5KJ4A

Crystal structure of mouse protocadherin-15 ec9-10
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
228
structure length
228
Chain Sequence
MNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADPPGMPASRVRYRVDDVQFPYPASIFDVEEDSGRVVTRVNLNEEPTTIFKLVVVAFDDGEPVMSSSATVRILVLHPGEIPRFTQEEYRPPPVSELAARGTVVGVISAAAINQSIVYSIVAGNEEDKFGINNVTGVIYVNSPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDENDHPPVFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title An elastic element in the protocadherin-15 tip link of the inner ear.
pubmed doi rcsb
source organism Mus musculus
molecule tags Calcium-binding protein
molecule keywords Protocadherin-15
total genus 50
structure length 228
sequence length 228
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5kj4A02
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 5kj4A01
4ZMZA 4XXWC 1WUZA 4ZMPA 2OMVB 3LNHA 3LNEA 4ZTEA 1WYJA 4ZMYA 3K6IA 1OP4A 4ZMTA 4ZI8A 4AXWA 3K6FA 1NCHA 3K5RA 4NQQA 2OMXB 2YSTA 1L3WA 4NUQA 3K6DA 4ZMNA 4AQAA 2QVIA 4APXA 4NUPA 4QD2E 5DZVA 4ZMXA 2OMWB 2OMYB 2WHVA 2X2UA 1NCGA 3LNIA 2V37A 4ZT1A 4AQ8C 4ZMOA 4NUMA 3QRBA 1SUHA 4ZMWA 2YQGA 1NCIA 1NCJA 5KJ4A 3LNDA 3FF8A 2OMUB 3PPEA 2WCPA 5JYLA 3FF7A 4AQEB 3MVSA 4APXB 1ZXKA 4AQAB 1EDHA 2EE0A 2OMTB 3Q2WA 3Q2LA 4ZMLA 4ZMVA 3UBHA 4AXWB 1Q1PA 1FF5A 2WBXA 2A4CA 3UBGA 4AQ8A 4AQEA 2WD0A 2O72A 5CO1A 1O6SB 4AK1A 5CZRA 3LNFA 4ZMQA 2A4EA 1ZVNA 3K5SA 3Q2NA 5JYMA 3Q2VA 4XXWA 2QVFB 4OY9A 3UBFA 2OMZB 3LNGA
chains in the Genus database with same CATH superfamily
1J9TA 4ZAKC 1HEHC 2V3FA 5DJ6A 3H6AA 2X0VA 3CHSA 3GSQB 3GXUB 4ZPTA 5D7LE 3EJPA 4PJEB 4K9JA 4DK3A 4JM4H 3UTSE 4OV5A 1AQDA 2C3HA 3CZEA 4AJVA 5KUMA 3MR9A 3CFCL 3UFIA 2XQBH 4LRIC 3WEMA 2PNDA 1I7UB 2JJTA 5C3IA 5I5MA 4LXFA 2AANA 3K2IA 4IKIA 4NENA 3SGJC 1S7XB 2VXSL 1DBJH 4FFVC 5MENB 2LLNA 2BS9A 5BW7A 3RX8A 4QR7A 3ZDZE 2NNXA 5G55A 2YRPA 3KHOA 1BPVA 3GSVA 2OMTA 3UJIH 3IMRA 4Q6IB 4BK5A 1U33A 3HTLX 4U1IB 3QWOB 1U8QB 4B41A 1JFQL 1A4CA 2FX7H 4YZFF 5C09D 4Y2LA 3VM5A 1GL4B 4ZFGH 4XC1H 3KPSA 4UYQA 1C8PA 3O6FB 5T1MA 2QVKA 3L3IB 4GAYA 2Y3NA 4X98B 2GSGB 4Z7QE 5F9WC 4AYSA 1QRNB 3LVEA 4PJXE 3NACL 3BSZL 5BV7H 4KKPA 3IAQA 5IMKB 1KBPA 1BMWA 3L3OA 1X44A 4DWHA 4JRLA 3NA4A 4S0HA 1TO4A 4UM8A 3QUXC 2WQUA 4FI6A 5DA4A 2F61A 1RJLA 1INEH 3AAZA 3GJEB 2DBJA 4U3SB 3ZKXB 3L6FA 3NJMA 3C6LD 2IXQB 2WXJA 3QIBC 5DQJB 4HJUA 5C08A 3QXDB 3ULVF 4M62H 2J2ZB 5IBUG 3CAFA 1KIPA 4CMMA 4H1LG 4MQTB 5DC0A 4HJGB 43C9B 1M7IA 1OQOA 2EH8L 3WDHA 4AIXA 3ZMNA 5I19H 2NX5B 4WO4D 5IJDC 3C12A 1NJ9B 4G8GB 3G6JE 3UL4A 3PQYA 2X9YA 1QFWH 2A74A 3QORA 4JMXA 1IGFH 3MRBA 2BCKB 1FFTB 1D7DA 2X7LB 2GSIA 2OMXA 5HHNB 3MRFB 3T1FB 5FDYA 5IBLC 1Z5HA 4N24A 3Q3GA 3DJTA 3TJHD 2DMCA 5ISZE 3BQUB 3LJ3A 1WVZA 5GGQH 2A4CA 4AQ8A 4MMXC 2W9DH 4YOKA 4EVNB 5MI0C 3CK0L 4K7PL 4WNSA 5C9KA 2BNQB 3IGFA 3FFDA 4GFXA 4UNVA 5D1ZA 4GAFB 1HCZA 4OJFH 4IMKA 4OJEH 3ZR6A 1HKLH 4KK5D 3U46A 4GP4B 4PS8A 2WXGA 1UB6A 2YK1L 4WWKD 4AQ1C 1FGNL 2YD0A 1OK0A 1EJOL 5CNHA 1BVOA 2HN7B 5ALBH 4DUXA 2CGRL 5E8PB 3C9NB 3DX3A 3BH8A 3SBQA 5LGJB 5HY9B 4QRAA 1CDGA 1RZGA 3M07A 3WEXB 1EHLL 3GSRB 4QRPE 5LNGA 4LCWB 3EH1A 4NIKB 4EBQL 3RPKA 4HPHA 1JGDB 4ONGL 1J18A 2C34A 2IV8A 1YN7B 1BAFH 5BZDA 3QRLA 4X9YA 1MCOH 1QLEL 3L4VA 1THCA 4XPTH 5SWSB 5HYJB 1SZNA 1S7TB 5ES4B 1U8JB 4HUCA 4OZFB 4K5NA 1FIGL 4O58L 3WIFB 3OG4B 1A7PH 4DQOL 3C5ZB 1CR9L 4WJ5A 1XZWA 4Z7OB 2WYHA 4FQPA 3W82A 3AMLA 2MH4A 1J0ZA 2WBJC 2KDYA 3EDEA 4X8GA 4FMVA 4M02A 2V9RA 5A2BA 4PRIA 3ECUA 2X4QA 3H9SA 3LB6D 1A3LL 2EC9U 2YAPA 4LASL 4Q58C 3FPXA 4YAQB 2GBUA 1DBML 3RZCB 3VH8A 1ZS8A 2X4SA 3CZKA 2DH3A 4OLXH 4PJGE 2YJLA 3KGTA 1UZGA 2V37A 4HH8A 5LWYH 4ISVB 2AEIT 3OV6A 4OZ4B 3C8DA 3CH1B 2GAZB 4GW5A 5DEJA 5EZLA 5DMKB 3C8HA 2IDSA 3SHSA 1HH6B 4JFPA 1HTYA 3UYPB 1P7QB 1XWVA 3KL0A 3Q6FA 1DVQA 1AYOA 3CX2A 1OAZH 6FABH 1MCFA 2OMBA 3OM3B 4JREB 1ZGLP 2JB5H 2JKJA 4WUUE 2PYEA 2FX8H 4R2GB 3FO0H 2DEWX 2EDRA 2W0FA 2NYZA 4EAEA 4NNPL 5EMYA 5CEXB 3UADA 2QQNL 1D5MB 3TF4A 2OXGB 5I5JA 4QYOB 3ME0B 4LEEA 1CFQA 1GHFH 4TVUA 4UIMB 5C0CE 2P8MA 2XTJC 4TSBL 2KZKA 3ZKMC 3K2UL 5HDQL 3O45B 5DD3H 5DHDA 4ZUUB 4FGMA 2NTFB 4XP9H 1A1NA 5A7BA 4S1RL 1WIPA 4DQAA 3GXNA 2CO2A 3FB5B 1D5BA 3L6FB 5EU4B 1UA7A 4AIEA 4UM8B 1K9TA 2VLKA 5C07B 4MNGB 2ZG2A 3MTRA 4EO5A 3F7KA 4N22A 1YYML 1ZV9A 1CQYA 3TBWB 2CUHA 3AGWA 2XPGA 3MLXH 5TPWH 5FV1L 5JXAH 1F11B 3MLYL 3MNDA 1KIQA 2ESVD 3LZFH 5IKCB 3ARFB 3SJVD 3TT3L 1GY1A 3RJOA 4UTAH 4FNPA 3GZOA 1U30A 2ALWA 3GBEA 2VRQA 4PS4L 4YDMA 1PQZB 3HI6H 3L5XL 3ROOA 3MACL 4U6HB 3GHBL 2AEPL 2WLLA 4ZNCD 4QRSA 4ODWA 3MQIA 4NM8L 5AOKA 4XPBH 4PRPA 4D3CL 4ENEC 4PJXA 4A2GA 1RERA 3RKPA 4FC3E 4PRAB 1KCWA 2ATPA 3QYNA 3EFDL 4F9PC 1UM4L 1XDTT 2DLGA 1W15A 1T1ZA 2BNRA 4FCAA 2X0WA 4HGMA 4XC1L 2XQYA 3QDGA 5F6HI 5IQOA 1SHSA 4WEMB 4Y19D 5FYKU 3DRTB 1ILUA 4PWGA 4JRYD 4UOW1 1T04A 5DD3L 3GSQA 2VDPL 1RUPH 5CP3H 2RA1A 5E6ZA 3FU8A 3V4UH 3SO3C 2OR9L 3DDFA 1VGEH 1DQML 3MNMA 1EXHA 2CPCA 4LSVH 3E2HB 1BD2A 1QSEA 4XN9A 2P5WE 2RQ8A 4IQHA 1HHKB 1BOGA 3BUTA 4M7LL 3PHSA 1FNEB 1UJTA 4WW1B 1BMGA 1MG3C 3BQUC 5D7LA 3U9UB 5AVZB 1I7TA 5D1ZD 1O6VA 4NN6B 3VX0A 2UY7A 1EBAA 4GG8A 2IAMB 4NRXA 3ZKQD 3FO0L 1U0QA 4RDQG 5I1LA 1UB5B 3DWTA 1OARH 4OW6A 4YDZA 2B1OA 1QZ1A 2Z7ZA 5J12C 2NY6C 5KG9B 3WLWD 5KS9E 1P4LA 4RBPH 2BVQB 4ZNEA 3P30L 4XWOD 5I8EB 5D5MA 1U8IB 3S9DB 4HIEA 5AG9A 4H7VA 4BZ1A 3GXIA 1MFAH 4BWTA 3GI8H 3T6WA 4QRRD 2ID5A 5D2NC 1JGUH 3QWRA 3VDBA 1ROCA 3SDCC 1BMZA 4JRXE 5DJXB 2PWEA 2XBTA 3L8QA 3QUXB 3VFTB 5HTSA 1GIGL 3Q1EA 5GRZA 5T5NF 1A4AA 1W0VA 2GUOB 2JKLA 3CCHA 1EMTL 4P2RB 1NDMA 5EC2A 4BYHA 1IM3D 5AL0A 4JQIL 2IAMA 1MFEH 1NOAA 4JY4B 3LIUA 5D2LE 2I25N 5D7IF 3STZB 3IDIB 5EFIB 1XB8A 5I15L 5LQBH 2BP5M 5C08D 2CHZA 4UT9A 3NRQA 2O5XL 2VSMB 4PGCB 3MGAA 4GBXD 5D6DC 3UZQB 4DQOH 3UAAA 1OP5K 4ANXA 1U8OA 4OM1L 1P5VA 4XBMA 5HYSB 4R4NC 2ZXAA 5B3NA 1DEEB 5BRZD 1FNLA 3L48A 3VXNA 4NGHH 3TH2T 4H8VA 3QUZB 2IWGA 4TSCL 2X41A 4YDLC 1E3XA 1G7QA 4JM0A 4MSWA 4WU5A 1A3ZA 2XNAA 4D9LL 3FCGA 3WY2A 1RIUL 4LB8A 2AJZA 3DJRA 1NEZA 1UYWL 1I9IH 1RZKL 2D3JA 3QDGB 4LSQH 4KXBA 2E27L 4OGZA 1QSFE 2WV3A 4WHYH 5KYUB 1I9RH 1L9TA 3UP6A 3V8CA 4HEPG 5DURB 3FT4B 2DQGH 4POUB 5HDOA 3KLLA 2HB0A 4LPCA 1PL3A 4J3OD 4H4NA 4UQ2A 4AZ8B 4CW1A 1UD5A 4UIKH 4MWFB 3UDWA 3AWGA 5HYQB 1G6RH 4N0RA 4NUJA 4RZKA 2ZF9A 4XP6L 5HPMA 1NKGA 5D6DA 1JZEA 5E8DH 5BRZB 1CD1A 1JHTB 5DRXA 1TZ8A 3O4LB 1KCVH 2NCEA 1KIUB 4N9OB 1F11A 5TE4L 1GSKA 2F7QA 4PJFB 2XRAH 4PJFF 3BRFA 4FP8H 3KCWA 4JKKA 1T7XA 4P4RB 4UV4L 5L6YL 2ADIA 1JXGA 2XG4B 1L9QA 3MGOB 5J6GB 4YL4A 3MTXA 4XVUD 5T5NG 1BLNA 4BE6A 1ZT1A 1N2RA 3N04A 1G6RB 2ZXWB 2CBMA 4TF4A 1G7PA 4G8IA 2N59A 2K4WA 1ZVSA 2NPLX 3W56A 4PP1D 2HWZL 3SKMA 2CLZA 4M9OA 4ICXA 3HG1D 4ALAC 1K3ZA 1F86A 1Q9KA 5F1SA 1K85A 1P6WA 3LEVL 4FQQB 4ODBD 3BO8B 3TIDA 2VO5A 3CZGA 2Q5BA 2FWOA 1D5MA 3D0VB 3HC3L 1IC0A 1DJXA 3E6HA 3TBYB 5F7WC 3WKML 4K7FA 4PRID 5A43C 1AFVL 1V55B 2DJUA 3UBHA 3VFRB 4A2DA 1WWBX 4G3YH 1Q1PA 3IYLW 4JDTH 4P5TC 5FHAL 5EEYA 5AW7B 3TOPA 4PBVC 3T0XA 3BP4A 3HUJA 1KPVB 1Q9LA 1QLFB 4JGJA 5J6HA 3Q6FB 2R1WA 3BP6A 3QFDB 4H8UA 4WAFA 3VD1A 3PDOA 3SE9H 5J9PA 1GA2A 4CKQA 4V1DE 3VRLF 1H6EA 3S5ZA 4JHWH 1BZ7A 1VFOA 4RAVB 2OKMA 4XMTA 4M48L 4QHLA 4L5FE 2Q86A 3MXWL 1NANI 1EAJA 4X7DC 3TNNB 3VD2A 4TUJB 1C5CL 3CN1A 1RY7B 1UD8A 1HINL 2OMZB 3MLRH 4DGUA 3BIKB 2E74C 2F8OA 1LHZA 1CTNA 4HZ1A 3DK2A 3DGDA 1YA5A 4XN4A 5FUOL 1KJ2L 2R0KH 5DHXB 4MNQA 5J13B 5B1JA 1ESOA 3NIGB 4U6TA 5JIKA 1JPTL 1PJWA 3P4MA 5IHUH 2KZBA 2Y7MA 4JRXD 3GLDA 1J0YA 2GJZB 1IKNA 2QQQA 2FEJA 3QPQC 5HYIA 3T6QC 1WP6A 3HR5B 3QCVL 1SYVA 1Q72L 1P4UA 3L4XA 4U2ZA 5C1MB 1ZA3B 3BGAA 3RWDA 3ZUCA 3EYOB 5FGRA 4BQ9A 2XN9B 1IGML 1AC0A 2GJZA 1USQA 2NCMA 4KJPC 4LNVA 5TQ2L 4DZBA 5B3JF 3B2UC 5BMFL 4LVOC 4P5SA 1OVZA 1J1XL 1LWJA 1CLOH 5TF1L 3HE6A 4KTEL 2E75C 3GTNA 3DVFA 1WFMA 4KXDA 1K6QH 2CXKA 2EDFA 3QEGL 4M1GH 3TVMD 4DKEL 3BZDA 3VYNA 4AQ8C 2EYTA 4NRYB 1FZMB 3QK0A 4JM2B 2VUKA 3HPJA 3N1PC 3D25A 1UA3A 2R1XA 4G72B 2IAMD 2BRRH 5FDWB 3U46B 3WI9A 1GH7A 3ZE0E 3FFDB 2Y6TE 3DTXA 5ESAA 3RPIA 2X09A 5L9DL 4FZEL 3HG4A 2WQ8A 5AAWC 3EJTA 1PS3A 1V7NH 3HUJF 4PIBA 5B4MD 4F5CA 3JTTA 4XI5C 5E4AA 3LQMA 4Q56A 5EOQL 1XH0A 3ML8A 4OZGE 4L9LA 3N1QC 4PWEA 3W11D 1INEL 2R29A 4OD2B 5ABDE 5BVPL 4WHCA 5IGXH 4GSXA 5FWRA 5EIVA 3B7UX 3Q2LA 5ANME 5I8OL 3VWKC 2E0PA 5BV7L 3D06A 2J25A 4IMLB 5FKPB 1PDKA 4NYLB 1FF5A 1AZCA 3GSOA 1M7IB 4HMEA 2YXMA 3KWWA 1JV5B 5GSVA 4BUGA 1BX2B 1DQIA 1PY4A 1CPUA 5CO1A 4F7CA 1TTBA 4JFWA 3IKCB 4PW4A 3MFGB 5F1OB 3ZT5A 3GJEA 5GRJL 1A65A 1OSYA 1TMCB 3K2KA 1NBYA 4FXTA 3RRQA 4L9LC 4YHKH 3ETBF 1PZ3A 1PCSA 2XA8L 2F5BH 1N9PA 4NX0A 5J06A 4YWGL 2HTKC 4PJFA 1W8NA 1F2QA 1GGIL 4UUJA 4X6FA 3BVWA 1MKFA 3VQ2C 3K1DA 4XN1A 5DGRA 2GSGA 4LVHC 1Z2KA 2HTKD 4Y19B 1S5IL 1T66D 2I5YL 3P9LA 4J3OF 3ZE2E 1O75A 5JZ7C 1CFNB 3GRBA 4YLQT 5C3LD 1XVSA 2H5UA 1LYQA 1B4JL 3AG4B 3NJHA 4M61B 4U0RC 4ZS6D 1A0QH 5HPMB 3IRCA 2EDOA 2X6AA 3H9HB 3NAAL 2JB5L 1A1OA 1IC4L 4XZUB 4EOWL 2FCBA 5H35B 3K4AA 1BQHB 3PL6C 1FDLH 1GAFL 2DQEH 3NRPA 4OQTH 1S7XA 4HV8B 4X99B 2MOQA 1NKRA 4KNUA 1I7UA 1UGKA 4ZUWB 3SY6A 2XKNB 3WFDL 1KWKA 2XNAB 1CDJA 1V8HA 4WVRA 1AQDB 3O3AA 1JXDA 5J3HD 4PJ9A 3U9PH 5TDPB 1B9ZA 3BIAX 4PTUB 1ZLWK 3EYFA 4JO3L 3W11C 2EUZA 3WAKA 3WEAA 1QWHA 2YZ1A 4OF0A 2BOCA 3N1GC 4O51A 2DWDA 2DM4A 2NZIA 4W68A 5HYJD 3P11L 4LL1A 2V5YA 2OJEB 3CVHA 2DQJH 1R34A 4GAGH 4YSEA 2VXTL 3FF7A 3VI3F 1Y6MR 4GG6F 2GIYA 3TBVA 3JWNC 1YRKA 5J1SC 3ARZA 1FE8L 5I0DA 5LLIC 5JR1H 1FNFA 4ZK8A 1KB5A 1BZEA 2VR3A 1UKQA 2BNQE 43CAB 4JFYB 4JFZL 4TXVB 3LYRA 1UA6H 2A73B 2BOBA 4OLXL 4L29A 5ALBL 1G7JB 3NH7L 2F74B 4LKCB 5I1LB 2WXLA 1KPUB 4LASH 2NUTB 4QIRA 3RTLA 2BERA 4HS8H 5IWLC 2R39A 1GW0A 4XVSH 4LCUB 5JW3H 4G2AA 3DYOA 4R4FL 2QHLA 3FAXA 1NWPA 2NNAA 2YUZA 2FEEL 1T1WA 5HHQA 3ZZLA 2R0WL 4TVPL 3OKOB 2C26A 5FF6A 2BY3A 3L3HA 3JV4A 3SPCA 5GGQL 3HZKB 5DDHB 2JNZA 2O6FA 1LP9B 1MDTA 2AJUL 1MCWM 3HG1A 3QWNA 1F6AA 2L3BA 2X4UA 1T22B 4HF5L 2OXHA 1J0HA 3DRTA 4I9WE 3VM7A 4B9PA 1CC3A 2GITA 2B2XH 4HAKA 5DWUL 5CLYA 4EBQH 1UXWB 1OP4A 1SJVA 3SGDI 4AG4H 3Q1SL 4LLUB 2KDGA 1P6FA 2EQDA 3JWOL 3QXUA 4AUUA 4PLOB 3CSYA 5C8JA 1SQ2N 4JFDA 2F2HA 1FCCA 2IJ0C 1JZ6A 3D4GA 3T8XB 1RFDL 4NDMB 4LDOB 4OBSA 4U7MA 2A6IB 2F54E 4Q9CA 2V8LA 2XUWA 4XO9A 5FCUL 4AWJC 1A5FH 3GJFH 3MOQA 2XV0A 3DXAB 4LRNL 1AHKA 5KSAC 5IKCA 1BSIA 3ESOA 4GXFA 1BFOA 1TLKA 4JS7A 4Z7UA 4ZMXA 4Z7UF 3WL9B 1MH5B 3VXMB 5JNYA 1XF4A 2I07B 3AWFA 3TLRA 4F3FA 5TE7L 4Z18A 2AXWA 5C09B 4LRIA 3U0WL 2Y1ZA 3WGUB 4QY8B 5F96L 5CZXD 4KH2A 1CFTA 1YC8A 1OSPL 3U30C 2GPZA 5IV2B 1IUZA 2WB7A 5I1JL 4YBQD 2J1YA 3FSAA 4MA8L 3H3PL 2A9AA 5DK0A 1A1NB 4P07A 5C09A 3IEAA 1FLRL 3EF4A 4IYKA 4LPWA 1NZRA 2Z64C 4KDTC 5GS0D 5GS0L 5DVOA 2YS4A 4H0IA 3TV3H 4N90E 5EEUA 3B9KA 4LCCB 3KBPA 4NI6A 4K5MA 2NXYC 5JQ6H 4XN2A 2E56A 2EEXA 3ULUF 1CURA 4XI5D 5EU6E 2E7MA 5GIRA 3FU6A 5CD3B 2DWXA 3LKOA 5ICYA 1NMBH 4JRYB 3HE6D 1C5DB 4YZFE 5K9OA 1CO1A 4JDEA 3WHE0 2R2BB 2A77H 3VDCA 3E3QC 1N6VA 4UQ9A 2IAMC 5E6UB 4PJXF 4KKAC 3GMOA 5H2BB 5BVJB 4DPBX 3CIAA 4H0HB 2AEOA 1OT2A 3MO1B 4TULL 4JFTA 3EBHA 3IT8D 5FYLE 3V7MA 1JGEB 1FJ1A 4LU5L 5E2TL 3SGEH 3FUJA 4HDIA 4P9HH 5FYJU 1OGTB 3CZFA 1F97A 4AJ0A 1BG9A 3WS6C 2EUXA 3VXRD 3ABMB 1E5ZA 5HI3D 1PLAA 3DBXB 4KK9C 1GIGH 1U8NA 5EUOF 3GRWL 3B2UD 1ZS8B 2X4SB 2OK0H 3S37L 3HBPA 4YFEA 2LW3A 3UYRH 3L3DA 1TJGH 2BZCA 2P5WD 4XCEB 4XNMA 4S10A 3PP3K 2Z91A 4O2CA 2DMKA 4RA3A 1MFAL 1Q9WA 4Z76A 1HSBA 4P4KC 2B0SH 5JW4R 5TTRA 1NSNH 1HHHB 4BELD 2P52A 4W9HC 2NW3A 4ZUTA 3C5ZA 1OALA 5IFJB 1YNLL 4L29B 1A4KA 1RZ7H 1U3NA 4Y2DC 4C54A 5TE6L 4NM8H 5HP5A 1NDGA 2NXZD 3QYCA 3MRMB 4IBLT 3S3SA 3QIWD 1HL4A 1UCBH 2P5WB 4PS4H 1J7VR 1Y0LA 4BZ2A 4HG4K 5JPMC 3BPCB 3B9KD 4XX1G 3D3VA 3UTTB 5KBMA 3RVWD 3KYNA 3L2NA 1N5AA 5L88L 4JZOB 1ITBB 1X7QA 3BPLB 3NK4A 3UZVB 1K4DA 4G1MA 4QTHA 1EEUA 2VDMH 1NFKA 4LBEB 3CHPA 4EUPH 5E6SB 5KS9B 1D9KB 1KCLA 5FO7B 1BXXA 1BEYL 2QFPA 2L7EA 4M3JA 4KMQA 2DWEB 4QXUL 5CJQL 1WAAF 4DP7X 1FL3B 2BNQA 5TFSH 3F85A 2N0MA 3MV7E 1HNGA 3PAZA 3HC4H 3WFCL 3DDGA 4ETYA 1PGRB 2HTLC 5TDPA 1F18A 3ECBA 4AJYV 2OX5B 3DV6A 4XXDB 4NQDB 2P5PA 2PWFA 3BAXA 4UTAA 2D03L 4H8WL 3V6ZA 1B88A 1CXEA 2LQRA 2YKKA 5I1KL 2XJLA 5AQ0A 2R9HD 2DICA 1WEJH 2ZXBA 5GS2H 2J8UA 2DWSA 1YQVL 5IM7B 5BRPA 3VGAC 2CLRA 3MCYA 5CBEB 3MA9L 2EE2A 2ERJC 1X5ZA 2EJ1A 3MJ8B 4JREC 4M1CC 4QTIL 1GGUA 2OL3L 3SE8H 3OKDA 4X7SH 1DN2A 4KC3B 4NCC2 1KTBA 5KZCB 2GUYA 4A7UA 3BMVA 4GMSH 3O2VL 3DO7A 4EI5B 4KKBC 1M9WA 2D2OA 4XMXA 1U58B 5C08B 3IFNL 1PYWB 3WTTA 4UQ3A 4OCSH 4UNUA 3CC5B 2A4EA 1RULH 3AAZB 4U3SA 3TO2B 4E9QA 4UUJB 4H40A 4JY6B 4XNQB 1RHHB 1HCFX 4MBRA 1SMOA 3QDGE 5I0VA 3GK8H 3OKYA 4JQVA 1KCUH 2BHFA 2H2PC 2RIKA 4JPSA 3RX5A 4MNQD 3W1ZA 2R23B 4BZ2L 2DL9A 4DHLA 1QRNA 1JG9A 3HNTH 5DJZA 4GAYB 3IKCA 2R0LL 3BAWA 2ADGB 3E8VA 1IE4A 4HX1A 1YUHA 4TUKL 5HHVH 5T1KA 4AW7A 3GI9L 1BQRA 8FABA 3C6LB 3K7UA 3RZWA 5IEHB 2LT9A 1GGCL 1F4WH 1CIDA 1IC1A 1UWGH 3D1MC 5AG8A 3H56A 2AJYL 2JK5A 4F8PA 1EZLA 1KXVA 4GP8B 3MC0A 2FL5A 4HKXB 4N2KA 2X40A 3R06A 4GS7B 5D96B 4CNIA 5GRXG 5J5EA 4LESA 4PP1C 3GBLA 1L3WA 2DQUH 1I1FA 3BFWA 3DGGA 1A5FL 4GH7B 3EOYG 4K3DH 4ZFOL 4ZO7A 4YHML 2F8XC 4OI7A 4QTFA 1G1KA 3F6LA 3PGDA 4BSVB 5D1QA 5LCVL 1TIUA 4JNXA 5GZOC 5JQ6L 3MNVA 3QNFA 5BCAA 3S88L 3HN3A 2WLJA 3RB5A 3STLB 4GAJH 2Y6SD 1YEKL 1K2DA 2W0KA 2B8OT 3VWJC 1YMHB 1NPJA 2HT4D 2VQ1A 3KYOA 1VERA 5D7JB 3CJJA 4DPRA 3V5DB 1DANT 4BFIB 5DJDA 4DP4X 3FU5A 1CCZA 4FCHA 4P8QA 4AX3A 2XSKA 2ORBH 4Z1PA 4B50A 1KWGA 2YGPA 2QL1A 1Q0YH 1CR9H 1XGUA 3GKWH 5DTFA 5L6YH 3BP7A 1FYTA 5JOEA 4P3CL 4F8TA 5EN2A 2TSBA 4XMWA 1LTXA 2P45B 3O6LL 1HS6A 2XRAL 4JPWL 2FAUA 3MUGB 2AJVH 4PJ6A 4M4RB 4XWOC 4OZGA 2CGYA 1KYDA 3QH3B 4CMHC 4HWZB 1WGOA 2CO7B 3A24A 3IM1A 2F1EA 1SVBA 3SYCA 4DZBB 1N64H 3VFWA 1A6PA 1BD2D 3UC2A 5I1CL 4KXAA 5FWQA 1J05A 1LE9A 1PSKH 4LLMA 5FUZH 3S8GB 1L7TL 2XYBA 4P2QE 2DN7A 3BWUF 2AQRA 2QVTA 3TYGH 1U95B 4XOAA 1F13A 2WD0A 1SLWA 1MFBL 3NCJH 3JWOC 3QIBB 1M3JA 1M7DA 3H4HA 3P3UA 1YHPA 1OTUC 5DWUH 3WIIH 1AXTL 1U8MB 3M88A 5D4JA 4FI8A 3RP1A 1C8QA 4HUMB 4NO2B 4XT1C 1GZPA 1ZVNA 4G7QB 4XNMB 3FBQA 1G7IB 3IDMB 1BFVH 3OX8A 5EBWB 4HC1L 2PTTB 2WTRA 3GMNB 4HKJB 1ZANH 1RIHH 1XAKA 1JF6A 5I17B 1FORL 2NXYB 4Q89A 4AKOA 5D1XE 5BJTB 3QEUB 2QZ5A 5HHVL 1OGTA 3CZFB 5TFSL 5CN1A 1AGDB 1FPTH 3L2LA 3EDFA 5AUMA 2WXFA 4JCMA 1HN1A 1OKEA 5I6KA 3M86A 4HUWA 2ZOTA 4Q9RH 3C6SA 1C12B 3BLBA 3K6IA 4QRTB 2OR8A 1YO4A 2FLBT 2XWTA 4KAQH 2ARWA 1E6JH 4WEUD 1PG7X 2NY4B 4NQCB 2AXFA 1I9JH 1GTFA 1ZIAA 3FB7B 1L6XA 4O5LL 5HVHC 4NNYB 4TSAL 1QUNB 2BSSB 5HGDA 3SDCB 2G4GA 4A6YL 1TVBA 3O11B 5E6IC 2FWOB 5F89B 3VCLB 2J88L 3LRMA 1KN2H 4N1HB 2Y5QA 3TYFA 4TQHA 3EHBC 4FQCH 3D4YA 5B1BB 5DJAA 5KBPA 4U0RB 2W59A 1WA1X 3RL1A 2P9RA 1K8IB 2GEQA 2GABA 3LZPA 1RZJL 2W91A 3RHWF 4IOIB 2GB2A 4G42B 4HCFA 5DD5L 2IH3B 2NY7L 3V9CA 3ARPA 2K7QA 7FABH 2DQTL 4LSRH 4Y88A 4PVBA 5IV2A 1KSRA 2A77L 3T77A 3CSBA 4U1MA 3SGKA 1CFTB 4WCYL 2ADIB 4F92B 2AV7A 3FB6B 2JELH 5CSZA 4D0DB 2ICEC 1P2CA 5JXAL 4JO3H 1K8IA 1WJ3A 3CPLB 4X5QA 5F88B 4ZO6A 4HK0A 4LIQL 5LB1A 2Q7AA 1Z9SA 3MVSA 3WDJA 1G7LB 4HLJA 5CZVH 3D0AA 5DVKA 2GTZB 4JFVA 2HJFA 5LNDA 1JN6B 3OAZH 1WZAA 3IFPB 2HH0H 4P57A 5JIMA 3T2LA 4Z95L 5HGHA 3X3FH 5LBSL 3L9BA 4PLKD 4CVZA 3DVNA 2ZYHA 1JHLH 1AIFA 4J6RL 4JEGB 4AGMA 4HS6A 1LO3H 1M2VA 1WHOA 3RTQC 4YXLL 3HI5H 2WCSA 1U3YA 1AS7A 4KITB 2WW8A 2WBKA 3QUZA 4H1LA 4GQRA 2X4UB 4KKLC 4B9YA 1F6AB 4FFVD 4AYDC 3RURA 3MBXH 4BK5C 4P48A 4KTDH 4TPRH 3L5WA 4Z5RA 3OX8B 2OYLA 1HHIB 1SDDA 2MEJB 4XAWL 4FD0A 3EZJB 5CLTA 4DCQB 2E4FA 3HG5A 3QIWB 3MXVH 3D05A 3STZA 5F7DA 1ED3A 1O6SA 4MA8H 3D8MA 5EU6A 5A16B 4MHHI 2FATH 3RVXC 2VN5A 1WYJA 5E1QA 4PJ7E 1KN4H 1KFAH 3K2UH 3KPMA 3LTVA 5HDQH 4A66A 5AYQA 4C4UA 4EN3B 1GYAA 1MPAL 4OJDH 4NKIH 3W9DB 5LXVA 2I9TA 3GHEL 3GM0A 3QQ4A 2ETWA 3TU6A 1RIHL 3VQMA 3QUGA 4CC0A 1KG0A 1CT8B 2YD1A 4NCDA 2RFXB 3PIQA 1U2YA 4HIEB 3DBSA 3DROB 2XKSA 2OJZL 3G5XA 4LDLB 2J55A 1YZZA 1JK9A 1HL5A 3I84A 2VXQA 5AW4B 4BIKA 4RMBA 2QGBA 1YEKH 4GAJL 2IQAB 4NRXB 2RTTA 5G2NA 4KAQL 3OSKA 1IKOP 3D39E 1BBDH 1EJ8A 3B9DA 4QOKA 2ALAA 2QPEB 3OKLA 5F0LB 4BCXA 4XMVA 1GRWA 2UZXB 3F64A 3ILQC 4MMZA 5GSRB 3EOAA 3AB0C 1AZBA 4PJ8A 3ESPA 4PJIA 4WV1A 2EXSA 1Z3GL 3INUH 4HZAA 1M57B 3AW5A 2WIIA 3TA4D 3QDMA 2X88A 1F41A 3ZKSD 2W94A 1FYTE 3LQAC 4XCYA 1WZ1L 1MRFL 1O5PA 2CGRH 4JM2D 4N2FA 2E47A 1F4WL 1T04B 2WSDA 3CQFA 3EH3B 1KBGH 3WNOA 1T5XB 3FCTA 1EERB 1E7UA 4QNPF 5D1QB 3RUGB 4W4OC 4DKTA 1NGZB 3QDJE 1E90A 4J1UB 3ZQ9A 3GF8A 4QT5B 5K9JL 3AREC 4JFFD 3K6SA 1E5YA 5MHSD 3Q8FA 4K71C 1K72A 2CQVA 2X9XA 2F8IA 3QIBD 4EI0A 4ZMVA 5F1IB 2DQ6A 4D9QE 4OCRL 1G7MB 4XRCA 3CXHJ 4N6RA 2XCMC 2EDTA 4OQTA 4QWWC 3LZQA 5F1KC 4XOCA 3H2PA 1T83C 4IMKC 4IRSA 3K74B 3BDYH 2FZ3A 1Z32X 1J5OH 1DVFD 3FC8A 1AZUA 3OJ2C 4MXWH 3UABA 5C0JB 3TH4T 1T1XB 5F7UA 5EEVA 2HKHH 2YC1B 4QJ3B 3VFSA 4RGOL 3MREA 2ZAHA 1BJ1J 1F4XH 1NICA 1E5CA 2ZWNA 1JI2A 1DCEA 1SEQL 2ATKB 1BAWA 4LPUA 1NL0L 4XTRD 1KGUA 1E4KC 2EADA 4Y16B 2OCCB 3RWHB 5IW1A 1NC4B 1EXUB 4PJHB 3CC5A 3SDXB 4I9WD 4Z7OF 1U58A 4DK6A 1OPGH 1KTLB 2ITFA 4JVWA 2F54B 2XC8A 4AUYA 3BCDA 4KKLD 5HVFB 4KUCD 4Z7WE 1OCRB 1E5UI 1QBLL 1I8LA 5CJBA 1RIVL 5D2LF 3VUAA 3ZTNL 2DEYX 4NQQA 3SDYL 2I9LA 2QKIB 1NAML 4KPHL 5SWSD 3K6SB 1P7KB 3OAUL 1ACYL 4EXPX 5C2BL 5EEXA 2YAFA 1AO7E 1UXMA 4X4KA 3ZVVA 4D9RE 3L4YA 3VFGL 1F45A 3MKGA 1TZAA 3CDCA 3PHQA 3QZNA 4KO9A 3DSFL 1LO0H 2BVUA 4LLYA 4QPEA 3EH5B 3UJIL 5K9QI 1JNHB 3NPSC 1S7RB 4RSVA 2IDTA 1KB5L 1HZHL 4O4YL 3MSPA 5CSGA 2HFFA 3DTUB 4WEBH 2D31B 3ZL4H 1KTCA 4MQXC 5C0CA 2LV4A 4LEXH 4WZ9A 1T0PB 4LARL 3CVDA 4ISVA 2H8PB 1NWOA 3HG3A 5IJCC 5D7KD 4FXGC 3MPCA 3JWNH 4IGBC 1IT9L 3PL6D 2DDQL 1KZQA 3VB8A 4YX2H 5EU3B 1YEEL 3FSZA 1E9OA 1T2JA 4BZ2H 4NP4L 4XBGB 1XGPA 3N50A 3TO4D 4C56A 1F8TH 1JZHA 2XQYG 1GC1C 1TJHL 5IOPA 2DLFH 5B8CB 3HNSL 3OR7A 2NT0A 4JB9H 4XMKL 1TQUA 2AXJA 4CU8A 3NIDE 2BSBA 2ZX7A 3G5XB 2D3VA 1LO2L 5I2IB 5D72H 3V5KB 2ENQA 4G71B 4M5YH 4QF1A 5B39G 1MEXH 2RFXA 1KC5H 4KHTH 1QQDB 3EYOA 3ATFA 1NFDB 1AAJA 2P43B 4R7DA 5FYKD 3MROB 5CGBA 3U7AA 4Z7QF 1S7TA 3HNVH 1JNLL 4UINL 5HYJA 4OF8A 2XX1A 3ARVA 1RVFH 3AY2A 5FA3B 4QTIH 4F5CE 3SQOH 5IOKA 3MV11 3O2WH 4XX5A 1GS8A 1UKSA 4TOYH 1PLCA 5KOVC 1I9IL 3SPVA 3SQBA 2HAZA 1DANU 2R51A 1O7VA 4EPSA 2KI6A 3VRIB 2J5LB 3TBCA 2QR0A 2VCOA 5JA9A 3RB7A 1BIIA 2JQMA 1MHPL 3V0FA 3LS4L 4Z3TA 3EUUA 4JFEB 2OBGA 5DA0B 4KZCA 3UO1H 1LDSA 2C9AA 4JG0L 4B9FA 4UAHA 1AY1L 2H6UA 1OSEA 2YA2A 2DW5A 3MUHL 4JFSA 4S1QH 1H6FA 4ONHA 1H3PH 1WBYB 2BWQA 1FSKB 3I3DA 3VWKD 5KJRL 2UV3A 5FW6A 4UI2A 4AE0A 3LZLA 4HDIB 4YS4A 3UBGA 4POZC 1W9XA 4L2YA 2BP0B 4H20L 4W6WB 2ZX8A 1VHPA 3UTPE 4LZKA 2WLMA 3TPUA 2JV6A 5KSBB 1OTTC 3QUMA 5H2BA 2Q87A 5MEND 3P9MB 4G6KL 5FYJL 1M71B 4JKPL 3VFRA 3AXHA 3LXUX 1R1CA 1EWHA 4ZS6C 3UYRL 2ZKHH 3UROR 4FKEA 3BKJL 5HHOD 1NOLA 1BWMA 3P77A 2IANA 3IFPA 5ICYB 3KJ4B 3QIUC 1OB1B 4PJBE 1JJUA 1KXHA 4KI5C 5E5RB 3N9GH 1NGXA 4KDWA 2H1XA 4I87A 2VC2H 3FFCE 3LVTA 3U0TB 5ID1B 2C3GA 4ERSH 2QADC 4N0CC 1ZDQA 1CICB 3GSWA 4AVJA 1G6RA 3K8LA 2W80C 2JCCF 3II1A 4W9CC 3RFZB 3DX8B 1EZSA 4WSGA 2AKRB 5FUCC 3L4TA 3VXSD 3NVQA 3K4DA 3CVIL 3P9WB 3RVVC 2YQGA 1IGIH 1JVLA 4YSRA 4KKRA 3LZFL 5IQ7L 1I8MA 3VD9A 4G42A 4X8CA 4IOIA 2FX8L 1SVCP 2A1WL 3BAEL 3Q6GL 4UF7C 4KK9D 2GI0A 3QXWA 3RL1B 4YUEH 4L18A 2D7NA 3B3IB 1UOKA 1ZLDA 2VDLH 1EEZB 3I50L 4RFNB 4AQEB 3K71B 1SM3H 3DLQR 1ZHLA 4QOKE 3EUDA 2AC0A 4KY1L 2R1YA 4ZTPH 5GGSY 2PO6D 4Y1AA 3WNNA 5DMJB 5IVNA 2V3DA 2YAEA 3B2XA 5D71L 4IKKA 4Q6IA 1FAIL 1Q1JL 2DM2A 4L8BB 2JSFA 4MD4B 4WWOA 5ETUB 1G5AA 2WZ0A 7CGTA 4FL4B 4LLVA 5D7SH 2B1AH 1DQDH 1W80A 4GQZA 2PW1A 5C70A 1CI3M 5SWZD 3CLFL 4RMQA 1ZLEA 5KYUA 3C6SB 1EAPB 4P5TA 5CIPA 2EIZA 4MQ7A 1BDYA 3BJLA 5AUMB 5K1NA 2QQNH 1ILSA 3ISYA 2FQDA 4K8RC 1AXTH 2IPUK 1ZA6B 2NY5L 5JHLA 3HUJE 4MMYA 1ZHKA 1KJ3L 2CCLA 4AIOA 1XF2B 4JM2F 1UTDA 1NL0H 4OZGF 3MJWA 4PGBA 4YSUA 4LHUD 1JNLH 1KGXA 2WO3B 4GYBA 1YEDA 4J3OG 1JXFA 5CJXC 2HUHA 2VQTA 4X5WA 4PVLA 5FHBL 2X1PA 1TQCB 4U1KA 4HH9A 5IR1A 4HOXA 4B97A 3WY4A 4PJ5B 5J89A 4KJQD 1G9EA 1L0XA 1A6ZB 2J21A 1J48A 1CU4L 4M03A 4PU2A 1QRKA 3UTSA 4NO5A 3WKPA 2BOBB 5AOIA 1ZOXA 5SX4I 4OCRH 1XF3A 3ISWA 4A55A 4RX4D 5DJYA 5E8NB 1LE9B 4JFYA 2O5ZL 4URTB 43CAA 1J9CT 2Q3XA 1RZFH 4EUPA 5IFHL 5IREA 4UNTA 4KWUA 2NY0C 3INOA 4OV6F 5G5DA 3MJGX 2ZP9A 5CWSB 4YSOA 1Q9OA 3BWAB 1J5CA 3KCPA 3VI4F 5F2FA 5JHLH 3QISA 4Z3EA 4JFFE 5LG6A 1ET8A 1KBGL 1UB5A 3OHXA 4WEBL 2VZ1A 4WTZG 5FW8A 3VXRB 3R19A 3T0AA 3OXSA 1TTUA 2X53A 1SFHA 2WHVA 2YO3A 5FS5A 3E7JA 3S88H 4NJ9H 3T5WA 4UAOB 1AS8A 3N91A 2EDBA 2NY4D 4LL9A 1QFWL 5GGTA 1EO8L 3GTTA 4I5BA 3PP4H 4WI9A 4JHUA 3REWA 4E9XA 3BPNC 1SF5A 2CRZA 2QEJA 4OGAD 5EOCH 4B9CA 5EF3A 2YWZA 2WAQA 3PNWB 4Q6KA 4RDQF 5DHYA 1MFCH 1NC4D 1IGCL 1JPSH 5ITBL 2Y7SA 3L3KB 4P5TD 2G30A 4PTUA 4K23H 1TVHA 2FHBA 1IGJB 4P2AA 4U6XB 3RDTC 1XZ0B 2VXTH 4ODUA 4PJ9B 4M62L 4PRPE 5KYWA 1D7FA 3U4AA 4M8RA 3WE6B 3PGDB 3KPLB 4BSVA 5A3ID 4X42A 1JI1A 3T0EC 3VSQA 3RGBA 2VISB 2Y0SA 2DYSB 2WQAA 2XWRA 2VRKA 1GS7A 1OSZB 2CO6B 2GQHA 1JPGB 4OSUH 1RZFL 5E03A 5E8EA 3BP5A 5I5RA 4LAQH 4X8JB 2WXHA 4TNWK 5ITFA 2WGNB 1CD0A 3NH7H 3UGEA 3FSVA 5DD6A 3F01A 3KPNB 3MOBL 5EBLB 1ETA1 2G0KA 3TTYA 5EWIL 4KVPA 3IRPX 2VDOH 4K7PX 4RDBA 4LO9A 2R2HB 6PCYA 3QFJA 1SBBA 4MZ3A 4YSAA 3ARFA 5FX3A 3VG9C 4X5PA 4U33A 1ZEAH 1N5YL 2HTLD 4RX4A 1RUQH 2XVGA 2Y4SA 3CFJB 4HGWB 1R3HA 4JHAL 3TBWA 2PR4L 3M7FB 4JG5A 4EDXA 3EOBB 3HZMB 3M8OH 3ZE1F 4UM9A 1UWEH 3BXNB 5I6MA 3DOSB 2Z6FA 4C56E 1WS7A 1FGNH 4JY6A 4XNQA 3IF1B 3N44F 1JDDA 3QZBA 4LSQL 2FO8A 5IBLD 3QNYA 5L7XH 2EDEA 4ZNEE 1PLBA 3O8XD 4YHPA 4BZYA 1H5BC 1LE5A 3MU3A 5ISZD 5ERWA 2DI7A 1WIUA 2MHAB 1N8ZB 5KVDH 3EKCA 3PAYA 5HI5D 4ZI8A 3VJ6A 2CDFA 3TF7C 1R33A 2CM6A 3HE7A 4R83A 3SDAC 3NACH 2EUWA 4H8WC 3DX7A 3KH4A 2J8UB 4L23A 5DS2A 3KR3L 5E9DB 3OPZH 2ED8A 3BQUD 1BEYH 3BD3A 4ORGB 4AQAA 4F93B 3KBFA 4ZFGL 5D7IE 4ZUSA 4MX7B 4CUCA 3WXWL 3EXJA 4KY1H 4ZTPL 1YEGH 2YA1A 3CDFA 5FGCE 1P4IL 1EFQA 4N20A 5JPNC 3PQYE 4JW3A 2AW2A 4JDZB 4PJ9C 4I18B 1RCYA 4Y4FB 1ES0A 4FABH 3GJFA 3RWGA 4MXVF 3V0DA 3VWKA 1G4MA 1HAUA 2JCCA 3DYPA 4ZT1A 4MVBC 1AANA 5DMKA 1VEOA 3CVIH 1PFOA 1JF1B 3D25B 2BVPB 4OGQC 2J12B 2Q0ZX 1XGYH 3RHWK 1HL9A 1MFMA 3GGWA 1ADWA 2QSTA 1XBDA 4X5XA 5TDNB 3SDAA 1HK6A 4KZEH 1NCDH 1CFSB 1TMQA 2QV4A 1JK8A 1AG0A 3MLUH 1N6UA 3EW3B 5E08L 4KJWD 1HHGB 1S7WA 2NQ3A 3KPRE 4Z7NB 3UCQA 5B1KA 2F7OA 4P4KB 3WCYA 1S9KC 3GJFK 4I3RH 4QGYA 4WFHE 4XNUL 1G0YR 4ZMLA 2P4AB 3R7QA 2BX5A 3ZSSA 3OB0H 5BPPA 3NDYE 4HKZA 4GKOA 2EUVA 3RVTD 1ORQA 4GIAA 4KI1A 1E4WH 1YJDL 4AEFA 3F6IA 1ZK5A 1SQMA 3GNMH 2AFNA 4F57H 1WS8A 3PJSA 4P5RA 2FH6A 1RZ8B 4IRZA 4JHWL 2GKIA 2HMID 3Q8EA 2CRYA 4PD4K 3KWVA 5H37A 4P9HL 5FOBB 3QG6B 4LU5H 2WGXA 2Y1YA 3GPSA 1WPCA 4AEEA 1XGTA 3GBDA 4HT1L 5E00A 3GIVA 3RWCA 4Z77A 5DRWA 1TTFA 4FTVE 4UWQB 1QW8A 4XCEA 1IQWH 1E4KA 3BMWA 1XV8A 5HJ3B 4IRZL 4JDTL 4XPBL 3DHUA 1FQ9C 3HBZA 3JUYA 1GXEA 1A7RL 4Z7QB 4I2XE 3GMLA 2DH2A 2VZOA 1JERA 1GKEA 3MJ7B 3NTCL 3SKUD 1MFCL 1DQJB 3KYAA 3LNEA 2KBGA 3HAEG 4G5ZL 3O6FD 4FYQA 2Z65C 3KPTA 2WVVB 3AXLA 3KPOB 4HIJA 1WV7T 1OAJA 1IZKA 3BW9A 1L0PA 2DMBA 4FFYH 4FHBD 4NJ9L 4FYSA 3RIAK 2XIBA 5I8CA 4NJAH 1HC1A 4OZIA 2BNUB 1X5GA 1E2WA 4YMPA 2C3VA 2R2BA 5T1LB 4ODVH 1A6UL 2BCKA 3QO1A 2X1QA 5F7YC 4IRJD 1EJOH 5TF1H 3WIAA 4YPJA 1TFPA 12E8H 2KL6A 1FG2A 5DK3A 4PH8A 4IKJA 3EXLA 4G8GA 5KYYB 4PJAA 1IGMH 4IBVA 2YZ8A 4I77L 2EVHA 3BHBA 1YEIH 2AJVL 2J2ZA 2UZYB 2HG0A 4XP1L 3GZKA 2VOTA 3D34A 3TFKC 3WTYA 1JAEA 1MCOL 1DVUA 1QLEH 4BA0A 4IBUA 1RJLB 1A6AA 2AEQL 3RUGE 2YD8A 4JPKL 5IJVB 5FHBH 3ZKMD 1HH9B 1T7WA 3A6CH 1RAMA 2VITA 3W3BA 1GKOA 1N0XL 3TVMB 2VDOL 2B08A 3KLQA 1NEPA 2PP9A 1QZNA 3QR0A 5DK2A 3ZSTA 1FO0H 1R5IA 1J86A 5KVDE 1I4FA 3CHRA 2Z92A 4S11A 5CZXC 4BH7B 5AENA 4GQPH 1UCTA 4OLVH 2EACA 3ARGD 4QRUB 2Q7YB 1G9HA 3V6BR 5KBNC 4UYPA 1CXHA 2YWYA 1P4BL 2OMTB 5A3IC 4ETQA 1R0AH 3SE3A 4NIYE 3ULSB 3WFHB 1CDYA 1AXSA 2Q6WB 1S7UB 4AOFA 3C8KB 2P8PB 2YKLL 2WO4A 4N6QA 2HLEB 4R7LA 2QSVA 3SGKC 1MCNA 5JXEA 3GSXA 1RZIA 2B9AA 3APDA 5F1NB 5DXWA 1MJJA 4GUOA 4JK0D 1HEZA 1OPGL 2VITB 1XD1A 1GZHA 1HXKA 2Z0BA 3VXNB 2JQAA 5LGHL 2YGNA 3IJEB 3UJTL 1LP9A 3HG1B 5E5MA 3QG7L 3QQDB 4NN5C 2IPKA 3BX7C 3LPWA 3WN5B 5CS7A 5EEZA 3HI1B 2C3XA 3S7GA 1HSAA 3LV3A 3V4PA 4DN3L 1JGUL 1MCWW 3HFMH 4L5FH 3SE3C 1UZ8B 1W16A 3DOHA 5BS0A 3GS7A 2EYRA 2PXYC 3WKQA 4IDJL 4DPAX 1AD9A 2BO0A 2WBJD 2NW2B 3CHQA 3ZGHA 4PJAF 2VXVH 3ARED 5IMMA 1XH3B 5JPNB 5KYYA 2HFTA 3NFSH 3CFCH 2X28A 3V7AG 2JKWA 3X11A 3TN0C 4N9GB 1XB6A 3VFTA 4ACTA 1QEXA 4I0PC 2C3VB 5JTWA 4F37K 4LNRA 5CUSH 1GZHC 3KGSA 3F7QA 4N25A 1F0LA 4UQAA 2R4RL 5CM1A 4YHYC 5FECA 3CDYA 3F12B 1PZ2A 1VGKB 4QJ5B 1U8IA 5I8EA 1XL6A 4M7LH 4PYHA 5KG9A 4ALAH 2EDLA 4GEJA 4PJBA 4M6MH 4XP6H 1U8HB 4FFZL 1SXNA 2PXYA 1CG9A 1XCTB 2IADB 3V4UL 1R17A 4NJAL 4CRPA 5KAQF 1A7BA 4RMVA 4TTGA 3U9PL 2VDRL 3C87A 5GGSB 2SODB 2NYYC 4LSSH 4OT1L 2AMUA 5E8OA 2K45A 4WW1A 2CUMA 2NY5H 3CD4A 5I1EL 5DRWB 3DHMA 3TEUA 3QIUD 3QWQB 1QSEB 3U4KA 3S0PA 2AK4B 3MV8D 2V9UA 5E5UB 3C60B 3EFDH 3WAJA 4PWKA 3KXFE 4Y16D 3IETA 4MD0B 3SDCD 4CN6A 4JFOB 3ZHKA 1SJXA 2Y06H 5DLLA 1U6AL 2QKSA 5I0XA 1DBKL 2A6KB 4WWID 2XKNA 1IQWL 2DJ4A 3KVQA 5E99H 3I85A 4LSPH 4HLEA 4F7TB 3P3YA 1F3DJ 3MCKA 3MRGA 3EJSA 1PKQB 4PRAA 3O2WL 4NOFA 3IXAB 4P2OA 3UG5A 1OCOB 3V0VA 2VT0A 2VZ3A 4ODWB 2CE6A 3C5SA 5F3HA 1QABA 1DQMH 4MZ2A 3RGVD 1CFNA 4X9HA 1KY6A 4PWFA 3BISA 3UBXA 1GPOH 1GOHA 3OKKA 2X9WA 4X6FB 2IQ9H 4QRRB 1PAZA 2PP7A 4ONFH 1IC5H 1TT6A 4WU7A 3T4AA 2BY0A 4R7VA 3Q2VA 2AZAA 5E1HB 2F53D 4HIIA 5F9JA 4BFOA 4NZDA 2QADD 4HFWA 3CZUB 4MNGA 5JPMA 5EBMA 1EGJH 4A2LA 4XWGL 4RSYA 3WFEL 5EU4A 2L8AA 1VLXA 3HKZA 4KI5D 1P5UC 2FIKA 5ADOH 4LBAA 1FFOA 2NTFA 4ZUUA 3P2DA 3QDJA 4JPVH 2APSA 1D5ZB 15C8H 5K39B 4B9KC 2CK0H 5FM5O 3MOAH 4F7MB 4Y2DA 4CKVX 4TLSA 3R4DA 4YHLL 2JIXB 4JZJB 3VXQA 2Q3ZA 4KKAD 4XBEH 3RGVC 4Z9KB 2ZPKL 4HCRH 3VJ6B 3MV8A 2XJKA 2OR7A 5C0BD 3X3FL 3RWFA 1NGYA 4OD3H 2VC2B 1N8ZA 2AVFA 1YQ2A 3APMA 2N7SA 3D4CA 2BRRL 1ZWIA 3N41B 2I7OA 4PRNB 4XNZB 2OTUB 3C5JB 3D07A 2ITDB 3QNYB 2PYEB 3FO1B 3RYMA 2BW5A 4OCYH 3LH2L 3QI9B 4XBPA 4TUOB 5T5FL 1LNUB 1AH1A 2APXA 2HVKA 4X2UA 4BM7A 5IESL 5AB1A 4XVTH 3H3PH 4NM4L 3S4SB 5F8QC 1CE6B 2BSCA 4EI5C 3HPJB 1KTDB 5GS1A 1OWRM 3QJHB 3UBXB 4GKZB 1XH1A 4B60A 4X6BB 4UT6A 2Z9TA 2BHZA 3AT8A 3QDMD 1DUYA 2HZHA 4P2YA 5DMIL 3RE0A 5IVZB 1B6DA 5DD6B 3C5SB 3JWNE 5F3HB 4KGJA 5JLZB 5CJ8A 2X4NB 3VD4A 1JPTH 4KKQA 5IHUL 2V7NB 2L7UA 2P7TB 1DSYA 4Q0XL 4YVUA 3NSJA 4Z78B 5FB8A 1JCKA 2X42A 3S97C 2TAAA 4L3CB 3AZUA 4NC0B 4EE2A 1LVEA 5HDWA 3QFJD 1RK0B 1SYVB 1GHFL 3IDGB 4DH2A 4LGPB 4LF3B 3SO5A 1UZ6E 4ZBJA 3CV5A 2YJQA 4YGVB 1MQKH 5BZDB 1JD9A 4WSJA 1HQRA 3LY6A 3E80A 4Q9RL 1JZ4A 3O9WD 4GW4B 2A83A 5B1CA 1PZUB 5G4NA 3GHPA 4HYTB 9CGTA 4OAWB 7TAAA 2ICWI 4PJ5E 3L5IA 4MZRA 2P49B 3LNGA 4IIQA 4V33A 4ORZC 2HJLA 1JRHL 2AGJL 4NWUH 5CEYA 1BYNA 3H85A 3GO1H 3JVGA 1Z3GH 2H7WA 2V8MA 3INUL 1WUNT 2VXVL 4Y8AA 5FXCH 5DVLA 3EGXA 3NIDF 3QFDA 4JG1H 4JZJC 3VFNA 1L7IH 1BGXL 1PMYA 4IS6B 2B14A 3BN9C 1A8JH 2VDRH 1KJMA 4XP5L 1IJ9A 4YHOL 3BQUA 1I1AB 4NFBA 2HRLA 3FUIA 4EEEA 3TEZA 2CLVB 5ENWA 2BH0A 1UM6L 4K9EH 3QEQD 1FLRH 5F0PB 4F58H 4G82A 4NT6A 2ZOOA 2GK0A 5HHPB 4EKJA 2HFEB 3C5XA 4HU2A 5DJ0B 2LU3A 1ET5A 1KJVA 4ZXBC 4PY8J 1EANA 1XH3A 5JPNA 2QFRA 4GI6A 4NI3A 4HH9B 5I1IL 5IMMB 5IR1B 5IJKC 2ODHA 3UZEC 5I1HH 2I7SA 4CILA 4KKNA 4UANA 43C9A 1CDBA 3JVGC 1BFSA 3MRLB 3EO9L 5TE7H 3SZKC 4G8IB 2CBOA 1SJEB 4PRIE 3THML 1JIBA 1D2OA 2WNKA 4M7LT 4XNXL 1S7VA 2N4IA 4ELME 1IAIL 2FLRT 5DQJA 1FSKC 1SOSA 3QXTA 3O4OB 1H6TA 4KMLB 5MI0B 5HHMB 1IAMA 3BVNB 3NCYP 4WTWA 4RGOH 3UTTD 3HRPA 4GG6A 4HWBA 4WI7A 3BYTA 2W92A 3AG2B 3TCXA 4M7JH 5FYLH 2NLJB 3BH9B 1A7NL 5DRNA 4MJID 5FYJD 3EJRA 1NGWB 2B39A 1IBDA 3CX5J 4WWKC 4LCYA 4ESKA 2EKSB 2WMPB 2X89A 3F6JA 5DD1L 2WKOF 1JZIA 4YSPA 5LDUA 4PV1C 3WSQL 1KBWA 1XSKA 3QQ3B 4J3WA 1W0WB 3ZDYF 4UQIM 3ZDYB 2CO4A 4J4PD 3DIVA 4F2EA 4EIUA 4YPGB 4JO2L 1A3QA 1RZKC 2WMPA 2EKSA 3BOVA 3S36X 1ORSA 4LGRB 4DKDC 1BQLH 3U6RB 2FD6H 5J13C 1R5IB 1A0QL 1OK8A 4LL4A 2PYFA 3ENEA 4ELMA 4S1DC 2MQ0A 2C7UB 2WINA 4MKMA 4YNYA 5FKAA 4E9SA 5CP7A 4AK1A 2NLJA 4OV5B 2ZD0A 4ZPTB 5BUAA 1O9WA 3FOMA 1OLLA 1T2QL 2JKNA 3N3EA 4MJJA 5MHSE 4GG6B 1REIA 3FDWA 3T4YA 1QAWA 5F71A 2KZ1B 3ZDWA 1U8OB 4UQDA 5HYSA 3HHSA 1URIA 3QW9A 2K4AA 3LIZA 5D2NB 4AEIH 4MRCA 2BXZA 4PJGF 3IMBA 4J6IA 3BGMB 3L17A 3ULVL 4M4PA 4WFED 1BGXH 4A04A 2ZCHH 4MAYB 1DQVA 4I0PB 1X5HA 4DP2X 1DJZA 2FT8A 4I48A 3B34A 4BKSC 1W0VB 1NBZB 3CCHB 4PJCB 4JVUA 2UYLA 3OKNA 4TVPD 1KB9J 4ZYKA 2B3RA 3CN4A 2XKUA 1JYWA 4Y2NA 1C1EH 1DVTA 1J1PH 2Q8AL 3VRJB 2I24N 1J8HB 4B3EA 1CLCA 5ELIA 1EFXD 4LLWB 5E9AA 5C0DA 3D18A 1P4LB 3S36L 1Z5LB 3C2SA 4BZ1H 1CL7I 1ZT7A 3JBG7 3UTQB 1NIEA 1OWWA 1TLMA 4G6FD 1ZLVK 1QYGH 4X6CA 1PZAA 5EO0B 4Q6YA 4IIQB 1FVDB 2UY7B 1TDQA 4KJWC 1AG6A 4A67A 2EE6A 5K9KA 4YSQA 3UTSD 4G6KH 5FYJH 1U8CA 2WYIA 1S7SA 5FYLD 4K55A 2F53B 2YBGA 1H3XA 1KGCD 2CKBA 4RGNC 2GJ6D 4OAWA 3V0IA 3VFUA 4NC1C 4AQZA 1TTGA 1GMIA 1BBJA 1NCBH 5BO1L 1VSCA 5MENE 3MA7A 4JFQA 4X7TA 1UVQB 3MZTA 3ML9A 3H2WA 3MI6A 4R8WL 2AQPA 3ARGA 1PD1A 3FT2A 5F6IC 3TBSB 4DUWA 3V55A 1OB0A 3MMEB 5K5YA 4N0FB 1ZTMA 4ZQKB 4GMTH 1HOEA 2AJSH 2BSRA 4PVMA 1MHPH 1NFDA 4E9TA 1QI5A 4NKOA 4I3SH 4EIBA 4H0LC 4G6FB 3SBWA 5JHDB 3PWUB 5FGSA 2PW2B 2E9JA 4PB9L 2X4OB 4Y19E 2VZSA 4RA0C 1FRGL 4XWGH 1HILA 4Q97A 3DX1A 3O9WB 1RVFL 5IOPB 1AZNA 4F9LC 4R0LC 3ZTEA 4A68A 4L3FA 5K33A 1RH8A 1L7TH 2EIKB 2F7PA 4MAYC 2APFA 3WTUA 4BXVA 3SKNB 4I2XB 1DUYB 3SYQA 1RSFA 3ARQA 5D1XB 3RX9A 4ADGA 2AK4D 1DR9A 1UT2A 3HJ0A 4QDGA 3KR3H 1BZOA 1QFUH 2A9CA 1CE6A 3F8UB 2VJ8A 3LPPA 5IVXF 3T0EA 5J11C 5HBBA 1KDJA 4ZG1A 4LPYA 1H5BB 4KK6D 1C5CH 3D5OF 4F80A 1HU8A 3QORC 4M5ZH 5C07A 2VLKB 2GVYA 2Z0UA 3EHBD 2IVFC 4N5EC 1SY6H 1XR8B 4UQEA 1EIBA 4P5KA 4NCC1 5I1HL 4G1EB 4FQCL 2V2XB 2ZG3A 1FAKT 4FLOA 3RU8L 1G4RA 3PAUA 1IIIA 3AXIA 1HI6A 1ZWIB 4LP8A 5KSVB 1KTJA 1G0XA 1T89A 3WNIA 3QB7C 3FUFA 3S3JA 5KW9L 3CQQA 4N1CA 4L37A 5I1AB 4R26L 5J7CC 1QSED 1WHPA 3BGFB 4X80L 3QNXB 3RBGA 2VKWA 2RR3A 4KRPC 3WKMH 5HD8C 4IU2B 4NS0A 5CCJA 1I3UA 2UUDK 2VLJD 3F3HA 4ZPVA 4YEEA 2ZKXA 2MHAA 4NB7A 1D5RA 4I0CC 4N8VG 1AVAA 4DP1X 4FULA 5T33L 3AS3A 4APXA 2EZ0C 2GJ6B 3IXTB 3MV8E 5HXMA 1MXGA 5EBGA 1DBMH 3KLDA 4QO1A 1YEFH 4NFCA 1EXUA 4Y9EA 4IIZA 2K6WA 1JNNH 2PLTA 5DRZB 1H5BA 1RURH 2DOCA 3BN9D 3T0EB 1NGPH 1I1YA 1KXQA 2GTQA 5A40E 1I8KB 3ATDA 5J6SA 5PCYA 4TTDD 3WEOA 5JOFB 4OZ4A 3E8UH 1ZDSA 4QRRA 1IM9B 3RWEB 3MCG1 5JUEH 1R0AL 4GT0A 5AL8A 1VPOL 5DJ2B 5I18L 1GYWA 5AVXB 1WZKA 2CRIA 4JGUA 3QFJB 5ID0A 4OZIF 2DBLL 4I89A 3LEYH 4RZCA 1LEGB 2IWFA 3ZE1B 2WOYA 3PPEA 4KI5F 4ZXBB 3KMDA 1FIEA 3X13A 1JVOA 1PZBA 1NAMB 3MCLH 1IGYB 4DJMA 1A6WL 2XFGB 2DL2A 5SV4A 1J8RA 1BAFL 2WLKA 3BVVA 1E67A 3RTQB 3SY0B 5F3BB 1Y7VA 3ARUA 3APCA 3WN6A 1OSZA 3K6NA 2XQ0A 3BQVA 5C07D 2I27N 3QZPA 4KOBA 1EHLH 1PY0A 4JFDD 5SWQB 1U8JA 4L4VA 5FO2A 3PJLA 4AVKA 3KGUA 4DO4A 1WFTA 4ODUB 5IZ7A 1IAOA 2UWEA 2WXOA 4MDRA 4PW9A 5J56B 5KVGH 5C3TA 3QRFM 3LD8B 4AL8L 3ZDZF 1DE4B 5DHYB 3T04D 4HEME 1DBBH 4JR9H 1A6VL 4M6NH 1SDYA 2HG5B 9PCYA 4MYPA 1PKOA 4MMZB 1DVXA 2G3XA 4K15A 4KUZH 2CKBB 5E8PA 2PR9A 5BOPA 4J2XA 4B53A 2W9DL 5IESH 2YKLH 4BH8A 1IC7H 4U3XA 3IGLA 2IADA 4X4XA 1E9PA 1PW3A 2VZUA 4I8DA 1JPSL 2R27A 3SCMD 2WXQA 5ITBH 4G7VL 1U8HA 1KNOB 3VD5A 2C4FT 4K3EL 3CDZB 4K3DL 4YHMH 4MDIA 4IDJH 1ACCA 4YBLC 4XPHH 3MCLL 4WDIA 5EUKA 4K8RD 3ULUL 3S6CA 2IEPA 1HIML 1ONQA 3IGAA 2K6ZA 3MRDB 4FNLL 5IW6B 4ODXB 1R4XA 2FLMA 4Y5VC 1DCLA 3Q3GB 2LAAA 1AP2A 4LLQB 4AV4A 1M9SA 2G2RB 3T1FA 3AGVA 1H0DA 3PXJA 4H2AA 4AL8C 3WO4C 3F7LA 3DHPA 2QVIA 4J7RA 1SXZA 2Z93A 4RGMC 3QPXL 1S9XB 4B0MM 1VKXA 1J5IA 4DGVL 1JZJA 4YLBA 2X5PA 1AI1H 3TJEL 4FMKA 1M7XA 3LV3B 3U82B 3ZTDC 5LJYH 3ECWA 4H1LH 5I6LA 4YHKL 2NMSA 1T0MB 4OIBA 1CU4H 4B5EA 4KHXH 4JFED 5CD5C 3C08H 4FXGA 4FA7B 3VGFA 4QWWD 1IMHC 1BQHG 3GYRA 1IAKB 4IRJA 4QRFA 1RZQA 4AM0B 4EN3C 4QGTA 5IMKA 2UXFA 3V6OE 4HCRL 3I75B 5EF2A 1C16B 1SJHA 1TETH 4JG9A 1VACB 3LNDA 2VL5A 5GGVL 4ES9A 4QJ4B 2WBJB 1FGVH 2LFGA 1HL8A 4J3VA 5BV7C 4PQXA 4PJGA 4TPRL 1F6LL 5AAMC 2XV2A 1AIZA 1QA9B 2FWSA 4ZX3A 1EFXA 2BM3A 4WW2A 3MLWH 4DPCX 4G9FA 3HCVA 4ETQB 3Q48A 5KJ7E 2AI0H 2HJFB 3VFVA 4QRUA 1YMMA 3RVUC 3F83A 4RNRA 4Y1AB 3MV7D 3V4VL 1ZVHA 1IJNA 3B2MA 1P0SE 2EP6A 5I1GL 4AQEA 2VSDA 1B6UA 2SEBB 2HVJB 4UNIA 1WWWX 1Q90A 1CBJA 1F58H 3GMQB 3U2SA 1P2CB 3VI3A 1VCBC 5HDBB 2P44B 5HDBF 1YEGL 4BGLA 2UY6A 3GDBA 3LS5L 3S35L 1JZDC 4TQEH 3RJQB 3BI9X 3PG2A 1XXDC 3NP3A 3A5VA 1MFEL 4HHWA 4YHNB 2GHWB 4YWGH 2E9GA 3ARSA 2FWLB 3QS3A 2IH3A 4YXHH 4XBEL 5ABAA 3V8OA 3WLBA 2E5EA 5SX4H 3EFOA 1QASA 5L2JB 4ABVA 2NRDA 2QELA 2MPAL 3MRLA 4ZTOL 1TETL 1V3KA 3G08B 1IFHL 2BIHA 1HXYB 3IDNA 3L2MA 5HGBB 5I8KL 4TNGA 3U7WH 5BOJA 1CGWA 4PJAB 1EZVX 4MMXB 3KEDA 5DFWH 4DN4H 5D93B 4ZMAT 2H6OA 4M3KB 5CJXA 4CU6A 3W57A 1FG2B 1S9WB 4KROD 4Z7WA 1MW2A 3B1TA 2PO6B 5FFOA 2XN0A 5E08H 5J1AB 1X9QA 3P77B 4TVSa 3T65A 2W88A 4J3XA 5A2JH 2BNUA 4KFZC 1K3IA 2FYYB 4F24A 3QQXA 4WUUB 2Y7QB 3ISRA 4YBQC 1RJYB 5B7EA 4FE9A 2ZYRA 1FCGA 2WVVA 3AXLB 4MB5A 4HK3N 2YAHA 3GXDA 3RA7H 1AS6A 3MRJA 2JVUA 2O1AA 1JMXA 2C3WA 1T0NB 3IPFA 5E2WL 3T0ED 4HJIA 1MVYA 5CEYB 3ZKNC 1SEBA 4W9JC 5I17A 1OZUA 3CDGA 3KAAA 4APQA 2Y5TB 4W9GC 5E94B 3QG7H 35C8L 3N85L 4LFHD 4I85A 1BM7A 4EZMA 5HJ3A 3E1F1 2BNRE 4HPOH 1QSFB 3F7YB 2WUBL 3QPKA 3GMMA 3BDBA 5E00B 4GKNB 3VRIA 3H7BB 1EX0A 5I24A 1ZRUA 2VLRE 5AYUH 5IG7B 3SQBB 4APQB 4EIZC 4L1LA 2BC4B 3KLKA 1WIOA 3BESR 4NZUL 3PJSB 2ENJA 3TBTA 2IBZX 2BY2A 3KPRA 3O41A 1WFOA 4OCMC 2ZWKA 2IC2A 3FQXB 3P69A 1X9UA 1LQSR 1ID5I 1FFRA 1HQ4A 3I02B 1L5GA 3HPLB 2K0RA 3KEHA 3V5KA 1R3LA 4PJFE 7PAZA 3NPSB 3SPJA 1J9SA 3F00A 3UGUA 2VLKD 5JLZA 3AJ7A 4I4WA 4JFEE 5TD4A 3TYGL 2GTWA 3OZKA 4XH2B 3BE1H 4DEPB 3MUGA 1ITCA 2XZCH 2DPKA 1E9OB 1NBVH 4CSZA 2QKIC 3P2TA 5EN2B 3RAJH 1I9EA 3TEYA 1A7NH 1OCWH 3B2PA 1EVUA 4P5MB 4ZAKB 4M5YL 1MXDA 1KTDA 5GS1B 3D2UD 1PEWA 3G08A 5AZ2H 3H42H 3K1KC 3LKPB 5LHDA 1NGQH 4XXWA 4RH4A 1I7ZB 3WLBB 2WK2A 4JE4B 4IHOB 4N8VB 2VQ1B 3KYOB 4XX1E 5D7JA 4N2OA 4OY9A 4A2EA 3CPUA 4JPWH 3QZWA 4ANKA 3ZYZA 3LEYL 3TPKA 5F9AC 4KX8A 1JV2A 3CFBB 2YOCA 3W2DL 1JNHA 1QD0A 4WHDA 2LGNA 4LRNH 3C5JA 5A7EA 5E2VH 1XSJA 3PHQB 3OAYK 1ZT4B 2M83A 1JL8A 5DC2A 4HUNB 4N5UA 5KTEL 4CSTA 4HXAL 4F8OA 1A6TA 2PPEA 4RNRB 2CA3A 1YMMB 3K72A 2B16A 3JVFC 4PEEA 4ZS7H 3IAGC 4R5TA 3HCVB 3HC3H 3QI9D 1Y1DA 3ABKB 4DO5A 8FABB 1UJ3B 5FEBA 2BZ7A 2D8KA 3DGCR 1CD9B 5T3ZH 5HHME 5KS9F 1MJUL 4FQ1L 2ADGA 4HX1B 4M43H 2A3TA 2XZCL 1FFOB 3O2DL 3PWPE 4CSPA 2BCMA 3T2OA 1WZLA 1G87A 1WC7B 1CYWA 4G8FB 4S2SB 3W0WE 4DVBA 3QCUL 1E7VA 5IW1B 3CLWA 1KB3A 1AGFA 4IKNA 1J11A 4YN3A 5SWZE 1FC2D 1TU2A 1A3LH 3V6OC 2OMYB 3FNKA 5A2KH 2DYPA 1EDYA 2EEAA 2XXCB 2X4TB 2P5EE 3ZHLA 4JRXB 4EDXB 3WTVA 1FL5B 1JWUB 3FFOA 3IU3A 1FVEA 2Q76A 1R3HB 5IHWA 2GIXA 2VDNB 3TO2A 5C0BA 1I82A 3OKKB 32C2B 1A3RL 4PRHB 2BJMH 2ENYA 4HA1A 2MWCA 4LPTA 4ZSOA 4PV8B 2H1PL 4M6AA 3Q9PA 4M5ZL 5EBLA 5B7FA 4JPIB 1FO0L 4PLJD 2ZXGA 4OGYH 1VKXB 3ILDA 4K3JH 1ETB1 1QTYT 3LRHA 1G7MA 3MJ8A 4QRPD 4UILL 1U3HA 4XRCB 3OB0K 1RJCA 4JO4H 1KN4L 4GO9A 5GHWL 3V0WL 4M93B 3GRGA 2VMFA 3AY4A 3W0WA 5CLZA 4PJBF 4QT5A 3V6OA 4HG4J 3RJDA 2ZCKH 1AP2B 1MY7A 1LMKA 4X80H 4W9LC 3K8KA 5F70A 4R4ND 3ROLA 1R3IH 2WWKO 1OARL 5HI4C 4AKPA 2OL3H 3SE8L 5IB1B 5L4FA 5GGRY 1TVHB 5FK9B 3FTSA 4JDVB 1NEUA 4JFOA 4CDGC 3MBWB 2IH9A 3R8BB 4NQXA 1QBML 3TGXA 5CZRA 4MD5A 4WV1B 4WHYG 2FJGB 2DKSA 3S34L 4UBDC 1IARB 4YDKL 1OM3L 3REWB 4LBEA 5JYMA 1EHNA 2NY6D 2VLLA 2AJSL 3AG3B 4IHBA 3CFUA 4X4ME 1RI8A 3OXSB 5A2CA 4WGWB 3RTQD 4XNZC 2HG5A 3OHXB 3ZYOA 3MBEA 4DN4L 2VE6A 1DE4A 3KCPB 3NDZE 3PABA 3CSFA 4NN7B 1OCWL 5E6RB 5AW8B 3V4PH 5L4JA 3IDXH 3TFKD 2WSKA 1UT1A 1YUKB 1YY9D 3FMGL 4Y9FA 3RGVB 3GLEA 4XCNA 1WISA 2NQCA 2DB8A 3NEOA 4X9GA 5D1XC 2EO1A 2YAOA 2ZUQB 1GAFH 1OM9A 2DQEL 3ARBB 1NCNA 5T1LD 4ZOAA 4MAUH 1Y6NR 5H37G 2QQKL 1DQLH 1CL7H 4UDUB 1H9DA 3DTDA 4R0LB 5E5LA 2A1WH 3BPLC 1HX0A 3W9DA 2UXVA 4BZ1L 2VB5A 3I74A 1A6ZA 4NUQA 3TT1L 5C6TL 1TCRB 5I9QC 3NESA 1J8SA 1LEKA 4PJ5A 2F53E 4J3UA 2QPUA 1IGYA 4MCZB 3SBRA 4Q4EA 1T21A 3U6XS 3MBEC 4BCYA 1UZ8A 4AMKL 1EZUA 1YEDB 1WLHA 3GNML 4Y4KA 2H3NB 1HSAB 3V4PB 5ID0B 3JXAA 3WN5A 3GZPA 1GTNA 3DBXA 2AQ1A 3B2DC 32C2A 2CO3A 2WN3A 4HEPA 4HHGA 4Z0BH 4ONFL 3KNBB 1ZHKB 1TVDA 3HVDA 2O61B 5DEGB 2Q1EA 3MRPA 3OWEA 4ZMOA 1KC5L 2E8ZA 2R2CA 3KLSA 1I1YB 2EICA 1A2YB 4OD3L 4PTTA 2C1OA 2XV3A 3MJ9L 4YGAB 3BAIA 1JPEA 1NIAA 1SYSB 3D2UA 4RGNB 1BFTA 4V1DB 4Y1TA 1N7MH 4YUEL 1CFVH 3MRRA 1EAOA 4K3JL 3EGSB 3OLGA 4I9XA 5E6ID 1EEYA 4YHZL 2F7RA 2FO1A 1RUAH 5KVDL 4OB5L 3FL7A 3C8KA 2AXGA 4HIXL 4MJHA 3VQLA 2CK0L 4J39A 2R15A 2XWCA 4IEFB 2L0DA 1YEWA 1UJ3A 4ZPVB 3D69B 3T0BA 2NXYD 4P57B 4FRWA 4JRYA 5IQ9A 2CH8A 1BYOA 5FYKH 4IU2A 4N2HA 3SQRA 1S7QA 3LIZH 3WFEH 4Y9BA 3OGOE 4L4TE 4N2DA 1TOXA 4NHUB 1KLGA 2KYIA 4CSSA 2RMNA 4ES8A 3P0VH 5FYKE 3B3IA 1NQBA 3AS2A 4HK0B 2ZX6A 2R4SL 3DMMB 3DIFA 5AOMA 2D4DA 4NSKB 3FQ2A 4W70A 4WWNA 1E8ZA 2V2XA 3DSFH 4JKLA 2WN2A 3FB6A 4Y9CA 3QJSB 5LGYA 3DI2B 4V2CB 1LILA 1SLXA 5B38G 4OZHE 4KK8C 4O5LH 5F0MB 2ICWB 3CZSA 5FLVA 5DSCA 4ZXBD 3WNJA 1ZE3C 2X70B 3KYKH 4RRPG 2G9HA 5IK3A 2R29L 5DCCA 2OCJA 5F7HA 2X12A 4UTBL 2YQ3A 2VMEA 2WCGA 4N3UA 2ARJB 4KZDL 3NN8A 3QR1A 4AGOA 1QSVA 3H0TB 3FCUB 3P0YH 3BUBA 1DZBA 3D3VD 3VYOA 2WUCH 4RWYH 1SN5A 1EA9C 5BRQA 4E9RA 2NYKA 3GXFA 3H53A 4AV5A 1DP0A 1TVBB 3O11A 5AW9B 1IC7L 2FRGP 3FTUA 3F62A 1TJHH 4R97C 3VCLA 3G9VA 5FGBA 3PRZA 1I8MB 2JJTC 1NFAA 3IJ9A 2OSWA 1CYXA 4JN2B 1MFNA 2VM3A 2G5BA 4XNYL 2EDYA 3EBGA 5JO5B 4AC2A 1FH5L 2ZOKA 1FG9C 1LL1A 3Q43A 4A7GA 1G6VK 5GISH 5CR1A 2KPNA 4F7KA 3GMRA 4RLDA 1MI5E 4LARH 4P3DA 4HKBB 2NY2D 2HKFL 1GVIA 5HI3C 3G3LA 4E41D 4AYGA 4NHCH 2VUOA 2OMVA 2ZYIA 3DV4A 3LKQA 1KB9K 5ANMB 1BVKA 4IRSD 1T5KA 5ECGA 1OGAE 2CJUH 5ACZB 2X9ZA 3P2BA 4U1NA 4OLUH 4KTGA 2BXYA 4L8DA 4Q8BA 5EBWA 4MS8C 1A7OL 2X6CA 3QHTC 5I1CH 3S3PA 2Z8WC 2Y24A 1JZ2A 3W38A 3WXVH 3VFUB 2VH5H 3ALXA 4QXVA 1S7SB 1YAZA 5AW3B 1J1OL 4FQLH 4OZFG 4KPHH 3CDGB 3L4ZA 4GI8A 3ZDZB 3SPVB 1SFDA 1JRHH 1TQBB 2AJUH 3Q01A 2WCPA 2FNBA 2BSTA 4HWUA 3MGTB 4NQED 1X3DA 2R0WH 1Q0XH 3DXAE 4BWUA 1NFDF 5I76B 3ORJA 5TH2B 4D0CB 2C9UA 1J05B 1E27A 3LHPL 4WEEA 1SHXA 2CSPA 1BJ8A 1MHEA 5C0FA 3K3QA 1PG7L 2AABL 3OZ9L 4QXGH 3ZL4L 2FGWH 2QQLL 5DZOA 3TURA 2P8LB 3B5GA 3DPBB 1HHGA 1S7WB 5DO2C 1RK7A 3OR7B 1ZV2A 4N8UA 1YNTF 4KJYB 2DYPD 5I0WA 2CO1A 2J8HA 3QA3B 1WTLA 5LCVH 4O02A 1NMCB 3QHZH 4ZJ9A 4IBTA 5I71C 1TTRA 3CGTA 2EH7L 2CD0A 4YE0A 4PY8I 4C59B 4X5XB 3RA7L 1N64L 4G43B 2MCAA 3NN8B 3ZZQA 2BOCB 2WKGA 1AO7B 5CGTA 4H44C 5DR5L 4GQ9H 2HJKB 2YPVH 3LPFA 5D55A 4U3CA 4KRNA 1JTOA 3NA9H 2OS7A 2CUAA 4YSDA 4XMPH 2MNUA 2XWJA 2WXRA 4XPGL 2NY4C 4JR9L 2OCFD 4OLWL 1R5WB 3JWDL 2FATL 4XVJH 3TZVA 3VI3B 3WMPA 2YMXL 2YXVA 4PREB 4M00A 2HLFC 3QAQA 5IBUB 5KVEH 2VDOB 2R69H 4G80B 3ARYA 3X14A 2PCYA 3V5HA 5HSFA 2NUPB 4FNTA 1UFUA 4UV7L 2KMWA 2F0CA 4WV1C 5H35A 2R29H 4JCLA 1S7QB 3VFVB 4Q52A 1NDTA 3DARA 3UACA 2NOYA 4G9FB 1DQQB 4KY2A 3K6DA 1IBYA 1LE5B 2PYED 3BSHA 3KPQB 4TTDC 3BAYA 1MCLA 5IT2L 5I19L 1CDUA 2GYSA 3CQPA 5AKVA 3TO4B 1CZ8L 4FTVA 4GB9A 2JB6A 4L0ZA 2PWHA 3L3OC 3PHAA 1IC4H 3LQZA 4M8QB 5IVXE 4EOWH 1JGVH 1Z9PA 4QRPB 2X1OA 2HRPL 3GB7A 3IFLL 3MX0B 2B1AL 1OHZA 1TYRA 1AC6A 5DI8B 3LNIA 4EQ2A 1M1SA 1U3ZA 1NBYB 2YC1A 3UMNA 1T7YA 2VLJA 4PWJA 2QLVB 5AVTB 2VABB 4EI5A 2H3KA 2H3NA 2NXZB 2G75A 4F7CB 4KZDH 1SJEA 2YBRA 4FQXB 2KQMA 2E7LC 1JV5A 3KPNA 3MLZH 4FXKB 4DTGL 3GSOB 1MPAH 1S9XA 4KXCA 5KWYC 2PP8A 3APNA 5DJ0A 2GI7A 2HFEA 5HHPA 4EXKA 5JHBA 4Y16C 2X4RB 4E5XB 2D3LA 4HC1A 1WITA 2NZ9D 3TM6A 1FVCA 5KVGE 4TSBH 2XBDA 2X3BA 5KVMC 4Q9QL 3P0VL 1Z5YD 1RPUA 4JJ5A 5D1ZC 4AMKH 3B5TA 1G9MH 4AGNA 4WI8A 3WENA 4BRJA 4FEMA 1A7QH 1XCXA 1CDIA 5KBKA 3VFPA 5I6OA 5IHBA 4NFDA 4LK4A 3U48A 5DUML 8CGTA 4I5BB 5E4EB 1MOEA 3DX6B 1S4IA 1YEHL 2H0EA 4ZD3L 2AERT 3OMNB 3ULUC 3U36B 3ZKND 1BPLB 2AEWA 4XOBA 1GJIA 3VU1A 3BEWB 4HALA 2J5LC 3DX6A 2VLME 2XXFA 1JPFA 3TESA 3VXRA 4LVNB 4FZEH 3EYSH 1FUNA 5DVNA 5C0ND 3Q5OA 5CJQH 5BS0E 2YHGA 3HE6B 1JF5A 3CVHH 3G5WA 5HJGA 2P5WA 4ZTOH 1CE1L 1OT4A 5A2IH 4MQXD 5CLWA 1WBZA 2VDMB 1E6OH 1N0LA 3KPPB 2XN9A 1FZKB 2DIBA 1MLCB 1NDGB 3IVKB 3QUKB 1W8EA 2QMKA 3HB3D 4BXSV 3V6FA 1GYUA 3RNKB 1JOIA 4L3CA 3IJHB 1BP3B 5JIPA 1BVZA 1OIOA 2IOIA 1UC6A 3IGUA 2EILB 4ALAL 4DGIL 1HHHA 4TULH 1SF3A 3S3DB 3CC1A 4MNQB 4OM0H 1NAMA 4AV0A 1XGZA 5EU6B 4AYID 2VO8A 2MSPA 3CG8A 4ZXBA 3QIWA 2WNGA 2FX9H 1KDIA 2YBRB 5TE6H 1P84J 3BIKA 4ZSOB 4WHTB 1SDDB 2A7BA 1KULA 1Q72H 2VABA 1HZLA 2OMZA 1F4XL 2YD5A 2LHAA 3QJHA 1CGXA 1UEYA 1RPQA 3HHMA 4NRZB 3V9FA 5M7QA 3IBOA 5EO9B 3KXFA 3SCMB 3OPZL 2B0SL 4FLHA 2WSPA 4WWPA 5T3XD 3BEVA 2ZUTA 4CADB 1FZOA 3FOLA 3VMPA 4D8OA 4OJYA 4LIQH 1AGFB 1RZJC 1PPIA 1DN0B 3IJSB 2VDNL 2N1KA 3O8XB 2ICES 4KV5E 5D7HA 1HT6A 2PW1B 2J1WA 4M29A 1PG7W 4BFKA 1E30A 3KPQA 3QUZD 4XCFH 2WIMA 1F3JB 1DQQA 3E6HB 2W9LA 3CVCA 3MNZA 2B15A 4L8BA 4M6NL 4MD4A 3FK3A 4PJ9D 1MG2C 1AZRA 2PWGA 3LKOB 3L1OH 4FKHA 3VD7A 4WJKB 1F1DA 2PABA 1IBZA 2JLLA 2MCPH 2WO2B 1MRDL 1U4EA 5SX5K 1MWOA 2R1YB 4YJZL 3A4AA 3VXQB 2JIXA 4JZJA 4LCCA 4A7VA 2BMKA 4WUUD 3X14B 1TYEB 4YSCA 3FN0L 5E1GA 5F88A 4F7MA 1R47A 1TTCA 3MZGB 1QPXA 3CPLA 1KENH 3IU4L 1HZHH 4YE4L 5E95B 1JZ3A 1YN6B 2OYMA 4KK5C 3T6ZA 1YDPA 1ZT1B 1IGFL 5JOPD 2PKDA 5DFTA 3VGGA 4ZFQA 4GFTB 1FO0B 4JO8A 2AKRA 5LWYL 1TSRA 4F58L 2XG4A 5I1DB 4FJZA 1WDAA 4OGYL 5AAMA 3SDYH 4L4VE 5E1IA 4FQJH 1J0KA 3D85B 1NMAL 1KYOK 3KJ6L 4NBZB 2F1AA 5DEZA 1Z66A 1ZD6A 1MW1A 4G43A 2Y7OA 1FI8C 3U0TA 2BIMA 5ID1A 4J3TA 5DRXB