;  3I4M G;  4DV5 Q;  2F0N A;  4GLV B;  2HDL A;  1I3Q B;  4GKK Q;  1RJT A;  4OL7 A;  1PH5 A;  4OEL B;  5EGT A;  4QQB X;  5IYD G;  5C6A A;  1B70 B;  3J7A V;  2F0J A;  4PV1 C;  2PW7 A;  3S16 B;  2B2Y A;  3KDF A;  3HOW H;  1TWC H;  1I4H A;  2RDF A;  1G91 A;  3O13 A;  5KIX A;  3OTO Q;  4JYA Q;  1YBY A;  2O5I C;  1CA5 A;  1PXU A;  2FHT A;  1WTQ A;  3FP9 A;  1IKM A;  4PMW A;  2C9O A;  3URY A;  3A7A B;  1B2T A;  2K50 A;  1ENC A;  1CZG A;  3L9A X;  1SYG A;  1YNJ C;  5JVH 3;  3KF8 B;  1SYC A;  2B2U A;  4L5T A;  2NVX H;  1B44 D;  1RDP D;  3OMG A;  1XWE A;  5ELO A;  2IPK D;  2D2C C;  1EL0 A;  3ND9 A;  2IL8 A;  2ZJR A;  4A3M H;  4A3D G;  1HNX Q;  2BOS A;  5COY A;  1CKM A;  1BUV T;  1ML0 D;  4CDF C;  4JC0 A;  4KI0 A;  3F2D A;  3S14 H;  3TZD A;  4DAV A;  3GTJ B;  2EY6 A;  4UPA A;  2Z6K C;  4A3J B;  1HTL D;  3KF8 A;  1SJE D;  1Q12 A;  1X55 A;  2HT1 A;  2PYK A;  4AYB E;  1BF4 A;  1MGS A;  2F0K A;  1PHJ A;  3H91 A;  1QOH A;  3S15 B;  3VR4 A;  1EUJ A;  1KDB A;  5EBC A;  1GUT A;  1ICF B;  3OW7 A;  4C3J B;  3F8T A;  2DUD A;  3I55 A;  2CFM A;  2DY8 A;  1CQV A;  2HCI A;  4BXX G;  2RA4 A;  4GNX C;  2R7Z H;  3FMC A;  4DXG A;  4DPG A;  5EQ0 A;  4ZKB B;  2K52 A;  1IL2 A;  3GTM B;  1XMO Q;  5IGC A;  2L15 A;  3BVM A;  4KY5 A;  3GTL B;  1LUZ A;  1H95 A;  4G57 A;  2E74 C;  2A19 A;  1NE3 A;  1D5Z C;  3DMU A;  1Y1W G;  4X3T A;  4IUU A;  3M3Y B;  3UDF A;  1P8L A;  4ZYS A;  1FNW A;  4JI6 Q;  1NMF A;  1SNC A;  3CCV A;  1PH2 A;  4X66 L;  3A8J E;  4JV5 Q;  2F0V A;  3N6R A;  3KLS A;  5AJ3 L;  1G51 A;  1VQF A;  3CW2 C;  4JPB W;  3P1H A;  3MTS A;  1OXV A;  5JVG 3;  4B3S L;  1SMY C;  1ZYR D;  1A62 A;  2N49 A;  5J1Z A;  5JJZ A;  1N34 L;  4LFB Q;  4RAU C;  1CI3 M;  5FO7 B;  4JI2 Q;  2G9H D;  3TME A;  4XTC S;  1IBM L;  1UE5 A;  2RCN A;  4CDC C;  5IP7 G;  1KTK A;  5EKI A;  4DV1 L;  4DR2 Q;  3PIP 3;  4LW1 A;  4K2K A;  3L7Z C;  2MPM A;  3PV0 A;  4LFA Q;  1MSG A;  3VA5 A;  3I4M H;  4RGT A;  4MIU A;  3GTO B;  1DYQ A;  3VYR A;  1I4G A;  5LMU L;  1KXL A;  1WOC A;  4X65 L;  1Y8N B;  4JBW A;  2IX1 A;  5COR A;  3IRB A;  4K8I A;  4LF5 Q;  1CZW A;  4DA2 A;  4DV7 Q;  3CD6 A;  3AFQ A;  1STA A;  1TWG H;  3FKI H;  1E0B A;  2R93 G;  3EVQ A;  4CJ1 B;  1TII D;  1IXR A;  2JE6 I;  3I4N H;  3D3R A;  4UP9 A;  3BDC A;  3MVV A;  4EQ5 A;  1STH A;  4K2L A;  4ZLT F;  1S72 A;  4DKA C;  1SE4 A;  3I70 A;  2K1B A;  4I7Z C;  3QWN A;  4HTH A;  2LXJ A;  4IUT A;  1UE1 A;  5ISR A;  1EYC A;  3KBG A;  3SK8 A;  2BE5 C;  1UNS A;  1JB7 A;  1JWU D;  3PUZ A;  4A93 G;  1XYI A;  2CWA A;  1GO3 E;  4PZ7 A;  1PLF A;  5IT9 c;  4RG1 A;  4Y7N B;  4WJW A;  2XGT A;  2NB0 A;  2JA6 B;  2QDB A;  1EIF A;  2WKD A;  5I9O A;  3L0O A;  3ULL A;  4QIW E;  2RF4 A;  5DAU A;  5C4X G;  4OWX B;  1FL0 A;  3I7F A;  1B3Q A;  5M5X B;  2L12 A;  4JI0 Q;  1HNW L;  1I4X A;  2R92 H;  1UAP A;  1W6J A;  1J9O A;  1YI2 A;  1PH9 A;  4HJ8 A;  1PYS B;  1PVO A;  1L0W A;  2JK8 A;  2UUC L;  1JE4 A;  1VQ8 A;  4V0B A;  4JI3 Q;  4HJ5 A;  3A8K E;  1PFS A;  5C4H A;  4GOP B;  3H0G B;  1ZYR C;  3K8A A;  3S1Q H;  3UDG A;  4M8A A;  3MHB A;  4C3H B;  3MFG A;  4A3G B;  1G6P A;  3Q8D A;  3BVG A;  1S3O A;  3TZU A;  3HOX G;  1KD1 C;  2VW9 A;  2I5L X;  2K4K A;  3CKI B;  4BXX H;  4A3C G;  4FF1 A;  4ULL A;  2AWO A;  1I50 H;  2CQA A;  3K5L A;  1EWC A;  2MO1 A;  3CPF A;  1X32 A;  2LSS A;  2B8F A;  3NWT A;  1B8A A;  1TWF B;  2I5H A;  2YU9 H;  3U4V A;  1P16 A;  1CKO A;  5CMD A;  2A8V A;  5EKL A;  2UU9 L;  3D31 A;  4NP5 A;  1YIJ A;  2F4I A;  1WYD A;  1EQT A;  5IYC G;  2L9H A;  1Y1W H;  4JI5 Q;  4DV3 L;  3DWA A;  4JOI A;  2OQK A;  4JI8 Q;  3QR8 A;  1ZKO A;  3ULJ A;  3LGJ A;  5FKA C;  5ELN A;  4A3J G;  2A69 D;  5KNB A;  1UEB A;  3NEL A;  2JEA I;  4OXP A;  1IBK Q;  2IT1 A;  1OXT A;  2WP8 J;  3I72 A;  3SK5 A;  1BDO A;  2E75 C;  2KCC A;  1HR0 Q;  4X3K A;  1JCK B;  4DV4 L;  2I0Q A;  1Z9F A;  4BBS H;  3CMA A;  2OWO A;  2N8N A;  2HD3 A;  3GDE A;  5K36 H;  2F0P A;  1SXT A;  1RF2 D;  1TT2 A;  1HZA A;  1MIU A;  1D5M C;  3J7Y W;  1W2B A;  3T1Y Q;  2DNC A;  2K7V A;  5KND A;  3OIP A;  1EY5 A;  4G7H C;  3RZO H;  4RCN A;  1X56 A;  4XQJ A;  4R4Q A;  5JPM C;  1LTT D;  2PPB C;  5DM7 3;  4PZ6 A;  1Q1E A;  2WAC A;  4RHS A;  2RDG A;  1GUW A;  2B2Y C;  3JAM c;  2GA4 B;  1SE8 A;  4B3T Q;  3M85 A;  4B3M Q;  4G7O C;  5E7N A;  4CKC A;  1D7Q A;  4JYA L;  3OTO L;  4GN4 B;  4DR7 L;  1DD2 A;  1MJC A;  2TSS A;  1L2F A;  3P75 A;  1DGS A;  2NVY H;  3OSO A;  4DAY B;  3MEH A;  3AYH B;  1RIP A;  1JJG A;  4C3I B;  1W6K A;  2ATW A;  1N36 Q;  1A2U A;  5M9O A;  4QCL A;  2B2U C;  4OO1 H;  1D6E C;  4HMI A;  3B6Y A;  3RNU A;  1QCB D;  5FLM G;  5D3D A;  5T1I A;  1EQQ A;  2K33 A;  4A93 H;  2B63 B;  5BN5 A;  2VUM H;  5IT9 L;  1UWV A;  3GTP B;  3MXP A;  2OTL A;  3BU2 A;  4DUZ Q;  3GTQ H;  4A4I A;  1HNZ L;  4O1N A;  1EFW A;  1WTH A;  4HIO A;  2E2H H;  1AN8 A;  4OX9 L;  1TY0 A;  5IGF A;  2UXB L;  1MD2 D;  4ZUJ A;  1I3Q H;  1XTD A;  2KA7 A;  1ESF A;  2A69 C;  1JT8 A;  2F0M A;  3KUP A;  5EKK A;  3PSI A;  1LT6 D;  2LS0 1;  3S16 H;  1XPR A;  1PH8 A;  5J39 A;  3J7A 5;  2K75 A;  4LF8 Q;  3DEP A;  1N8R C;  1JJC B;  1QB5 D;  2Q8T A;  4P2C B;  4X64 L;  1A3T A;  5ELC A;  2BDO A;  2RVL A;  2VL6 A;  5M3F G;  4DR5 Q;  5IOD A;  2EY1 A;  3NPP A;  2V4D A;  3CCQ A;  1EY8 A;  1EQV A;  1E7Z A;  1WD0 A;  3I73 A;  5EAY A;  4A3C H;  2P5Z X;  1N9W A;  1U9R A;  2XVS A;  4GN5 A;  4U68 A;  1RKN A;  2FIN B;  2EPB A;  4R8N A;  3G4S A;  2WAQ E;  1HZ9 A;  5FLX c;  4A3D B;  1H9M A;  1VQL A;  2ZTE A;  2O2L D;  4A3L H;  2ENB A;  3OYY A;  4NXN Q;  4DN4 M;  1PZJ D;  4HCE A;  1RL2 A;  4HJA A;  3IFT A;  5HGQ A;  3MC0 B;  1SE3 A;  2DJG C;  3U9S A;  3KLS X;  1A63 A;  3R3O A;  2L55 A;  4TRD A;  3GTJ H;  4OWT B;  4A3J H;  5E3F A;  2XIW A;  1BBW A;  2JYO A;  4K5W A;  4LF9 Q;  3BYT B;  5I6Y A;  1QIL A;  3ONA B;  2Z0S A;  4BY7 B;  2Q2T A;  1I6V C;  2F0I A;  3HGB A;  4A3K H;  2FFK B;  3S15 H;  1NUC A;  1X65 A;  3K5N A;  3AB9 A;  3OOC A;  1IYJ B;  4X62 Q;  4LFB L;  4C3J H;  3VR6 A;  2EE1 A;  5FJ8 G;  1LTS D;  4XXE A;  4GKJ Q;  4A3G G;  1NNX A;  2A73 B;  4IUV A;  4KD3 A;  5HGT A;  4DR2 L;  1VF5 C;  1Z6H A;  3SK4 A;  3PUX A;  5E4W C;  1K0R A;  1X3P A;  4J8Q A;  1QNU A;  1GUG A;  3DM1 A;  2M9V A;  1EIG A;  2B3G A;  2X6L A;  4NKL A;  3GTM H;  5GAE C;  1ENF A;  2E5L L;  1BXT A;  2QIL A;  5C3E G;  2NTS A;  3GTL H;  4KHZ A;  3JAM L;  3S1R B;  2YV5 A;  1U4R A;  1U4L A;  3HKZ G;  5LMN Q;  4ZQ3 A;  1JR0 D;  5IIF A;  2YTY A;  3M3Y H;  2K5W A;  2RDH A;  5FK9 C;  3T1H L;  5L37 A;  4ABN A;  1PV4 A;  4N8X 1;  3SK6 A;  2I07 B;  5CBE E;  1Y8P B;  2MNA A;  1HUM A;  2YTV A;  1VQO A;  1Q3L A;  1C7Y A;  2EYL A;  1S5C D;  1VQA A;  1K3B C;  1Y8O B;  1M90 C;  3RMH A;  5T1G A;  1ESR A;  1O7Z A;  1ASZ A;  3M7G A;  1PFB A;  1QE6 A;  3AQQ A;  4YCV A;  2KHJ A;  3WWV A;  4FF2 A;  3T51 B;  4CJ2 C;  4FYD A;  1V9P A;  1YNN C;  2B2W A;  4X3S A;  3GTO H;  3EBE A;  2OF1 A;  2CWP A;  3T53 B;  2DY7 A;  2EYP A;  4FVM A;  4O2D A;  3S2H B;  3HZX A;  4EX5 A;  4L5S A;  3RLN A;  4JI4 L;  1GVP A;  4JI1 Q;  1PZK D;  2F0F A;  4CKE A;  4JI3 L;  1IBL Q;  4A3I B;  5DM6 3;  3RUZ A;  1HZC A;  3R8B A;  4AH6 A;  2JA5 G;  2FXQ A;  2SEB D;  2ZXR A;  4DR6 Q;  3DWP A;  2WIN B;  5I6W A;  4C2M B;  3PO2 B;  1SEB D;  2DGY A;  1TQO A;  2NVT B;  1SYB A;  5E4X A;  3HEJ A;  3CCJ A;  1OXS C;  3H94 A;  2UUA L;  3NXW A;  2PI2 A;  4QY7 A;  3G6E A;  1R9T B;  1RTN A;  2CW0 D;  2F0E A;  1VQP A;  1AEX A;  3PF4 A;  1FD7 D;  4QL5 A;  3E5S A;  5FLX L;  3KYH C;  1EWI A;  4Y7N H;  3D0F A;  1YIT A;  3JAM E;  1TVX A;  1X6O A;  5JPN C;  2JA6 H;  1NMG A;  4DR4 L;  4KN7 C;  1SRO A;  2K01 A;  2RKS A;  1GXD C;  3LWU A;  3C3L A;  1KDC A;  1VQH A;  1QNK A;  4JOI C;  5M5X H;  1EZ6 A;  4FF4 A;  4POF A;  3FDT A;  1L1O B;  4LFC Q;  2EZV A;  4CDE C;  1V43 A;  4FXG C;  1WCM G;  1PMR A;  4IAL A;  4FXK C;  2K32 A;  3H3V I;  1HCZ A;  4KHP Q;  3H0G H;  3QIA A;  5GQO A;  3CXC A;  3K57 A;  2CVR A;  5CV6 A;  4C3H H;  5FJ8 H;  1PH7 A;  1OXX K;  4A3G H;  3HOX B;  1VQK A;  4CGY B;  1SYE A;  5C0X J;  4DV6 Q;  2MFI A;  3Q24 A;  2K5H A;  2HHH Q;  2QEJ C;  1N32 Q;  1B4O A;  4KY6 A;  3TQY A;  1I6H B;  1XMQ Q;  3PIO A;  4NB3 A;  1TWF H;  2B2T A;  3ZJY C;  3X3N A;  1JWM D;  2Z1C A;  3H6M A;  1RCV D;  4MZ9 A;  4GN3 B;  1QVF A;  5JJI A;  2MO0 A;  2HCC A;  1I4Q A;  2G9D A;  1LLR D;  2E76 C;  4BA1 I;  3X3M A;  1QUQ B;  1TWA B;  3NUC A;  1K73 C;  2ALY B;  3CRL C;  1FJG L;  5IY0 A;  4H7B A;  4K6L A;  1AE2 A;  3D4D A;  1N36 L;  2NVQ B;  2ZT9 C;  1O7I A;  3HOV B;  2CW0 C;  4BY7 G;  2PQA B;  4AQY Q;  2PO4 A;  1LAC A;  4HIK A;  5KGU A;  2F0L A;  1NCV A;  1CHP D;  3Q22 A;  2RBM A;  3CCE A;  1ILP A;  2QDL A;  4LK1 C;  3JAM i;  3PQI A;  4IPH A;  5FLX E;  1BCP F;  2OT2 A;  4DV0 Q;  1IHZ A;  2CH4 A;  3EN2 A;  1C8C A;  5EPJ A;  4DK6 C;  2K05 A;  2AWN A;  4HN7 A;  4DK0 A;  3SR1 A;  1JB3 A;  1QUQ A;  2F4V L;  2VQE L;  5JEA G;  2NN6 H;  2R6G A;  1KNA A;  2Q8R E;  1XNQ Q;  1A8V A;  5GAD C;  2Y0S E;  1LT4 D;  1IL8 A;  4A3E G;  2EXD A;  3F2C A;  1YZ6 A;  1KQS A;  1KHI A;  2OCE A;  3J81 c;  3NEM A;  4AIM A;  1EY9 A;  4IUR A;  4PNY A;  4BY1 H;  3NBH B;  2CH4 W;  2YTX A;  1HH2 P;  4DR5 L;  4LMQ D;  3FEW X;  3CCL A;  4MN3 A;  3FPP A;  4C3I H;  1CUK A;  1D2B A;  3E3X A;  5FO8 B;  2HUG A;  1O7Y A;  3G48 A;  4RCO A;  1HA6 A;  1H9J A;  1X3Q A;  1EWH A;  4EGV A;  1G2S A;  2F0D A;  4RA8 A;  4Y52 H;  1JOK A;  2QKI C;  4TKO B;  1Q82 C;  3OIQ A;  2B63 H;  3NP8 A;  4QB4 A;  3GTP H;  2SOB A;  1LM0 A;  1SFO B;  3HRZ C;  3OMC A;  1MI2 A;  4IFD J;  4HJ9 A;  2PQE A;  4K5X A;  1WTO A;  5IYD H;  3T56 B;  3BZC A;  1J5E Q;  1N33 L;  1LTR D;  5GAG C;  4F8M A;  2JA8 B;  3PGZ A;  3I8Z A;  1LTI D;  4K0K Q;  1I4P A;  1EIY B;  4A3I G;  5M3F B;  2AHO B;  2EJF C;  4DV2 Q;  4JVZ A;  2KED A;  1Y1V G;  4O42 A;  1VQ7 A;  3BDO A;  1II3 A;  4DR1 L;  5CC4 A;  2KCN A;  1K8A C;  1JOO A;  1ENA A;  4GKJ L;  1EEF D;  3PO2 G;  2A6E D;  2O5J C;  1EY0 A;  5DEH A;  4KJN A;  3FRP B;  4RGM A;  1BVS A;  1HXY D;  5CV9 A;  3VR2 A;  3CU7 A;  2G5D A;  4RMF A;  4HMJ A;  3UE0 A;  1E2Z A;  1LT5 D;  1AFP A;  3S24 A;  4A3D H;  1VQ6 A;  2B2V A;  2C35 B;  2NBF A;  1LT3 D;  3OPO A;  4KLK A;  1B53 A;  3AFP A;  4XYO A;  4CJ0 B;  5LMN L;  1JMC A;  3NWS A;  1JC7 A;  1PYB A;  3C1F A;  3MFY A;  1MJE A;  1SAP A;  3HOZ G;  4JI7 L;  4IUN A;  1FVI A;  1TS5 A;  4N9P A;  1STY A;  3KK7 A;  1HR0 W;  4BY7 H;  5LHY 1;  4A3B G;  4FO2 A;  4QF4 A;  4L8J A;  2F0T A;  4UP7 A;  4ZRZ A;  1I94 Q;  2BA0 A;  1FYC A;  2EYM A;  1C48 A;  4LWC A;  2EDG A;  2ZM6 Q;  3VYS A;  3NBI A;  1AP0 A;  2AQ3 B;  4IFD I;  4TSS A;  2O4X A;  3EJI A;  4F7X A;  3AEV A;  4KV6 A;  4DXF A;  3TSS A;  1XNR Q;  5JEA H;  2B2W C;  4KTA A;  2AQ2 B;  2A68 D;  5C3E B;  1J8I A;  1VQG A;  4GOP A;  3V05 A;  4JI1 L;  1VQ9 A;  1HQM C;  1YHQ A;  3T4A C;  2HIX A;  3HKZ B;  3I90 A;  4KD4 A;  3S1R H;  1A3U A;  1F2M A;  1PH4 A;  3QG1 A;  2ES2 A;  4LF4 L;  1CSQ A;  1FR3 A;  1HZB A;  3TEH B;  3J81 L;  5IGD A;  2F0U A;  2QA4 A;  4IPC A;  3CP0 A;  4DR6 L;  3AU7 A;  2Q2I A;  2DNE A;  4XDX A;  2MGS A;  1GHJ A;  2CCZ A;  2SDF A;  1E22 A;  5KYL A;  3I91 A;  4Q5V A;  5EPK A;  2F0Q A;  4IUP A;  2K5D A;  5HUR A;  2AKW B;  3E9H A;  3HOV G;  3MXG A;  3RZD H;  4P74 A;  4JBM A;  2I5M X;  4O0A A;  1D1K A;  2E2D C;  3CME A;  2EYF A;  3NTI A;  3BYY B;  4KJO A;  4XIG S;  5KYI A;  4A75 A;  5IP7 H;  3I4O A;  3M7N A;  3ERO A;  2MHV A;  1E24 A;  3F2U A;  2VB2 X;  5I9P A; 
#chains in the Genus database with same CATH homology
 1C4Q A;  3GTK B;  1DOK A;  2PMZ B;  4ID6 A;  1SDF A;  1NSN S;  2JEB I;  3K59 A;  3CQZ B;  2ICE C;  2XWJ B;  2R7Z B;  2JA5 B;  4B9X A;  4IFD G;  2AUJ D;  5D65 A;  1H9S B;  2L4N A;  1H9R A;  4RKL A;  3QJY A;  1T5E A;  4BBR B;  4I65 A;  1HFN A;  2KJX A;  2D62 A;  3C1E A;  1OXU A;  2LY7 A;  3S1M B;  1TS2 A;  5C5L A;  3SHL A;  1LV9 A;  1BCP B;  1QJO A;  2A68 C;  1SE2 A;  3D4W A;  1Z7T A;  5A2Q L;  4OIK A;  4ME5 A;  5CV5 A;  2B2T C;  3LNN A;  3R2T A;  1PRT D;  1STG A;  3LWE A;  4ZUI A;  4KKS A;  1H9S A;  2IWH A;  4CBV A;  2FMM A;  4DAY A;  1UEA B;  5C5M A;  1WTW A;  4LJZ C;  2XSC A;  1WCM B;  4E6I A;  1DOM A;  1WTV A;  5E1F A;  1S5D D;  1JIC A;  4H0L C;  1OO9 B;  3Q23 A;  3BG3 A;  4PMB A;  2D9U A;  1G8Z D;  2EVB A;  1CFM A;  5CGK A;  4Z9C B;  2XRQ D;  1NR4 A;  2BA1 A;  4EQP A;  4YIJ A;  2KUM A;  1DJR D;  4V19 0;  5KEE A;  5G3L F;  3W2D A;  2SNS A;  1KDA A;  4KN4 C;  3M4O B;  4MHE A;  5C4Z A;  3S2D B;  3I4N B;  3QB3 A;  4B08 A;  2WII B;  1CA6 A;  1WVL A;  2LMC B;  3HOU B;  1WTR A;  1PRT F;  1ZEQ X;  4XQN A;  1SNM A;  2KVM A;  3NTH A;  4KHV A;  4XT3 B;  3G7L A;  5I2Y A;  3K5M A;  4C1N I;  1EY7 A;  2I46 A;  2AUK A;  1G2T A;  5I2X A;  1IYV A;  3OHX C;  3SVM A;  2Z4H A;  2FJ2 A;  2BCO A;  4G4K A;  5NUC A;  3M4Y A;  1M4V A;  3PIO 3;  5D14 A;  2XWB B;  5I4D A;  1CQF A;  1NAP A;  3I4L A;  5IT9 E;  3U9O A;  2E2I B;  3S17 B;  1RHP A;  3V96 A;  2JXM B;  1SND A;  1F77 A;  3KLR A;  1R4P B;  1HRJ A;  4ILW A;  2EJM A;  5CV4 A;  2F0W A;  1WTP A;  1PTO F;  4A3E B;  3PUW A;  4RHR A;  1VMP A;  1O80 A;  3SDZ A;  1DOL A;  2KEC A;  5M5W B;  4DF7 A;  1HQR D;  2PZU A;  1JOQ A;  1XXG A;  2ZXO A;  1V1O A;  1GOZ A;  2A74 C;  4J6H A;  1U4M A;  3QOL A;  3PMF A;  1CM9 A;  3RLF A;  2N88 A;  3H09 A;  1SYF A;  3K7A B;  3GV6 A;  3D8G A;  2B2V C;  2M00 A;  2LKV A;  4UAI A;  4B9W A;  4KMU C;  1S4Z A;  1UUP A;  1EOT A;  1BR9 A;  3W3A A;  1ICW A;  3I3C A;  5CYU A;  4K14 A;  1SYD A;  5CR3 A;  4XYQ A;  2WB1 B;  4C56 C;  1EIH A;  1YNJ D;  2H4O A;  4DK1 A;  4DU9 A;  4CHT B;  1K8O A;  1Y1V B;  1JWS D;  4CKB A;  1TKW B;  3E6Z X;  3NQT A;  1TY2 A;  2NUC A;  1LTB D;  4OIJ A;  3PO3 B;  2YYZ A;  1PFN A;  2DN8 A;  2IX0 A;  5D3I B;  3IL8 A;  4U67 3;  1B50 A;  3Q0A A;  3NQI A;  4NDX A;  1I4R A;  1T5X D;  4N9T A;  4K5V A;  4PMC A;  4XQQ A;  1A15 A;  4HAE A;  1DCZ A;  3EA6 A;  5EJW A;  1BNZ A;  3DEO A;  3S1N B;  3HOZ B;  4FP5 D;  1WD1 A;  4X3U A;  1RTO A;  1XX8 A;  3P7J A;  4A3B B;  2F0H A;  1BCP D;  3GQB A;  3DXJ C;  5AFW A;  1ZXT A;  2F1M A;  3V2T A;  1DZ1 A;  1S5F D;  2B39 A;  1Q90 A;  2AQ1 B;  2PW5 A;  2M2L A;  1FNV A;  3NE5 B;  2QF7 A;  1GUS A;  1ONL A;  5M5Y B;  1F2Y A;  5CV8 A;  1EZ8 A;  1EEI D;  3C2P A;  3J7A F;  4HSP A;  2MJ8 A;  3E0J A;  4EVO A;  1EY4 A;  4H44 C;  4UDU C;  3D4R A;  5IOC A;  4EQN A;  1QWY A;  1L0Y B;  4OGQ C;  2NYZ D;  2KQ3 A;  3Q6S A;  1SMY D;  3L3O C;  1CHQ D;  2F0O A;  4ODG A;  1AW7 A;  4DFA A;  3DHQ A;  4HED A;  1TS3 A;  3A8I E;  2RSO A;  1U4P A;  3VR5 A;  1KLU D;  4QUC A;  3R2I A;  1STB A;  1TU2 B;  1XTC D;  5C3X A;  2ID0 A;  2SNM A;  2JA7 B;  3K58 A;  1GUN A;  3CRK C;  3R93 A;  2PZW A;  4ZK9 B;  3OWE B;  3NHH A;  2NWG A;  4A3K B;  3ITP A;  4DGZ A;  1JOR A;  3CHB D;  4BA2 I;  3VR3 A;  1CK1 A;  3FVQ A;  2E2J B;  2R3Z A;  5EBD A;  1PRT B;  2EYJ A;  5IGB A;  2J7Z A;  3GV3 A;  3SE0 A;  2XN9 C;  4JK1 C;  2KHS A;  1M8A A;  1BCP C;  1EYD A;  1AZP A;  5KNC A;  5CV7 A;  2BE5 D;  2X6G A;  1STE A;  2A6H D;  5C0X I;  5ELB A;  1GHK A;  4OO1 I;  1IYU A;  4FF3 A;  2ICI A;  4A3F B;  1LTG D;  4AYB B;  1VCI A;  3A56 A;  2IW3 A;  1TS4 A;  1BBX C;  1Q8I A;  1CTM A;  2J0T D;  1PTO B;  1PYW D;  4IQZ A;  3NBH A;  2F3V A;  3KBX A;  3GP7 A;  2K28 A;  3LX0 A;  5C4J B;  2JSO A;  5K36 G;  1K83 B;  2PZT A;  1EYA A;  1S5E D;  2Y0S B;  4DNT B;  3HOY B;  2C5C A;  5C44 B;  4EQO A;  4FNF A;  4K8J A;  3SEB A;  1PFM A;  1BQQ T;  3TN2 A;  1ET9 A;  3J80 L;  3IFD A;  3NSW A;  1TWH B;  1GJX A;  2QCP X;  4G7Z C;  3D6W A;  1PDQ A;  5BN3 A;  3ND8 A;  5M3M B;  5C0X G;  3VYT A;  4WRD A;  1MSH A;  4OO1 G;  3FPU B;  5DNF A;  2PCF B;  3HS0 C;  4RKB A;  1EU4 A;  2EY2 A;  2A6H C;  1F2Z A;  3A55 A;  3MXU A;  2F0S A;  3UI2 A;  3GTG B;  4RGN A;  1DON A;  5C3W A;  2VXW A;  5F2D A;  3PUY A;  3H3V C;  3MWY W;  4FXD A;  1V8Q A;  3OWF A;  2RSN A;  1VDZ A;  1SNQ A;  3MXN A;  4OHJ A;  4KY7 A;  3VA7 A;  1HTP A;  3HOW B;  2XRS D;  1TWC B;  2HDM A;  3PUV A;  2D5D A;  2N55 A;  3TP5 A;  1O7L A;  5J22 A;  1F9Q A;  3T13 A;  2H1E A;  1SSO A;  1F9S A;  2IJ0 A;  2WV6 D;  2JP1 A;  3EQL C;  5TSS A;  1LAB A;  2NVX B;  1QG7 A;  4TQU S;  2EOT A;  1B9M A;  4NW2 A;  4QIW B;  2A5H A;  2R61 A;  3DUZ A;  4LAA A;  3J80 E;  2A6E C;  1WTX A;  4A3M B;  1GUO A;  2F3W A;  2X69 A;  1LO5 D;  1EU3 A;  3GD7 A;  3S14 B;  3GO5 A;  4R9W A;  2IX3 A;  2L5T A;  3BDL A;  3NTK A;  1AZQ A;  5FO9 B;  1FGB D;  1DM0 B;  3ERQ A;  1O78 A;  1HA5 A;  1A2T A;  3NK9 A;  5JOB A;  1V1P B;  4ZAI A;  2RQX A;  1B9N A;  4C3J G;  1EFI D;  5LL6 S;  1B3A A;  3EFX D;  5A35 A;  2EYO A;  3T16 A;  5CBA E;  1DXM A;  3HG9 A;  4WFN 3;  4ZKC B;  1Z47 A;  5G3L D;  1RD9 D;  3MA2 B;  2EY5 A;  5EPL A;  3RD4 A;  2VB3 X;  4K6D A;  4RH6 A;  5K5P A;  1V1P A;  2HQE A;  4BY1 B;  3MZ5 A;  4DNR B;  1F2L A;  5ELD A;  2WKC A;  5ELE A;  1STN A;  5C0X H;  1E2W A;  1Y69 U;  3DWQ A;  3TP6 A;  1ET6 A;  4IN3 A;  1SJH D;  4M1U B;  3J81 E;  2VNU D;  1G6Z A;  1E2V A;  1HHV A;  2KOL A;  2TMP A;  4KK7 A;  5FOB B;  2KEE A;  1IKL A;  2Z8L A;  3BS1 A;  3I4M B;  1L0X B;  4KKU A;  3ZYY X;  3MAQ A;  2EJG C;  4HSV A;  3TP7 A;  5KRU A;  2BDN A;  1ILQ A;  3TP8 A;  5ELF A;  1TWG B;  3FKI B;  1CT1 D;  1G29 1;  3TBI B;  1PTO D;  1HUN A;  3BVZ A;  4QUF A;  2CHB D;  2NTT A;  3HP3 A;  1K8M A;  3WOE A;  1D1I A;  4RWS C;  2ZXP A;  1ROD A;  1KNE A;  2EYH A;  3S9W A;  1HFG A;  2L0C A;  2PNR C;  4IZ8 A;  3BZD B;  3C46 A;  1IW7 D;  2XNA C;  1MBY A;  1H9K A;  4F88 A;  2R92 B;  5A2Q E;  1YNN D;  1PRT C;  3WDN A;  3D6C A;  3K5O A;  1SNP A;  1A3V A;  2OXP A;  5IGE A;  5BN4 A;  4RGO S;  2B8G A;  2Q8I B;  3S1Q B;  1F9P A;  2NN6 I;  4RFB A;  4KKT A;  4IUQ A;  1BOS A;  1D5X C;  2L11 A;  2EXZ A;  4WOR A;  3TDQ A;  4C3H G;  1S5B D;  1BO0 A;  2WAQ B;  1I50 B;  5LL6 X;  1SNO A;  4IFD H;  1VF7 A;  4BS9 A;  3AMU A;  2F0G A;  2YU9 B;  4R8I A;  1KAB A;  2J4X A;  3SXH A;  4Q0F A;  4GZY C;  3IKJ A;  1PTO C;  1Y1W B;  3K0Y A;  4PQX A;  1EY6 A;  1B1Z A;  4XT1 B;  2Z4I A;  3P20 A;  5JAV A;  1R4Q B;  3QO2 A;  3K6O A;  4NMZ A;  3RZD B;  1PTO H;  4BBS B;  3WOF A;  1JQY D;  1VMC A;  1IW7 C;  1HPC A;  5JEA J;  2OEO A;  3VYU A;  1A6X A;  4S3S A;  4HCS A;  2FMC A;  2K03 A;  2K6A A;  2LFN A;  3QOJ A;  1KLG D;  3RZO B;  1NR2 A;  3A54 A;  2MUY A;  4J1M A;  2MP1 A;  1KAA A;  2NN6 G;  3A7L A;  4C1N K;  4H13 C;  4DAP A;  4F87 A;  2K5Q A;  1FNU A;  4BWG B;  2R93 B;  4L63 B;  2NVY B;  3N52 A;  1F9R A;  3IAY A;  4C3I G;  3G6J B;  4L6T B;  2NZ1 D;  1SBB B;  4A93 B;  5IGG A;  1PZI D;  1TR5 A;  1LTA D;  2K04 A;  2VUM B;  1Q1B A;  3GTQ B;  2F03 A;  4HR7 B;  2L1B A;  5C4X B;  2E2H B;  4QMG A;  2F0N A;  2HDL A;  1I3Q B;  1RJT A;  4OL7 A;  5EGT A;  5C6A A;  3J7A V;  2F0J A;  4PV1 C;  2PW7 A;  3S16 B;  2B2Y A;  1I4H A;  2RDF A;  1G91 A;  3O13 A;  5KIX A;  2O5I C;  1CA5 A;  1PXU A;  2FHT A;  1WTQ A;  1IKM A;  4PMW A;  2C9O A;  3URY A;  3A7A B;  1B2T A;  1ENC A;  1CZG A;  3L9A X;  1SYG A;  1YNJ C;  5JVH 3;  1SYC A;  2B2U A;  1B44 D;  1RDP D;  3OMG A;  1XWE A;  2IPK D;  2D2C C;  1EL0 A;  3ND9 A;  2IL8 A;  2BOS A;  5COY A;  1BUV T;  1ML0 D;  4KI0 A;  3TZD A;  4DAV A;  3GTJ B;  2EY6 A;  4A3J B;  1HTL D;  3KF8 A;  1SJE D;  1Q12 A;  2PYK A;  1BF4 A;  1MGS A;  2F0K A;  3H91 A;  1QOH A;  3S15 B;  3VR4 A;  1KDB A;  5EBC A;  1GUT A;  3OW7 A;  4C3J B;  2DY8 A;  1CQV A;  2HCI A;  2RA4 A;  3FMC A;  4DXG A;  5EQ0 A;  4ZKB B;  3GTM B;  5IGC A;  3BVM A;  4KY5 A;  3GTL B;  4G57 A;  2E74 C;  1D5Z C;  3DMU A;  4X3T A;  4IUU A;  3M3Y B;  4ZYS A;  1FNW A;  1SNC A;  3A8J E;  2F0V A;  3N6R A;  3KLS A;  3P1H A;  3MTS A;  1OXV A;  5JVG 3;  1SMY C;  1ZYR D;  5J1Z A;  5JJZ A;  4RAU C;  1CI3 M;  5FO7 B;  2G9H D;  3TME A;  4XTC S;  1KTK A;  5EKI A;  3PIP 3;  4K2K A;  3L7Z C;  2MPM A;  3PV0 A;  1MSG A;  3VA5 A;  4RGT A;  4MIU A;  3GTO B;  1DYQ A;  3VYR A;  1I4G A;  1Y8N B;  4JBW A;  2IX1 A;  5COR A;  4K8I A;  1CZW A;  4DA2 A;  1STA A;  1E0B A;  3EVQ A;  4CJ1 B;  1TII D;  2JE6 I;  3D3R A;  3BDC A;  3MVV A;  1STH A;  4K2L A;  4ZLT F;  1SE4 A;  3I70 A;  2K1B A;  4I7Z C;  3QWN A;  4HTH A;  4IUT A;  5ISR A;  1EYC A;  3KBG A;  3SK8 A;  2BE5 C;  1UNS A;  1JWU D;  3PUZ A;  1XYI A;  1PLF A;  4Y7N B;  4WJW A;  2NB0 A;  2JA6 B;  2QDB A;  2WKD A;  5I9O A;  5DAU A;  5M5X B;  2L12 A;  1I4X A;  1UAP A;  1W6J A;  1J9O A;  1JE4 A;  4V0B A;  3A8K E;  5C4H A;  3H0G B;  1ZYR C;  4M8A A;  3MHB A;  4C3H B;  3MFG A;  4A3G B;  3BVG A;  3TZU A;  3CKI B;  4FF1 A;  4ULL A;  2AWO A;  2CQA A;  3K5L A;  1EWC A;  1X32 A;  2B8F A;  3NWT A;  1TWF B;  5CMD A;  5EKL A;  3D31 A;  4NP5 A;  2F4I A;  1EQT A;  2L9H A;  3DWA A;  1ZKO A;  5FKA C;  2A69 D;  5KNB A;  2JEA I;  2IT1 A;  1OXT A;  2WP8 J;  3I72 A;  3SK5 A;  1BDO A;  2E75 C;  2KCC A;  4X3K A;  1JCK B;  5K36 H;  2F0P A;  1SXT A;  1RF2 D;  1TT2 A;  1D5M C;  3J7Y W;  2DNC A;  2K7V A;  5KND A;  3OIP A;  1EY5 A;  4G7H C;  4RCN A;  4XQJ A;  5JPM C;  1LTT D;  2PPB C;  5DM7 3;  1Q1E A;  2WAC A;  4RHS A;  2RDG A;  1GUW A;  2B2Y C;  2GA4 B;  3M85 A;  4G7O C;  4CKC A;  1DD2 A;  2TSS A;  3P75 A;  3OSO A;  3MEH A;  4C3I B;  1W6K A;  1A2U A;  5M9O A;  4QCL A;  2B2U C;  4OO1 H;  1D6E C;  4HMI A;  1QCB D;  5D3D A;  5T1I A;  2K33 A;  2B63 B;  5BN5 A;  5IT9 L;  3GTP B;  3MXP A;  4O1N A;  1AN8 A;  1TY0 A;  5IGF A;  1MD2 D;  4ZUJ A;  2KA7 A;  1ESF A;  2A69 C;  2F0M A;  3KUP A;  5EKK A;  1LT6 D;  2LS0 1;  5J39 A;  3DEP A;  1QB5 D;  2Q8T A;  4P2C B;  1A3T A;  5ELC A;  2BDO A;  2RVL A;  5IOD A;  2EY1 A;  3NPP A;  2V4D A;  1EY8 A;  1EQV A;  1WD0 A;  3I73 A;  1U9R A;  2XVS A;  4U68 A;  1RKN A;  2FIN B;  2EPB A;  4R8N A;  4A3D B;  1H9M A;  2O2L D;  2ENB A;  4DN4 M;  1PZJ D;  4HCE A;  3IFT A;  3MC0 B;  1SE3 A;  3U9S A;  3KLS X;  3R3O A;  2L55 A;  4TRD A;  5E3F A;  2XIW A;  2JYO A;  4K5W A;  3BYT B;  5I6Y A;  1QIL A;  3ONA B;  4BY7 B;  1I6V C;  2F0I A;  3HGB A;  2FFK B;  1NUC A;  3K5N A;  3AB9 A;  3OOC A;  3VR6 A;  2EE1 A;  1LTS D;  4XXE A;  2A73 B;  4IUV A;  4KD3 A;  5HGT A;  1VF5 C;  1Z6H A;  3SK4 A;  3PUX A;  5E4W C;  1X3P A;  4J8Q A;  1QNU A;  1GUG A;  3DM1 A;  2M9V A;  1EIG A;  2X6L A;  4NKL A;  1ENF A;  1BXT A;  2QIL A;  2NTS A;  4KHZ A;  3JAM L;  3S1R B;  1U4R A;  1U4L A;  4ZQ3 A;  1JR0 D;  5IIF A;  2K5W A;  2RDH A;  5FK9 C;  4ABN A;  3SK6 A;  2I07 B;  5CBE E;  1Y8P B;  1HUM A;  1Q3L A;  2EYL A;  1S5C D;  1Y8O B;  3RMH A;  5T1G A;  1ESR A;  1O7Z A;  3M7G A;  1PFB A;  1QE6 A;  4FF2 A;  3T51 B;  4CJ2 C;  4FYD A;  1YNN C;  2B2W A;  4X3S A;  2OF1 A;  3T53 B;  2DY7 A;  2EYP A;  4FVM A;  3S2H B;  3HZX A;  1PZK D;  2F0F A;  4CKE A;  4A3I B;  5DM6 3;  3RUZ A;  3R8B A;  2SEB D;  2ZXR A;  3DWP A;  2WIN B;  5I6W A;  4C2M B;  3PO2 B;  1SEB D;  1TQO A;  2NVT B;  1SYB A;  5E4X A;  3HEJ A;  1OXS C;  3H94 A;  3NXW A;  1R9T B;  1RTN A;  2CW0 D;  2F0E A;  1AEX A;  1FD7 D;  3E5S A;  5FLX L;  3JAM E;  1TVX A;  5JPN C;  4KN7 C;  2K01 A;  2RKS A;  1GXD C;  3LWU A;  3C3L A;  1KDC A;  1QNK A;  1EZ6 A;  4FF4 A;  3FDT A;  2EZV A;  1V43 A;  4FXG C;  1PMR A;  4IAL A;  4FXK C;  2K32 A;  1HCZ A;  3QIA A;  3K57 A;  2CVR A;  5CV6 A;  1OXX K;  3HOX B;  4CGY B;  1SYE A;  5C0X J;  3Q24 A;  2QEJ C;  1B4O A;  4KY6 A;  1I6H B;  2B2T A;  3X3N A;  1JWM D;  2Z1C A;  3H6M A;  1RCV D;  2HCC A;  1I4Q A;  2G9D A;  1LLR D;  2E76 C;  4BA1 I;  3X3M A;  1TWA B;  3NUC A;  3CRL C;  4H7B A;  4K6L A;  3D4D A;  2NVQ B;  2ZT9 C;  3HOV B;  2CW0 C;  2PO4 A;  1LAC A;  5KGU A;  2F0L A;  1NCV A;  1CHP D;  3Q22 A;  2RBM A;  1ILP A;  4LK1 C;  5FLX E;  1BCP F;  2OT2 A;  1IHZ A;  1C8C A;  5EPJ A;  2K05 A;  2AWN A;  4HN7 A;  4DK0 A;  3SR1 A;  1JB3 A;  5JEA G;  2NN6 H;  2R6G A;  1KNA A;  2Q8R E;  1LT4 D;  1IL8 A;  1EY9 A;  4IUR A;  4PNY A;  4LMQ D;  3FEW X;  4MN3 A;  3FPP A;  1D2B A;  5FO8 B;  2HUG A;  1O7Y A;  4RCO A;  1HA6 A;  1H9J A;  1X3Q A;  1EWH A;  4EGV A;  1G2S A;  2F0D A;  4RA8 A;  1JOK A;  2QKI C;  4TKO B;  3OIQ A;  3NP8 A;  4QB4 A;  2SOB A;  1SFO B;  3HRZ C;  3OMC A;  1MI2 A;  4IFD J;  2PQE A;  4K5X A;  1WTO A;  3T56 B;  1LTR D;  4F8M A;  2JA8 B;  3I8Z A;  1LTI D;  1I4P A;  5M3F B;  2EJF C;  2KED A;  4O42 A;  3BDO A;  1II3 A;  5CC4 A;  2KCN A;  1JOO A;  1ENA A;  1EEF D;  2A6E D;  2O5J C;  1EY0 A;  5DEH A;  4KJN A;  3FRP B;  4RGM A;  1HXY D;  5CV9 A;  3VR2 A;  3CU7 A;  4HMJ A;  1E2Z A;  1LT5 D;  1AFP A;  2B2V A;  2NBF A;  1LT3 D;  3OPO A;  1B53 A;  4XYO A;  4CJ0 B;  3NWS A;  1JC7 A;  3C1F A;  3MFY A;  1SAP A;  4IUN A;  1TS5 A;  4N9P A;  1STY A;  3KK7 A;  5LHY 1;  4FO2 A;  4QF4 A;  4L8J A;  2F0T A;  4ZRZ A;  2BA0 A;  1FYC A;  2EYM A;  1C48 A;  2EDG A;  3VYS A;  3NBI A;  1AP0 A;  2AQ3 B;  4IFD I;  4TSS A;  2O4X A;  3EJI A;  4F7X A;  4KV6 A;  4DXF A;  3TSS A;  5JEA H;  2B2W C;  4KTA A;  2AQ2 B;  2A68 D;  5C3E B;  1J8I A;  3V05 A;  1HQM C;  3T4A C;  3HKZ B;  3I90 A;  4KD4 A;  1A3U A;  1F2M A;  3QG1 A;  1FR3 A;  3J81 L;  5IGD A;  2F0U A;  3AU7 A;  2DNE A;  4XDX A;  2MGS A;  1GHJ A;  2SDF A;  5KYL A;  3I91 A;  4Q5V A;  5EPK A;  2F0Q A;  4IUP A;  2K5D A;  5HUR A;  3MXG A;  1D1K A;  2E2D C;  2EYF A;  3NTI A;  3BYY B;  4KJO A;  4XIG S;  5KYI A;  3M7N A;  3ERO A;  2MHV A;  3F2U A;  2VB2 X;  5I9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...