5KJ4A

Crystal structure of mouse protocadherin-15 ec9-10
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
228
structure length
228
Chain Sequence
b'MNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADPPGMPASRVRYRVDDVQFPYPASIFDVEEDSGRVVTRVNLNEEPTTIFKLVVVAFDDGEPVMSSSATVRILVLHPGEIPRFTQEEYRPPPVSELAARGTVVGVISAAAINQSIVYSIVAGNEEDKFGINNVTGVIYVNSPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDENDHPPVFLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protocadherin-15
molecule tags Calcium-binding protein
source organism Mus musculus
publication title An elastic element in the protocadherin-15 tip link of the inner ear.
pubmed doi rcsb
total genus 50
structure length 228
sequence length 228
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5kj4A02
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5kj4A01
1L3WA 4APXA 1O6SB 1NCGA 3FF8A 4ZMNA 4ZMZA 1WYJA 2YQGA 2V37A 1NCJA 4XXWA 4NUPA 2OMWB 2WD0A 2OMYB 1SUHA 4OY9A 4QD2E 4ZMWA 4XXWC 4ZMPA 4AXWA 4NUMA 4AQEA 4NUQA 2A4CA 1ZXKA 4APXB 5JYMA 4AXWB 2OMUB 3LNHA 4AQAA 4ZMTA 3K5SA 3LNDA 2OMVB 4NQQA 5KJ4A 4AQ8C 3UBFA 2WCPA 1Q1PA 3QRBA 3PPEA 3LNIA 1EDHA 2YSTA 3Q2VA 4ZMOA 4ZMQA 4AQ8A 2QVIA 4ZMYA 4AK1A 3K6DA 2X2UA 3UBHA 4ZMXA 5CZRA 1NCHA 2QVFB 3LNGA 3MVSA 3Q2LA 1ZVNA 3K5RA 4ZMVA 4ZTEA 2A4EA 3UBGA 4AQEB 1FF5A 2OMTB 3FF7A 1NCIA 4ZI8A 3LNFA 5CO1A 5JYLA 2O72A 4ZT1A 4ZMLA 1WUZA 3Q2WA 2OMZB 2EE0A 3Q2NA 3K6IA 2OMXB 3K6FA 2WHVA 4AQAB 2WBXA 5DZVA 1OP4A 3LNEA
chains in the Genus database with same CATH superfamily
4GP8B 4XCYA 3DTDA 4KKLD 2G9HA 2Y6SD 3DGCR 3BZFA 2B9AA 1O7VA 2DIAA 2O4EA 4ZMNA 5FW8A 2BJMH 4UAOC 2WLYA 3VWJD 3QJRB 4PD4J 1BA9A 4QYOA 4EKJA 3VFWA 1NCDH 3WELA 2YRLA 3UO1H 4XMWA 3QRGH 5BZXA 2FQEA 1WUNT 5I18H 6FABH 2YAPA 1EMTH 2BSSB 1A25A 1RHHA 5G4OA 1BOGB 2VXVL 3S5ZA 5JQ6H 4IKKA 4WK0B 2O6FA 2EXWD 2XWBB 5FYLD 4LOUC 3KH3A 5I6NA 3EO9L 2JQAA 4PGEB 1I4FA 5FO9A 2XWDA 1QUPA 3ARDB 2YQBA 2X4RA 1BOYA 4NWUL 1A9VA 1JGVL 1U8LA 2D31B 1AQDB 3LSOA 3B7UX 5DO8A 1MCNA 3FQRA 3NJXA 1DQKA 1ERNA 1KFGA 1Y0LA 4KK9D 5HP5A 1K8IB 2WCPA 4PJHE 4OZIF 3RIAF 4MAYC 4PJ5B 3CNKA 3UYPA 1VPOH 5TDOB 1NCWL 5GZOA 4F2MB 4K7FB 4RGNC 43CAA 2ESVA 4XN1A 2X4SA 3ZYJA 4EE2A 3OMAB 1IFRA 3E6HB 1NA8A 4XB7A 2DBLL 1WZMA 2IWEA 1BQHA 1IM3B 2Z8SA 3CSPA 5H35B 4DVBB 5CEZH 5IWLC 1P7HL 2P45B 4GLRH 4M7ZB 3P77B 3ISRA 5F2FA 2HLFC 3H3BC 4RFOH 1V7NL 2ZKXA 4GBXA 2C3VA 5MEND 4JG0L 3MYJB 4MD5B 2B1AL 2OTWA 4RGMB 1NDMA 3NABL 5B38A 3KNBA 3QDJA 2FSEB 1KPVA 4L8CB 1EGJL 2VLME 3OR6A 5I0WA 4K9EL 3P3TA 5IFAH 3TA3C 1O9ZA 1WBYB 2OL3B 3PREA 4U49A 5EN2A 1XCTA 5I1DB 3LNFA 3BQUA 4K3JL 5DJDA 1OAKH 3ILPB 1N9PA 4P5TB 4P9MH 2YA2A 1IC1A 1X9RA 3BWAB 2XNAA 3LD8C 4NJ9H 4WWOA 3RVTC 1KN4L 1TU2B 3FONA 5HYSB 5CN2A 4WTXA 2VXQL 4UTBL 2FIKB 3MFGB 4G9FE 3L4VA 1CBVL 4LCWA 3IFPB 4YSQA 3VGFA 3IM1A 3OKOA 3QO0A 4X5XA 4JN2A 3QHTC 3MV9B 5EOQH 3EJSA 2FR4A 2WAQA 4HIIB 5E6RB 4ERSL 2ATKB 1IGYB 3APCA 3QUXC 1IVTA 3BSHA 5D7EA 1BFOA 4BXVA 4L5FL 2JJUA 4J3OF 5CHNA 4GW5A 4U1JB 5I76A 3FCSA 3N50A 4J5VA 1XGQA 1XIWD 2E46A 1NCJA 5DFWH 1H15B 1U8OA 4DN3L 1KJ2H 5HJDA 3HZMA 4Q6YA 5DEGA 4B9KC 1JBJA 2BSED 3H42H 4RGOH 2AXGB 5JNYB 3ATEA 4PJ9C 3I3EA 3VSQA 4Z7IA 3QNFA 4LSQL 2VNCA 1A7OH 3Q2CA 1UJ3B 4CUCA 5C0CB 4XCFL 5I73B 1OAQH 4OKDA 2V5TA 4K94H 3BW9A 4Y4FC 4A68A 1XL4A 3FT0A 3BP5A 2VXSH 3VVVA 3Q5YA 3ARPA 4N2NA 5DMKA 2VDLL 4NGHL 4M3HA 3FTSA 4C56B 4HJJH 5DYOA 5HDBF 1XGPA 2PCFA 5CFAA 1LGVA 4MJHA 1AR1C 5DJAA 3I3BA 2ICWA 4FA7B 5E1IA 1UXSA 3VSVA 1OEZW 4P23B 3D12B 4LP5A 4LCYA 4OQTH 4ZMOA 3CZGA 2VH5H 4XX5A 2BVYA 2N4IA 2XQBL 3QUYB 2F5AL 1MJ7L 1VCBC 2FYVA 5IROD 3SDXE 5FO7A 4PLOB 2DTML 2ZT9C 5DRNA 3NJKA 4L4TD 2MHAA 4EOWL 1CS6A 1UURA 4D0DA 5H8DA 4NQVB 5KWYC 1DQIA 3K5RA 2UWEB 1DSYA 3U36B 5BRZA 2Y5EA 4I48A 3TBYA 1E4KA 2B3RA 4OLZL 1LWHA 5HI4D 1A4KA 3DIFA 3EIFA 1KV7A 4QRTB 3S3SA 5GRUH 5FEBA 3SPGA 3NCJL 1CLCA 1RP9A 4H1LG 3EJQA 5EC1A 4MTMA 1OSZB 2F7QA 5T1LA 2Y5QA 4L48A 1S9YA 5F7LB 2P7TB 1TLMA 1XCQB 2W0FB 3GRBA 1CQKA 1E8WA 2WYHA 1GTFA 4N90D 3IGLA 4H8PA 3VB9A 3OKEA 3CZSA 1P4LA 2DI7A 1DJXA 2AJ3A 2WHVA 3C5SA 4TS6A 3G04B 3VACA 2ENJA 4MHHG 2A73A 1HH9B 2OCCB 4WUUE 3MJ7A 3NSJA 2OS7A 2PXYD 1I8IB 2VL4A 3OLDA 5FWRA 2ZCHL 3E3QC 2RJMA 4NJAH 4Y9GA 4ATTA 1MPAH 4OM0H 4X7SL 4FFYH 2V33A 4Z7UF 1BLNB 1SYSB 2VIRB 1PZCA 3MBED 1E5BA 3T0EB 3VXUE 5EV7A 3BDYH 3NCMA 2DKUA 1NIEA 4JDVB 3NH7H 2AMUA 3VRLF 3GXFA 1ZKAA 3MRBA 4HHAB 5D7LB 3LY6A 3ARED 1PS3A 1E3FA 4GQ9L 4P5TD 2CRYA 4N9OB 2XIIA 3RX5A 2QADB 5I1IH 5D7SH 1N2RB 4TOYH 2CPCA 3N40P 3GQFA 2ADFH 3Q8AA 1O9WA 5FUZL 1HSBB 5F7DA 4PWJA 3LPGA 2E6PA 1ADQL 4EDXA 5KTEL 3IKCB 1A6UH 1UD4A 4PRID 4UM9B 1TQSA 1IC4H 4OLWH 3OZLA 5JXEC 3VSUA 1XF2A 3TEWA 4U6XA 1BVKA 3BJ91 3QR1A 2QTVA 1K8DB 4LNVA 4LHUD 4BK5C 4N0UE 3HE7C 4LDLB 2BSBA 1QBAA 4XXCA 3SDYH 3X3GL 2X3BA 1E4XL 1OW0A 4C57C 2EUWA 4DPRA 2Z31C 3LHAA 2JKNA 5T5FA 4Z7VB 5KVDE 1J0JA 1AOHA 1TIUA 5M95B 4WO0A 1KTJA 1EDHA 3BLBA 3GMOB 4KK9C 3ZE0F 4F33B 4TM9A 3V4UH 4JFED 4Y7MA 2YD6A 1C5DA 3ARZA 3NPSC 4X7EC 4Q7DA 3HZVA 5T1KB 3D85D 2X0VA 5ICUA 4C47A 1TZ8A 5H94B 4ZMYA 1HXMB 3F7KA 4HDIA 4MJ5A 1Z9NA 4QOKD 3TJHC 2EDKA 2EUVA 4NM4L 1DQDH 3GXIA 1AQKH 4OLYH 2AKRB 5I6OA 2EE6A 5ERWB 3WXVL 1I1FA 4FG2A 2Z7YA 4D8PB 1ZT1B 3AT0A 3B8YA 4JQXA 4TUUA 5I1JH 1QPXA 1QFHA 4P05A 3QJOA 3PJNA 2AQSA 2HLAB 2WAHA 1MFNA 2O72A 3QDJB 3ZDZE 3GI8H 1I8MB 2B0SH 3JWOH 4ELMA 4F37F 4NZUL 2A38A 4N2MA 5BRZD 1U3NA 3OJMB 2D3VA 3OJDB 1RJYB 3ZYIA 1PZAA 3UZVB 4DZ8A 4GG6E 2AEPH 3K0WA 4L8DA 2CUAA 1FGNL 1ED3A 2W9EL 4XO9A 2EIMB 2ZXEB 4H8WC 1KCBA 1YUHA 4JKNA 4Y5YB 5DJCA 4P49A 3ARWA 4XXDB 4A38A 4KZ0A 4UUJA 5EEXA 4PJEE 4DGIL 2RIKA 2GSMB 4MYPA 4R2GB 1B4LA 1CF8H 1F3DJ 2B1OA 3BOVA 4JFQB 1FZJA 2CGYA 2EABA 5BS0D 2DQIH 3L5WB 4ZNEA 1E42A 1G1OA 3JT2A 4FFZH 5F7KC 1EGJA 1TEGA 1PY9A 2IPKA 3GHEH 4P46C 3VXOB 5DRZB 1RUKH 3E8VA 4EDWL 2EVJA 4U31A 1E4JA 4MNQB 3TJEL 1ZWIA 3CFDA 4XVJH 2JF1A 1DJWA 2KDGA 2ZICA 1DBAL 2BM3A 4N4YB 4CW1A 1A14H 1QLEH 2BFVH 3D18A 4ICWA 4Q9RH 4ONHA 4YS4A 2IH1B 1SOQA 5ID0B 3ZT7A 3K2MC 3I9GL 1JK8B 1DDTA 5AYUH 5E1HB 4D3CL 3CX5K 1JNNH 1F42A 4OD3L 1XR9A 4OZIB 2J71A 1EJ8A 2Q6WB 2DDQL 2NXYB 2VN5A 3FO0L 3T2PA 3G08B 1X9LA 4FG6D 4S0SD 2VLRD 2IJ0C 3PL6A 2XVGA 1R5IA 1J9QA 3PDOB 2DQFA 4YSTA 1T4KB 1DANT 2CE6A 5FECA 2QLYA 2X05A 3X11B 1MXDA 1ZIAA 2V2WB 2WQVA 3QHZL 3WFBH 2OSYA 5EIIA 4GS7C 2FUTA 4G6MH 5DYOB 2AEQL 3LYRA 3W2DL 5J11B 1T22A 5C0AD 2P48B 1CZ8L 5HHOE 4TYUA 3W9EB 1GY2A 4GP5B 2YPKA 1HEJC 3ARQA 1IGFH 4LVOC 3DMMB 2F8OA 3L7EA 2DQDL 4WFHD 1SXCA 3MV7A 4R26L 3RZWA 3W37A 4PRHD 2F9BT 4GQZA 3SE3A 1ZLWH 1K3IA 1Y07A 1Q72L 5J3HC 1YEHL 4OW6A 1KIPA 2GQHA 1U58A 1UOVA 4LLDB 2V7HB 5KEZA 4IU2A 1EEZB 1K5NB 2MTAA 4W9JC 1CFTB 3U36A 3ARUA 1KPUB 2ZE0A 5K9KA 3PDDA 1U8JA 1EERB 4MA8H 4XP4L 3SKUD 5JYLA 3SQOL 2JB6B 3APDA 5GGRB 4YX2L 3OR7A 3MNWB 1ODAA 2XI9A 2Y06L 3DPDA 2XRAL 3PHOA 2Z8WC 4ODSH 5DJZB 5DD3L 1AOZA 3IFOB 4JHBA 1JF1B 5HGBB 4FEMA 1DBKH 1TENA 2B20A 1VESA 2NUPB 2V3EA 1WTLA 5I19H 5C0DB 3UEZA 1SUJA 1HZHH 4JDTL 2LQRA 4UQ2A 3CVDA 2NSMA 2FB4H 2VMDA 4AUJA 3ZDYF 3VQ2C 4IJTA 2WUCL 3CFNA 4UYPA 1P4LB 1XF4B 2K0RA 3BN3B 3T1FB 1S5IH 3WIHL 3DTXB 3RUGF 4GJTB 3QIBC 3HPJB 4IK7A 4JCWA 3UBXB 2NR6D 1GC1H 3HIZA 3LX9A 4IBQA 2OLDA 4F8QA 4QLRA 5F7AA 4Z8FH 3TNNA 1AZRA 2XN1A 1TVHB 4KGLA 2FYYA 4ZAKD 1IUZA 3ZTNL 5I1HH 3TF7C 4JKPL 1EFXD 5IJVB 2DLTA 4K55A 4LPVA 4ANUA 2NYZA 4Z7VF 1OAUH 3GNMH 1DVFC 4K7PY 4DKEL 2BRRH 4B9JA 3QNYA 4NKMB 3L3GB 3VFUB 3SDDD 2DMGA 1RZFH 1KACB 4D9LL 1U8PA 3EHBB 4YR6B 5LCVA 3WAKA 4M7LH 1JTOA 2YMXH 4C59B 4E9YA 3HE7D 1OGTA 2EO1A 1ZGLA 2FWSA 4EDXB 3MLVL 1A5FL 3HS9A 2VERA 4OD1H 4YDMA 1UD8A 2N1TE 5CMAB 5E1QA 3NTCH 4WK2B 3IDJB 1WFMA 3PWNB 4DPBX 1G0DA 1KCRL 3BQVA 4FCHA 4Y1AD 2GIMA 4Q6IB 1YJDH 5GRJL 5HDQH 3SJVA 2QELA 2C1OA 2OXHA 3P2TA 2EZ0D 1IGIH 4OLXH 2BY2A 1NCUA 3CC1A 1AHWC 1YEEH 1J8KA 1MWAH 4JFEE 1C8QA 2Z93B 2M83A 4N3TA 4GKSA 4PWIA 3UC0H 3EADA 4EN3A 3EJUA 1QBBA 5KSVA 1FPTH 3DUUB 3D39B 2A6KA 4Q8BA 1JYWA 2J12B 3A3YB 4XBPB 3H2WA 1T0MA 3KPNA 1XGUB 2XKUA 5GRWA 3OKLB 4JQIH 3QIBA 3CHSA 4HJ0C 5D1ZA 2D0GA 4WV1C 2O1AA 1H8NA 3D4GA 3DX4A 3L9RB 3GSVB 4KJPD 2GEQA 4R7DB 4KFMA 3GJFB 4CSPA 3Q5OA 3AXLB 2OMZB 3RX7A 4N8VA 4ZW5A 5I6KA 3HG1E 2IQ9H 2CGRL 4FMVA 5ANMA 4OF3A 5T3ZE 1YNKL 5DJ2B 4IRZA 2DF3A 4E5XA 2VZUA 2CO6A 5JIMA 1KFAL 1NGWA 2VDMB 3C8HA 4YO0A 3F6JA 5E4AA 2KLRA 4P46B 4U1LB 5F9WB 2AJXH 1SEQL 3ZOAA 2E7LA 1E28B 1ECYA 3V6OC 3FT1A 2JXMB 2V9TA 1N68A 4X6DF 4Z6AT 4OIIH 3SGDH 1R4XA 4KXCA 1IEBB 1VACB 3CX5J 1NBZA 3MV7E 3MUZ1 5AG9A 5AOKA 3T65B 4Y9CA 1CL7H 2WXPA 5KZCD 4X80H 5T5FH 1NOAA 5GS0L 4JFQA 2W0KA 1DSFL 4JNXA 5EU5B 1RZIA 2X9ZA 2QSCH 4BHUA 4UT6H 3VMOA 1E27B 4Q74A 1TJIL 3IU3B 4GO8A 4P4KC 1B88A 2ZIDA 3DGGB 2G2PA 5E08H 3KLAB 3QIUD 1Q9OA 4MNQE 3DUHA 3NIDB 4ZSOE 3LZPA 5TF1L 4ALAL 2B7DT 3MR9B 4FFYL 4KKQA 3UXFA 3U4EA 5L88H 2CCWA 2FH8A 2CQVA 1BD2A 2OMUB 4KI5F 2ZAGA 4YVUA 1NANI 1VFBB 1QI4A 3ARSA 1TQCB 1SMOA 5I1AB 1R75A 1JI1A 3MZGB 3I6GB 3HMXA 5F3FA 4HUCA 3NJHA 1XGYL 1KULA 2K1MA 3EYFB 2H0EA 3MRQA 4TOYL 4ZTOL 4UAOB 1UADC 3QBTB 3K8MA 1CFVL 1GGIH 1JZHA 3RY6A 4YFEA 4NRZA 5LCVH 4LOFA 2HT3C 5DRXB 4A7TA 1KELL 3BHBB 1OT4A 1NC2D 2MNJB 5GZNC 1DP0A 4EOWH 1I9EA 1P5UC 5FOJA 1Q9KA 2DQCH 1KGJA 2X4QA 5BJTA 3IJEA 1VGKA 1X5FA 4NUJB 1WFUA 3DBXA 3DMMC 4JY6A 4WO4B 4X6EA 3P0YH 5I6XC 5A1AA 3FUIA 4ZMLA 5EC2A 3STBA 1IBGL 1KGCD 2XTLA 4IU2B 1YEIL 5IZ7A 3QUMB 1QOKA 2BIPA 4QRPB 4P57A 4HWEH 1KC5L 1NGPH 3L4UA 1KIRA 1F86A 3RUGE 3ESVF 3N42B 4PJAB 1ZAGA 1PEWA 4POYA 3DYMA 4PW4A 3MLZH 4OCYL 2WKOA 35C8H 1JNHA 2DWSA 3MRRB 4Z5RB 5FDYA 1GJIA 5HGBA 3MLWH 5IQLA 2DLGA 1II4E 3LN5A 3M8OL 4I9XA 5HHXH 4OF6A 4JRWA 1BEYH 2VN6A 3WKML 2HKFH 1RIUH 2A9CA 2QZQA 3FB7A 3N5AA 4G1EB 4PN6A 4WU7A 4YFLF 3HJ0A 2XKNB 1LK2B 2CHNA 3NG5A 3WEAA 4BUGA 5CGYD 1BHGA 3JT0A 2GUOB 1LD9A 4Q6KA 1NAMA 5D7JA 1U8KA 1AIFA 5F7UA 3U6XS 2CBQA 2GBTA 5ABDE 3S37L 2OL3L 5DT1L 3QEQA 5IHUL 2MOGA 3OKMB 4XBGB 3FTGB 3C5JA 4QOKA 2C9VA 1KIUB 3OAZH 4W81A 4QUOA 3MUY1 3VFNA 5I71C 1PLAA 3QYNA 1EV2E 5CJQL 3KHOA 3H7LA 4TRPH 4X9BA 4OJAA 1KLGB 3D48R 4HFUH 4BIKA 1CGYA 1M6OB 2GJ6A 3DX7B 3L3HA 5BOPA 1TVBB 4F1SA 1LXMA 4JFZL 4CMHB 2MKWA 3BAEH 4AQ8C 1P7KB 2YHGA 1G94A 2B08A 3FZUD 1UEMA 1GSKA 2C4XA 1KG0A 4FFTA 4FI6A 4NO2B 5AW0B 5GIRA 3VXSD 3ZKXB 4YHML 3VTAA 4ZFOL 2ERJB 2XWXA 3AY4A 4TNGA 4MDJB 4OR1A 1TZIA 4FKKA 3TCLB 3GRWH 5DRWB 1MREL 3PWNA 3ARFC 3CVIH 3MA9H 4GAYA 3VM5A 2B4CL 2Y07L 4RMRA 1ZSDB 3EXJA 4HC1H 5HYJE 3U4BL 2X4OA 1N4XL 3NZHH 2NY4D 5CJXC 4L3EE 3S2AA 1EO5A 2CUHA 1IBYA 3DVGB 3F62A 3FCUB 2VLRA 1NTDA 1KCVH 2ZUUA 3DO4A 4GKSB 1KBKA 3RJQB 5J9PA 2XQYG 1WEJH 2ITFA 4DUVA 2QQNL 3QXDB 4Z9KB 2FL5A 1AG0A 3DJZA 5JUEL 5HDLA 1IE4A 1X4YA 3QPXL 5C0FA 3GXNA 3Q8BA 1XGUA 1UKQA 2MH4A 2X6MA 2Y9RT 2JCCB 2VZ3A 3R8BB 3W2DH 4TULH 4HSQA 4FCAA 1T2JA 5C3IA 1OAZL 2EE0A 3TO4D 5BPPA 4Y19A 4PV1C 3ARGB 3F6LA 4YHKL 2OYLA 4WFFD 5JHLA 4DKDC 3UTOA 1MNUL 3FTZA 4HG4J 1XTMA 1G7QB 2WANA 3KPLB 2CO1A 3QSKB 3KL0A 5FAAA 5AB9A 2AEPL 1LHZA 2YUWA 4G59C 3BAYA 4JZJB 3T2QA 3VCLB 3GF8A 2WWOA 4ABVA 1YEHH 1HQRB 1T6VN 1DJSA 15C8L 1IAMA 2FWOB 5D1XB 4I77L 5CLXA 5FHBH 3DGDA 4XWGL 1I1RA 1KEGH 3U6RB 4AENB 7TAAA 4A37A 2EVIA 3SQOH 1LDPH 4JJOA 3L3IB 1DFBL 3QORD 3HBQA 4AT6B 2DM4A 5C6PB 4XOEA 4AGNA 3O81A 3K4AA 5I0XA 3TN0C 4A6YH 2HG5B 4X98B 5E8OB 4KZDL 4FZEL 3V4PA 1A0QH 2BVPA 1LP9B 3ULVF 1T83A 3QIWD 1DBAH 1BQHG 3M17A 4NCC1 2EYSA 2YAMA 5FKPA 3SKNA 4ZDHB 4GXUN 5AAWA 3IGAB 3EDFA 1BQLH 3CJJA 4GKNB 3ZJAA 5HPOA 4HIHB 1KZYA 4R0LC 4D3CH 3NZ8A 4L1BA 2YAEA 2CIIB 1UACH 1CL7I 4X6CE 3TN0D 1IIKA 5AWNL 5G5DB 5L8JB 3J8F7 1I8LC 2OL3A 4QXTB 2WVVB 4EF3A 3ZTNH 1B4JH 5DD0H 3KDMA 5FK9A 3BQUB 3VDAA 4Z3JA 4F91B 3H2QA 3LKRA 2WNGA 2QGCA 3AQXA 2XNAB 1UCTA 2XCMC 4ZZFA 1KBPA 2BRRL 2O5NA 4LCCC 1URZA 4GSQA 1WAAE 1P9MA 3SGKA 1IT9L 1MHCB 1E4KC 5DUPL 1ZCRA 2AZAA 3MNVA 4JZNA 1AAJA 2VDKH 4MAYB 4MA7L 2H26A 2YPLE 4BKLB 4FXKB 4ZMVA 4UQ9A 2BXYA 2WUBH 1JGDB 3ZTDC 2CHDA 3NEXA 2WBJD 2W9LA 4NRZB 4W9LC 5HGAA 5KW9H 4U0RC 3QNZB 5EA0H 1N6QH 3GSQB 3VI4F 2A4ZA 1J8SA 1BW8A 5FUOL 1NCIA 2L7QA 1TITA 4Y5YC 5FYLH 2I9LB 1UD6A 4LVHB 2X38A 4Z7NE 5FYLE 1HCVA 1OTUC 4OZHE 5L7XH 2XHNA 3VXSE 3BISA 4FYRA 1U8CB 3GXPA 4QRSA 4D2NA 4JMXA 4PRPA 4R2GC 3LV3A 1RSFA 2V9UA 4AYID 1INEL 2ZXDA 1S7WA 1NM4A 3Q7JA 2NY1B 4HUMB 3H9YA 5E51A 3RFRA 2XOTA 3MRGB 4HCRH 1VGEL 2GPZA 2IV9A 2Q76A 2XYCA 2NW2A 4X6DB 5DD3H 3RUGA 1JXGA 1DVFB 4L5FE 2WIIB 3O9WA 1A1MA 5CSZB 4M3JA 4R7VA 5E9DA 5FGCB 4TVPE 4KTGA 5AEAA 1MRFH 2XDHA 2UUDH 5ADPH 5DHVH 4LVEA 1R9FA 4KMLB 1B9KA 2HX7A 4ZNCD 2A77H 4HS3B 4F80A 1J5HA 2GFBA 4YSAA 1IU1A 1S7XB 5C9KA 2BNQE 3F00A 2B9BA 4P9ML 2WM0A 5IVXA 2R83A 4JHZA 4GMSL 5DC2A 1UYWH 3CZEA 2I7SA 1ZVYA 1XR8B 1KXQA 2R7EB 4X5PA 3RWDB 2ICWB 3VU2A 1Y6MR 4HIEA 1KYUA 4P23A 2CO2A 3QUXD 4QYAA 3WHE0 1ILUA 1YNKH 2GJZA 2ZYHA 5F21B 3WKYA 2I32A 3ECQA 3EH4B 1OY3B 4KHXH 4JKPH 1S3KL 4X4ZA 1J8HB 1QNIA 3QEQB 4ZOEA 3PV6A 1NFDB 1JP5A 2WNKA 2ZUYA 5DRNB 4AE0A 4G80A 2C5DC 1NCBL 3ARBA 3HE6C 3TT1L 1G7MB 2CDGB 4O5LH 2EIBA 3TNMA 1MFVA 1Q9LB 1QUNA 1FFTB 4GUCA 2C9XA 1CD1A 3GSUA 5EBGA 4QRQA 1K2DB 4KJQD 4QKXB 3DJRA 1JPSH 2ZJSH 3R1GL 5HI5C 1L9PA 1AC6A 3K1DA 1KLGA 2HUEA 4NX0A 3QRBA 2H47C 3U7AA 4WRLA 4M6OL 4LSSH 3VI4A 5EC1B 3DV6B 1A7OL 3IXAB 5JDJA 3MMEB 3LIUA 4IIQB 2YFNA 4X0KA 4YPGA 3KLKA 1W15A 5SWSA 5CEYB 3TV3H 3A4EA 3VG9C 4AK1A 1PZSA 3P4OA 4GW4A 3ZRCC 2P5WB 1NCHA 6CGTA 1WAPA 4NNYA 4ODVH 4WDIB 3K1KC 4HAFA 1LP9E 4ZAKB 3QUZB 2X1OA 2DD8H 4YHZH 4R4BB 3BPCA 5DK0B 3BC9A 3GS4A 5I74B 3BD5A 1AXTH 3D5OF 1FPTL 3F7RA 4B9YA 4NXSA 4M8RA 1VKXB 2Q7YB 2VRAA 1GGTA 5JR1L 2EEXA 3WEXB 4YGVB 4B96A 2P47B 4E9RA 3VWJA 2ESVD 2HT4D 5C07E 6PCYA 1FIEA 3RGBA 1B90A 4WWKD 3QI9D 5D1QD 3V0VA 3VXRD 3CFMA 5J57B 3O4LB 4Y2OA 1HYSC 1QKZH 1N2RA 4ODXB 2FD6H 5D1XE 3GSRA 2CCVA 1YQVL 3ML9A 3UDWA 3WS3A 1CO1A 1KTLA 4U1NA 1EO8H 4Y16A 3EBHA 5KSBA 1GZHA 2R69A 4YE4H 3R0MA 3CHPA 2AMGA 1IGTA 2DL9A 2F08A 5FA3B 3QZWA 5AW5B 2V7NB 4ELKA 4JFFE 4UM9A 4Y9FA 3LKNB 1XF2B 4PJ7B 1I9IH 2L7UA 1GYVA 5AW1B 5A6IA 1K8DA 4JX0A 3CN0A 4KKPA 3H6AA 2Q8AL 1J7VR 3IE4A 2FWOA 1NJ9A 4LCWD 5D1XA 5C0IA 4ELMF 5F1SA 5I8CA 1UH2A 1Q1JL 2W1NA 3TGXA 1F02I 2VLJD 2BS8A 4KKLC 2WN2A 1OAQL 3B6SA 1RZJL 2P5WE 2N7SA 1LTXA 3GMOA 1CYWA 4DP5X 5JW5A 3VNZA 4HPHA 3NAAH 4JPKL 3N2JA 3PNWB 5A2JH 1R47A 2OMVA 2X4PB 3V6ZB 3LOWA 1MPAL 1RK0B 4TSBH 1O5DT 4HV8B 5ID1B 3TTSA 3CK0L 1MEXH 2FECI 5E8OA 4FD0A 3NN8A 1G9MC 2RTTA 4I5BA 5F89A 1LO0H 4TKWA 3FU6A 1EZLA 1URIA 3PWJA 3GJEA 4JR9L 5CJOL 3QP3A 1M7UA 2VR6A 2HSIA 2JELL 3BT2H 3IGAA 3KPOB 5GS1A 5L8LB 3UBFA 1AR1B 4TUOB 1UM5L 2WYTA 2YMOA 4HIJB 4ADGA 3ZDXE 5HYEA 5AVRB 3ZLQC 2VDNL 2BOBA 4WZ9A 5GS0C 3C87A 2KT6A 3S48A 1F8TH 5LXGL 1NOFA 1HYSD 2CRIA 4FX5A 1QW9A 3V5HA 4UDUB 4RETB 4HWZB 1H3XA 5IMLA 3KPTA 1X6NA 3MUJA 5E9AA 1RPUA 1OK8A 3WXWH 2YR3A 3U46A 4KH2A 4XRCB 1YUHB 1E9QA 2DWEA 5DJCB 3WIHA 4OLWL 1YEDA 3WNJA 2WB7A 5LGYA 3MN8A 1SMAA 1OT2A 1JK9A 3DJSA 4EMZA 4UUJB 1FL6A 4X6BB 2Z35A 1A7NL 4HX1B 4PH8A 1PPIA 3GXMA 3T0WA 1W6WA 5J1AA 3ATAA 3WHXA 5ANHA 1HZLA 3WMSA 2FSDA 2RA1A 2OMXA 5AOJA 1R0AL 4RX4A 4NZTL 1IQWL 4I18C 3P11H 1NBYA 1EH9A 3VXOA 4JREB 5IQ7H 5DMIH 1HJCA 4RFNC 4XZUB 1ZWIB 4BSVB 5E8EA 1D5RA 4K7PH 3OWEA 2Q8BH 5A7EA 2EVFA 1HOCB 1TTGA 3KPSA 3T6WA 2H4EA 5L0QC 4ONFH 1AQKL 1EZUA 1A8JH 1ZLEA 3VW3H 5ID0A 2R23A 4HEPA 4NCC2 1WRFA 1X3DA 2RFXB 3RY5A 1LQSR 2YGQA 3IJYA 3RUGB 3WE6B 4GRWF 1SVCP 5E94A 4UNUA 4M48H 2WTRB 5E9DB 1JZGA 1HIML 3PABA 2QV2A 3DHMA 4KZEH 1NWPA 4Q58C 5JQIB 2IBZY 3EJJX 3UO8B 3PAUA 4QT5B 2JI2A 2GJPA 4JO5A 4Y4HA 1Y18A 3LS5L 4X7TB 1S7RA 3L95A 4C83A 1BYNA 3NYKA 5EIIB 1C1EL 3OC5A 2GTWB 1MFUA 2AQRA 4MQXC 5AZ2H 1N8OE 3TPKA 5EO0A 1BVOA 4NUMA 3TZVA 1DO5A 3CSBA 1RULL 1X5IA 4IBUA 4PRDA 3IAPA 3ECVA 3TYFA 1YYLH 2VDML 2H5UA 5FLVA 3RWEB 5TPWL 2N0MA 1NEZB 3K2UL 1P84J 2GB2A 3ZL4H 5I8OL 4LLDA 3V52L 4LHJB 3MV8A 1DN2A 3LVTA 3UP1A 1JWUA 2HA1A 2KERA 4GAGL 1FNEB 4YBLC 4WWKA 4XVJL 5D1QA 4AKQA 1DQQB 4ZZKA 3GEFA 3BP4A 2PLTA 4HF5H 4ZXBC 3FTWA 5FYKU 2ZSWB 4NQDE 2OI9B 1EXUB 1QFWI 2AQPA 2G5BB 2VDOL 4JFYA 3EJCA 1NGZA 5AYUL 3IXAA 2I26N 1PAZA 5BMFL 3CFIC 3GI9H 2JWYA 3N85H 4W9EC 4BHUI 5CEYA 1XF4A 1XWVA 2C9RA 7PAZA 4WAFA 1IAIM 1JSYA 2X44D 3DTXA 1R3HA 1ILSA 4ZAKA 1ZD6A 2OYMA 5F6IB 1A9EB 4R4BA 1EANA 2JJWA 4OFKA 1YA5A 3B2UD 4W6WB 3IE9A 4DW2L 3DSNB 4DK3A 5KSUA 2UY7B 2X09A 1WF5A 3KS0J 4PMEA 1VHPA 3ZDYE 1L5GB 4B50A 2H3NB 3EOBB 4Y8AA 3C8KA 3SOBL 1CZ8H 4RAHA 4HK3J 1F4HA 2H3XC 3BEVB 1ACYH 3AJ7A 1G87A 3CXHK 2OW7A 5EDSA 1BPLB 2JKXA 3BH9B 1NCNA 4OCWH 2NTFA 3IGUA 4Y2OB 3FB5B 3N41F 1H3UA 2PO6B 4HS6B 1UA6H 1NFKA 5KVGH 3NIFF 4H20H 4W9GC 5EO9A 2KS0A 2QADD 4NDMB 2CRMA 1U91A 4WEBH 3C60A 4JDEA 5IJKC 1HEZB 2D7QA 1Z5YD 2WGNB 4R4FH 4W9DC 3C9NB 4Z78A 1MFAH 3HG1B 1BZQK 3H9SB 5C8JB 2BW4A 4Y1SA 1BP3B 1IGTB 3LZOA 4P4KA 4ZS6C 2I07B 2XX1A 3HAEG 5CN3A 3PJSB 3KD4A 2NR6C 3ECUA 4IEFB 4ZUVA 2XRAH 1SJVA 3IPFA 4KO7A 1A14L 1FYTA 1QLEL 1FVDB 4O51A 3F7LA 4XGZA 1N0XL 1A1NB 1OCOB 2WXGA 3E9TA 4KRMB 2RR3A 5HYJB 5K1JA 3B8SA 4K23L 1AGBA 1A1OB 3UZQB 3I85A 3D39E 3QUML 1DJIA 1EXHA 2YLHA 1SN5A 5DUBA 1ZT4A 1FZKA 4IGBB 4F93B 1FH2A 4OIFA 3W0WD 2XPGB 5EN3A 3V55A 3ZKQD 1QRKA 3WXVH 3IMSA 1NPUA 1SQMA 1BMZA 2XN9D 3OQ3B 4JJHA 5E6ID 1E6JH 4Q0XH 1EFQA 1KB5B 4I7ZC 4JPIB 1SDYA 1HZKA 3QIBB 3UJIL 2DOCA 1XEUA 2G60H 2IH9A 4BFIB 2J20A 4LHUA 4XMXA 3PWJB 1MRCH 3MV01 4OCMC 3REWA 3IS0X 4N6RB 4XNZC 3EFDL 4LLWB 5BV7H 3AXLA 3EO0B 2DWYA 2IH3A 1DLHB 4LGRB 4L4VB 4HBCH 1TCMA 4QMEA 3TASA 3ZW3A 2WQSA 1BFSA 3IDIB 4OFQA 1P5UA 3PYCA 3HFMH 4FFWD 4XX1E 5KBKA 4ZX6A 3ESNA 3MKKA 4IW4C 4BXSV 3MRDA 3LNGA 3DURB 3KWUA 1JZ4A 4DH2A 1FZOB 3CFJA 3PL6D 3FUFA 4XP6H 4NKIH 4ZO6A 1HKLL 4BCYA 2VR5A 1KGYE 4H8WL 3M45A 2B2XH 5DK3A 3SDDC 5IMLB 1A5FH 1T6WA 3BN9C 3FSAA 4FNLL 1HESA 1FF5A 1OV8A 4M43L 4OZFB 2FAUA 2W95A 1IBZA 4NN5B 2Y06H 1Z2KA 1OCCB 1JK9B 4OZ4B 4YHPA 5AAMA 4O4YH 3MQIA 3IN2A 5E6IB 2OKMA 1PYWA 5HDQL 3VXNA 1WIUA 3WYRA 3RYMA 1ZA3B 5KYUB 5K5YA 3O4OB 1UB5B 3DVIA 1QSFE 2OMXB 3O41B 4KHTL 5ACZA 2IWFA 3WNMA 5I66B 1TFHA 4JGJA 5D2LA 3U0PB 3RPIB 2EDWA 1RU9H 5IB1A 1KMGA 4NBZB 2VDLB 4PRAB 5ALCH 3LKQB 5DFAA 5KVFH 2VOTA 3V5DB 3H2PA 5CR1A 1F18A 1THCA 2TRYA 3RWCA 4PWHA 4EZLA 2CUIA 4FJYA 1OVZA 3Q6FB 3CDZA 5LKNA 2JKWA 2R51A 3X3FL 4F7PA 1HDMB 2HVJA 2NX5D 4YUEH 3GDBA 4WI9A 4F58L 6TAAA 1KGWA 1JHLH 1RPKA 4R4NC 1F5WA 3HTLX 4NQSB 2XV0A 4UILL 3VQMA 3W39B 5ADPL 4WI0B 2ZZUT 3DHUA 3IJYB 3WE6A 5DC4B 1OGAE 3UTSD 4ONOA 2XV3A 3ALWA 5EU7E 4WHTA 4JM2D 5A3IC 1ORSA 2IQ9L 3NQKA 1HU8A 2ZOTA 1OSPL 3EYFA 1Y6KR 3J07A 5IVXF 3TA3D 5JPNA 3TEZA 4H44C 4Z77B 3ETBF 4S2SA 4JFDA 5KAQF 3GGWA 3KGSA 4TLSA 4R6UA 4Y4HB 3N1QC 3R4RA 4YDZA 3NIGE 2XYBA 4J4PA 4TQ8A 2Z7UA 1SQ2N 3MLVH 1VFOA 1J05B 1FN4A 1IC7H 3COOA 2DL2A 4ZW3A 4MX7A 1F4WH 1TR7A 1D5BB 2IMMA 3MREA 5MP6L 1LMKA 4U7SA 3MRJB 3UJTH 4NQQA 5GGUA 4MVBD 5FDWB 5IV2B 3HN8A 2LU7A 4OFPA 3C60D 4HH9A 3RHWF 3DBXB 3VD9A 1YEEL 5EU7C 1B6DA 4DAGL 3FYIB 3O2DL 2WZAA 4JY4B 4F9LC 1EJ6A 1O6VA 3CGTA 4CADA 2D7OA 3SZ6A 3BFWA 4KKAC 4JFFD 2BNUA 2OFQA 2K3TA 3VXTA 4K5OA 3SPCA 4N2AA 4PCTA 3HC2A 5TQ0H 3GIZL 4EO5A 1DZ0A 4IRSD 2BSTB 4EIZC 3FFCD 3UAFA 2GITA 2BVUA 5LBGA 4RBPH 1INQA 2H32A 2O5YL 1O9VA 3MAWA 2EXWC 3UAEA 3W9DA 5IMMA 1U8QB 4O2FB 3UAJC 4F7CA 2DD8L 3VDCA 4YHZL 1J18A 2Z31D 4PJGA 4OM1L 2H2SD 2YD1A 3JTBA 3QIBD 5CO1A 1M57B 3HI5H 4PRNB 4ADJA 4B9PA 5AVUB 1JPTH 2I25N 2H1PL 2L7EA 4DN4L 3SYPA 4PJXA 2PP8A 3AGVA 4I0PC 5CR8A 2X88A 4B27A 2DYRB 3U25A 1Q0EA 4CSTA 4GO9A 4N2KA 1YEGH 5AB1A 2ZUWA 5EIVA 1A3RH 3RWIB 4EI6B 1TCRB 5GRVK 4LPWA 2E86A 3B9KC 3KYKL 4PJ9B 1KGIA 2ICEC 3CLEL 4GIOA 4EI5C 4H88L 4JRYB 3A6BH 1AGCB 3JTTB 4JO4L 3KEHA 1HI6A 1EFXB 2JJSA 3JYCA 4LKXA 2DQCL 3BH9A 3ZU8A 3NJFA 2FT7A 5ESQB 3FB5A 3PHSA 1LK3H 4Z7OE 4Y7OC 2DWXA 2GJ6B 1AO7B 3CFKB 1MW0A 3FHQA 1RK1B 4U1KB 4CSZA 1A7PH 1MCSA 3ZYOA 2R4SH 1P7KA 2GSGA 43C9B 3H9SA 1FVCB 2W0PA 1UEYA 3HZYA 2HTLD 1KOAA 1I9RH 2WLIB 2YWZA 3O2VL 1KG0B 1AGEA 4IRJB 1CU4H 2O6DA 8FABB 3IMVA 4MDJA 2FHCA 5L8KB 4MB4A 4KVCL 3B1TA 5GGVY 5F3BA 4DEPC 4OCYH 5EBWB 1HNGA 1TEFA 2CWRA 4Q9CA 5J56B 2NNFA 4YHNB 2X3AA 4B9CA 2UZXA 2E3VA 3VW3L 4P2RD 3RG1C 4PUBH 1CT8A 4KPHL 2ZAHA 3E9UA 4WU5B 2WQ8A 2FJSA 3QUZD 5D7KE 4GXUM 4OI7A 3DETD 3KS0H 4S10A 5FO2A 1BD2E 3N06B 2EADA 3GYRA 4IGBA 4P2OA 3FFCA 1LJMA 1CICB 1DVQA 1U93B 3MODH 4QR7A 4EUPB 1Q1PA 3EUDA 3FO1B 2V9RA 5F1KC 4G8AC 2A9ML 2QKIC 1FE8L 1WAAA 1WZ1H 1YDPB 3JVGC 3BUYB 1WDAA 2C8NA 2KDYA 2QVIA 3HI1A 3IDGA 2BVOB 2K70A 5IJCC 4IS6A 3FN0H 3HVNA 3F5WA 4RA0C 1N5AB 3O3DA 4YN3A 1OZTG 5IROC 2FO4A 1V3MA 4FQ1L 2IH3B 4MMZC 3TWCH 1V3KA 3BUTA 5KYYA 3MROA 5F8RC 4EQ3A 3VCLA 1J5CA 1A6TA 2GY5A 3QZWG 3V8OA 1DN0B 1JFQH 1CCZA 3B9VA 9PCYA 5GGRY 2NCMA 4LL4A 5BZDB 4G1MA 4PGBA 2UX6A 3QWNA 1NOLA 3FQUA 4JRFA 1MH5A 4YHMH 1Z7JA 1UWEH 2QFPA 5D7LE 5LG1A 5BOZG 2NNAB 2ZXCA 4B0MB 4DVRL 1UJTA 3WG7B 1IKFL 3A6CH 5B7FA 4X9IA 3TCXA 4OZ4A 3WGUB 3T0EE 3HG5A 1RERA 4HC1L 4ORZC 3HFFA 4Y8DC 1OPOA 3S35H 3V6OA 4PBWD 1WLHA 4R84A 3RDTA 3ULVC 5IF0A 3ISYA 1ZA3A 5ALBL 1AFVL 3HB3C 3K80A 4AJ0A 2WO4A 4YWGL 3O41A 4KY1H 5DQJB 3ZE0B 4ENED 5L88L 3M17B 5DEFA 4LLUA 4ZDHA 3BAJA 1M6UA 4KMTL 2JCCF 3ROLA 1PKQB 4NO5A 2H2PD 2EH8H 4P23C 5DHEA 2CIIA 1U33A 5F88A 1XCXA 3QA3A 3BZFB 4QPEA 3DLQR 1AKPA 4NSKB 4F7PB 1NWOA 25C8H 1GZPB 4MMXB 3SOBH 4PI0A 1DQLH 5FK9B 3VFTB 1LLAA 3IKKA 5DR5H 1T1XB 3O6FD 3RFZA 4G5ZH 2CHWA 2YPVH 5EU4A 2ZP0T 4P0DA 2P8PA 3KLSA 4HS8L 3ZT6A 3GPSA 4AQEA 5CCKL 3BPOB 4WWPA 5JPNB 5LCVL 4PJXE 2XWJB 1N12A 3SDXB 3EH2A 1CGSL 1SBBA 3M7FB 3ZQWA 4MAYA 3V8CA 5A2FA 5JTWA 1MJUL 3ZT5A 3CUPB 1X6LA 1G1CA 1NC2A 2WNWA 3NFPB 1ASOA 1ICTA 2J6EL 1N7MH 1CE6A 3MLTA 1AR2A 1P4IL 4XB8A 1J5OH 2A83B 5F7EL 3LEYL 2ARJB 1JGEB 3K2IA 2JKRM 3B34A 3LSOB 3P0YL 5D55A 3RBSA 1AP2A 3VFRB 1MCOL 1YPZA 4HHGA 1PZ3A 3U0WL 2YXWA 1RURH 4QRSB 4PJCB 4PRPB 2QVMA 4FZEH 2HT2D 3LS4H 2CLVB 1Q0XL 2IBZX 2YUVA 2Z92B 3BKJH 1FCGA 4QO1A 2GK0A 2YD2A 2N7BA 1BQHB 3P0VH 3ARRA 5E5UB 3ZTJG 4I1NB 5DMYA 1OT1A 2ZWLT 1HQ4B 3RGVD 2KPNA 4PVBA 5E99H 1RMFH 5IB3A 1A8ZA 4QRBA 1X5YA 2CBPA 3G7TA 4GBXB 2H32B 3IJSB 5JPMA 4I8DA 4TULL 1GS7A 2O6EA 3WV0A 1YEKH 1ZLSL 1XBRA 4Y88A 5GRZA 3WLBA 3QJVB 3F7QA 4PJIA 4EUPG 2H8PA 4AQ1C 3HAEH 2APXA 3QORC 4PJEB 1GKOA 4X5WB 2ZTBA 5IVXB 4QGYA 4XBEL 5C09D 5JW3L 4NOBA 1WZLA 2QVKA 5E2UH 3V2AR 5T1MB 1HCZA 5SWZD 4UT6A 4HIEB 1NGQH 2DQUL 2NXZC 5LBSA 1UKSA 4R7NB 3DUSB 1BBJA 2ARJQ 1AE6H 4LOUD 4GOSA 2GK2A 2O61B 4B41A 3PV7A 1FL5A 4M8VA 3RTQC 4XCEA 5HYSG 2CA4A 2EDDA 3AAZB 3ARDC 4TRPL 2G5UA 3FOLB 3BPNC 4FFZL 4PJ9A 3OKOB 4GXVL 4IKLA 4NXKA 4WTWA 2XY2A 5D7JC 5F1NB 1YY8A 1U8HA 2PXYB 1IGYA 2ZOKA 2J5LB 2EIEA 1DBBH 3IS1X 1KPRA 3FQXB 5CHNB 4FTVD 5K69A 5IGXL 2LVEA 3RVTD 1G84A 4APQA 2PN5A 4L9LA 3DPBA 4HUXA 5C0CD 1H15A 1U8OB 3CFKA 5GPRA 2YGNA 4Y4FA 2KZKA 2YXFA 5DQ9A 3QK0A 5B1JC 1BECA 5JIKA 4F1ZA 4ZW8A 5C08D 2HFEA 1NMCC 2B4CH 4H1LB 2FZ3A 2HP4A 1E0OB 5KVFL 5C0BA 1FBIL 2R2BA 3LH9A 4M62L 2QMKA 3V9CA 4NNYB 3UTTD 5LBVA 4NC0B 1SN0A 3Q8FA 4UTAA 5JW4N 5I2IA 3TEYA 4HGKC 1MIEH 3BW9B 3ZK0A 4ELDA 1XGTA 3D51A 5L2KA 2F53B 2XACC 2Q7YA 4BFBD 1BQSA 2LTQB 4HALA 2V3FA 1X44A 3ULUH 5DJYA 2OYKA 5KVDH 3FRPG 2BIHA 3ZKXC 1P2CB 5J5EA 3ZZ1A 4MAYD 2IADB 2VXVH 1DCLA 4QKTA 5DUPH 5B8CC 3IDYB 4LRNH 5D5MF 4EUPA 1MLCB 3SBWA 2NY2D 3O6FB 3LRSA 3P9MA 4OZHA 5FV1L 1EXGA 4AKPA 2FTAA 4UTAL 5D4QA 5E2VL 4XCCH 3EZJB 4CVWA 1S3RA 1M3IA 4JHWL 4MFHA 2MOQA 3LPFA 5T3XE 4XB3A 4AEHH 3TO4A 4LCUB 5ITBL 1KB5H 4P8QA 4MQ7B 1GGUA 1HXYA 3F5WB 1G6RL 1R3IL 3ELAT 3C6SB 3MGTB 2YPLA 3O3DB 5IBLC 2DH2A 1YEFH 4NPYA 3GSWB 2AK4B 4PR5A 2JI1A 2WLLA 3DYOA 4UNVA 4JM4L 2NX5E 3TFKC 2HRPH 3VFPA 1KLFB 2DQTL 5KBMA 1XH3B 3QJZA 2OZ4L 3CHRA 3BRGC 4LPUA 2PYEA 5DDHB 1T66C 3AU1A 4GRLA 5CGYC 3B2MA 5CM1A 4FLSA 3TA3A 4AYGA 3BZ4B 2DJSA 4PLNC 2YARA 3I6SA 2A9NH 3V7AG 4FFZA 4P2QD 4WUUB 5T1LB 3CH1B 3EYVB 4G8GA 3S3JA 3W3BA 1SDDB 5GJSH 2A74B 4XO5A 3WLWC 4AQAB 1XCQA 2W0FA 3N3EA 3L3OA 3PNWA 4X6CA 4B7IA 5CUSH 5ESAB 1B0RA 2EKSA 1TTRA 2R69L 2OR9L 5J89A 3BIKB 5SV3A 3NABH 2GUYA 4MQSB 1AH1A 5ALCL 4HZAA 4Z1PA 1YNTA 1GGCH 3N0PB 5C0RL 2Y6TE 4I5BB 5AVXB 4NLHA 5CIPB 1NKOA 2YQGA 4PP2A 5AW4B 4F20A 3U48A 4U2YA 3GJEB 1EHXA 2OTUA 3BI9X 3X3FH 3KPOA 3H54A 4MJID 3CTTA 1UG9A 2DMBA 4DESA 4FQJH 4YPJA 4DN4H 5DD0L 3P3SA 3AB0C 3MXWH 5KSBF 1MCWM 5B4MD 2WXLA 1XCWA 1S3KH 3EF7A 2HVBA 3RU8L 1DVZA 1F6LL 1LWJA 5AAWC 4FLRA 1OOWA 1YECH 3RKDC 2VZOA 1BZ9A 5K9OA 4PRIB 2LW3A 4ABQA 5HDBB 3SKMB 5IESL 4LEBA 2AXFA 5KVEE 2X4TA 3EO1B 4XMKH 4YK4B 5JHDB 1MW2A 1RK7A 4Y0GA 4NKDA 3L5XL 4GEIA 5CCJA 3BWZA 4J1UA 1ZGLP 4ZPTA 4JRXA 4BE5A 4MRBA 3BD3A 4RNRA 5HVWA 3D25A 2CM5A 2FIRT 4JEGB 3LKSA 1HSAA 3GD1C 3VD1A 1FVEA 2EDTA 2VMJA 3W0WE 3S5LG 1WISA 4FQHA 4BJLA 1FC2D 4X9GA 1FO0A 3ARGD 4PREA 2BP0A 3WFBL 2A83A 3P40A 1FJ1B 1MHHB 4MCMA 5AVSB 3TWYA 4OCXH 1BJMA 4E0RB 3ABGA 1UKTA 5C0CE 1HWWA 4HSCX 4JPSA 4FNRA 4OGAC 5MENE 1PZ5A 5FX3A 1MFEL 4HJTA 3CBRA 4O02B 4ZD3H 5LAPA 3W38A 2OM5A 5D93B 5EPMA 1TTUA 5EOCH 1CK0H 4UIKH 5JO5A 3X13B 4XNMA 1IGJA 2R2EB 1RZKH 4G82A 2EVHA 2B77A 1ZVSB 1V3JA 4OU3A 3IB4A 4JO3L 2A74C 2B1AH 5DJXA 3RVVD 3UTQB 3VXPA 3MOQA 1MJJA 3BLKA 2BNRB 3HBGA 2IO5A 2X70B 4N87A 3RTQB 4FJ6A 4XHJD 4GMSH 4HLEA 4IIQC 3IRCA 5JQHC 2Y7MA 5MENA 2W65B 3SBQA 4K3JH 4P2RB 2DJ4A 3MLRL 3HHMA 2L8AA 2BH0A 4GT7A 5I8KL 3L6FB 4G9FB 2C3GA 4FHJA 3S36H 2ATPA 3HS0B 1UJ3C 4ISVB 1RJYA 3VFSB 5E00B 1QRND 3L4ZA 3CFCL 1J10A 3LKPA 4QF1B 5J1SC 1TFPA 4KUCF 5D7IB 3FCGA 4YHLH 4CJ1A 3LB6C 5IBTH 5F9WC 5FO8A 1FFNB 4LAQH 3K91A 5CLZA 5EOQL 4Y2NA 4XAKE 3HE6B 5IG7A 1N59A 2D3JA 1JVOA 4NZRH 3QUKA 2L4OA 1TJIH 1AI1H 4NQEA 5E0FA 1UT2A 4JG1L 5HSFA 4M1GL 4BZ2A 3RZCA 2L7JA 1IKFH 3A6CL 4HULB 1D6VL 2V17H 2W80C 2F54B 3L13A 4M02A 4YL4A 5TQ2L 3ZUNC 1H9VA 3X14B 1NEUA 4KK8D 2XZAL 4NNPL 1IKOP 3MHZA 3GMNB 2Z9TA 1IM9D 4LSQH 4ZFGL 3NSCA 2J5WA 5B3NA 1T03H 1FV1A 3N91A 4MZIA 4MKMA 3P1VA 2HFEB 1ULVA 3MLPA 2MFNA 2J8UE 3GUTA 4FQ2H 3MV11 4MA1C 5L4MA 3FQTB 1MWAA 2MPVA 4N1CA 2XTJC 2V8LA 3GMPA 1WC7A 2X1PA 1W8OA 3LNDA 4AVIA 5DFTA 2ZPKL 4KTEL 5HD8D 2Z0UA 1FG2A 4HJ0D 2Q6WA 1E4WL 1F4YH 2Z34A 2VN3A 3EHBD 4FNUA 4MD0A 3U4AA 3DO3A 3VG0H 3VWKA 1GA2A 5F44A 2ITDA 4FXLA 3A0OA 2DQGL 5KSUB 3LNIA 2X6BA 3POHA 3EJYD 1IAOA 1FORH 4IOIA 3AQDA 4TVPD 5AVVB 1BAWA 1YMMB 4U3CA 4ZK8A 1PL3A 1G9EA 2ENQA 2K7QA 2OBGA 5AZ2L 1FGVL 2I7OA 2IALA 1JRHI 4Z23A 4UWQB 1KYOK 4H25B 5DQDL 4CBZA 1JE6A 1MLCA 4QAMB 5J4MA 2NTFB 4O2EB 3B3BA 5DYFA 1VEOA 3H7BB 3KPRD 4U0RB 5DLMH 4MMYB 1YYLL 2QR0B 3PQYE 5ICXA 2W07A 2ADYA 4JM2F 1FFOB 4DEUA 4H2AA 2P8MA 4UQDA 2DJMA 2RAMA 1PQZA 3CXDH 4PTTB 1JDDA 2F19H 3EG9B 4HWEL 1KC5H 1O75A 2I07A 3D09A 1EQWA 4N26A 1QRNE 3GEWB 4TVPH 3UTSB 4A2DA 4R97B 1AKJD 2VITB 4XN5A 5FYJE 3PGCB 4BM7A 2EDMA 1PW3A 1TTCA 3BYTA 2VLKB 2YO3A 3PQYB 5GRYA 4F57H 4QHPA 1RZJH 2V2TB 2J6WA 3DI2B 1D6EA 1KF9B 1XH0A 1JZ8A 1LE5B 5D4HA 1BJ1J 5IUCA 3HCVA 4U3SA 4PRHE 1TZHB 2F2HA 1ZS8B 5JIHA 2P9RA 1HS6A 1S6NA 3CVHH 4FS0A 5CGTA 4F7TA 1HNFA 5E99L 1JGLH 4KVNL 3QXAA 1YQ2A 5DVMA 1AACA 2UYLA 4AV5A 5GRXG 3VRIA 5AQ0A 4FMKA 1I1AB 1R3JA 4C55A 1ZEAL 1UM6H 1EAQA 1A02N 1IIIA 2AV7B 1KT2B 1UCBL 5SWQB 4HUWA 4FP8H 1W80A 3B7RL 1S8DA 5HGGS 3TBWA 1OANA 1F1AA 1KTRL 3QWRA 4BWTA 1C08A 4IOSA 4WWID 4AGOA 3JV5A 4WLCA 2E7HA 3DRQA 12E8L 2I27N 2JV6A 4QHMB 3L3KB 4XNYL 3T4YA 5DTFB 3ZL4L 2IAMB 4XNUH 2VUKA 4BUQA 3T8VA 2GG1A 1MELA 1DUYB 5FF6B 2NTSP 4F9LA 3LH2H 4N8CL 4XPAL 4KVPA 2A99A 3CBJB 1ZTXL 2QSVA 4HA1A 5I1KH 5DEJA 4GXFA 2J6EH 3JTSB 4AC4A 3KW8A 4KRPC 1E5UI 5EZJB 3D0VB 3QYCA 4PLKC 1IQWH 3WLWD 4E9LA 3BSGA 4R3SA 4KRLB 4RQQB 4EXKA 5IQ7L 1FSKB 4HD5A 4NNXA 1QR4A 3QUMH 4UNTA 5JA8B 2Q2LA 4OD3H 3UTPD 2WP3O 4PRAA 1NUGA 5ESVA 1OP3K 5I75B 5A16A 1DVSA 1HXKA 2EINB 1AJ7H 4BSJA 3DO7A 5DFVD 1XTLA 1DZBA 3NCFB 2GTZB 3NBNA 5EU6B 3D39A 3Q6FA 1UXWA 3QDGB 1KY6A 3LZRA 1NAML 3PXLA 3K3QA 2VDRB 3D8MA 3L3JA 1NBCA 4IU3B 4NQXB 3GT6A 4XP5H 3WNPA 2FX9H 5CEXB 1MIMH 4PVNA 1ACYL 1EA9C 4X50A 2B59A 4HH8A 5FA4B 2CUMA 2MCMA 4DK6A 4KX9A 1WIOA 2FHBA 4MAZA 4XPTL 4LB8A 2EDBA 1SJXA 2FJGA 2IWGA 4O02H 2E7LC 5I71B 5CU9A 2J2ZB 3LKOB 5IB5B 3WENA 4BDVA 1MFDH 3MXVL 5MENB 3N0AA 3KH4A 1ZHNA 5DZVA 5CP3H 2R2HB 5DJ6A 3EUUA 3AU0A 2PCPB 1KB5L 1VF5C 4FQIH 4X4XA 3MA7B 3SIKA 4EZJA 4MJJA 2VDOB 5A2CA 4YO0B 1OAXL 3HKZA 1X5AA 3JV4B 5CBAA 1T04B 1WYJA 5FM8A 4NQCE 1I1CA 1L0YA 3OM3B 2IPTH 1PDKA 5FYKE 5FB8A 3QUXA 5E5MB 2L3BA 1RZPA 2BK8A 1XB8A 5IM7B 1DEEA 3MGAA 3MRHB 2R59A 4K7FA 4OLUL 43CAB 3OL2A 3RWGA 5JW4Q 1G7LA 1CE1H 1J9SA 1Z66A 5AZEL 1XXFC 5A6MA 2D3LA 3F3HA 3L7FB 4EZKA 4IYKA 1JHTB 5MEOA 5BMFH 4K3EL 3F65A 4XOAA 3DGGA 4PEEA 5TE7H 2GITB 4J3WA 4OJFL 4U3HA 2E27L 4BFFA 2NNXA 3A67L 4L3EA 3VO0A 4PW9A 2Z64C 1MVUA 3RIFF 2H6PB 4F2EA 3B1UA 5KYXA 2DDQH 2K9UA 2V3DA 1U8NA 2XZCL 3GXTA 4RWYL 2DMHA 3APMA 4XZ4A 3B2DC 4XPHL 2HVKB 1R1CA 3S96A 2YBGA 3IDXH 3SY0A 4E9QA 2XUWA 1J1PL 4X4YA 5DJDB 7FABL 1P7QB 4KRPB 2X0WA 4NAQA 3MRMB 1IT9H 4XN7A 5GSVA 1SJEB 1G1KA 3ULUL 5C08E 4YEFA 1XSKA 2WY3B 2XA8L 3WAJA 3KGUA 1Q94A 1RVFL 4PJEF 5DS2A 5TK4A 3MRQB 5F1IB 3QDHA 2DYPD 3JWNG 5EO1B 1IAOB 4IOIB 5AFAA 4S1DC 3RWIA 3UTSE 1QO3A 1UZ6E 4HYTB 4ZTPH 3B43A 3CC5B 2EE3A 2FO1A 3AWFA 3ABKB 3RJDA 5ITBH 1NBVH 4F9PC 1DCEA 5CEZE 2YWYA 2VN7A 1T5XA 2IDSA 1Q72H 2Y4SA 3HBPA 3K46A 4GW5B 4U1JA 1KENH 3MNMA 4KRNA 5ICXB 2A6JB 1BCIA 1C7TA 1J0KA 3QXUA 5TDPA 1MDTA 4LHQB 4A2LA 2QV4A 3DV4A 4XP4H 5HBBA 5J6SA 2AJZB 4YQXL 1XGZA 2UXGA 1FCCA 3FTXA 1NINA 1A7QH 4P06A 1J86A 4X5RA 1RUAH 3DROB 5AW2B 3LQAC 1YRKA 1HCFX 3GBLA 2ZNWA 3GSNA 1D3CA 4HUUB 4ZD3L 4I4WB 2ZWNA 3B9EA 1SYVB 4XCNB 3O6LL 5FPIA 2V2TA 5KS9E 5DMGD 1W8EA 4L3CB 3FT2B 4KO9A 4ODBD 4XMTA 1L3WA 3DSFH 4NN5C 3Q3GB 2F1AA 1YN6B 4KK6D 3FSZA 1JYNA 1FH5H 1QSFA 4JKMA 4PYHA 4Y9BA 1XD0A 2UVFA 1KBVA 4HQQH 2QGDA 2CKBB 1CICA 4Z8FL 4J6RL 1JYXA 4JGNA 1NICA 4HK0A 2WXHA 4WU7B 4Z3IA 1LK2A 2E9GA 2XN9B 2R29A 1WCBB 4JKKA 3KBFA 1GXEA 4FA8A 3P54A 3BUYA 1BVZA 1OM3L 3V10A 4DHLA 4LEXH 4KRPD 4WI3A 3UZEA 2AV7A 3CLEH 4IS6B 3OLEA 1AHMA 3AWEA 3A6BL 2EXTA 5CILH 1E4HA 1PJ9A 2FO4B 5KN5B 1F1DA 3DK2A 1C08B 1S78C 4I89A 5KYYB 3W82A 3DRQB 3EH3B 3SQBB 4AV4A 3P4NA 4AQZA 1UB6A 2LR4A 4M6OH 4J8RB 4RMUA 3QQ4A 4G7YH 5B1BB 2R4SL 4HWNA 3VGGA 2ZKWA 4XNXH 4M1GH 1DUYA 5FF6A 3CZLA 3CZNA 1TSRA 4BK5A 5CJXA 3BKYH 1BFVL 3S88H 3KXFE 4HISA 2NNAA 1R3LA 2GIYA 4G3YH 2EUZA 1OW0C 4M5YH 1WWCA 5GIRB 1OD9A 3OKEB 4AW7A 4HUKB 1IQDA 4IDJL 1T1WA 2OJZL 2VGLM 1AXTL 3C5SB 1RSYA 4ZMXA 5EEYA 4ALAH 1HH9A 2ED7A 4QCIA 3PWUB 5HHMD 4KNUA 4GNKB 4Q4EA 5CP3A 1SVBA 2GJJA 1RUPH 5EZOH 2YAQA 4FADA 3UX9B 2BSSA 1DBJL 4BSWB 3BDXA 4NENB 3A4DA 1BOGA 3BGFC 5KVMC 4MAUL 4QHLB 2H1PH 1E4WH 1F4YL 3CDYA 1AZUA 5GZNA 3GK8L 3S34L 4L2LA 1CDIA 2XWBA 4X8XA 3P9LA 2WIMA 3EYOB 3HR6A 1CR9L 1FNLA 1QVOB 1ZSHA 2JJTC 4PJ9D 2D03L 1N64H 1GAFL 4PG9A 4C4KT 4JHAH 5TE6L 6FABL 3INUL 3ZE1E 3KPQA 1XF1A 5IHZB 1IARB 4TF4A 1XIWC 3ARDA 1AQDA 4G9DA 4FC3E 1XFPA 2CJUH 4BFNA 5DVKA 4IBLT 3K81A 5HJ3B 3UTTB 3RWHA 3UYPB 1IX2A 3CFCH 1RLWA 1IM9A 2NY5C 3BVVA 2WZPD 5AB2A 4G8EA 3NFPA 3GMQB 3MUUA 4OTXH 5E9NA 3TN0A 1DJZA 1T4WA 1G6RB 3CLFL 3N42F 4PJAF 3GHBH 4DVRH 4F7EB 3QQNA 2X9WA 4DO4A 4FG0A 1AP2B 3RBGA 3MOBL 1PDKB 5FB8B 4NCDA 4NZ8A 3B2UC 5EZLB 5SX5K 1V7ML 3B9KB 4HIPA 3L3IA 4EZMA 4PUBL 3DRTB 5CEZL 1GL4B 4R0LA 2VL5A 2BVQB 1VIWA 3NFNB 4JLRB 4XODA 2CXKA 2AFNA 4NUQA 4JFOA 3TCTA 3T2NH 4OKVA 2YUXA 5IM7A 3ALXA 4HDIB 4UOQA 3VXUA 1IAIL 1XCTB 4F8NA 1G7LB 2H7WA 2AK1L 3RZCD 4P5TA 3I9IA 2AKRA 4P3DB 1LP9A 3BDYL 4LLYA 4UZSA 3V6OE 5ERWA 1BEYL 3L7FA 4E2OA 3AS3A 5FCUL 1W8NA 2YAHA 2YC1A 1BXUA 4M9PA 1A2YB 1M7IA 4YOKA 4D8PA 4L18A 2A1WL 3G6AB 4IRSB 1FNHA 2EDEA 3CN1A 3MO1A 4G6FD 3N9GH 2FHFA 1LEIB 2R1WB 4TNEA 5I1IL 1M05B 4N1HB 2Z3FA 4X5XB 4EN3C 4R7LA 4AE1A 4LARH 4J3XA 4FYQA 4AL8L 3RP1A 3QAZB 2HVKA 5CLWA 3ZE0E 3WXWL 4PY7B 1T20B 1WGVA 3OHXA 3GTTA 1FL3B 5F96L 1P7QA 5D5MA 1I7UB 3FCSB 4EEEA 1IE5A 5GSRB 1ESOA 2RD0A 3FAWA 3BAIA 1VEPA 3MVSA 4Y5YA 4M5SA 5I1EL 3AZUA 4RIRB 4HFUL 1KB3A 2NX5B 4BCZA 4PRBB 4ETQA 4B3VA 2ICWJ 1NMBH 1TQVA 3ECBA 4JVPA 4KXZI 1J0ZA 2Q5BA 1ZHLA 2VWEE 2VTFA 5CJ8A 1I7ZB 1VSCA 4NKOA 3LZQA 3CWGA 5INCB 5EORL 4BQ6A 5BUGA 1QFOA 1LE9A 2LFGA 2W91A 4L1LA 1JZJA 1GHFL 3FCTA 3F04A 1U4EA 4TVPL 3BP5B 1ORQA 4KKAD 1CVRA 4L4TA 2MPAH 5LN4A 5TDPB 3T8XB 3IN0A 1MXGA 3C5ZC 4CW1B 1XEDA 1WV7T 2WCSA 3D30A 1XGPB 1YPZE 3D9AL 2NW3A 4FA6A 3M86A 3QJTB 1UQSA 5C0BB 5FKAA 1FNFA 2H0FA 4GUQA 3ZTJH 3BIAX 3IEAA 1Q9WB 5LAXB 2AANA 1L0QA 4KI5E 1WEJL 3GSNB 4U7KA 2X12A 3U1QA 1I3VA 2CXGA 3CVHL 3FQNA 3HAEB 1GYCA 4MB3A 4P46D 4U6TA 5E8DL 1NCTA 3R4DA 2AITA 2C9SA 2VWEC 4U6HB 5DHYB 2G3NA 4BQ9A 3G5YA 2SODB 1T21A 1S46A 3OX8A 2V2WA 5F0MB 4AOFA 4HS8H 2RH0A 1CFSB 2DEXX 1YNLL 3R18A 3ZMNA 1A4KB 4MNGE 5SWSD 2YPKB 3KXFA 2HH0L 5I30H 4C4UA 4POZC 1FHGA 3B5HA 4OCLC 5IW1A 4H0HB 2IWKA 2VR9A 1COBA 5IB4B 1CDJA 1TNMA 2MCPL 1S7TA 4WTQA 1XSOA 2F7IA 4BYHA 1L6XA 3KEDA 1N19A 4Z7UA 2NNCA 4PR5B 2E0PA 3CHQA 4UB0H 4AH2B 2JIXB 2FT6A 1AO7E 3NCJH 1JV5A 4G8GE 1RZ7L 2F74B 3ENEA 3AREC 3MJ7B 4Z7OB 4N2OA 5EZPA 1XH3A 4XPAH 3WSQH 4ORGA 2GY7B 3AU1B 4GRLB 4FGMA 3X12B 1BLNA 4H8UA 1GOHA 3TLRA 1A0QL 2VLJE 4OZFG 3ML8A 3GRWL 4PJFF 1MREH 5BXFB 2AQTA 3PAVA 5IK3B 4JJ5A 2A74A 1W16A 4JRXD 4K3EH 1AFVH 3TPUB 5C0DA 2F8IA 3L3OB 1YUKB 2AV1A 4HT1L 2VB5A 3PWPE 4HG4K 4YSCA 1IQDB 3SGKC 5C86A 3BIKA 4PY8J 4DW2H 2E75C 2MOVA 4DK5A 1TKWA 2DTSA 3FF7A 4AM0B 3NESA 1E5AA 4X4MA 4YFLI 2V8MA 4OFYA 1DDHA 1QSVA 4PP2B 2DYSB 2GT9A 4LSPL 2Y5TB 3SJVD 2Z1KA 1Q0YL 3RDTC 3MBEA 2OR8A 4JO1H 4I18B 3AT8A 3H1ZA 5ITFA 3G9AB 3BO8A 2FEDD 3B37A 4M7KH 3Q1SH 3AY2A 4Z3FA 2CD0A 2FGWL 4F8OA 5IJVA 3EYOA 4K3HA 1IGFL 2XFXA 4P07A 5E2VH 3DXAA 3HA0A 4KUZL 4DCQA 2P3YA 3IMTA 2P5EA 4DF9A 5IHZA 2IFFH 2ICES 4XAKD 1GMIA 2AVGA 4ZUTA 4U6VH 3O0RH 1C5BH 2HJFA 1R33A 5E56A 2VZTA 5KSBB 1MJUH 3U9PH 2NY0B 4ANWA 3WMQA 1HCYA 1XIWB 2HJKA 1XF3A 5KVEH 3BD4A 2LU4A 2CO3A 2Y25A 1NANH 1PZBA 3P3RA 3WDIA 4KNTA 1V27A 4NPJA 4PJ7A 5FYJL 2BCKA 2VLLB 4H13C 4FTVA 4Q6IA 1PLBA 2FX7H 4RMSA 4XXWC 1CD9B 5DCCA 1OK0A 1XZWA 5FC9A 1MCHA 1YMMD 3PWLB 4NWTL 5EU6D 1QLEB 2BP0B 1ZT1A 3WTWA 3EOYG 4XI5D 3TTYA 3FT3A 4BFEA 3NFSH 1PX3A 5KJRH 2CMRH 2Z93A 3FO0H 3GMLA 4MS8D 3BPLC 3QQ9D 1NKGA 1CXEA 1SOSA 1KTCA 4GUPB 1JL8A 5C92A 2E6JA 1GC1L 1HHKA 3DX8B 4ZMTA 4LMQE 4PBDA 5I1JL 1PSKL 3SCMD 3U1SH 2E9IA 2XXFA 1ZVSA 2PNDA 1R5VA 4DZ8B 4JPVL 2HFFB 4X9HA 3TH2T 5DJXB 2NT0A 5KSAB 5BV7L 3GI8L 4GQPH 1B2YA 4YIQA 3SDDB 1A2YA 1M7IB 2YSTA 4RX4D 4YXHH 5JW3H 5GGTA 1JWSB 3NACH 4TQIA 3NEOA 3ULSA 1VA9A 2LLGA 3GMMB 3I2CH 3DXAD 2JQMA 2AEWA 2OXGB 2BOBB 4WI8A 2WCGA 2EC9U 1AHWB 4P3CL 2MQGA 2AJSL 3LIZA 1G6RH 4JFXA 3AQZA 3Q2LA 4XMPH 4NI3A 3CVHA 4PY7A 1PKOA 2NCEA 3BESR 4B9GA 4N25A 3CZFB 4E68A 2M26A 4XMKL 5D5MB 2YAFA 1QWHA 1UT1A 1BVLA 1UUSA 3QORA 1FLRL 4D94A 5FO8B 3UGUA 3IU4H 1XSJA 3QAZC 2DIEA 2Y7QA 1QFWM 4GRMA 5HGHA 4XH2A 2NX5A 1D5IH 1FL6B 4E41D 1IEAB 1WZAA 2P1YA 5FUOH 4TQHA 4G7VL 2RGSA 2IH1A 4U3XA 4WHDA 5DD6A 5IGXH 2ALAA 5E5RB 2OK0H 1BFVH 2F61A 3S88L 4XAWL 1JD9A 1B0WA 3T6VA 4ZO8A 3VRJB 4AIOA 2LU3A 5DUJA 1XT5A 4JDTH 1HE8A 3UMNA 3WN6A 3IPEA 3BQUC 3WJMA 3FSOA 3G08A 1K4DB 4MNHA 2PR4L 4AMKL 5F9JA 2YD0A 4L4TB 4LZKA 4S1SH 4WW1A 1ONQB 3DECA 4BZ2H 1HH6A 3UAAA 3HB3D 2CKBH 4G7RB 3RIAK 4DZBA 3KZ8A 1O6TA 2XETA 4APQC 1BD2B 2JSFA 2OMUA 4GYBA 4UV4L 5FFGA 3M1OA 4KI1A 3FFOA 1DUZA 1REIA 3BKML 5CP7A 3WJJC 1DQML 4YHOL 5LAXA 3VD0A 1GJWA 2R0ZH 1QSEE 4QAWA 1V54B 3L7EB 3F12B 5L2JA 1GGYA 3WL9A 1ASQA 4MQXD 3F64A 5DJ8B 3NCCB 4C8XA 2ZOWA 4U6HA 1EUUA 1CLOL 1DVTA 4D9LH 2X9YA 5BS0A 2P26A 3WKPA 2V7HA 1GCYA 2WBJC 2DWTA 3L5JA 4RAVB 3T3PE 2LV4A 1JPFA 4XP9L 1U8JB 3T4AC 1U8MB 5FHAL 1EUTA 3NTCL 1UZ8B 1PG7W 4WF7A 1SEBA 2AAAA 4MMYA 3KXFB 3U7YL 1NCBH 4IJ3B 3U4KA 4B9FA 3IFLH 2YGVA 2DH3A 5D1ZI 3IJEB 4AYBA 1A6AA 3N1GC 4KKRA 3IVKA 3DNKA 1IJ9A 3CG8A 4IGBD 3VMPA 1SN2A 4LESA 3IFNH 3Q06A 4JY6B 1QI5A 5EU3B 4WENB 4NHCH 1EHLL 1QASA 3EYUL 4X4ME 3TO4C 1CF1A 1BREA 2JIXA 4AQ8A 3UTZA 4NN6C 3CE1A 3GRGA 4P57B 4RFOL 4Y2DC 3WMPA 2R1YA 3ZQXA 2DMCA 4KK5C 4MBRA 1PZDA 1SPDA 3O4OC 5J13C 3OPZL 1TJXA 1PCSA 2DS4A 1GIGH 2BNRD 1JPGB 3RX8A 3T3ME 4L37A 1WPCA 2WN3A 4N68A 1BSIA 2Q1EA 3P69A 4H26A 4CMMA 2IH8A 3TPUA 2F7RA 4NP4H 3G5WA 2CBMA 3J7HA 2Z0BA 4E42A 5CKAA 4PJ6A 4KJYA 3AG4B 3FB7B 3OAWA 4FG6C 4G1EA 4YNYA 5IUSA 1A4JA 5IY5B 4AJWA 2V5YA 1D9KB 5T3XH 4LO9A 5I24A 1A3RL 1I1AA 3ULUE 1KBGH 4NO3B 5SWZB 3VH8B 4POZD 1KT2A 5F96H 3C60C 1E3ZA 2IANB 5IJKA 5L6YH 3DJ9A 1L5GA 3KCPB 4I18A 1S8DB 1U3HA 3C8KB 4ZW6A 4Z7WB 1A65A 3D0LB 4OLVL 1RZFL 2WJ5A 4NQDB 1D2OA 4XVUD 5I1CL 5T3ZL 2E76C 1NSNL 3QDAA 5TF0A 2ADJA 2EIZB 2IG2L 4HJIA 5DHVB 1O6SB 4PGCA 4UQIM 1NUNB 3QZOA 4UINH 3S3CB 8CGTA 4FJZA 3PGDA 4M1DL 1F90H 4N9GB 2XG4B 1JAEA 1VJSA 2V17L 1A9BA 4OSUH 4LBEA 2XA3A 3P11L 1J0IA 4E41B 3D2UD 4OUUA 3S4SA 1NGPL 1KGXA 4GG8B 4YXKH 2EH7H 2WWKT 3D0VA 4LL1A 5IVNA 3PJLA 3T5WA 3E80A 1R24B 2KI6A 4XBMA 4IEFA 1DLFH 5DHXB 3MTRA 3QCTL 4QYOB 4AG4H 4O2CA 2P24B 4K71B 1UZGA 5B21A 5IQOA 3Q5TA 3WTXA 1XZ0A 4S1DD 4TLKA 1RLBA 3KJ4B 1UFUA 2GW5A 5A2KH 3T2NL 3GJFA 1OCWL 3G3LA 3GMLB 4AKOA 1T83C 4OVVA 1FFRA 4QWWC 2A9MH 5I23A 4M8QB 5E9DE 2JNZA 2FL5B 5FCUH 5H37H 4NB7A 1DJYA 2C4FU 2UX7A 2VRQA 4XVTL 4NQXA 2JELH 2CAKA 5FM5O 4AQOA 5FO9B 2EILB 2J1YA 3HE7A 1UM5H 1NMAL 1GOGA 1FYHB 1QHPA 2YFOA 3GUFA 3TJHD 1IFHH 1YNLH 3D6GA 3QXWA 3QFJA 2UXVA 4RMQA 3REWB 3SDDA 3VTTA 3NZSA 3DMMD 1BQRA 1IEBA 1VACA 4WWKC 4PJ5A 1CG9A 5D1QC 3T65A 4X0NA 3PWPD 3UGXA 1U4FA 3ULSB 5T5NF 4I3RL 4GLRI 1OE2A 3C5ZB 4LCCA 3WTSA 2PCPA 4ZTEA 1P9MC 1P5UB 3SE4C 4JZJA 5FUCE 3JWNH 5BO1H 5EU5A 1QATA 1JN6A 3FTUA 3MBXL 3QR2A 5TPWH 4KITB 4MA3A 2YRZA 3DURA 5TD4A 4PJBB 3FXIC 3N44B 4HFWB 3JV4A 4TPRL 5I1KL 2CDFB 1A7NH 2LAAA 3G6DH 2VAAA 4ZX5A 1EAOA 3H4HA 3RL2B 2QPEB 4JO2H 3MYJA 5JORB 2P28B 5E5MA 4MCZA 4HWBH 4HKBB 4UT6L 4PPTA 4JO8A 3T6XA 4HJ1A 3WKQA 5B39B 3FQWA 3PE9A 3KJ6L 1ZTXE 2RBLA 5D1QE 1I1YB 3MI6A 4JE4B 3TEUA 1BFTA 5ACZB 3KCWA 4KMTH 1JF6A 2XWZA 2XV2A 3WJMB 4PJXF 1JHTA 1NQBA 1WBXB 1QFUH 2UXTA 3FONB 3I6KA 3NDZE 4RGMC 1G4MA 5GGSB 3UADA 4BKSC 1BAGA 3LKQA 3TVMB 4FYTA 1T0OA 3OG4B 2HMID 3QPXH 5CD5C 1NFIB 1ZK5A 3BWUC 5G5DA 4YDIH 2VDRH 4JPQA 3T0ED 5IT2L 5AVZB 2VJ0A 4M7KL 1L9QA 4X4YB 4J3OG 4TNWK 2JQZA 4FFYA 4YHKH 1S5HB 3OVUB 4JZOA 1TJMA 3FTYA 4NP9A 1SOXA 3TVMC 5HXMA 1Q9KB 4FULA 3EGXA 3M7OA 1UA6L 1JF5A 2YEQA 2VQ4A 3AABA 1BPVA 2AXGA 3FHAA 4HUNB 5GS1C 4JFDB 4Y1AE 2I24N 4FZ8H 2WYIA 4E9SA 1L9OA 4XNQA 1ODUA 1RULH 4FLQA 4WFGE 4DQOH 3QUMA 4G6AC 4P2CG 1KEGL 3MUGB 3WO4B 1BLIA 4LGSB 4YSEA 3Q0HA 2R4RL 3BWSA 4N0UA 4PG2A 1T5XB 1TQBC 2Z91A 4ESKA 4LCIL 4Y1AB 1VFAB 2Q3XA 1I53A 4A67A 1J11A 1TNNA 1QZ1A 2X7LA 2J5LC 3L9EA 4UQCA 1PGRB 1UZ6F 5JW4M 2ZX9A 3VI3B 1UH4A 4NQCA 1U8CA 5E8PA 5FDWA 1J1OH 4GAGH 3WSQL 3B7SA 1I85A 3ZZLA 1EJFA 3UAJA 4N24A 3HRPA 1WWBX 2VABB 2X2UA 3QNXB 3ZSSA 5ENWB 1AJ7L 1Z9MA 4K5NA 4UANA 3NJIA 1KNOA 2PR9A 3EJRA 1PTZA 1QLFA 4D9RD 1FNGA 5LQBL 5JUEH 5HVGB 3GBNH 1S9VA 3FT2A 5JIPA 3L4XA 4ZOCA 3HBZA 3U1SL 3D87B 3UPAA 4HT1H 5IMOA 3ZKSD 1J8RA 3WTYA 2GFBB 1U8QA 4YDLC 3OG6B 3CFUA 1KIUA 4R5VA 2FX8H 4UT9A 5D4JA 4EI5A 2XICA 2CIKB 4CN4A 1GMEA 2VAJA 4PGDA 1FG9C 1JPEA 3SE6A 4E36A 3RNQA 4YNYB 5DS8B 4QRTA 5FW6A 2GJZB 4OFDA 4OJYA 5B8CB 4PJHF 2VXUL 1RIHH 4RZCB 2QPUA 1BF2A 3QG6B 3AG3B 3KWXA 4DKTA 1NGXA 4XWGH 3SGJA 4YDLB 1IGML 3FUMA 4GI8A 5IR1B 1NIBA 5HI4C 3ARBB 4YZFF 3DARA 3VFMA 4LSVL 5IEKA 1X9UA 2A73B 4PJ7F 3VFGH 1AGCA 1UM4H 3RILA 2WBKA 1BMGA 3GMRA 4UM8A 1Z9OA 3KLHD 4CC4C 2OK0L 4LPTA 1PVHA 1OP9A 1OGSA 3ZHDA 4KAQL 4MJIA 1FDLL 2VIRA 4N2HA 2O26U 3DVGA 4KJPC 1UD5A 3VI4B 5FYJH 1A6ZA 3LN9A 1FBIH 4U1SA 1R3LB 3P30H 4KJWC 1FVCA 3PUCA 1PD1A 2AXWA 4U1HB 3RAJL 4BKTC 1WO2A 2WLMA 2A4CA 3A67H 1N0LA 4FOMA 2OJEA 2WOYA 5H4ZA 1T1WB 5C97A 4P2OC 5JPNC 1U2HA 1N6UA 2XZCH 4RWYH 2WK2A 2BSEA 1KCVL 2JCCA 3V4VA 1OWWA 1ZLUK 3IDXL 1HL8A 5CBEB 3C12A 2EE2A 4Z95L 4NM8H 5KVDL 3MCKA 3WEBA 5BZWA 1DQMH 1T2XA 2CNZA 2H6OA 3EKCA 3N6YA 1X4XA 1E5YA 5EEVA 2EXYC 3RGVB 1FRGH 3R0NA 2BSCA 5D70L 4EI5D 1TLKA 1XB3A 5CZXD 3P9LB 2X1WL 4U6XB 4JFHD 4KK8C 1DQTA 4L1HA 4MMZA 5DZ9A 5I1LB 1E50A 4PLJC 4M8QA 1U8IA 1XGRA 4XPTH 1KPVB 2BVTA 4OGAD 4BZ1L 2FEEI 5AYTA 2EDNA 3DYPA 3KPQB 1G9NC 1W0WA 3LRMA 2PMZA 2COVD 1AXSA 5I8EB 4X6DE 3PF2A 3QIWC 5AG8A 3IDGB 4FABL 1RJZB 2I5YL 5IW3A 1JYVA 4B5ZA 4JM4H 5F7MC 4XI5C 4HUVA 3BWUF 1KENL 1KTDB 4KI5C 1KJVA 2HKHH 2QQKH 4A6YB 3SPHA 4OJDH 1CXKA 1U3JA 2BIOA 2BVEA 2FIKA 4EXPX 4YX2H 4YDKL 3J2PA 4PJDF 4H8WH 5J1TC 2IPTL 2IGFL 3SPIA 3IF1A 3FU7A 1CYGA 1LYQA 5TFSL 1I82A 3NCWA 2BVPB 3QUZC 1A7QL 2XU9A 1DFBH 1T7ZA 1E9OB 1IM3D 2JB5H 3KYMB 3MLUL 2A6IA 1DBKL 4P59L 4EPSA 1BFOB 4TVUA 1PG7L 4WFFE 3FU5A 4PGBB 4E9WA 4G5AA 2EJ1A 4DPAX 1MH5B 2O30A 3R06B 3KYAA 1YHPA 3Q6GL 2R1XB 3M6DA 4XAWH 4YZWA 3TEXA 1GZQB 4AUYA 3HZMB 1I7TA 3LB6D 5DEGB 1GGCL 1U2CA 3V4LA 3M1BA 1Z3GL 1QSZA 4OKVB 5JNYA 5DURD 4UU9A 3OJDA 2E27H 2BERA 4X4KA 3AXHA 3QCUL 2BWQA 3NJJA 4Y4KB 1TZGH 1ZIBA 5E23A 1A7RH 4ODHH 2QKIB 3HUJF 4IDLA 4LT7A 4BFKA 2NZ1A 4XPGH 5ES4B 3V0IA 2HFGH 3S34H 3HI5L 4HZLB 3MU3A 4I3SH 5L9DH 1QHQA 3T3MB 5D72H 1YECL 4KU1A 2ICWI 1M05A 3TU6A 1LQBC 4BKLA 5K9JL 1FZJB 1RPQA 4JANB 1QG3A 1CBVH 3QCVH 1MNNA 3MV9D 5JHLH 3IETB 4AEIL 2VSDA 3LRHA 1KTKE 1FL3A 3WGVB 2IDQA 2EIDA 1N6VA 2VDKL 1ZA6A 2NY4C 1Z0MA 5DLLA 4OD1L 1XD1A 4XRCA 1FO0H 1Z9SA 4CDGC 3PUUA 4J3TA 4TTGA 3FO2A 1D9KD 1P0SE 3N44F 3A6OA 4DN3H 2W81C 3K72B 1OB0A 1XX9C 3W0WB 5KBNC 5EIQA 4K3DH 5C1MB 1A7PL 1MF2H 5B1AB 1GTNA 3DVNB 4MLIA 3S6CA 4WTZG 4M5YL 4QXWA 4IOFC 2QGEA 5IIEB 3GLAA 4ZJ9A 1U3ZA 5JHDE 5DSCB 5HPMA 3PDOA 4GPVA 4LSTH 3N40F 2EICA 4W9CC 3U1PA 5K9QG 3HHSB 1INDL 4XZUA 2OA9A 1CYXA 3RKPA 2DW5A 4ZW7A 2KBGA 1TQTA 3B5TA 3DX2A 3KPSB 1H3TA 2OMT