5KJ4A

Crystal structure of mouse protocadherin-15 ec9-10
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
228
structure length
228
Chain Sequence
MNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADPPGMPASRVRYRVDDVQFPYPASIFDVEEDSGRVVTRVNLNEEPTTIFKLVVVAFDDGEPVMSSSATVRILVLHPGEIPRFTQEEYRPPPVSELAARGTVVGVISAAAINQSIVYSIVAGNEEDKFGINNVTGVIYVNSPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDENDHPPVFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protocadherin-15
publication title An elastic element in the protocadherin-15 tip link of the inner ear.
pubmed doi rcsb
source organism Mus musculus
molecule tags Calcium-binding protein
total genus 50
structure length 228
sequence length 228
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5kj4A02
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5kj4A01
5JYLA 3LNEA 1NCJA 3Q2NA 3FF8A 1L3WA 3UBGA 5DZVA 4ZMNA 4ZMTA 2OMWB 4AQ8C 1EDHA 1WYJA 3K5RA 4AQEA 4ZMZA 2WCPA 5CO1A 4NUPA 3LNIA 2X2UA 4AXWB 4ZMOA 4ZMXA 3K6IA 2OMZB 4AQAB 4ZMPA 4NUQA 2A4CA 4ZMWA 1WUZA 5CZRA 4OY9A 3K6FA 4NQQA 2O72A 3UBHA 3MVSA 1ZVNA 4QD2E 4AXWA 4XXWA 2OMVB 4AQAA 1O6SB 1OP4A 1NCHA 2WHVA 2WD0A 2OMTB 3LNGA 4AK1A 2YSTA 2OMYB 4ZMQA 1FF5A 2WBXA 3PPEA 4APXA 3K6DA 1NCGA 3LNFA 1Q1PA 2QVIA 2OMXB 1ZXKA 4APXB 3UBFA 2A4EA 2YQGA 3FF7A 4XXWC 2QVFB 3Q2LA 4ZMLA 4ZMYA 2V37A 4AQ8A 4ZT1A 2EE0A 1SUHA 2OMUB 4ZMVA 3LNDA 5JYMA 3K5SA 3LNHA 4ZI8A 4NUMA 3Q2VA 4ZTEA 1NCIA 3QRBA 3Q2WA 5KJ4A 4AQEB
chains in the Genus database with same CATH superfamily
1FC2D 2EO9A 5F3HA 1FI8C 4POYA 3KM1A 4HX1A 3FONB 3ZMNA 2XZQL 2IWEA 2NY6C 5SX4I 5HGDA 2AXJA 4G80A 3V4PL 5BQDA 3CVBA 3LKRA 3PWVB 2R2EA 3QI9D 1KXHA 3EYSL 1EVUA 3FUMA 1BBDL 3G5VB 3JQOB 1U33A 1KJ2H 5HYJD 3DKHA 4QF1B 4AJYV 4QIRA 2DQFA 1B4LA 2OR7A 4ERSH 2Y7MA 4JANA 2ED9A 2ITCA 3ES6B 1TYRA 4JLRB 1TTBA 1UH4A 2V3DA 3QFJB 4N90D 1I53A 3JSSA 3S5ZA 3O3DB 2AEQH 2X1OA 5DQJA 2X40A 2ERJB 3DLQR 3DX0A 4KJWD 2EVFA 3QQDB 4U3CA 4F2MA 3CFCH 1HINL 1YZZA 3C8KB 1GRWA 1SVBA 3HC4L 4M6AA 4Z7VA 1PLGL 3P3UA 5GJTL 1RQ5A 4PVLA 4XNAA 3QXUA 1DZBA 4KKAC 3KR3L 2X0VA 1ZV9A 4LEOA 3H53A 5CJBA 3KWVA 4D0CB 3GMRB 5E56A 1IM9D 1VESA 2OM5A 3OAYK 1BP3B 2X4TB 1QABA 1UGNA 3EJCA 4JFZL 1NIEA 4V2BA 4DOHE 1IGYA 3B2UC 3NJMA 1GXEA 3H9SE 1YYML 3APFA 1A6AB 3KH3A 2C3GA 3ARDA 5DJAA 2B39A 2F5AH 3K74B 1QQDA 4DGVL 5BRPA 4F91B 2JELL 4X80L 5EC2B 2V5MA 2FX7L 2AABL 4ETQB 2FQGA 2WOBA 5HI3C 3F12B 5GZOD 1UM6H 4MNQA 4CNIB 1LWJA 5CJOH 2R7EA 4H0LC 1ACYL 4OQTL 3ARGB 3HLAB 2EEDA 4L29A 1M05B 3V0FA 4YR6A 2XG4A 4R0LB 3UG5A 4POUB 1GY1A 4KFZC 4BM7A 5E4EB 3C09C 3U30B 1YSOA 3HE7C 3I9IA 5HDLA 5KSBB 5CEYB 3V8CA 1JE6A 4XMVA 3GHPA 2Z4TA 5HDWA 4C4KT 1ZTMA 1JWSB 4ONHB 2XCMC 4YEEA 4ZMVA 3KD4A 1M42A 1T1WA 3BLBA 1KYUA 1XGRB 4PH8A 2H9GA 3FRUB 4MMZB 1LYQA 1UWEH 3VFPA 4N8VB 1M3JA 3HZMB 3MRKA 2DLTA 3GS4A 3G5WA 2LU3A 5CU9A 3LTVA 4OJEH 3UPCA 3DX7B 3MCLH 3BO8B 1AZZC 4QCIB 2XUWA 1GGUA 3MUHL 4L8SB 4TRPH 2EH7H 4Z95H 1NMBH 1X5GA 2NY3B 2HFEB 3R7RA 4ADIA 2LQRA 4I18C 3W82A 4S2SB 3V52H 3VFRB 3OAUH 5F1NB 3MX0B 1WP6A 5D2LB 2UXVA 1J86A 1JZJA 4OAWB 5L7XH 4FFYH 2QHRL 1AYOA 3SO3C 2FIKA 2YO3A 1E4WL 1PKQE 5AUMA 4WJ5A 1EZVY 2YMOA 3D69A 5F6IC 3S2AA 3T3PE 2EE9A 4B9YA 3MO1B 2DYRB 2UY7A 1TUPA 3IKCA 1PKOA 1JGDA 4Y4KD 5BQ7A 1GGCH 3GSUB 3NJNA 1C5DA 4ZFGL 4RWHA 1S9VB 43CAB 4M93C 1X5AA 3UTSA 3TTYA 2FWOB 4NM8L 3RVWD 5I0XA 3AU1B 5J9PA 3NFSL 3IFOA 2DIEA 1W0YT 4HWBA 4X8CA 4BFKA 4JE0A 1NCNA 3LKSA 4BK8A 3HVNA 5JW5B 2EXSA 5L4MA 4DP2X 4CN4A 4PJFA 4UOQA 4P2RB 4NQQA 1GMIA 3CH8A 3LRLA 3BP4A 4F58L 2NNRA 1TZIA 4P2QB 4HKXA 1RUKH 1CG9A 2ZYSA 2G60H 4R6UA 1BSIA 1S4IA 2A9MH 2YUXA 1EFQA 4NN5B 2MQ0A 1BHGA 3CH1A 4KXCA 5DEJA 4K7FB 4JG0L 2R69H 4G8IA 2EUXA 4X9BA 4EZKA 4WUKH 3US9A 1AC6A 3EH1A 4L4JA 2PYEA 4HULB 1HI6A 3KL5A 4OUUB 2FHCA 4E9XA 4UAHA 2AKRA 1ZGLP 2WO3B 3BEVB 5FYKE 1MFVA 5CGTA 3Q9QA 5JIIA 1NFAA 2GJ6E 4M43L 4MA3B 1A8ZA 1D2OA 5ID1B 4G6JL 2XA3A 3DOSA 1FQ9C 3TNNA 1AXTL 1BZOA 3FU3A 4TQ8A 1JK8A 3BHBB 4DN3H 5JIDA 1B9KA 3L3IB 4J1UA 3AVEA 1A6ZB 2VZ3A 5J3HC 3VFGH 4PD4K 1BZDA 3VWKB 5CFHA 3ZTCC 1TQBC 4QHUB 1GOHA 4CJ0A 1DFXA 2Z35B 2H32B 3LKPB 5EWIL 4AVKA 3CZUB 3CHRA 1QG3A 1IEBA 4CSZA 4DKEL 1CS6A 3LN5B 4WO4D 1ZSDA 3LY6A 1U91B 2KT6A 1YMMA 5FYJE 1BXVA 4X5WB 2XQBH 2YAFA 4ZNEA 5EPMA 2YEZB 4DOHB 3PWPE 3CXDH 4HIPA 1A7PL 3V5HB 3H9SB 2HRPH 1BPLB 3LNEA 5EO9B 3M86A 3PGFH 1X44A 5L6YH 1LEIB 3O3AB 2R0WL 2NY4C 4PJAE 4Y5XC 5A2FA 3INUH 5TF1H 4HK3N 3P9MA 4QRUA 5JA9A 1NCDH 4KVPA 1H9VA 4JDEB 1CFQA 2JIXB 1YQ2A 1JL8A 3O45A 5JPNB 3WTUA 4X4YB 4L48A 1J5CA 2IH9A 3ATFA 3ILQD 2XYBA 5T3XH 2WUCH 3FH7A 1I1AC 4PYHA 5H4YA 1L9SA 1TVHB 3RI5K 2AQ3A 3V4PB 2FZ3A 3KNBA 5BZDB 3LNIA 1C08B 3VDAA 4MQTB 1FUNA 5FX3A 4XZUA 1HDMB 2VR5A 1OGAD 4HMDA 4ZQKB 5GGVL 3RZCB 3IMSA 3L3OC 1CLCA 3RVTD 4AEFA 4EAEA 5F7YC 1P5UB 4PJ9D 3MXVL 4HUXA 1PZAA 2XY1A 1ETA1 4KOCA 4MBOA 1KB5H 2XG5B 1MY5A 5CIPA 2BOCB 1KTDB 4OZFA 3TURA 4AGNA 4C83A 4AEIL 1ESOA 4MZ2A 4JKPL 2MCPL 1B90A 4KO7A 4XNUH 3D0AA 4XWOD 4NC0B 3GEFA 4OJFL 4J8QA 3DX2A 4FFTA 2E4FA 4OJYA 2WHVA 1G7QB 2J4WL 2VZTA 3L4VA 3LEYL 1EV2E 4U6HA 1X5JA 4XE5B 1TJHH 3PHAA 4M4RB 2WGNB 5C1MB 1OKEA 3C6SA 2VNCA 4U1HA 1PKQB 1M57B 3T3PB 1GZHA 4RMRA 5F7WC 1S3KH 5EORH 3B6SB 1J0IA 2CRYA 5EIVA 4PJ6A 1A4KB 3NCJL 5EZLA 3CDZA 4LOVA 1R5WA 4MZIA 3SQBB 1OQOA 1HTYA 5BJTA 4F7EB 1UXMA 1VFBB 2IDTA 4GMTL 1OAKH 3TYFB 1I8UA 1INDL 2X1PA 5EUOB 3ECBA 2RH0A 1UZ6E 5ILTL 4RFNB 3TA3B 3AWFA 3POCA 4GIAA 2OL3L 1R33A 3UC0H 2XZAH 1CR9L 2WXFA 6CGTA 4JPKH 2GC4C 5LHDA 3QIWC 4Y4FC 3VI4A 2X42A 3PG2A 4ZAKD 3QCVL 1GHFL 4OLYH 1ZLSL 4I0PA 4KI5C 3BKYH 5ES4B 2VABA 2YKLH 4JO2L 2HFFA 3IDMA 3K46A 2VAJA 3VYPA 3CAFA 4Z7WE 5IB4A 2VC2H 5JW4R 4EKJA 3P69A 4JRWA 3QPQD 1YEJL 2OKMA 4ZK8A 4Q4EA 4G6KH 1GC1H 2XTJD 4IOIA 4M48H 4M7LL 2PXYC 4H88H 4KC3B 3ZE2E 3FCSB 2AC0A 3UBGA 2BOLA 2VUOA 2B4CL 3VQ2C 5D7IE 1FPTH 2AZAA 1FCGA 2QPDB 4URKA 4JFXB 1KBWA 4BIKA 3ESNA 3N85L 2H41A 4GQZA 5I1EH 4OZ4B 3MV9A 5EZOL 2XLLA 3MLXH 4I5BA 1SRDA 4PTTB 3Q05A 2WBWB 2HB0A 3MA9L 5KS9F 4DP4X 2X38A 1UB6B 4QT5A 1TEYA 3UZVB 3W9DA 1XGPB 1AHWB 1KB9J 4PIRF 2BNQE 4YE4L 5GS1A 4QEGA 2VM9A 1JV5A 4MJ6A 2WCGA 2Z65C 5BCAA 2VR3A 3QDGA 4HEME 1I31A 3WFDL 5HHOA 3LKNB 2IANE 1CTNA 2A9AA 2K3TA 2WQVA 3W81A 2KMWA 1P9MC 4LHUB 5DZNA 1Z9NA 4G83A 4N8UA 5LBSA 2VLLA 2WWMD 4M56A 4GRLD 4Z7OF 2WQSA 4PS7A 3RQ3A 3JTSA 4C47A 2M1KA 3PWPB 3QCTL 4NNXB 5JOEA 1OAXL 4GPVA 1U0QA 4NZUH 1JK9B 4TOYH 2G2RB 4X5PA 4KDTC 5GGSY 2I7OA 4RNRB 1XHHA 3QA3A 2WLNA 2VDNL 3MYJB 1YJDH 5F89A 3TPKA 4PJ5A 3U6XS 4ZFFB 5FIEA 1F5WA 1SM3L 1VGEL 3LQZB 4NLHA 1XD0A 1RZJH 3B5TA 4S1RH 3BPCB 3C5ZD 3QUYC 4GAJH 4MAYA 4RSYA 1LD9B 4K94H 2N3JA 2Q3AA 3QHZL 5DHDA 4BJLA 3BPNB 2IFFL 1FNGA 4BYHA 1KYFA 1UFGA 3VA2C 1B0RA 1PW3A 3P2DA 4NKDA 1MWAB 1RCYA 2WOYA 4JRFA 3MACL 3CQQA 4RSVA 1PZ5A 4BKLA 2BW4A 2NY1C 4M1DL 4PCYA 3EDJA 4WTQA 1WZ1L 2AI0L 4ZW3A 2YC1A 4UV7L 4G7YL 1L3NA 3BVWA 2BDNL 2OYPA 4RWYL 3NJGA 3Q8AA 3UBXG 3LDBC 3DUSB 3PABA 5DT1L 2IPUG 5C7XH 4Y2DC 1IM3B 3KPRD 4YGVA 4WHDA 3NRFA 3QCUL 4XOEA 3WEMA 4U7KA 1BM3H 2A74A 5DJYB 5EUKA 5IUCA 4H8PA 4OGXL 4ZO7A 1N26A 1OPGH 4UU9B 1Z0MA 3S98A 1N5YH 1VRSA 1A3LH 3TEYA 1UUNA 1Y6NR 2AHIA 3RPIA 5E4AA 3WEOA 3TZVC 3SB3A 3N0PB 2DMKA 4PBXA 4LGRB 1NEUA 2DBLH 2NDGA 4G6FB 1U8OA 4NQDA 3MTRA 4P4KA 1LO0H 1J8SA 3MPCA 5KYYB 3WE1A 4GRWB 3FO2B 3RJDA 3WENA 3CC5B 1U58B 2EDHA 3NACL 4YSQA 5K33A 3S3CB 2R39A 1VFOA 4MNGE 2E27L 3OF6D 4JM4H 4FERA 2CHXA 5KAQG 2BJMH 3IRPX 1VGKB 2BS71 4KTEH 1TCRB 2WINA 2YD9A 5E1AA 3KWTA 3CV5A 3WFBH 1DDHA 1MIML 3GBDA 4AOFA 4ZMWA 2P24A 3GLDA 1RJYB 2PO6D 2DTML 3LQAC 3CE1A 5LLIC 4TQHA 5J1AA 4BCYA 5KUKA 1GTNA 3T65A 3QEGH 3QIBA 4HIXL 4IIZA 2WZPA 1PDKB 3UYRL 4KZEL 4QMEA 1LK2B 4TL4A 1SHXA 3A6OA 4QD2E 4UOZA 4Q56A 3SKOB 43C9B 4YXLH 2VXQL 4Z7WB 5LJYH 4JPQA 3PWNA 5TE4H 4XP9H 1OARL 4A2LA 4WHYG 4CC4A 5BUGA 5HDQL 3BJ91 2EVJA 5CJ5A 4N24A 3Q2CA 4X2UA 2Y22A 4FNQA 3IN0A 2YXFA 1A1NB 3DYOA 2EDFA 1Z32X 3EH4B 3RDTB 4APQD 2EDQA 5D5MB 5IROA 1UJTA 2ZSVA 5E4OA 5D2NE 5ID0B 1R34A 2ZUTA 3RA7H 4DUXA 3L9BA 2NXZD 2ZXBA 4Y2OA 3GBLA 3ZW3A 3MA7B 4IW4C 2CDFB 2EYTA 3IS1X 2BNQB 1S9XB 3VGHA 5IEKB 2AK4A 1N0LB 3CZGA 2VRQA 1MIEH 1E3FA 2EO1A 4NRXB 4HLZG 4PJ8A 5HJ3B 3O9WD 1YO4A 2ZYRA 3U83A 2AJUH 4PGBA 5DMIL 4HKZA 5IHWA 1QLEL 5LXGH 4RMQA 4NQED 4PP2B 1XGYL 3JV6B 3LZFL 4H26A 4EUPH 3W38A 4F92B 3GUTB 3ARDC 3MLPA 4F37F 2OFQA 4UILH 2PP8A 2B5IC 3BXNA 3S88H 4MJ4A 4FNPA 3V5DA 2OL3B 3EFOB 3K71B 5CLZA 4F7MB 1NJ9A 1NMCC 4P5TB 2CRMA 2DWDA 5IT2H 3B2DC 3L6FB 4YHLL 4ACPA 2FH6A 4HEPA 2QSQA 1Q94A 1IBHA 3Q5YA 4FQCH 4OF3A 3S9DB 2X89D 3IDIB 3OC5A 5B4MD 4A6YA 1OTTC 2APBA 6PAZA 4W6XB 3UO1H 3OKKB 3D25A 1PCXA 4KV5E 2X1QA 2IAAC 2A7BA 4YHPA 2NYYC 3TEXA 1QSZA 5IBTL 2PYFB 1N7MH 1HHGB 1GGIL 1ILSA 4KMLB 3RFZA 2E4TA 2X4SB 4ONOA 1BIIA 2WCPA 1UA6L 1FFPB 4ZUSB 1HHJB 3VGAC 2IWGA 3I50H 4LDOB 5DUBA 4HXBH 4E9LA 3HC0A 3DV4B 1EX0A 5C07A 3QUXA 3RY5A 5IJDC 1B6DA 2LAGB 2NY7H 4YDVA 5AAWA 1OSPL 2G0KA 3N42F 5C09A 5HPMB 3NIDE 1BGXL 4XR8C 3HIZA 5E00B 3CMGA 4HV8B 3FSAA 1U8IA 3TONA 1IGTA 1RP8A 1REIA 1AXSB 5AVRB 2F53A 3H54A 4EQ3A 2C3WA 1QO3B 2BRQA 5IMKB 1DVXA 3WG7B 1RIHH 4BH8B 1UG9A 4PJIF 5CSGA 3DXAD 5EFIA 1C16A 3VI3E 2WBKA 3SE3A 1RI8A 3H6AA 4CC0A 5L8KB 4N2GA 4WUUD 2AQTA 4OF7A 4WEUD 3WUZA 5MEND 4S0TD 5I0YA 3T77A 3KPNA 3ASWA 3MLWL 2JJWA 3U6RA 4ORZC 1AANA 4M3JA 3NZSA 1YNTB 3U1PA 4B9JA 3I02A 3FBQA 4WFFD 4FZ8L 5LQBL 3B2XA 4N0FB 5D1QC 3I3DA 1UJ3A 2L04A 4JREC 5GIRA 1EEQA 5LDUA 1EHLH 2BINA 3D2UA 4Y19B 1F6AA 4MNGB 2OR9H 1G0YR 4OZIF 3GMNB 3CN4A 3ALXA 3RU8H 2QQLL 1G9EA 1L5GA 1G7HA 2FX9H 4V2CB 1T21A 1EEZA 2NYZA 3F8UB 3JUZA 3SDCC 5I76A 1AP2A 4XN8A 2G5BA 2X4RA 2IF7A 3FOMB 3VXUA 4WI5A 3IFNL 2W9DL 4DEWA 1KCSL 5DUML 4GAYB 4M4PA 3I6KA 2IH3B 3K8LA 2YD4A 4FN0A 1JTPA 4P4RB 3EH5B 3GSVB 4JFQB 2MRYA 3VD3A 3J7HA 2AEPL 2DQCL 3EYQC 1UWXH 1OPOA 1QA9B 2WGXA 5KN5A 1B0WA 1OM3H 5T5FA 2NNAB 1KELL 3PFQA 2YEVB 3PP4L 5AKTA 1BMWA 4Y5YA 3Q1EA 2P5WD 3L81A 1CVRA 4PUBL 2XWBB 1JV2A 3SGEH 2Y24A 4PG9B 1SYSB 5D2NB 5I1DB 5FECB 4YSDA 3BVVA 1EAJA 2CSPA 2QPEB 4IS6B 4OIIL 4IOFD 5IBLD 2ZF8A 3ISWA 1KYDA 2VDQL 3MOBH 2VMJA 4WWID 2ZAHA 4K2UL 5DFAA 1XCTA 4Q4IA 4L23A 5L2KA 2GJZB 5LAXB 1KEGL 1H9DA 3R8QA 2J5LC 3K72A 1XIWB 2V9UA 3OTTA 3VFSA 1T6BX 2VB5A 1YECH 2ITFA 4Q7DA 4X7CC 4CW1A 2NNCA 1CICC 4UWQB 5HHQB 2O1AA 2F7QA 1NCTA 3U9PL 4JKLA 1WRFA 3QWOA 4MQXC 3VE0A 4CILA 4ES8A 1Z3GL 4AZ8B 4OI7A 3JWOH 2EH8L 2VE6A 2H3KA 4HJSA 4J27A 3HG3A 2NMSA 4M61A 2RAMA 1GKEA 4HHAA 3MFGB 2CBQA 3J8F7 2LFEA 4Z7QE 4IHOA 2PR4H 1OAQH 1TOXA 4XCYB 5F8QC 4H2AA 3PP3K 4C56E 3IDUA 3OPZL 2YZ8A 3SGDI 3ROOB 5I71C 4MXWH 5IM7A 4AENA 1P4LA 1R75A 2BCKA 2IO5A 4F7KA 3VTTA 3MREB 1RK0B 1S2EA 3CFBB 4JUTA 4P5KB 3SKNA 2OULB 5A6LA 5JHLA 3CUPA 2JFCA 2Y6SC 3OKOB 2D9CA 5LBGA 5D7SH 1AO7B 4L1DA 5AOIA 2ORBL 4ZDHB 4KJYA 1XFPA 4H8UA 1PLCA 4XNZC 1QKZL 1BYOA 4I1NB 1I9EA 1ZMYA 4UT9L 1J0ZA 4PB9L 3S96B 4OZHF 1JPTL 3ZE1F 1CD1B 2HSIA 5IOKA 1M7IA 4GS7B 4UAOC 1DVQA 1UVQB 1S7UA 3LKOA 1ZHBB 3P02A 4JFPA 1KIQA 3Q5OA 3NIDB 4YHIB 3UPRA 3HI1B 4U4BA 3SCMD 1R3IH 3BPLC 1F58H 2R4RH 4HQQL 1FL5B 4ZFZB 1J88A 1NGWB 3FDWA 4RIRB 1AD0A 4QJ5B 5F9WB 2NZIA 1IVLA 3MZTA 4P46A 4EJ1C 4UDTB 1YPZB 2BIIA 3V6FA 2BRRH 3LXBA 4CC1A 1BX2A 1O7VA 1VADA 3QUMA 3VI3B 4R7NB 1GZHC 4QGYA 4HU8A 1MAJA 3SSGA 4XPHH 3CVHH 3LS5L 5CLWA 3VXPB 3J07A 1DVFD 2FEDC 3IFLL 5EN2B 2I32A 2BY1A 4FA8A 3FTWA 4TNVK 4BA0A 1RUML 1T20B 4JO4H 1TQTA 5DRWB 5EU4B 3KDMA 3M1BB 2CKBH 4OIBA 5GS2D 1ZK9A 3WEAA 1IT9H 1X9RA 2BK8A 2ZOLA 4R97C 4TSCL 5F88B 4ABQA 3OWEA 5IEHA 3EYOA 4P23C 3MJ9L 1WFIA 5JORB 3VFNA 1DZ0A 1L9OA 4YHMH 1MFBH 4NUPA 2PLTA 5DD3H 1OAYL 4HEPG 1KJ2A 4I0PC 1DQKA 1F2QA 2YRLA 4JFEA 5ABZA 5JXAH 5D72L 2J12B 3RX7A 1Z2KA 3TN0B 1A4BA 1VACB 1HNGA 4PJ7E 4PR5A 4FULA 1JF1A 3HS9A 3TIEA 5MEQB 4LEEA 5D7KD 4F93B 5ESVB 3PWUA 4JZJC 2WM0A 1DCEA 4IKIA 2EZ0D 4KRPC 4XO5A 4YUEH 3RVUC 3SE8L 5EZJB 4ODHL 2R0ZL 3B7SA 1M2VA 3QFJD 5C0EB 1U3HB 1GAFL 1C9SA 2XNAB 4K0OA 1LDSA 3RTQB 2B2XH 3SPVB 4W9GC 2MJWA 1BXUA 3ZQXA 4ZFOA 1IGCL 1UASA 1NDMB 5DMKA 5F7MC 4KX7A 1JRHI 4MFHA 5DVPA 5GS1C 3ML9A 5GQBA 4WTZG 3RY4A 3LIZL 5KG9B 3MJ8B 4WK4B 2LHAA 2PW2A 1JGVL 3LIUA 3L54A 4BQCA 5DSCA 1D5IL 3MBXL 3H7BA 1H8SA 3QVAA 3SDXE 4K8RC 4IMKA 4QOKE 4DVRH 1ODUA 4WV1A 5E2VH 3L5IA 3MBWB 1CK0H 1CDGA 4HF5H 4ENED 1BWMA 2C9SA 3PNWA 1FNHA 2QDWA 35C8L 4I2XE 2FR4A 3BVNA 4MDJB 1HXMA 5BMFH 3FU7B 1JGEB 1WBXA 1IGFL 1QPXA 1OAZH 3F05A 3VFWA 3ZRFC 1AS7A 4HU2A 4LLUA 5GSRB 4FI8A 4AYBA 4YIQB 1QI4A 3ULAB 3ARGD 1K6QL 1D7CA 3S36X 2FB4L 3VXQA 5E5MB 1U8MA 4GSDH 3CMOH 5FYKU 4NUJB 3EJQA 5DCCA 4J8RB 4MAYC 4XN2A 4K5LA 1FYTD 3C5JA 4XNMA 1ZVSB 1J8HB 1GIGH 4DQOH 2DQHL 1UH3A 2XJKA 3N55A 3TJEL 2AJXH 4X6EB 5I0VA 4N9GA 3LVTA 2DKMA 4X0NA 1Q4NX 3W3BA 2YQ2A 1SLXA 3MU3A 3S6CA 4HS3A 2AQ2A 3OZLA 1BOGA 4U3SA 3FTZA 2KKQA 4LRIA 3BD3A 1TCMA 4YS4A 4PS4H 5HHMB 5I74B 3ZDXF 5CJQL 4QTIH 3UJTL 1R0AH 1HH9B 1HE7A 5KVDL 4AEHH 4PRHA 4U1LB 3GKWH 4PJGF 3SPGA 2ENYA 2J8OA 4FTVE 2P5PA 1BCIA 4K71B 1HOCA 5FYJU 1PZSA 3MNMA 2A74C 4PPTA 2VDQB 1QW8A 1F86A 2AXFB 2AMUA 4OLWH 3MNWA 2CA4A 3AXHA 1O9VA 5E51A 1ZTXH 1IIKA 5HGBB 2ZCHH 1T80A 1XCXA 1JWUB 3FU9A 4UQ2A 1DR9A 2CBMA 2DQIL 1CF8L 1T66D 3NN8A 3DV6A 3Q3GB 4XHJD 2YUWA 5I15L 3H7LA 4MD4A 4L8BA 1QFPA 1HZHH 2QQNH 5F1IA 5KTEH 2VERA 1WE5A 4XPFH 3BZFA 2A38A 1OP4A 3FTGA 3ULUD 3ARFA 1IBFA 4HPYH 5ABDE 1QASA 3EOBA 4PMFA 4ZRGA 4WSKA 4R8WH 3ZVVA 3R19A 2XXFA 4IHBA 1UOVA 3BIAX 4P2RD 3X12A 2R69A 1IL1A 1AKJD 3CDCA 5HHPA 3KHOA 4L4VE 5HXMA 1SYVB 4P2QD 2G5UA 4APXA 2JCCA 4UIMB 3BQUB 5CHNB 1TF4A 2O5ZH 2AGJL 4MWFB 2YJLA 1V54B 2F54A 4Z5RA 3LZNA 1CL7I 3TBSA 1UYWL 4IRZH 5DJ2A 1U8LA 1GZQB 1N64L 1RJLA 5EIQA 3KS0H 5FCUH 2VLRB 3ULVC 3FTYA 4WZ9A 3DO3A 3BH9B 2UVFA 3S35X 1AGFA 3DOHA 4DGYL 2BX5A 3UCQA 4O2CA 4PSPA 3I6LE 1A3RH 2HG5A 4CC4C 2ZXCA 3B9DA 3GMMA 2E0PA 1A7RL 2LV4A 1Q0YH 4FXGB 1MCNA 4NRYA 3RWIA 3V10A 2KLTA 1NTDA 4KVCL 3MJGX 1LQSR 5KVDE 4NUGL 1YA5A 3DVNA 3CDGA 4JBSA 2EINB 3QW9A 1P1VA 1JTTA 3RJQB 5E6YA 2R0LH 4F2ME 5CS7A 5DQDL 4UQCA 2D7PA 4TUKH 5A3ID 2AJYL 1JZHA 2KPWA 3KPOA 2ARJA 3PXJA 3MV7B 4F2EA 4Z9KB 5F96H 3TBYA 3HTLX 4TSAH 3B7YA 2GSMB 1KCLA 5GRJH 2C3XA 3KYKH 1X9QA 4BDVA 2BP3A 2DL9A 3NH7H 1D3CA 3HZ3A 2WXMA 3QULA 2FJHA 4XCFH 1F0LA 1RPQA 4JFYA 1UEMA 3SDXB 4QOKB 5M7QA 5H94A 3DGCR 4PJXF 1RZGA 4NYLB 3GJFK 3H9SD 1LO5B 3L3DA 4PGCA 3X11B 3GXUB 4Y4HB 1JGUL 1YNLH 3R0MA 5CEXA 1I9IH 3TT3H 2BSCA 3GJFB 1T5XB 2YA0A 1NBCA 2YPLB 3BP5B 2WY3B 4AXWB 1AGCB 1N0XH 1S7RA 1U8CA 1X6LA 5GRZA 4F33B 4XOBA 4M7KH 4Z7AA 3VFMA 5I1LB 1QRKA 1YY9D 4P5MA 3TIDA 2JI1A 1BBJB 2X9WA 4ODTH 4HT1H 4RMUA 3L4TA 4ZX6A 2AJ3B 4XPBL 1V05A 1R17A 1DVTA 1ZV2A 3CCHB 2AV1A 3FRPG 1G9NH 3A0OA 1CU4H 5A43C 2GSIB 3CD4A 3WNIA 2FX8H 3FCBA 3CHPA 2PCYA 2RIKA 2VDLH 3O3EA 4OLZL 3PS6A 1KB5A 3VFOA 5GS2H 3GI8H 3EHBC 4TSBL 3RFZC 2R56H 4Z3HA 1AGBA 1TZGL 1KACB 2OZ4H 2OXHB 3ZUNC 5ICUA 1DSFL 5F6HJ 3PV6B 4KUCD 2I9TB 2ZAIA 5J0BA 4NZFA 4DWHA 2A9CA 1I9RH 3NMEA 5IUSA 4B97A 3AABA 2D3JA 4DFIA 4OB5L 5I17B 1I9JH 3QUXC 5AAWC 1UT9A 1E5YA 4LPCA 2NW2A 2VDRL 5GGQH 2O93L 1H19A 1MH5B 3M1OA 1N9PA 3KCPA 3FFDA 3LDBB 4P3DB 4EI5A 5MEOA 4JK0D 3OJDB 3U1QA 5CEZL 2RFXA 4XNYH 1AD9A 3DETD 3QC5X 2YD0A 4LPXA 3NYKA 4IRSB 1UZGA 4AKOA 4XP5L 3E8UH 2DI7A 1SMAA 2HTKD 2KZWA 2O5YL 4QRRA 2JV6A 2ZWKA 3E2HB 3F7PC 2XVKA 2HRHA 2Z4QA 3FH8A 1R46A 3NCYP 3IS0X 4ZPVB 2V37A 4W6YB 1QTPA 1BFVH 1S7WA 1J1XL 1NFIA 1XF4B 2XXMB 3HE6C 3BIKA 3UTSE 1NC2D 5KBLA 1ORSA 3RLSA 3TO4D 5E99L 1G4MA 4RDQF 3K6SA 2O61B 4AQ1C 1IGIH 3K5SA 5J4MA 3LNHA 3MJ6A 4N4YB 2NR6C 3BQVA 4HSAC 4P99A 3U1SL 5LGJB 1BFOB 3F2LA 3QZMA 3VX0A 1UJ3C 4UINH 4LLQA 4NM4H 4PJFE 4EZMA 4HH8A 1C8QA 4XI5C 3TA3D 3S5LB 2K8MA 4FFVD 1QLRA 3QZWG 4X0KB 1D5MA 4L9LA 4L4VB 3IDYB 3WIHL 2R29A 5I5IA 1KEML 1WTLA 1DVUA 2B3RA 2CE6A 2YMXH 4LCIH 2ZP8A 4NI6A 1DUZB 2AF2A 4M7ZC 4DHLA 1NCUA 2A9NH 3GS0A 2WC7A 4HX1B 3WEBA 1CBVH 3HEIB 4M6ML 5AW2B 1P2CA 4OD3L 3N41F 1M7XA 4ILDA 3ZJAA 1HIML 3B83A 2VXUH 4XVSL 3LKRB 1RU9L 4HPOL 1ETJA 1QWHA 1XR8A 3HUJF 2VQ4A 3DECA 2VKXA 4H20H 5FYKD 2D7TL 1U93B 4XC3H 3PY9A 2GJ6D 3A4AA 3NSFA 2APXA 5FOBA 3T2NH 2VRKA 4UOW1 2Q5BA 3RP1A 5E8EA 2HKHH 2WLIB 4N1CA 3CZSA 4XBEL 2UUDH 4F8QA 5CEZE 2A0LC 2J8UA 5ICYA 5DQJB 4Y5YC 3DHUA 1DQJB 3QNZB 4F2MB 4YFLI 2RQ8A 3MGOA 2J56A 1KXQE 3M17A 3QR0A 2BNRE 2Z31B 2DLFL 4OCYH 3GIVA 3PF2A 3CJJA 1S9WB 1SJHB 3ARBD 4FQPA 5EBMA 2OS7A 2L0DA 1XGQA 3WXVH 1AGDA 2V5RA 4HD9A 2EE6A 3CX5J 3W11D 5FYJD 1RIVH 1SQ2N 3QUZC 5FHAL 3D2TA 3LNGA 3HRZC 3GTTA 3SODB 3MJWA 4GG8A 1NAMH 3DPBA 1MCWM 3PAVA 4ALAH 3C60D 4UQIM 3ARDB 2BFVH 3FB8B 1BJMA 1CTMA 2B5IB 1HHKA 1Q9KB 3L3GA 2WSKA 4YDKL 1OTSD 3EFFB 3MRNA 3H56A 4ODUA 3PXHA 2DZEA 2ZNWA 1EPFA 1NGXB 1MCCA 1Z66A 1G7JB 2FBJL 2R7EB 2Z93B 5DZJA 1PZ3A 3FH5A 4P3CL 1KBKA 2YD7A 2VDPL 4MGXA 5FGRA 2M26A 3THMH 2XXGA 4YR6B 5PCYA 4PI2A 2ZYIA 2B9AA 1KV7A 4P05A 2CRZA 2P8MB 4PRIA 3ULUF 4JQXA 4YLCA 3CNKA 3BGFC 1G7PB 2DD8L 4R5TA 5DHYB 3J2PA 4J3SA 5F9JA 5FCSH 1I3RA 4IIQA 3W2DL 4JY5L 3WSQH 1QX1A 3S34H 4GW4B 1T1WB 2NZ1A 3O6KH 3NJKA 5KJ4A 3X1NA 1KBBA 2C9PA 4JM2A 1JNLH 3GB7A 5HDOA 4Y1TA 2Y1AA 3RDJA 1T1XA 1F8TL 1YEEH 2V9RA 2ZSWA 4U49A 5DHMC 5INDA 1JHKL 3WNNA 1L7IL 3GRWH 4Z3JA 1IQWH 4GAAA 1WH0A 2DYPA 3FHEA 4D0BA 2HN7A 2FBOJ 2BZCA 1P84K 3GI9H 4YX2H 3IJHA 3L7FB 2CO2A 3GWJA 5IVXA 2GKIA 2JB5H 3N40P 2WAHA 5EC1B 4MCZA 4R4BB 2FIKB 4MQ7B 5FGCB 3QP3A 5AUMB 5FHBH 3D69B 1X4ZA 2MMXA 3FT2A 3H42H 3T4YA 2UY7B 2GEQA 3IKCB 2D9QB 4EN3D 2C3VA 4GSRA 4XRCB 2Y5TA 2NXYC 5BQ7B 3NCFB 4K9JA 3VWJA 3WHXA 3V6ZB 1ID5I 5HVHC 4A1RA 1CIUA 3K6FA 2WKOF 3GC3A 3B9KA 3C08H 1P4UA 4H44C 3CSBA 2DIBA 3M7FB 4PJFB 2WB7A 4IK7A 3WFCH 2P4AB 5AW7B 1NANI 5EZIH 3VI4E 4DK3A 1BEYL 4UOJA 3HBQA 4R4FL 4G43A 1E9OA 5JZ7C 1Q72H 2EP6A 5DJCA 4XHQA 3CH1B 4K3HA 2NW3A 3VA6A 4IBTA 1NCAH 2ADIB 3EJYC 2WBXA 2MOQA 5IZ7A 1HI6B 4Y1AA 4OI8A 3BW9A 5I75B 1OCCB 5BZXA 4KVNL 2XT1B 1F3JA 1A02N 4P5SA 4QHKJ 3DWTA 1XEDA 1V10A 4NBYB 4X6CF 3JYBA 1ZXKA 1N5AB 1RY7B 3F84A 4PLKC 1VERA 3S36L 3TNNB 2CHWA 2YAOA 4FKKA 5F9OL 2RCSH 3LXCA 5DU7A 1JK8B 3ZE0E 4W9EC 4YQXH 3IU3A 3WY3A 2EKJA 5I1IH 3MV9E 3RDTD 3ECQA 4UTAH 1ADQA 3LEVL 3NJFA 3RWEB 3K0YA 2CA3A 1K3ZA 1OCWL 3Q7JA 3V0VA 1NUDA 3S3PA 1C1EH 1KIPA 2WTRB 1RUAL 3TO2A 1F6FB 1WGVA 3EO9L 4TXVB 4EXKA 2Q3XA 2BNRB 1IEBB 2BNQD 2BP5M 3HFFA 5JYMA 3QDGE 3VQ1C 4B5ZA 1OSYA 4KUCF 1EHKB 5HHOE 1W9XA 5C08A 3U46A 3F01A 4WW2F 2IAND 2MNUA 4MDIA 3U9WA 5IMMB 1IU1A 2HXAA 2AXHA 3QRGH 4XP4L 2FHBA 3TCLA 4IMKC 4LO9A 1K3IA 4PRAB 4MX7B 5EPMB 3W0WB 4EI0A 5IOPA 4WV1C 2IALB 4UV4L 3X13B 3KLHD 5C3IA 4AG4L 2FO4B 4QXTB 5GGTL 1TR7A 1JIBA 2VQ1B 3KPTA 3SDDA 2ZP9A 1T03L 4MCNA 4BZ2H 4NP4L 3NPZB 5FFGA 3P11H 1DBBL 5DS1A 2N7SA 2OW7A 4QRUB 3ABGA 1CFQB 2ZG1A 3ZZLA 1EQWA 2FEEL 1A6WL 3F5WA 1JGLH 1UC6A 4KK9D 4DAGH 5KANI 3QEUA 4QRPA 4YNYA 4WIQA 1VFAB 3WCYA 1WS8A 4AL8H 1ZEAL 2UZXA 2CGRH 2CDEB 1CFSA 4OT1L 3GSOB 3UMNA 2C7FA 3ZKXC 1U95B 4FI7A 5HGAA 3LB6D 3VQMA 2YPKB 1KPUA 4IRJA 4MZRA 1NWOA 4R26L 1D5ZB 2X6UA 4LRIC 1BVLA 1C5BH 4HUXB 3I75A 1FIGL 2X44D 3IXAA 2CIIB 2W07A 5FV2A 3QS2A 4UAOB 2Z1KA 4OZFB 1QRNB 5HHVL 5CP7A 4JGNA 2G2PA 1JHTA 2ZTBA 1NLBL 3L9YA 5DFVC 5D4JA 1AACA 3BZ4B 1MHCA 2Y2WA 4XO4A 1KLFA 2ITDB 3RWGA 4PJIA 3DMMB 1TJIL 3ERXA 1F45A 3S35L 2B59A 1FF5A 3MKKA 5HVFB 1Z5LB 1SXSA 5E6RB 4LAQL 5SWZD 1WICA 1F3DJ 5AD0A 2NY2C 3C6SB 3S5LG 5CZKA 1G4RA 1JZIA 3TC9A 3DJRA 4B60A 1P5VA 1PYWB 3IDXL 1TEGA 3CK0H 5EZLB 3LS4L 1O7DC 2MPVA 1I8KB 2GCYA 4R96A 4NQDE 1R5WB 4PJDF 4JY4B 5AW6B 2QGBA 3NESA 4I3RH 3S4SB 4N0YH 4E42A 3P9WB 1X4YA 3IDJB 4TVPE 4D9LH 4OZIA 2MWCA 4HMCA 4BGLA 4NQSA 3MZGB 3NK4A 1TQVA 3RIAK 4YHOH 5L2JA 1URLA 2C9RA 1NGYB 3ETBJ 1S78D 1XZ0A 4DK5A 5JIHA 2VDPB 3FHQA 3AY4A 5FYJH 1C5CL 1MJ7L 4LLMA 2AK1H 1HL9A 4PVMA 3VI4B 4RISH 1AGEA 3FUJA 1MFCL 4TVSa 3UTZB 1RZPA 4IGBB 3RILA 1OTUD 1ZS8A 2XIDA 2CJSA 3TASA 1YEKH 1KN4H 3IDMB 4JG1L 2HFGH 3HHSB 1GH7A 2W9EH 4H7VA 4PJAF 1IGMH 4NO0D 5JIQA 1EZUA 3S97C 3ARVA 3LZQA 3I9AA 4IOIB 1EXUB 1CFTA 1KJMB 1UACL 4D0DA 3ZRSA 2VGLM 1E6OL 1IEAB 4FC3E 5HTSA 3DTDA 3V0HA 5C0RL 5JUEH 1ZHKA 3RL2B 1KFAL 2APTA 1SPDA 2X1WL 1KFGA 1NGPH 3MLZL 2GUYA 1C7SA 2HP4A 5CCKH 2H0EA 2ATKA 1Y6KR 4GUPA 3UABA 1NPJA 1MCQA 5AFAA 2LU7A 3L3KA 4QT5B 1UCBL 1TTRA 4DQAA 3MOAH 3WFHB 3ZGHA 2AK4E 2XWCA 1JV5B 3CFJA 5KJRH 1G84A 4LQFH 5E8PA 3TX4A 5EF0A 5TQ2L 3S3JA 5IR1B 4IYKA 3BSZA 5IP4A 3NP3A 4FFZH 3KPMA 2OAAA 3DIDA 3W56A 1FORL 2CXKA 2BZDA 3B2UD 3F7KA 4FG6C 4LNRB 3HG1A 4WI0B 5ANHA 5EU5A 3JTSB 3QNYB 4L1LA 2IPKB 3B3IA 1PBYA 1XGUB 3K1KC 3D39A 4HS6A 2CMRH 2JKIS 1S5IH 1CLVA 4A37A 2F18A 3I6GA 4N2IA 1N68A 2Q7YA 3V0WL 5E2TL 5F7EH 2LABA 5HI3D 3SJVA 4BQ8A 1ITCA 3GSWB 2WJ7A 3SD2A 5F89B 1P6WA 1ES0A 3POHA 3EOAB 1A9EA 5FO9B 4U6XA 4JX0A 3LD8B 5E8OA 3K8KA 4WEBL 4C58B 4GKNB 1VPOH 3VFTA 3HAEH 3Q0HA 2JXMB 5CMAB 1EZSA 3UOAB 1AG0A 2K78A 3H9HA 4MAYB 1MCDA 3HE7D 1MJ8H 2BLFA 1GYCA 1QPPA 4ODSH 4CVZB 1XBRA 3VXRE 3FO1A 4ANWA 4JDVA 5B1CA 4ZMYA 4NKDB 2RQEA 1JNNH 4H1LB 2CDGB 3D07A 3JWDL 5DHEA 5F7NC 4A55A 1GA2A 1YCSA 1PZ5B 4S1SH 4BKLB 4X7EC 2Z1PA 2J8HA 2FT7A 4U6YA 5AW4B 2YC1B 3OAZH 3QFDB 4W9FC 1M7DA 3E1ZA 2D03L 3O3BA 1G9ML 4TQPA 3MLSH 1XBDA 3K4AA 4G6MH 4BCXA 4L8CA 3PABB 1VAHA 4EI5C 4AQEB 3MXWH 3RX8A 1KBPA 4Q58C 2F53E 3N9GH 4PJCA 3TPUA 5SX5K 3JTBA 1YEIL 3QXVA 3NCWA 3ZE2F 1YUHA 4NBZB 4XP1H 4QTHA 4Z0XA 1MI5A 3L7EB 5D7IF 4ANKA 2D3LA 4NNPL 4WTXA 3ULSB 4HG4J 4DN4H 2W92A 1LEKA 4AUUA 3RPIB 1MJJA 2VCOA 1YMHA 4RZCA 1YQVH 4LLDA 3ZOAA 2IAMA 3T0VA 3AGVA 4IDJH 4X7TB 1H3UA 1U8OB 1E30A 5I26A 1JGIA 3LV3A 4P4KB 2D0HA 4NI3A 1WT5A 4YK4B 4CADA 1JI1A 5BRZE 3AS1A 3OR7B 4HOXA 4BQ9A 1RUPH 3IRZA 3DURA 4GXVL 3GK8H 3IMTA 1SEQL 2GYSA 3BFQG 1J1OH 1RZ7L 2A5UA 4ZTPL 4XMLH 1HEJC 3EJTA 1DANU 2FGWL 2PP7A 3BUYB 4E9WA 4L9LC 1T4WA 4HCRH 1DDHB 1QSFA 4S10A 4BFFA 3GS7A 1FFNA 3NJLA 3QO1A 2P24B 4PV1C 3VFUB 3VXUE 4V1DE 5C86A 5J1AB 4NXKA 3T65B 3KXFA 4M9PA 2YD3A 5K9QI 3QIBB 4OM1L 4F20A 1AQKH 2CZNA 2X12A 1PIGA 4OGYH 2AQNA 1XDTT 4L5FL 4JZOA 1MJUL 4J3VA 3QWRA 3SDAB 2XQ0A 5BV7L 1BVOA 1ET7A 1ZHLA 4D9QD 3IMRA 2NY5L 3WTVA 2IGFL 5FYLE 2Y0SA 1A1OB 1U3HD 1GZPA 3H3KA 1WIUA 5HI4C 5KOMC 1ORQA 3RTQD 5J3HD 1RFDH 1S7TA 4QXUH 5E23A 1E5BA 1CE1L 1RLBA 4CBPA 1USZA 3D3VE 2HT4C 2OSLB 5I8KL 3HZKA 4UQ3B 1E5UI 3M8OH 4XGZA 2YPVL 4Y2LA 5FPIA 4AYDC 4K9EH 2EYTB 5EBLA 5I19L 4TL5A 9CGTA 5JO5A 4FMFA 4LT7A 3Q2LA 2AK4B 5JDJA 3OBAA 1MQKL 4AK2A 4FZEH 4KMTH 5IWLA 4PJ8B 1ACCA 4PGBB 1E67A 2BVQA 1CLZH 2HPOA 3PLYA 1B2WL 3DGGA 4HKZB 3ZL2A 2JKLA 3EJSA 3P0GB 3EJZC 3UADA 1SXNA 2QVKA 4K07A 1T2QL 3FTVA 1A7QL 4H26B 3ZQ9A 3WXWH 3D12B 3B2MA 5GRYA 4UNVA 1RULH 1W80A 2DQDL 5HVWA 4M7JH 1RZJC 3VXOB 2NY4D 3AT9A 3V5DB 2D8KA 3D18B 5DK2B 1NJ9B 3I9GL 3N43F 3RGVC 2DWDB 1BZ9B 4ABUA 5DZVA 1B0GA 2C7UA 3AG1B 4NP9A 4ICXA 4PGDB 4MAUH 1JNHB 2KLRA 4BFIB 1FZOA 1Q94B 1I1AD 4A6YB 4NZRH 3FZUC 2D4FA 5AZ2H 4C56D 2VMEA 1I7ZB 2YXMA 3GSQB 4JQXC 3D87B 4MQSB 5K39A 1ZIBA 4YHPB 5FM5O 3VXRB 3OR6B 1UUSA 2P46B 1PMYA 2CBOA 2XYCA 4FXKA 4ERSL 4I4WA 3HG2A 3RFZB 1GJUA 1J48A 2DB8A 2H1XA 3EXLA 5DI8A 4AQAB 3BAIA 1GPOH 4PJGA 5CD5C 3OQ3B 2AEQL 3IETA 5ANMA 4JM2C 1NICA 5DUBB 2WYZA 2XV0A 3L9RA 2K6ZA 5C9JA 5HGHB 1W15A 1LP9A 2HVKB 4JHAL 3FQ4A 3X1GA 2EYSA 2WLJA 3NCBB 4HLEA 2FEEI 3ZTJG 1TVBB 1AYRA 2F08A 3JYCA 4JKKA 2NY0B 3N06B 5CNHA 3S4SG 3RBGA 3WS3A 1WQVT 3F62A 3NCCB 3AS0A 2F53B 3KJ4C 3HCVA 4FQHA 4X4XA 2MQ3A 4L1TA 1KLGA 2F74A 4HWZB 4WWKA 4AMXA 3HW7A 5CBAB 2HWZH 4KPHH 1DDTA 1G6RH 1XF3A 1IBBA 1A0QL 2F5AL 3AXLB 3KPNB 2E56A 5KSAA 4LBEA 3U6RB 4PCKA 4HKJA 3VWJC 1PNDA 5K1JA 4UIKH 3QG6A 1CTOA 4YSPA 2MSPA 4PP1C 4Y5VA 4LLYA 1UM6L 5BRZB 5CJOL 3B9KC 3MV01 5JMOC 3NFNA 4HFUL 1JTOA 3RUGF 1IAOB 4IRZA 1KB3A 1F6AB 1WAAF 2WLKA 3GMOB 4GYBA 3VCLA 2Z7YA 1H15A 3QIWD 4Y4FD 3GZOA 4AJWA 2X9XA 1L5GB 1G7HB 5HDRA 5AOLA 1EEZB 3Q8BA 2JKXA 5I76B 1AP2B 4JFEE 4O2EB 4XNQA 2G5BB 4G6AC 4V1DB 2B8OT 5KOVC 5GS0D 2Q7AA 3PRZA 1AXIB 4OBRA 3BRFA 2EACA 3MV11 4L37A 1BXXA 3I6KB 2VH5H 4MD5A 7PAZA 3BKCH 5F1KC 4GLRI 1SDAB 4Z18A 4AYGA 2B9BA 1T22A 1HEHC 2PXYD 3UTOA 1QUNA 2F7OA 3MCLL 3ZKNC 3A22A 1A4JB 3DX4A 4MA8H 5KSUA 3US1A 1KIUB 2WYIA 4YL9A 4TRPL 1LJMA 2EH7L 4Z95L 1GOGA 1SOQA 1NMBL 2WP3T 1YUKB 3FFCD 1EA9C 1IFHH 2XKNA 3KGUA 4KXZI 4HH9A 4X6BA 1GGYA 1LO3H 2F19H 2JJSA 4HC1H 5BXFB 2Q2EB 5L7XL 4FFYL 5B3JF 3D3VB 4NSKA 3VXNA 4S11A 3UZQB 2GI7A 4OKDA 2O30A 1EWHA 2HJFB 2WQWA 2CAKA 5IFJA 1GGCL 3FQ2A 4XPAL 3BUPA 4E2OA 5J6HA 3ZU8A 4XBPB 4KHXH 2F7PA 3A23A 5T1KD 2EDEA 1UB5A 3LZRA 2X4QB 2ENJA 5IFAH 3K72B 3RWDA 3WTXA 3P3RA 3VFSB 2Y1YA 2ZUQC 4JRLA 2FSEB 3G5XB 3VGBA 1KTLA 2I60H 5AYUH 5I16A 2BS9A 1KGUA 3N6YA 3QWOB 3SDDC 5G2NA 3V5KB 5IQLA 3RB5A 1OV8A 3VNYA 2P45B 1D6VL 4H1LG 4HHAB 3T6WA 1THCA 1ZT7A 2BVPA 2NT0A 3IXTB 4O5LL 2E75C 3S48A 5BO1H 1EBPA 1FDLH 3UAEA 4YAQA 5LB1A 2E9IA 2Q8AH 4GAGL 2R1XA 3G6JF 3LH2H 4FDWA 4KKLD 3QUYD 4HGWA 2OZ4A 3VXMD 3D85A 3HB3C 4KKQA 1QBML 5HD8D 2D3VA 4R5VA 5LBVA 1THAA 4BE5A 1JYWA 3T0XA 4AENB 2BCKB 2EDLA 3KDPB 3VG9C 5BV7B 3O4LA 4ICWA 1FFOA 3CUPB 5I1JH 2UZPA 4BUGA 2A73B 1LWRA 5GZNA 4G1EB 2X4NA 4DN3L 1FFRA 5IVZB 2NY1D 2X6AA 5CUSH 4KNQA 2WZ6A 4LSQH 5A2AA 3O2DH 3SZKC 2AANA 2WVVA 1WVZA 4PRHE 2H3XC 2Z7WA 5CAYB 3OKLB 1E90A 1S7UB 2BNUA 1VZIA 4FTVD 1NEZG 4Y2DD 5E5LA 3VD5A 1E8ZA 4YDJA 1PSKH 3TF4A 5DD1H 3OB0K 4NUMA 2FQFA 1K5NA 4HD5A 1U8NA 3SOBH 1AD0B 1J87A 2XN9A 2XQBL 1GTFA 4AQOA 5F0PB 2GEEA 1U6AH 4P46B 1K4CA 1RZIA 2VT0A 1HAWA 3FQ1A 3LH9A 3T8XB 1BX2B 4BSJA 3QUMB 4I1RA 2HRPL 3GMQB 1OAUH 4X5XB 3TZVD 2NXYB 1S5HA 1PCSA 5FDWA 1HS6A 5DQ9B 5L6YL 1MF2H 1F4AA 3INUL 5EU7E 5TF1L 1NCDL 1HWHB 3QDJB 3T0EE 3HZYB 5F7LB 2QV4A 3ESOA 4P2AA 2EXTA 3NAAH 3UERA 3SN6N 1FAKT 2G0LA 2CALA 3AAZA 2K4WA 5IEHB 2VLKA 2XOTA 3EYOB 5DS8B 2JCCE 4BHUA 3AY4C 3VFNB 4R7VA 2F54E 1MCLA 2N56A 5CKAA 4LRNH 1H3PL 4FCHA 3V0DA 3HUJA 3KW8A 1D9KA 1I7UA 3TBVB 3U0WH 1LNUB 4PR5B 4O9HL 1JZ2A 4JRYB 3QC6X 5AB2A 3TIEB 4UM9B 2WXRA 3ZDZE 4JFSA 4DO4A 5TE6H 1KC5H 3I6LD 1MHEA 2WBJA 5F0JB 2PWDA 3AY2A 3O6FB 5FEBA 3KWXA 3DX3A 1CDIA 5C2BH 4Z7QF 1BD2A 4LNVA 5KBDA 2OJEA 1NPNA 4XNUL 5I1AB 5JXED 2DICA 5DYOA 4JFDE 2V9QA 1M71A 1RJZA 3K2KA 4YSSA 3HBZA 4Q9CA 1TJHL 3CN3A 5LCVH 3HZVA 2QTVA 5FK9B 3NIFF 5DMKB 4QHLA 1KZYA 2OQJB 3WN5A 3WKMH 2DKUA 2RTTA 3F58H 1KPVB 3WLWC 2QZ5A 4BKSC 3HHRB 4L3EB 3L1OL 5F7BA 3EZ8A 1JPFA 1OD9A 4Y88A 3DJTA 3A6CH 1OAKL 1DJWA 1RP9A 3MRPA 5CBEB 4X5QA 1X5YA 2X1XR 1SN5A 3O6LH 1E9PA 1T6WA 1PJWA 3ARDD 3KYNA 5KVEL 3KJ6H 4X99B 1N19A 1QFWI 3BVNB 1T04B 4XX1E 3UC0L 5T3XE 2XZAL 4JPKL 3T6ZA 1WBXB 1QEXA 4UNIA 1MELA 3STLA 3VFWB 1TSHA 4MNQD 4N87A 4LLUB 4OLYL 3BKYL 2E9JA 1WG3A 2GTZB 1IGJA 3ZHNA 3AQXA 2YKLL 3U0PA 1D2PA 2AEOA 1KCUH 1OTTD 3OC8A 2GUOB 4B7IA 5IW6A 2VC2L 2QGDA 3MLUH 4F3FA 2F2HA 4EOWH 3BVTA 1M9WA 2X7LB 3S3DB 4G6KL 1GC1L 1X5HA 2NYYD 3FPXA 5JW3H 3NSJA 5D7JB 3BUQA 4M48L 4H88L 5J11C 2B15A 1KIRB 1RZQA 4N9GB 4UQBA 4GG6F 4Z78A 2A6IB 4UTBA 1FPTL 3E3QC 1ZLDA 3Q6FB 2KC0A 3GRWA 1WBYB 4MNHA 5E94B 5I1EL 4U0RC 1CMOA 3EGSA 3IFPB 4FD0A 4KI5F 3TTSA 2R0KH 3EKCA 3IDGB 3RG1C 4WQOA 3PGCB 4JQIL 4PRHB 4EXPX 1IC0A 2YLHA 3B5HA 4PJ7F 5LNGA 1FO0A 4AYFA 4NKMB 2V7NA 1CGUA 5IESH 5AW5B 2OYLA 5DLMH 4KNUA 4NDMA 4PCTA 3SZ6A 4PGEA 1T4KB 5DMGC 1PF3A 1JMXA 5EO0A 5JDSA 3MNWB 5KVGE 4CDGC 5C97A 1R9FA 3NEXA 2BMKA 2D7QA 3IGFA 4UQ2B 1ZA6A 1T5KA 5T1MA 1AY1H 1WFTA 2VR4A 2WKOA 1QLFB 5DHVH 1ETZB 5FM5M 5C70A 3NN8B 3DV6B 3ZXAC 4TOYL 1JPST 4MD4B 5FO7A 2IAMC 3UTSD 1HHIB 5F1IB 2CJUH 2GIMA 3FT3B 2QGCA 3BDYL 5FWRA 4AK1A 4Y9FA 5K9OB 3BZFB 5I9QB 2V5TA 3ARFB 4YHNB 3GGWB 1FNEA 2E59A 4TUJB 3T0EB 1R19A 2YBGA 4UT6A 4W1TA 1KBVA 3TVMA 3X12B 4K7PH 3VACA 4MA1C 2CU9A 5CD3A 1MFMA 3R06B 1Z1WA 4K94L 3BWAB 4APXB 3V7AG 4BA8A 1KT2A 5EDXA 5E8NA 2F54B 1EAOA 5D71H 3ATAA 3FUHA 4MJ5A 1KCVH 1A6PA 5G4MA 3SIKA 5IJBC 4F2FA 4I3GA 3TBSB 2VUYA 5DJ2B 3RIFF 1RJLB 2X9YA 3EF4A 5IBUB 2PYED 2BOBA 4N8CH 4IEFA 2TRYA 4QRTA 2EDJA 4LPUA 1DQQA 4XCNA 3C6LB 2GHZA 1OQXA 3N0AA 4UTAA 1CGWA 4NC2B 2HMIC 3TOPA 5GJSL 3GMMB 3RWIB 3SKJL 2IDFA 1CD0A 1NFDA 3NABH 4KRLB 2X6BA 1F4WH 3KLLA 5C7XL 2J8UE 4J4PA 1L9MA 3DIFA 3QJHA 1BM3L 3EO1B 4YZWA 5C0IB 4GI6A 4JFDB 5ESQA 1OPGL 4ORGA 3P4OA 1SOSA 3IWUA 3KPOB 4J3OG 1L7TL 2OMWA 2P28B 4NHUA 1AQ8A 1HQRA 3LRSA 5DVMA 4FQXA 4DT2A 1F4YH 1UT1A 4Z7OE 1YN7A 3G5ZB 4X9FA 3WS6C 1NCCH 4OZGF 4XPTH 5AVZB 4HETA 3UTQA 1OLZA 2B1AH 2CLRB 1YMMD 2EXWC 3C5XA 3G9VA 4FYTA 4OF8A 2DBLL 5DK3A 4AGPA 2Y7SA 1U8HA 1A14H 2FJHB 2VQUA 4JFYB 4NNYA 1GYVA 5AVSB 1LO0L 2Y7NA 3L3HA 4JO3H 3OGCA 1R3HA 2PWFA 5ITFA 3GMLA 1MCFA 1LEGB 3L3DB 3M6DA 1FFQA 1PY0A 3UYPB 4IJ3B 2OMZB 1A22B 4HALA 4UTCA 2BJML 1YN6B 3OHXA 5G55A 4G59C 4KTEL 4OF6A 3UXFA 3X2QB 2Q2LA 4YJZL 1S7RB 1U8CB 2E3VA 2VN3A 4YXKL 1XMEB 2LOEA 4P5MB 3U2SA 3TIDB 4TS6A 3P3YA 3QEGL 3V4VH 3S8WA 2EDMA 1NMAH 5IQ9A 2V7HA 3FXIC 5CCHE 4LFHG 1IKNA 2DPKA 4PRIE 4YXLL 3W9EA 4XVJL 4XP9L 1P7KB 1V7NL 2GBVA 2OMYB 3O3EB 2WLMA 4NQXA 1KB5B 2BY0A 2W94A 1ZXQA 3MSPA 5EBWB 4P59H 2Y6SD 3TV3H 3K91A 4FXKC 2C1OA 3DI2B 1AGBB 4R3SA 1IZKA 2YMTA 5DD0H 5EZPA 4QLRA 2AAVA 3CFDB 2XZZA 4JL2A 1OANA 4NQUA 1S3RA 3TBTA 3ZMEA 5CCJA 2N0KA 4CU6A 3LQAH 3GXNA 3RA7L 25C8H 4U1NA 5H2BA 5HYJB 1MCWW 4ELMA 3FFDB 1G7MB 2APVA 3L2LA 4KTGA 1MIEL 1MHHA 2TSBA 1ZV5A 4FKEA 4MS6A 4UDUA 4MB3A 3D4ZA 3RNQA 2AJUL 4X6DA 3U6XA 3LPGA 5J12B 5LXGL 1E40A 3V9EA 3D05A 4PY7B 1S7WB 1R5IA 4HAGA 4F7PA 1NFIB 4YO0B 1QNZH 2H8PA 3F83A 4Y16A 4FLOA 5KSAC 4UILL 2EIZB 5AKVA 4UF7C 1ORSB 2NNXA 3ZYZA 4Z7VF 4WW1B 4JPVL 2AQ1A 4Y5VC 3Q2NA 5IT2L 1EGJH 1KCBA 7PCYA 4K23H 4LLQB 3PJLA 4AGLA 1I8LC 4FQCL 1MRDH 1OP5H 4WO0A 2PR9A 4P04A 5IW1A 2QSCH 3UO1L 3FQXB 1A7NH 4AWJC 1NBYB 2E6QA 2VC2B 4K3DH 1T7WA 1AZUA 3OG6B 4AUJA 1KGYE 3LQMA 4I0PD 3UG3A 3WNMA 2J44A 2W91A 2OX5A 3FTUA 3HN5A 2X05A 4Y1AE 2ATAA 2CM5A 2LGNA 4W9JC 4HUWB 1XR8B 3LHPH 1R3LB 1UWGL 2CNZA 3VXSA 2OJ1A 3MRIB 1MCIA 2OJZH 2XN2A 4HXBL 1NUNB 4FP8H 4Q9QH 4KRPD 1U92B 5IB1A 4Z76A 3MR9A 4WI7A 5E8EB 4NPYA 3BMVA 1QHPA 2CK0H 3MNZA 3UP1A 4X4ZA 1XXDC 3D52A 4WI9A 4Y7OC 1CD8A 2ODHA 3FO9A 5EOTB 3MV9D 4WJG3 3EJJX 2JJSC 5E5UB 2E46A 1H5BC 2X3CA 1BZ7A 4FFZA 1G6VK 4QRBA 3MGOB 1KGJA 1WUNT 3CZLA 1RIHL 5I6XC 4NN7B 4MA7H 2KDYA 1V7ML 2YXVA 4J39A 4Z7OB 3QDGD 3BWUC 3WEXB 5C08E 3WIIH 1L0XA 5HHOD 1DLHA 1OWWA 2XQYG 1J05A 3VRJA 1OEZW 2PPDA 4K8RD 3X3FH 3DARA 3I3BA 2Z3FA 2PTTA 3MROA 5ICXB 4OV6F 3DPBB 3VYOA 1CZ8H 2BW5A 5AW1B 3UP6A 1EHLL 3HS0A 2BSSA 3CSYA 3UTTA 1LK3H 4OBSA 4Y4KB 2VXTH 4YPGB 1SOKA 3RU8L 2VM3A 5PAZA 2ROYA 4PJ5D 1G9NC 1XF5A 2FX9L 1B88A 1G5GA 3VM5A 2YAHA 5AZEH 1IVTA 3OGOE 3SKMA 4A2GA 9PCYA 4XO8A 3TNMB 3WTWA 1JZ7A 4GNKB 4MAYD 2NUPB 5IVNA 1U8PB 1A9VA 3E8VA 3S3SA 5DF0A 2IQ9H 4PRIB 1JZ5A 2JK5B 3GINA 1PFCA 1ZANH 2FO8A 2QMJA 5MI0B 4DH2A 1W72L 2J6EA 4BE6A 4KH9A 4J7RA 5F9JB 1I3RB 4IIQB 2AJZA 3CXHK 4LEXL 1OM3L 1JSYA 1ZWIB 1K4DB 1KTCA 2DQEL 5GZNC 4J2XA 1UXWA 1XSKA 1BF2A 4NX0A 4J12A 2ZSWB 4HWEH 4QR7A 1E65A 1SFDA 2Q6WB 5HY9A 5INDB 3QSKB 5F1OB 4F8NA 5C0NC 4J3OC 1KPRA 5FAAA 3PJSB 1V55B 4ZMZA 4PJIE 4KITB 4RVBA 2DYPB 4KKNA 3TJHD 4YE0A 5CO1A 5KWYC 3MOBL 3ZHFA 1UTDA 4FABH 2IIJA 2V0AA 2HKFL 3IJHB 3KJ4B 4MJIA 4B0MB 1RD6A 1R5VB 5EOCH 1H0DB 4MCZB 4K3EH 4YFDB 3MGTA 4RGNE 3FSVA 2DQGL 4LP5A 4PB0H 1R4XA 2FDBP 2ZWSA 3FT2B 1KGCE 2C3VB 5DK0A 2Y7LA 2Y5TB 2OMVA 5K1VA 2HLAA 3UH8A 5TGBB 5I8EA 4LVOC 5GGVY 4NQDD 2AFNA 5C6TH 3ETTA 4P4KD 5ACZA 4OZIE 3CTTA 4N2LA 2D2OA 1A7OH 1QACA 2BHZA 2MKWA 4HCRA 4X5RA 3U7AA 4ODVH 4TVPD 3TLRA 3GFUA 5EEUA 1UKSA 1OGPA 1Q0EA 2XY2A 4XBGB 5TDNA 2G4EA 3MRRA 2Q9OA 1A9BA 2B1HL 3BZDA 4TNGA 2PR4L 1L9RA 1OAQL 1MN4A 1SJVA 5BUAA 2OTWB 2PCPB 4FMKA 1IJNA 3GZKA 1WZKA 1ZT4A 4FI6A 1JPSH 3BH8A 4G43B 4MXWL 3CVDA 3ULVD 1D9KC 3V0JA 4NO3A 4UT7H 4O02L 32C2A 3QIBD 4MRBA 2WZPD 5D7SL 2A99A 2ATPA 5KAQF 2PW1A 3BW9B 4PEEA 3OWRA 2FGZA 4U2YA 4UNUA 4AH2B 3NEEA 3NRPA 4QLWA 3DO7B 1AE6H 2KQNA 3N44F 2MOGA 3IPFA 5J06A 5LNDA 1T7YA 2HJLA 1Q1JL 3OD3A 2J1WA 1WGOA 1XCQB 2XA8H 4QGTA 1VDGA 2YS4A 3VD4A 5FA4B 4W4NA 1GGBH 1R3IL 4PY8J 4JO5A 2R4RL 5AZUA 4PJ9B 1N8ZA 1SF3A 4H8WL 3UX9B 5IROD 2KZBA 2FHFA 4ZI8A 1OB1B 1VF5C 4BSVA 4WHYH 3MFFA 1KIPB 3FYEB 1A4AA 3HC3L 3IDNA 2R59A 3SYCA 1OP9A 4CU7A 3TO2B 1QOKA 3VNZA 4G5AA 2Q0ZX 2AK4D 4JGJA 3B8YA 3EGXA 3WN5C 1Y07A 4PRPA 4XPHL 3TP4A 1KN2H 3CVHL 4F37K 3FB6B 5C08B 4EUPB 4HDIA 4PJ8D 5IW3A 3PQYA 3DOIA 3WUWB 1GGTA 2ENSA 4MDIB 3II1A 2C5DC 1Q90A 5CIPH 5IMOA 4D8OA 3HG1E 2PWGA 4JO4L 5IOPB 3GBEA 3NVQA 2CKBL 1KGWA 3CZFB 2NSQA 2Y25A 3D39E 1IT9L 4PBVC 2CLZA 3KYOA 3VD1A 3GHEH 4Y9GA 3CN2A 2F0CA 1JN6A 1ZD6A 3SJVE 3RURA 3QG7L 4HLZH 4HG4K 4Z7NF 1TQUA 3BDBA 2P47B 3KVQA 1Y7VA 2BIOA 5I8OH 3FOLA 4KH2A 2RA1A 2O6PA 3HKZA 3F5WB 1BMGA 1V3KA 5L4JA 3D7PA 4FQ1L 3QEUB 3A67L 4JVWA 1FBIH 3ZZSA 3VVVA 1DL7H 1UD3A 5IQMA 1BBDH 3CPLA 3WYRA 1PEWA 4RA0C 4TNWF 1TVDA 1FH5L 2VL4A 3HFMH 1M56B 1OAJA 5DZAA 3WTYA 2QZQA 1NAKH 3H3PL 4YUEL 2NLJB 2NX5A 3E3QE 3VG9B 1XB8A 2VAAB 3EHBD 3OV6A 4XXWA 4DZBB 1MFNA 1WBZA 3OXSB 2F1BA 4LPVA 3WOVA 4IRJB 5JQIB 1F11A 3N42B 4RAUA 2Y72A 1DE4A 1FSKB 4DEUA 2B2XL 1SY6L 2DIJA 3GO1H 3WMQA 2DWSA 3ZT5A 3HC4H 2ZWZA 4LMQE 5C07D 1KJVB 3QUXD 4B9IA 1WWAX 5B39G 4YDLB 4CUCA 2H6PB 2NZ9D 5C09D 2A1WL 5BOJA 4AVHA 5I6PA 4LCVA 4JJ5B 2GABA 1OK8A 1MHCB 4DGIH 3RWGB 8PAZA 2AITA 3AREA 4PJIB 1GCFA 4UUJB 1G6RA 2B59B 4FQLH 2F53D 3DROA 1MXDA 3CZJA 4AT6A 5HHNA 2VJXA 4HJ1A 4I0CC 1MI5E 1OOAA 1BA9A 1BW8A 4LASH 1I7TB 1IJ9A 4DVRL 4OFYA 4BCZA 5E2VL 4NO5A 3EO0A 1CK0L 4RGNB 1UM5H 3ZE0F 3TF7C 4HF5L 1U2HA 1WA1X 5KJRL 3T1FB 5DMJB 4GBXA 4BGDA 4C57C 2QR0B 5BMFL 4XXCA 1WAAA 4AITA 1OAZL 2NR6D 4KZ0A 1I8AA 1HL5A 3S8FB 4OZIB 2QQKH 3TBBA 4DJMA 2LLNA 1ACYH 1W8OA 1F13A 2IADB 3GPSA 4GRLB 4NQEE 4RDBA 4A2HA 1KV3A 5FGBA 3D0LB 3D2UD 4XI5D 4BZ1L 5I2IA 4GSDL 1XZ0B 5A7EA 4YFEA 5L8LB 3OKNB 1Q9WB 4WENB 1QSFE 5LBSH 4DQOL 1UWXK 3EBIA 4W81A 4PW4A 1IAIL 2AJXL 4MD0B 3LN9A 3VXUD 5F7FA 4HJ0C 3KGSA 1ZS8B 3FAXA 3KXFE 1N4XH 3WY4A 4G42B 1XSOA 1W72B 4YWGH 2CHDA 3RX5A 2OI9B 4E5XG 2CPUA 4MB1A 5LKNA 1Z9SA 5DRXA 3AADB 3C5ZB 3WLBB 4W9ZA 2I9LA 4PS4L 4JB9H 2W0FA 4HC1A 4QTIL 1R0AL 4N68A 1A1MB 2VN7A 1T7ZA 5FYLD 1ZHKB 3W5NA 1NIFA 2A0LD 4J4PC 3G3LA 1XL6A 2B3IA 5J8OA 5AVQB 2PTUA 1VJSA 2APWA 2CCWA 1AQMA 5C6WH 5HYSB 3EDKA 2ATKB 4OLWL 3VSTA 1E4WH 5IMLA 1SJEA 3HG4A 4LKXA 4OD1H 1SDYA 1VKXB 4XMPH 3Q6GL 1HSAA 1QBBA 2G9HA 3LEXA 5DR5H 5D7LA 3RY6A 3CFJB 4Q52A 5KSVB 5CP3H 1DQMH 5E8PB 2DM3A 3S8GB 1NCWL 2X70A 2ICEB 2WIIA 2QQNL 1HZHL 5L2KD 3KPMB 4JVPA 5FKAB 3IJEB 4XPFL 2ZJSL 3EADA 3PDOA 1N3NA 3T6XA 5I6NA 1S46A 5IHLB 4HPYL 3EDFA 3P0YL 5EU5B 3DXAE 1U3YA 3MRQA 1TTCA 2VDOL 3N5AA 1N6UA 4R8WL 2YSSA 3UFIA 3C75A 3I6GB 3L5WB 4DCQA 3K6DA 2Q7YB 1NUFA 5FFLA 3QISA 3OHXC 4WDIB 1OHQA 2BY2A 4AL8C 4BKTC 4PREB 1ZGLM 1R3JB 3G6DH 1JZ8A 4JG0H 2ZCKH 4LOEA 4O2FA 4PWIA 1GSKA 1PD6A 3N3EA 2ADGB 4H25A 5E8OB 1YVLA 2DWEA 5FCUL 4E9VA 2V2TA 1EXHA 4OFPA 4M1GL 2XPGB 2EICA 5JIKA 3MCKB 3BP6A 3H9YA 4HZLB 1A3RL 3O2DA 4FLRA 4YSCA 1BLNB 1Q0YL 3ZDXE 4WHCA 4G8GA 4G70B 4OZHB 3ZE1B 3D48R 5E1GA 1OF2B 4PJGE 3OHMB 1TT6A 4U33A 4JRXA 3MNVA 2DQJL 5TDPA 3IMWA 5L0QC 2H1LM 3IJ8A 1HNYA 2R0LL 1IE5A 2HTLC 2R2BA 1LP9E 1NBQA 4LQ1A 4U6YB 2GBTA 3QJTB 4B9PA 2WXPA 1TKWB 4DP0X 4MXVE 3VFVA 5B8CB 3ULVF 3ZDYF 4FFWC 2BC4A 1ZTXE 4KQ3H 3ULVH 3EG9A 5D1ZA 1KLUB 5ALCH 1YEHH 5GRJL 4UZUA 2AXWA 2VUKA 2XI9A 2HVJA 4DIXA 4MMXA 1UD2A 1QFUL 3MRBB 4R7LA 5ICZA 1OE2A 3NH7L 3CVHB 2OSXA 4LU5H 5B21A 2P80A 2R2HA 3E1F1 4XCFL 1YUHB 1OCOB 4QTHB 4APQB 4W68A 5SWQA 4P46D 2GT9A 2VW4A 3PWJB 3U25A 3GLAA 2NXZB 4AYID 3L5HA 4LCUA 3L4CA 1XVSA 1LEKB 2CKBB 3NFPA 2NXYD 3MNDA 1MJJB 1YNLL 1LXMA 4G7QB 4JHZA 1YMHB 4JGMA 4RZCB 4LLDB 4L4TA 4Y16C 3QUKB 1I9IL 3TT3L 5HJGA 5D6DC 6TAAA 2I26N 1N0XL 2E7DA 4GXUN 4G7VL 3OKDB 4M7KL 1IKFH 3K6NA 3C9NB 5TQ0H 4GXFA 3K1DA 3BUBA 3QXAA 4NQEB 3LSOB 1FA4A 1BOYA 3DURB 1JYXA 4QY8B 3UIZA 5I66B 3QO0A 1F4HA 3CVCA 3HNTL 3QI9C 2CO3A 4KUZL 3L4YA 2Z92A 4PG2C 2CBTA 3GXMA 3IB4A 1FFNB 3FQWA 3QO1B 4WKZB 2DY2A 2FX8L 2VDLL 2OA9A 4ZUUA 4JFED 2UYLB 4PAZA 3GI8L 2FLRT 3KXFB 2R56L 4J3BA 5BZWA 1UT2A 3MV8A 3TT1H 5GS3A 3FYIB 3GSXA 2VZUA 3QPXH 5C0JA 4KJWC 1E4KA 1RURL 4TTGA 4OKVA 1CPUA 3CFEA 1JZDC 3ZIYA 3CFQA 1DVZA 1RL1A 3GPEA 1D7FA 1ZHLB 4M8RA 4PLKD 2MCPH 4NZ8A 3WGVB 4EUPG 3REWA 5IQ7H 3MRFA 3ALPA 3WUWG 3PIQA 3GSNA 1GZPB 1WHPA 2ICWA 4BSWA 2J4WH 1ORQB 5E24E 3IMUA 1DQTA 1XSJA 3I85A 4GKSA 4XNXH 1N59B 2XRAL 3FK3A 1LMKA 3NCEB 2N1KA 3LRHA 4N86A 2A83B 1IE4A 4OIAA 3KYMB 2GB2A 2AVFA 3SDYL 5EBLB 2WVTA 4D8PB 2C26A 4PJXE 1IB5A 2DOCA 3NCJH 2XV6B 4F57H 5H37A 3L1GA 2ZXWB 1XTMA 3AUWB 2V6HA 4MHHI 1BVKA 1IBZA 3L45A 4NS0A 2BVQB 5TDOA 1IGIL 1EIBA 3P54A 3A5VA 2F15A 3Q2WA 5MP6L 1YY8A 2F8OA 3ARXA 3FUNA 3ZO9A 4TQEH 3DXAB 4I9WE 4NM4L 4UINL 1PY4A 1ZA3B 4WUUB 2VR7A 4WU7A 5MENB 3QEQA 1XTLA 2MPAH 2NDFA 4IBYA 4LMQI 4G9DA 4N0UA 3CC1A 5INCB 3RWCB 1NUGA 3C2AL 2YD5A 4ELKA 3MRLA 2ETWA 1BREA 1GHFH 1J8RA 3V4UH 4QHMA 1BJ1J 1ASQA 2PPFA 2A9NL 1CBVL 3SEPA 3T4AC 4GG6A 2LVCA 3EW3B 1M1XA 5C3TA 4QHNA 5I1CH 1YEJH 3L48A 1H3TA 2MHAA 1HL8A 4H20L 3I84A 4XC3L 5K39B 1UQSA 4J3XA 4OI9A 2MKLC 4ZUWA 3BP7B 2VLJA 2YRZA 2WNWA 4Z7UA 3T2NL 3O4LE 2YGPA 3ZDXB 1NBVH 3ZYOA 2HKHL 4I4WB 5DJDB 5CZRA 1V3LA 3IK2A 3PNRB 4PJGB 1U4EA 2EXYD 1ZHNA 3GXTA 3IETB 3VTAA 3IVKA 4AIXA 1KG0A 3SY0A 3L9RB 4OCRH 4X9HA 5IY5B 2ED7A 4LARH 4YE4H 3VUAA 4E36A 4PRHD 1XX9C 4CVWA 1QVOA 3F7YA 4S1QH 3WFDH 1A6UH 1C12A 4QRAA 3L5XH 4GKLA 4M6NH 3TGXA 2XN9E 3IN2A 2B7DT 3G5YA 3VYNA 4X4XB 4BWTA 5DTFA 2NY2D 4KK8D 1TIUA 5IGXH 2RR3A 1NAML 3QCTH 1D7BA 5EA0H 3LNFA 2X10A 4WWKB 5T5FH 5FYLH 4ALAL 3RTLA 3L3JA 1XF3B 2VDOB 1BG9A 5AVUB 3FUFA 4LBEB 4NZDA 1MRFH 2VDNH 4RGOH 1A6TB 3ROLB 1P9MA 3QG6B 5IK3A 5DVLA 3ZHDA 2CGZA 2W88A 2ZWLT 4G5ZH 3EYFA 2C9XA 3ARFD 4LLYB 3OMAB 3QE5A 5FA3A 3NFNB 1MLBA 1ML0A 3FSWA 1NDGA 1WWBX 1HYSC 3L2MA 4XP6L 4RESB 3BPOC 4F7TB 4M03A 3THML 4QXGL 2VLKE 1EEYA 3U4EA 4DKFL 2IFFH 4LXFA 5I18L 3I74A 1QYGL 5L9DH 4AV4A 4MMYA 2EDYA 2F54D 2EADA 3ULUL 3HUJE 4KK5C 1HXYA 3L8QA 5E0QA 4PJEF 8CGTA 1T7VA 4HOMA 4XMKL 3WSQL 4M02A 3S34L 1CDBA 1I82A 5LG1A 1CE6A 3O6KL 4LPWA 3SPHA 4RAVB 3HA0A 1WZ1H 1JNLL 4O58H 4WAFA 3OKMA 4G7YH 1FYTE 5CILH 4B7LA 1YEEL 1T22B 4ZUVB 1JJUA 4NO2A 1WA0X 4RWYH 4PRDA 3NA9L 1BD2E 1RLWA 5DT1H 4Z1PA 2OXGA 1HU8A 3V4LA 5KSUB 3QIUA 3FN0L 4J2QA 4DUVA 4U6VL 2IFGA 3FUKA 2FUQA 4WO4C 3EJUA 3MMEB 3FCGA 3GI9L 4YX2L 1NFKA 5CZVH 4JNXA 2YKKA 1ED3B 4O51A 4BFRA 1BVNP 3GNMH 4JN2A 1WC7A 2H26A 3LHAA 1WAEA 4C4KO 1E3XA 2ADJB 4PLOB 5FHBL 1G43A 5JHLH 4OJCA 3KBPA 5HYQA 1NCOA 3OXRA 3EUUA 1XGZA 3KPPB 4PJXB 5IFJB 4ZSOA 1CT8A 1JDCA 3MUZ1 4EDWL 5J6HB 3O8XA 4XH2A 3BZEB 1MXGA 4PWEA 4KTDH 3JBG7 4ODBD 3SCMB 3VB8A 1S7XB 1FL3A 1DUYB 5BS0A 4FG6D 4N6RA 5E9AA 5F7DA 3NACH 3EH2A 3FFOA 3PU7A 1KTLB 2EC9T 4AMKL 3WFCL 1QI3A 1VA9A 3V4VA 3GXPA 1P7QA 5IHZA 2Z6FA 4HIIB 2YUVA 5T3XD 4IBZA 2QFRA 1XCWA 2UY6A 2DTMH 1ZT7B 2BVPB 2GTQA 1Q72L 1T6VN 4PU2A 3TBWB 1NCAL 2JKJA 2PTVA 4HIXH 2VDLB 3UYRH 2K6WA 3FB7A 3QQ3A 2ICWJ 5E08L 1B9ZA 1SGKA 1AR1B 1FGNL 3VSVA 1OARH 4JFHE 5TTRA 1CFNA 3FJTA 4I13B 5HDQH 1Q9LA 2OMTA 4QJ4B 1P4BL 4U1SA 1EFXA 2AXGA 3MKGA 1I3VA 3FB5A 4XXWC 2A6DB 4P5RA 3O4LB 2JB6A 3RHWF 4YHYB 2RCSL 4XWOC 4YQXL 2X4NB 1L0YA 1AFVL 2H2PC 5DD5H 4AQ8A 1MLCA 4UTAL 3RFRA 5K9JL 1WISA 2R1YA 5C0BA 1HEZB 4IBVA 1C1EL 2QKIB 2M83A 3MRCA 1NBZB 3MRDA 4QO1A 5IV2B 2BNUB 2XETA 3BWSA 4EI5D 1KYOK 3AREC 4XN9A 2CNYA 3T2PA 5J6GA 4GEJA 5DJXA 4QRRD 1QLEH 5J1TC 2E5EA 2DW5A 3ZSTA 3HLKA 5HGGS 1CQKA 1RZIB 1XH3B 2OTUA 4YZFF 1NIBA 4LOUC 1KULA 1EGJA 4LEBA 1KNOA 2Y4SA 4GBXC 1NA8A 4ATTA 4BZ2L 1TO5A 3L4ZA 4XXCC 1SLUA 5ABAA 4ZS7H 2F8IA 3DPDA 3F6LA 4ZAKC 4M8QB 1YEFL 4ANUA 1RHHA 1WTGT 3FONA 4IJTA 3ABLB 1ETB1 5FGBC 5B7EA 1CIDA 4OV5B 4X8JB 1D6EB 2UV3A 3IMVA 1OW0A 3VXTA 3OZ9L 4DSYA 4ZMPA 2VLKB 2WK2A 3MRJB 1JP5A 3G5VA 3N41B 2CGRL 4MSWA 5A2CA 3FBKA 5AYQA 3DHMA 1T2XA 3P3TA 5L88H 4RGMB 1MZYA 3DGDA 1GGIH 3HUJB 2IGTA 1PPIA 4RMTA 4X6CE 2UUDK 3ES6A 4OCXH 3WTSA 4JLRA 2BSBA 1WFMA 4LSPL 3UGEA 2FD6H 5E2JA 3OX8B 5AOKA 2K70A 3QQDA 2G3MA 1C5BL 3C87A 1OWRM 1TPXB 1CLYH 3WJLA 1FYTB 4B6ZA 1E28B 4H8VA 2WBJB 4PJBF 1SXAA 1NFDE 2XICA 3DJSA 4N1HB 5IJVB 3ZKMC 1UURA 5KBMA 1E9QB 4OVUA 2IJ0C 5HI4D 4D0CA 3F7QA 3GMRA 2L7JA 1SBSL 5KVMC 3MRHA 1M71B 4Q9RL 2X4TA 1Z5HA 5FYKL 2HT4D 3W39A 2MOVA 4UB0H 1CJYA 1ERNA 2R1WA 4X7FC 4I3SL 1FZMB 1A6AA 2TSAA 3RY6C 4WCYL 3QYCA 1NAMB 2C8NA 3AUVA 1UXSB 3MLWH 4LK4A 5F1SA 3GZPA 1E2ZA 3QB7C 4F5CA 1JZ4A 2QPSA 1AVAA 4FXLA 4ETQA 3T08A 1COBA 3FUDA 5LQBH 4N0YL 2VXVL 3L17A 3BAXA 3EJZD 3U0TB 2XWEA 4D9LL 3KZ8A 4OU3A 1BG1A 3EUDA 5DUPH 2YAPA 3U7YL 5JPMC 2BVEA 4KO5A 1V3JA 2LU4A 5AVXB 1LM8V 4NC1E 2MTAA 4E9TA 1U8KA 3JWNG 5FYJL 5KSBA 5CEYA 2DKSA 2AK1L 4RISL 1OALA 5DJZB 5TE7L 1FGVH 4FQJL 1HK6A 5D1QA 3R0NA 3BE1L 4ONHA 2W9DH 5DUMH 3UJIH 3DX6B 3QZPA 1XGRA 3FUIA 3FRUA 3U0PB 1KN4L 3ORJA 4MMZA 5IW6B 1L6PA 1AKJB 3FZUD 4ZMNA 1IGML 4PRID 3HZMA 4N2KA 2AEPH 4N85A 3DX7A 2AW2A 3BO8A 5ERWB 3SDCA 4QCIA 3DDGA 2R51A 2E9GA 4L8SA 1S6NA 5GRVK 5JUEL 4BFEA 1E8XA 1KELH 3BEWB 1MVUB 4PYGA 2APSA 4JAMA 4D9RE 5AWNH 5HYEA 5CD5D 1SLWA 1NGPL 4S2SA 2JCCF 1PX3A 4MNHB 4JM2D 4PUBH 5F1NA 5D2LA 3EGSB 4OAWA 4PGZA 5MERA 3SBWA 2EDDA 4XTRC 2XJLA 1MWAL 3MO1A 4ELME 4GKZA 1A3QA 1IAKA 2HLFC 1R47A 2RHEA 5D1ZC 2R4SH 2DYPD 1ITBB 3K2UH 4LQFL 5ALBH 5AEAA 4AYFB 4K2UH 4BHUI 1KTJA 3UBHA 2PWHA 43CAA 3UBXA 4MMXC 3ZDZF 2AV7A 4PGEB 5E2WH 4NN6B 4X6DE 4DEPB 1KEGH 3AU1A 4LVNB 3CBKB 4M6OL 5BW7C 1EEUA 4PJDE 5B1JA 5JW5A 3OKYA 2A9DA 2EIKB 1ZA6B 2J21A 3DSFH 4OCSH 5T1MB 3LOWA 4NJ9H 3WN6A 4F15C 3M88A 4Q6KA 4KNTA 2VISA 4I48B 2EH8H 3ZTEA 3VWJD 5F7EL 1NWPA 4PP1D 4LHQB 1WPCA 2VXSH 5E03A 3B9KD 5BPPA 4P48A 2ZXQA 2GY5A 4AUYA 2AQQA 2DMHA 1SMDA 2J71A 3HR5B 4LVHC 3SE9H 1CICA 1VPOL</