5KJ7A

Structure of the ca2+-bound synaptotagmin-1 snare complex (long unit cell form) - from xfel diffraction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 3
publication title Advances in X-ray free electron laser (XFEL) diffraction data processing applied to the crystal structure of the synaptotagmin-1 / SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis,exocytosis
total genus 28
structure length 63
sequence length 63
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5kj7A00
1URQD 1N7SA 2WZ7A 3RL0B 2N1TA 1GL2B 1N7SB 1L4AA 2YMYA 3RL0D 4W80A 1URQB 2N1TB 1GL2D 3RL0C 4WY4A 1N7SD 1GL2C 2NPSA 1N7SC 3PP5A 2M8RA 1KILC 2N1TD 1SFCA 4WY4B 3HD7A 1URQC 2N1TC 5KJ7A 2HG5D 1T3JA 2NPSB 1HVVA 1SFCB 4WY4D 4WY4C 2NPSD 1XTGB 2NPSC 1SFCD 1L4AB 1SFCC 5KJ7D 5KJ7C 3KYQA 4W7YA 3B5NA 3TSIA 1L4AD 4JF7A 3RK3B 1L4AC 4W7ZA 5CCHA 3M0DC 3HD7B 3B5NB 2HFED 2PP6A 3RK3D 1GL2A 3VOPA 3RK3C 3HTKB 2XDJA 5CCGA 3HD7D 1KILA 3B5ND 4OH8B 3RK2B 4N78E 3HD7C 3B5NC 1URQA 1NHLA 2KOGA 4LGDE 1JTHA 5CCHD 1KILB 3RK2D 5CCHC 2H8PD 3RK2C 5CCGD 1JTHB 3P8CE 1KILD 5CCGC
chains in the Genus database with same CATH superfamily
3L71D 1KFNA 3CWBE 2QJKB 2QRXA 1FOSE 4R4LA 1MUUA 3U1CA 3L74D 1DD4A 1K05A 3B4SA 1FE6A 3LIDA 4W80A 1M1JB 5AVXB 3KZIH 4H44C 1EZVI 3LW5J 1LTBC 1QLED 4JPZB 5CJ0A 2JKVA 1SQXG 1BDCA 1FJKA 3QWOC 2GUVA 1IFDA 4EYYQ 1GK4A 4WVZA 1SQVG 1OVVA 3AE9C 1BE3G 1VQ5P 1YBKA 2C9NY 2NPSC 1SFCD 1N86A 3SFEC 3HE4A 5KAIH 1AVOA 1P84H 3C9IA 5KLVE 4U3FE 1Y47A 3MIWA 3A0HH 3MZWB 1J2JB 1M7LA 4O9BA 3TDKA 2HFED 1S5LE 1FDMA 2XDJA 5CCGA 3L70G 2Y0CA 3PH0A 1CW5A 2HPCB 1URQA 3A7OA 1PV3A 2ZT9D 1L0LK 3A0BH 3GF7A 3I55P 2FYUG 1KILB 1N2DC 2NZ2A 1SQXD 1JY2O 1SQVD 3N4XA 3NXSA 5KLIB 1HTLC 3CMAP 1BE3D 3BCCE 1LTJB 1IC2A 1YYCA 2P7JA 2LXBA 1M1JA 2FBWC 3CX5I 1QX8A 1OWAA 1N73B 1YJ9P 2E5TA 1HH0A 5GTHH 1SLQA 4RESB 3KHUA 2QJYC 1M56D 3NTNA 1RF1B 1X0TA 2P67A 1Q86Q 1T2KD 3L70D 1JOCA 3H1HJ 2CPBA 4EOTA 1HBWA 1SFCB 4PD4E 2FYUD 1R8EA 2A45G 1QEXA 1RHZB 3H1LG 4DOJA 2VRSA 3S4RA 1NTME 1QVGO 3P32A 1LT9B 1IFIA 2A45H 3M0DC 1OX3A 1G2CB 2HPCA 1OFCX 1IFJA 3BATA 3RK3C 3AEGC 2ZT9B 1KN7A 1JEKA 1KILA 3B5ND 3JC22 2WTYA 1SQPE 5APSA 5AW7B 1LTJA 4ASWA 1JCCA 2IBZG 1FBMA 2YO2A 1N73A 3GMAA 2WZ7A 3N7NA 3AEAC 3WUUA 3H1IE 1OVUA 3H1LD 3L75J 3RGUA 1L0NG 5KLVJ 3CPWO 2V7QJ 4I1LA 1MFTA 2WITA 3TF5A 5APXA 2QE7H 2HYNA 1SFCA 1JY2N 2Q6QA 1YTZI 2IZ0A 1AQTA 2JJLA 2OYOA 1PL5A 4H0LD 4PD4I 4WBAA 2KS1A 4UB6E 2WVRA 3SSUA 3L73E 1LT9A 1ZV8A 1G2CA 2RN0A 1L4AC 3VMAA 1SQXK 1FDOA 3B5NB 3L71E 1L0ND 1FZBA 1SQVK 1D7MA 1BCCG 2GA1A 1FZAA 5AVZB 1S4XA 2G8YA 2Z5HA 1IK7A 4D6TG 3HD7C 4N78D 3CXHH 2AEMA 4AQRD 1J1EB 3L4FA 2MJZA 3RK2C 3AEEC 2R3CA 2H88C 3CL3D 2XKMA 1S3JA 1X9VA 1QGKB 4U7JA 2OTLP 1K8AQ 1GW3A 2WSFJ 4B86A 4C7NB 1NTMJ 3D6ZA 2FYUK 3RL0C 3V4WA 1ZXGA 3M0AA 1GL2C 2DW3A 3CXHD 3VMYA 3KZIE 2W83C 1BCCD 1FZCB 1OIPA 3VN0A 2HG5D 1GU4A 3SWFA 4D6TD 4H0LB 3Q5RA 2D2CC 5APVA 2O01N 3H1KG 1SQPJ 4K3AA 2W6JH 1FZFA 2BCCG 1IFMA 3Q5SA 5B66H 5KJ7D 2LKMA 3SWKA 1NH4A 3KYQA 5TISE 5KAIE 3B5NA 1PGOA 1SQXE 2JEEA 1NTZG 1P84E 2YXQB 2E74D 3H1IJ 1SQVE 2YNYA 5AW1B 2ITAA 3A0HE 2FFDC 2C0XA 2B9BA 1LTSC 4N6JA 2JO1A 1L0LG 4OWFA 1EDJA 2IYOA 3VMZA 3BVHA 2OYIC 4L75A 2B87B 1YQ4C 2ZFCA 1LJ2A 3GG2A 3H1KD 2E76C 1VQKP 3L70E 4C7NA 3TNUB 3I56P 2H7HA 5H2FH 4BWNA 2BCCD 1RF0C 4EIJA 2R5BA 2I1JA 1JB0J 1W2EA 5AW5B 1NVOA 3CCUP 3H25A 1NTZD 2RMZA 2ZAEB 1FZCA 2FXOA 2QIWA 1PPJG 3L71J 5GTHE 1N7SC 1PGQA 5AW4B 2N1TC 3L74J 1VL2A 3PJSK 1KC8Q 4BXLA 2XV5A 2C0WA 1L0LD 1L0NK 1EXJA 4Z1MH 2E74B 2Z4EA 3KDPB 1MV8A 3WMM0 1DEBA 1PP9G 4LC1A 4K35A 4L76A 5B5EH 2E75C 2L5GB 3L37A 1DD3A 2YKPA 1P84I 3D6YA 3CCVP 1Q90D 2K9JB 2YKQA 1PPJD 2B87A 1BDDA 1BGYG 1KB9H 1VQ7P 1DH3A 3VYIA 4I7ZC 3TNUA 1LTGC 3PRJA 2PFXA 1FDIA 2RKLA 4KJMA 1FZEA 3S1KA 1BSHA 1KQSO 3JCUH 1H88A 1SQXJ 2YMYA 1USEA 1PP9D 1URQB 2XNDH 1SQVJ 4JYCA 1BE3J 2FXPA 1KB9D 2K1AA 3MUDC 1RE4A 3TK1A 2HODB 5KJ7A 1HGVA 2KSEA 1FJPA 1VF5C 3HTKA 2O1JA 3ITKA 1G1JA 1BGYD 4WY4C 2KYVA 5KAFH 1NO4A 5APQA 2FYNC 2Q7CA 4H13C 1LWUB 4A7PA 3L70J 4PV1D 5APWA 1NKNA 2K9JA 1MZ9A 1S9KD 1AQ5A 2FYUJ 3M9QA 2J59M 2PP6A 4IFDK 2ZYAA 1NKZB 1NU1G 1KV4A 3RBZA 2OGUA 3O6QB 2A45I 2UWJE 1WRGA 3L75E 1NHLA 3V2NA 1YHQP 2IDBA 2KSJA 2JR8A 1VQNP 2O1KA 5CCHC 3CXHE 1MFZA 2Q5UA 1NTZK 1LP1B 3L72G 1BCCE 1RE3C 3R4YA 2OTKE 3C1LA 4D6TE 3F5HA 4HB1A 2D2CD 3P8MC 2PRRA 1K04A 2P10A 1HF9A 2HODA 4KT0J 2FY8A 3G6EP 4NPDA 2NRGA 1NGMB 1NU1D 2POHA 3H1LJ 1JMMA 1NTKG 1KFMA 2KI7B 2AXCA 2W90A 3CMEP 1LWUA 1JY3O 3KQGA 3D70A 4PV1B 2QJPC 2WSSH 3L72D 5AVTB 1YTZT 4OGQC 4RO0A 3M9BA 4IL6H 2H89C 1VQPP 3CCMP 1YI2P 1EZVG 1RY3A 3H1KE 3O6QA 2E76D 3VOPA 2JWDA 2BCCE 2YKOA 3RL0g 3W68A 2IFMA 1IK9A 1OMIA 3E7KA 2Q9IA 3H1JG 2KS1B 2R32A 1BSNA 2KZJA 1EC5A 1LP1A 1L0NJ 3AE7C 1NTKD 1JTHB 3Q2YA 1G1IA 3CXHI 5CCGC 3TGUG 2R44A 4ZMDA 2D2CB 2BEZF 4AUWA 1NOHA 1LTAC 1L0LE 5H2FE 3WU2H 2WPSA 1L4AA 1VQLP 2QJKC 3V2PA 2K37A 1AVYA 1EZVD 1KQFB 1VQMP 2I8DA 5CMZA 2HLOA 3CCLP 1M1JC 3HD7A 2KXPB 1EXIA 1ZR4A 2ZVOB 2C9LY 2E75D 2Y0DA 4IL6X 4YTPC 3H1JD 2XZRA 1Q81Q 1JMBA 4GOEA 1KQGB 5KTBA 2ZJSE 2KK7A 1PPJE 2OYIB 3CWBG 3AEBC 2OYHB 1USDA 1BCCJ 1T6AA 3TGUD 3WUVA 2YMKA 2IZ1A 4LLHA 1GMJA 1E5WA 2E76B 4D6TJ 1IJDB 2R5DA 1YIJP 5KKZC 3II6A 3HRNA 5K5GB 2OQQA 3CX5H 3PTZA 1M90Q 5B5EE 1NWQA 3E1RA 5AW9B 4XE5B 1GL2A 3MHVA 2IBZD 4RJTA 1JY3N 1SQQG 2KOGA 3ZDMA 1JTHA 1PP9E 4EDFA 2Y9ZA 4EI2A 1KILE 1KB9E 4WWIA 2WSEH 1IFNA 1A02J 1JY2P 3L74E 3OAKA 1X22A 3CX5D 1SQBK 1NU1K 1ZOYC 4GDOA 3CWBD 1SVFA 4U3FG 2YIUB 5KLIC 4H44D 2W8ZA 1SP4A 4IFMA 4PJ0H 3H1KJ 5C39A 2Y0EA 1N73C 1NJIQ 3U1AA 2E75B 1H89A 3P8CD 2BCCJ 1GW4A 1OVRA 1S9KE 1RF1C 2OYIA 1SQQD 2FYZA 1NTZJ 2OYHA 2NPSD 3V6IA 4Y99B 2AXTH 3BCCG 3W67A 5KAFE 1LNQA 1SFCC 3GHGB 2IPPA 3UIAA 1R5SA 4RKUJ 1L0LJ 3OA7A 5BU5A 3IN6A 1YQ3C 1QVFO 4U3FD 1IO4A 3M91A 1RQVA 2WMMA 1NTKK 3EQ2A 3AECC 1PIXA 1LT9C 3HUSB 4LGDE 1VQ6P 2ZT9C 5AVWB 1VQ4P 3B71A 5AW3B 3IF4A 1KYOH 1EDLA 1BE3E 3Q1MA 2M5AB 1RQUA 5BVZA 3BCCD 1EDKA 4H44B 3IFMA 4PD4H 2IFNA 2JDIH 4QMAA 2FYNB 3A5TA 2P2UA 3SFDC 1J1DC 2QM7A 3A0BE 2XU6A 3AE5C 5EFWB 5AVQB 1EDIA 2QA4P 2M8RA 3H32A 1KYOD 2NPSB 4GKGA 1HVVA 1VPCA 2FYUE 1HUCA 5CJ4A 1PP9J 2Y9YA 3AE1C 4PD4D 3GHGA 1KTMA 5DJUB 1OZHA 5DJTB 1M8OB 4C46A 3BASA 5AVYB 1N8RQ 1CZQA 3FGAD 2WT7B 4WB4A 4JF7A 1H0TB 5E79H 1AA0A 1GTWA 1BGYJ 4YPCA 4IL6E 1U7MA 3RK3D 4UB8H 2P58A 3EFFK 2M0BA 3HUSA 3HTKB 5AVUB 4C7RA 3AE4C 1A02F 1NAFA 2WWWA 3B5NC 4ZNCA 3Q3DA 3L35A 2KLUA 4HKZH 1TU3F 3OJAB 3G71P 4YXDC 1EZVE 4ZKPA 2M5AA 3G4SP 3LIEA 3MP7B 4TT3H 2Q1KA 2WSCJ 1M1KQ 3L73G 1J1EC 1FS0E 3H1LE 1X8YA 1CI6B 1WMKA 2AEFA 2QJYB 3B8EB 5M1BA 1SQQK 4DCKA 2QSIA 2V4HA 2IX7C 3M06A 2PAJA 2NPSA 3TGUE 1FZGA 4DZOA 3CCRP 3EFGA 4OVNF 2SPZA 3HE5B 1GK6A 4HJGH 4MN4C 1GDTA 2JWAA 1FZCC 3V2QA 2IBZE 2KLVA 2WT7A 4H0LC 3T97B 5GTIH 1H0TA 3MD0A 2FXMA 2XNXA 1NU1J 2G3AA 3L73D 1AV1A 1L4AD 2A06G 3RK3B 5APYA 1JCDA 2O01H 2WSCH 1L0NE 4GT1A 3K5BA 1HWTC 4JYBA 4YXWH 5AW0B 3CX5E 2IYPA 1HGZA 3HD7D 3L72J 3V5BA 4N78E 4N3YB 1IFPA 3CC2P 1ZRTD 1OXZA 3RK2D 1OW8A 2J5UA 5AW6B 3P8CE 1CI6A 1MKMA 2K3RA 1SQBG 2BEQD 2QM8A 2N9YB 5AW8B 1FU1A 1Q82Q 1SQQE 2KIKA 3RL0D 3S9OA 1DIPA 2A06D 1NTKJ 1GL2D 1UIIA 4BRYB 1PFIA 1ZW0A 5KKZB 5TISH 3AEDC 2R3SA 4PJ0E 3HE5A 1H8AA 1E79H 2WPVB 1VQ9P 2I1KA 4L73A 3L36A 1NTMK 3GW6A 3GF3A 3T97A 1N7LA 1QL2A 3M0DA 1JNMA 2KZIA 1K9MQ 4GOFA 1L4AB 1Y9BA 1RE4C 2AXTE 2IBZI 2ZYGA 5KJ7C 3VP8A 4W7YA 1SQBD 1Q2NA 2WPQA 3H1JJ 2K9YA 2E74C 1P84D 1SQPK 3HD7B 2OTJP 3C8VA 3LW5H 3CD6P 1PGPA 1U57A 3RK2B 1T8ZA 3CCSP 3TGUJ 2CK3H 5B66E 3AE8C 1ZLLA 4JBZA 2ZXEB 1KYOE 3PHLA 3CC4P 2OARA 3RL0B 1S72P 1GL2B 4BRYA 1NTZE 3I5CA 1LT1A 4IOIH 1N7SD 2GUSA 5AVSB 4NPEA 3TYYA 2N1TD 1UIXA 3CWBJ 1URQC 3FXDA 3M9HA 1KZUB 3VMXA 3RK3E 2KUBA 1NAYA 2YXRB 2O3JA 3FX0A 2B88A 3MGNA 1GU5A 1JUNA 3IAOA 3H1HG 1M57D 4CPGA 1T3UA 1ZN5A 2FFDB 2WSEJ 3P7KA 1SQQJ 4W7ZA 1LWUC 1R5LA 5E79E 2P1JA 2Q3EA 4UB8E 1J1DB 1NYHA 2KP8A 2QVAA 3IR9A 2HR3A 1PGJA 4XA4A 2Q3IA 1RF1A 4U3FJ 1ZMEC 2H8PD 3BRTB 1RH5B 3R2PA 2QEXP 2L91A 1KYOI 2LXCB 1FAVA 2W6AA 3H1HD 1N7SB 3G3ZA 3A2AA 3NMDA 2RH0A 1LTTC 3MTUE 2N1TB 5APTA 3KXDA 3Q5PA 1HJ0A 3PP5A 1KILC 1SS1A 3BCCJ 1S2EA 3L75G 1VQ8P 2JP3A 1T3JA 1VF5D 5KLVG 3F89A 1BGYE 1YJNP 2AEJA 1DEEG 4WY4D 1LTJC 2E5YA 3JCUE 1OW6A 2M3BA 4I2LC 2FFDA 4H13D 3AE6C 1ZRTE 1JY3P 1U7JA 5GTIE 3A3YB 3AEFC 1GD2E 1OW7A 4GODA 2V7QH 3G9RA 4NPFX 3FWLA 2PGDA 4PV1C 2K88A 3H32B 1S5LH 1DX7A 3GLMA 1EQ7A 1S1CX 3BRVB 5CHXA 2W27A 4HYTB 2W6BA 1VQOP 4OH8B 4I7ZB 3D71A 1RF0A 1IZNB 1W2BO 5CCHD 2A06E 3L75D 3O8ZA 5KLVD 3VP9A 1ZR2A 4TLFA 4KHXA 2CPSA 4I6MC 1N7SA 2BASA 1JO5A 1FOSF 2B89A 2N1TA 1ZP0C 1JM0A 1VDFA 4ZKUA 1FC2C 4JQ0D 2KNCB 1VF5B 1SQBE 1NU1E 1KB9I 4DT0A 4WY4B 3ABVC 1NTMG 3KPEA 2N9BA 1YITP 4H13B 2J58A 1S5LX 3CCJP 2YO3A 3L72E 2WSFH 4OGQD 3PLNA 3U59A 4L74A 3CCQP 1T2KC 4M3LA 1SQPG 2OYHC 5AVVB 5TJHA 3V2RA 1PZQA 1KORA 3E1IA 5L8RJ 3L73J 2LR2A 2E42A 3H1IG 2H43A 4AYCA 1NTKE 1NTMD 1LGHB 1KMIZ 1Q7YQ 2WPRA 3FXEA 5CCGD 1AFOA 1AJYA 2WQYC 4IFFA 1URQD 1WT6A 3H6PA 3MUDA 3OW2O 3NFQA 2KNCA 5BU8B 3EWKA 1GZLA 1SQPD 3JSVC 4WY4A 2QG4A 1YJWP 1L2PA 2YIUC 2FKWB 2O01J 1X79B 1Y8AA 3SWYA 4DJGA 4GIFA 3WUTA 3H1JE 2QJPB 2KB7P 3H1ID 1XTCC 4XFJA 3L71G 3WU2E 1XTGB 1Z56A 3FWNA 4OGQB 4UB6H 1W5CE 3AE2C 3RBXA 4HH2A 1CSBA 3L74G 2M3EA 4Y99C 3TSIA 3USSA 3CC7P 4ASVA 3HE4B 1LTIC 1HJBA 3CCEP 5KLVK 5CCHA 3VTPC 3CI9A 3GHGC 5AVRB 1KQLA 4R4MA 5APUA 3QH9A 5CBOA 1RE3A 2ZYDA 3CLQA 1KD1Q 2ZXXA 4Y28J 3H1HE 1SQBJ 2ZVNB 1QL1A 2MKVA 5CBNA 3AE3C 2GM4A 2E43A 2Z5IA 3V4QA 1K73Q 3HUSC 1KILD 5AW2B
chains in the Genus database with same CATH topology
1KFNA 2OARA 2WSEH 1IFNA 4C7NA 1A02J 1JY2P 3OAKA 3TNUB 2H7HA 1FOSE 1MUUA 1NU1K 1SQBK 3RL0B 1RF0C 4EIJA 3U1CA 2R5BA 2I1JA 1SVFA 1GL2B 3LIDA 1W2EA 3I5CA 5AW5B 4W80A 1M1JB 5AVXB 1SP4A 4IFMA 1FZCA 1N7SD 2GUSA 5AVSB 1N73C 1N7SC 3TYYA 3U1AA 1H89A 2N1TD 3P8CD 5AW4B 1LTBC 1GW4A 1URQC 2N1TC 5CJ0A 3M9HA 1S9KE 1FJKA 2XV5A 2C0WA 2GUVA 1IFDA 1KZUB 3VMXA 1RF1C 1GK4A 2OYIA 2FYZA 2OYHA 2NPSD 1L0NK 4Y99B 2C9NY 2NPSC 1SFCD 1N86A 3MGNA 1SFCC 3HE4A 1GU5A 1JUNA 2Z4EA 3GHGB 3KDPB 1MV8A 1T3UA 1ZN5A 2IPPA 3C9IA 3WMM0 2FFDB 3UIAA 1DEBA 4LC1A 3P7KA 3MIWA 3OA7A 5BU5A 1IO4A 4W7ZA 2L5GB 3L37A 1J2JB 3M91A 1LWUC 1M7LA 1NTKK 2YKPA 3EQ2A 4O9BA 2HFED 2P1JA 1FDMA 2XDJA 5CCGA 1J1DB 1LT9C 1CW5A 2YKQA 2KP8A 2HPCB 1URQA 3A7OA 3HUSB 3IR9A 4LGDE 1L0LK 1KILB 4XA4A 1N2DC 2Q3IA 5AVWB 1RF1A 1DH3A 2H8PD 3BRTB 5AW3B 3VYIA 3TNUA 1JY2O 1LTGC 3N4XA 3NXSA 1FZEA 1HTLC 3R2PA 1LTJB 1IC2A 5BVZA 1YYCA 2P7JA 1M1JA 3IFMA 2IFNA 1FAVA 1OWAA 2W6AA 3A5TA 1N73B 1N7SB 2P2UA 1H88A 3G3ZA 3A2AA 2YMYA 1J1DC 3NMDA 2QM7A 1HH0A 1LTTC 1URQB 3MTUE 2N1TB 2XU6A 1SLQA 4RESB 5APTA 5AVQB 4JYCA 3NTNA 1RF1B 3PP5A 2M8RA 1KILC 2P67A 3H32A 1T2KD 1RE4A 3TK1A 2HODB 5KJ7A 1T3JA 1JOCA 1HGVA 2NPSB 1FJPA 4GKGA 2CPBA 3HTKA 1HVVA 4EOTA 1VPCA 1SFCB 1HBWA 4WY4D 2O1JA 1HUCA 1G1JA 1LTJC 5CJ4A 4WY4C 2KYVA 3GHGA 1NO4A 2M3BA 2A45G 4I2LC 2FFDA 5APQA 4C46A 2Q7CA 3BASA 4DOJA 1JY3P 2VRSA 1LWUB 5AVYB 1CZQA 3A3YB 1GD2E 2WT7B 4WB4A 4JF7A 5APWA 1NKNA 3P32A 1LT9B 1GTWA 1IFIA 1MZ9A 3H32B 1S9KD 1AQ5A 2A45H 3M0DC 1DX7A 1G2CB 3M9QA 2J59M 2PP6A 3RK3D 2HPCA 4IFDK 1EQ7A 1IFJA 3BATA 3BRVB 3HUSA 1NKZB 3RK3C 3HTKB 5CHXA 2W27A 5AVUB 4C7RA 1A02F 4HYTB 1KILA 2W6BA 3B5ND 4OH8B 2A45I 2WTYA 1NAFA 2WWWA 3B5NC 1WRGA 1NHLA 3V2NA 3L35A 1RF0A 2KSJA 5CCHD 5APSA 2O1KA 3OJAB 3O8ZA 5CCHC 5AW7B 1LTJA 3VP9A 1JCCA 1MFZA 2Q5UA 1NTZK 4ZKPA 1ZR2A 3LIEA 4KHXA 5AW2B 2CPSA 4I6MC 1FBMA 2YO2A 1RE3C 1N73A 1J1EC 1N7SA 2WZ7A 3N7NA 2BASA 1JO5A 1FOSF 1X8YA 1CI6B 2N1TA 3B8EB 3P8MC 1SQQK 1VDFA 4ZKUA 2IX7C 3M06A 4I1LA 2HODA 2WITA 5APXA 2PAJA 2NPSA 1FZGA 2HYNA 4DZOA 1SFCA 4WY4B 1JY2N 2POHA 1YTZI 3EFGA 3KPEA 1JMMA 2N9BA 3HE5B 1KFMA 1GK6A 2JJLA 1GDTA 2J58A 1FZCC 1LWUA 1JY3O 3V2QA 3KQGA 2KLVA 4WBAA 2WT7A 2YO3A 2WSFH 3MD0A 1LT9A 2FXMA 5AVTB 2XNXA 1ZV8A 1YTZT 3U59A 1G2CA 1T2KC 1L4AD 3M9BA 4M3LA 3RK3B 5APYA 1L4AC 1JCDA 2O01H 2WSCH 4GT1A 1SQXK 2OYHC 1RY3A 5AVVB 3V2RA 3B5NB 1FZBA 1HWTC 4JYBA 1SQVK 5AW0B 3VOPA 1FZAA 5AVZB 1HGZA 3E1IA 3HD7D 2YKOA 2Z5HA 3V5BA 4N78E 3HD7C 4N3YB 2IFMA 1IK9A 2Q9IA 2E42A 4N78D 2R32A 1OXZA 2H43A 4AYCA 4AQRD 3RK2D 1J1EB 3L4FA 1LGHB 2MJZA 3RK2C 5AW6B 2R3CA 2WPRA 1JTHB 5CCGD 3P8CE 3CL3D 1AFOA 1X9VA 1CI6A 1G1IA 5CCGC 4IFFA 1URQD 1WT6A 2QM8A 4AUWA 3H6PA 3MUDA 1NOHA 1LTAC 5AW8B 1FU1A 3NFQA 1GW3A 4B86A 4C7NB 2WPSA 1L4AA 5BU8B 3RL0D 1GZLA 1GL2D 2FYUK 3RL0C 3V2PA 4WY4A 3V4WA 3M0AA 1PFIA 1GL2C 2FKWB 1X79B 3VMYA 5CMZA 3HE5A 3SWYA 1H8AA 4GIFA 2HLOA 1M1JC 3HD7A 1FZCB 3VN0A 2HG5D 1GU4A 1ZR4A 3SWFA 2C9LY 2I1KA 3L36A 1NTMK 3T97A 2KB7P 2XZRA 5APVA 1XTCC 1N7LA 1QL2A 1XTGB 1Z56A 3M0DA 1JNMA 4HH2A 5KTBA 1FZFA 1IFMA 2OYIB 1L4AB 1CSBA 5KJ7D 1RE4C 2OYHB 2LKMA 1NH4A 3KYQA 5KJ7C 3VP8A 4W7YA 4LLHA 3B5NA 1E5WA 4Y99C 3TSIA 1IJDB 2JEEA 2R5DA 2WPQA 3HE4B 1LTIC 1HJBA 3II6A 2YNYA 5KLVK 3HRNA 5CCHA 3VTPC 1SQPK 3CI9A 3HD7B 3GHGC 3LW5H 5AW1B 1NWQA 5AVRB 5AW9B 4XE5B 2FFDC 2C0XA 1GL2A 1KQLA 1LTSC 5APUA 1RE3A 3CLQA 4N6JA 3RK2B 1T8ZA 1JY3N 2KOGA 1QL1A 1ZLLA 1JTHA 3VMZA 3BVHA 2OYIC 2GM4A 2E43A 2Z5IA 3V4QA 2ZFCA 3HUSC 1KILD 2ZXEB 2XKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1URQ D;  1N7S A;  2WZ7 A;  3RL0 B;  2N1T A;  1GL2 B;  1N7S B;  1L4A A;  2YMY A;  3RL0 D;  4W80 A;  1URQ B;  2N1T B;  1GL2 D;  3RL0 C;  4WY4 A;  1N7S D;  1GL2 C;  2NPS A;  1N7S C;  3PP5 A;  2M8R A;  1KIL C;  2N1T D;  1SFC A;  4WY4 B;  3HD7 A;  1URQ C;  2N1T C;  5KJ7 A;  2HG5 D;  1T3J A;  2NPS B;  1HVV A;  1SFC B;  4WY4 D;  4WY4 C;  2NPS D;  1XTG B;  2NPS C;  1SFC D;  1L4A B;  1SFC C;  5KJ7 D;  5KJ7 C;  3KYQ A;  4W7Y A;  3B5N A;  3TSI A;  1L4A D;  4JF7 A;  3RK3 B;  1L4A C;  4W7Z A;  5CCH A;  3M0D C;  3HD7 B;  3B5N B;  2HFE D;  2PP6 A;  3RK3 D;  1GL2 A;  3VOP A;  3RK3 C;  3HTK B;  2XDJ A;  5CCG A;  3HD7 D;  1KIL A;  3B5N D;  4OH8 B;  3RK2 B;  4N78 E;  3HD7 C;  3B5N C;  1URQ A;  1NHL A;  2KOG A;  4LGD E;  1JTH A;  5CCH D;  1KIL B;  3RK2 D;  5CCH C;  2H8P D;  3RK2 C;  5CCG D;  1JTH B;  3P8C E;  1KIL D;  5CCG C; 
#chains in the Genus database with same CATH topology
 3L71 D;  1KFN A;  3CWB E;  2QJK B;  2QRX A;  1FOS E;  4R4L A;  1MUU A;  3U1C A;  3L74 D;  1DD4 A;  1K05 A;  3B4S A;  1FE6 A;  3LID A;  4W80 A;  1M1J B;  5AVX B;  3KZI H;  4H44 C;  1EZV I;  3LW5 J;  1LTB C;  1QLE D;  4JPZ B;  5CJ0 A;  2JKV A;  1SQX G;  1BDC A;  1FJK A;  3QWO C;  2GUV A;  1IFD A;  4EYY Q;  1GK4 A;  4WVZ A;  1SQV G;  1OVV A;  3AE9 C;  1BE3 G;  1VQ5 P;  1YBK A;  2C9N Y;  2NPS C;  1SFC D;  1N86 A;  3SFE C;  3HE4 A;  5KAI H;  1AVO A;  1P84 H;  3C9I A;  5KLV E;  4U3F E;  1Y47 A;  3MIW A;  3A0H H;  3MZW B;  1J2J B;  1M7L A;  4O9B A;  3TDK A;  2HFE D;  1S5L E;  1FDM A;  2XDJ A;  5CCG A;  3L70 G;  2Y0C A;  3PH0 A;  1CW5 A;  2HPC B;  1URQ A;  3A7O A;  1PV3 A;  2ZT9 D;  1L0L K;  3A0B H;  3GF7 A;  3I55 P;  2FYU G;  1KIL B;  1N2D C;  2NZ2 A;  1SQX D;  1JY2 O;  1SQV D;  3N4X A;  3NXS A;  5KLI B;  1HTL C;  3CMA P;  1BE3 D;  3BCC E;  1LTJ B;  1IC2 A;  1YYC A;  2P7J A;  2LXB A;  1M1J A;  2FBW C;  3CX5 I;  1QX8 A;  1OWA A;  1N73 B;  1YJ9 P;  2E5T A;  1HH0 A;  5GTH H;  1SLQ A;  4RES B;  3KHU A;  2QJY C;  1M56 D;  3NTN A;  1RF1 B;  1X0T A;  2P67 A;  1Q86 Q;  1T2K D;  3L70 D;  1JOC A;  3H1H J;  2CPB A;  4EOT A;  1HBW A;  1SFC B;  4PD4 E;  2FYU D;  1R8E A;  2A45 G;  1QEX A;  1RHZ B;  3H1L G;  4DOJ A;  2VRS A;  3S4R A;  1NTM E;  1QVG O;  3P32 A;  1LT9 B;  1IFI A;  2A45 H;  3M0D C;  1OX3 A;  1G2C B;  2HPC A;  1OFC X;  1IFJ A;  3BAT A;  3RK3 C;  3AEG C;  2ZT9 B;  1KN7 A;  1JEK A;  1KIL A;  3B5N D;  3JC2 2;  2WTY A;  1SQP E;  5APS A;  5AW7 B;  1LTJ A;  4ASW A;  1JCC A;  2IBZ G;  1FBM A;  2YO2 A;  1N73 A;  3GMA A;  2WZ7 A;  3N7N A;  3AEA C;  3WUU A;  3H1I E;  1OVU A;  3H1L D;  3L75 J;  3RGU A;  1L0N G;  5KLV J;  3CPW O;  2V7Q J;  4I1L A;  1MFT A;  2WIT A;  3TF5 A;  5APX A;  2QE7 H;  2HYN A;  1SFC A;  1JY2 N;  2Q6Q A;  1YTZ I;  2IZ0 A;  1AQT A;  2JJL A;  2OYO A;  1PL5 A;  4H0L D;  4PD4 I;  4WBA A;  2KS1 A;  4UB6 E;  2WVR A;  3SSU A;  3L73 E;  1LT9 A;  1ZV8 A;  1G2C A;  2RN0 A;  1L4A C;  3VMA A;  1SQX K;  1FDO A;  3B5N B;  3L71 E;  1L0N D;  1FZB A;  1SQV K;  1D7M A;  1BCC G;  2GA1 A;  1FZA A;  5AVZ B;  1S4X A;  2G8Y A;  2Z5H A;  1IK7 A;  4D6T G;  3HD7 C;  4N78 D;  3CXH H;  2AEM A;  4AQR D;  1J1E B;  3L4F A;  2MJZ A;  3RK2 C;  3AEE C;  2R3C A;  2H88 C;  3CL3 D;  2XKM A;  1S3J A;  1X9V A;  1QGK B;  4U7J A;  2OTL P;  1K8A Q;  1GW3 A;  2WSF J;  4B86 A;  4C7N B;  1NTM J;  3D6Z A;  2FYU K;  3RL0 C;  3V4W A;  1ZXG A;  3M0A A;  1GL2 C;  2DW3 A;  3CXH D;  3VMY A;  3KZI E;  2W83 C;  1BCC D;  1FZC B;  1OIP A;  3VN0 A;  2HG5 D;  1GU4 A;  3SWF A;  4D6T D;  4H0L B;  3Q5R A;  2D2C C;  5APV A;  2O01 N;  3H1K G;  1SQP J;  4K3A A;  2W6J H;  1FZF A;  2BCC G;  1IFM A;  3Q5S A;  5B66 H;  5KJ7 D;  2LKM A;  3SWK A;  1NH4 A;  3KYQ A;  5TIS E;  5KAI E;  3B5N A;  1PGO A;  1SQX E;  2JEE A;  1NTZ G;  1P84 E;  2YXQ B;  2E74 D;  3H1I J;  1SQV E;  2YNY A;  5AW1 B;  2ITA A;  3A0H E;  2FFD C;  2C0X A;  2B9B A;  1LTS C;  4N6J A;  2JO1 A;  1L0L G;  4OWF A;  1EDJ A;  2IYO A;  3VMZ A;  3BVH A;  2OYI C;  4L75 A;  2B87 B;  1YQ4 C;  2ZFC A;  1LJ2 A;  3GG2 A;  3H1K D;  2E76 C;  1VQK P;  3L70 E;  4C7N A;  3TNU B;  3I56 P;  2H7H A;  5H2F H;  4BWN A;  2BCC D;  1RF0 C;  4EIJ A;  2R5B A;  2I1J A;  1JB0 J;  1W2E A;  5AW5 B;  1NVO A;  3CCU P;  3H25 A;  1NTZ D;  2RMZ A;  2ZAE B;  1FZC A;  2FXO A;  2QIW A;  1PPJ G;  3L71 J;  5GTH E;  1N7S C;  1PGQ A;  5AW4 B;  2N1T C;  3L74 J;  1VL2 A;  3PJS K;  1KC8 Q;  4BXL A;  2XV5 A;  2C0W A;  1L0L D;  1L0N K;  1EXJ A;  4Z1M H;  2E74 B;  2Z4E A;  3KDP B;  1MV8 A;  3WMM 0;  1DEB A;  1PP9 G;  4LC1 A;  4K35 A;  4L76 A;  5B5E H;  2E75 C;  2L5G B;  3L37 A;  1DD3 A;  2YKP A;  1P84 I;  3D6Y A;  3CCV P;  1Q90 D;  2K9J B;  2YKQ A;  1PPJ D;  2B87 A;  1BDD A;  1BGY G;  1KB9 H;  1VQ7 P;  1DH3 A;  3VYI A;  4I7Z C;  3TNU A;  1LTG C;  3PRJ A;  2PFX A;  1FDI A;  2RKL A;  4KJM A;  1FZE A;  3S1K A;  1BSH A;  1KQS O;  3JCU H;  1H88 A;  1SQX J;  2YMY A;  1USE A;  1PP9 D;  1URQ B;  2XND H;  1SQV J;  4JYC A;  1BE3 J;  2FXP A;  1KB9 D;  2K1A A;  3MUD C;  1RE4 A;  3TK1 A;  2HOD B;  5KJ7 A;  1HGV A;  2KSE A;  1FJP A;  1VF5 C;  3HTK A;  2O1J A;  3ITK A;  1G1J A;  1BGY D;  4WY4 C;  2KYV A;  5KAF H;  1NO4 A;  5APQ A;  2FYN C;  2Q7C A;  4H13 C;  1LWU B;  4A7P A;  3L70 J;  4PV1 D;  5APW A;  1NKN A;  2K9J A;  1MZ9 A;  1S9K D;  1AQ5 A;  2FYU J;  3M9Q A;  2J59 M;  2PP6 A;  4IFD K;  2ZYA A;  1NKZ B;  1NU1 G;  1KV4 A;  3RBZ A;  2OGU A;  3O6Q B;  2A45 I;  2UWJ E;  1WRG A;  3L75 E;  1NHL A;  3V2N A;  1YHQ P;  2IDB A;  2KSJ A;  2JR8 A;  1VQN P;  2O1K A;  5CCH C;  3CXH E;  1MFZ A;  2Q5U A;  1NTZ K;  1LP1 B;  3L72 G;  1BCC E;  1RE3 C;  3R4Y A;  2OTK E;  3C1L A;  4D6T E;  3F5H A;  4HB1 A;  2D2C D;  3P8M C;  2PRR A;  1K04 A;  2P10 A;  1HF9 A;  2HOD A;  4KT0 J;  2FY8 A;  3G6E P;  4NPD A;  2NRG A;  1NGM B;  1NU1 D;  2POH A;  3H1L J;  1JMM A;  1NTK G;  1KFM A;  2KI7 B;  2AXC A;  2W90 A;  3CME P;  1LWU A;  1JY3 O;  3KQG A;  3D70 A;  4PV1 B;  2QJP C;  2WSS H;  3L72 D;  5AVT B;  1YTZ T;  4OGQ C;  4RO0 A;  3M9B A;  4IL6 H;  2H89 C;  1VQP P;  3CCM P;  1YI2 P;  1EZV G;  1RY3 A;  3H1K E;  3O6Q A;  2E76 D;  3VOP A;  2JWD A;  2BCC E;  2YKO A;  3RL0 g;  3W68 A;  2IFM A;  1IK9 A;  1OMI A;  3E7K A;  2Q9I A;  3H1J G;  2KS1 B;  2R32 A;  1BSN A;  2KZJ A;  1EC5 A;  1LP1 A;  1L0N J;  3AE7 C;  1NTK D;  1JTH B;  3Q2Y A;  1G1I A;  3CXH I;  5CCG C;  3TGU G;  2R44 A;  4ZMD A;  2D2C B;  2BEZ F;  4AUW A;  1NOH A;  1LTA C;  1L0L E;  5H2F E;  3WU2 H;  2WPS A;  1L4A A;  1VQL P;  2QJK C;  3V2P A;  2K37 A;  1AVY A;  1EZV D;  1KQF B;  1VQM P;  2I8D A;  5CMZ A;  2HLO A;  3CCL P;  1M1J C;  3HD7 A;  2KXP B;  1EXI A;  1ZR4 A;  2ZVO B;  2C9L Y;  2E75 D;  2Y0D A;  4IL6 X;  4YTP C;  3H1J D;  2XZR A;  1Q81 Q;  1JMB A;  4GOE A;  1KQG B;  5KTB A;  2ZJS E;  2KK7 A;  1PPJ E;  2OYI B;  3CWB G;  3AEB C;  2OYH B;  1USD A;  1BCC J;  1T6A A;  3TGU D;  3WUV A;  2YMK A;  2IZ1 A;  4LLH A;  1GMJ A;  1E5W A;  2E76 B;  4D6T J;  1IJD B;  2R5D A;  1YIJ P;  5KKZ C;  3II6 A;  3HRN A;  5K5G B;  2OQQ A;  3CX5 H;  3PTZ A;  1M90 Q;  5B5E E;  1NWQ A;  3E1R A;  5AW9 B;  4XE5 B;  1GL2 A;  3MHV A;  2IBZ D;  4RJT A;  1JY3 N;  1SQQ G;  2KOG A;  3ZDM A;  1JTH A;  1PP9 E;  4EDF A;  2Y9Z A;  4EI2 A;  1KIL E;  1KB9 E;  4WWI A;  2WSE H;  1IFN A;  1A02 J;  1JY2 P;  3L74 E;  3OAK A;  1X22 A;  3CX5 D;  1SQB K;  1NU1 K;  1ZOY C;  4GDO A;  3CWB D;  1SVF A;  4U3F G;  2YIU B;  5KLI C;  4H44 D;  2W8Z A;  1SP4 A;  4IFM A;  4PJ0 H;  3H1K J;  5C39 A;  2Y0E A;  1N73 C;  1NJI Q;  3U1A A;  2E75 B;  1H89 A;  3P8C D;  2BCC J;  1GW4 A;  1OVR A;  1S9K E;  1RF1 C;  2OYI A;  1SQQ D;  2FYZ A;  1NTZ J;  2OYH A;  2NPS D;  3V6I A;  4Y99 B;  2AXT H;  3BCC G;  3W67 A;  5KAF E;  1LNQ A;  1SFC C;  3GHG B;  2IPP A;  3UIA A;  1R5S A;  4RKU J;  1L0L J;  3OA7 A;  5BU5 A;  3IN6 A;  1YQ3 C;  1QVF O;  4U3F D;  1IO4 A;  3M91 A;  1RQV A;  2WMM A;  1NTK K;  3EQ2 A;  3AEC C;  1PIX A;  1LT9 C;  3HUS B;  4LGD E;  1VQ6 P;  2ZT9 C;  5AVW B;  1VQ4 P;  3B71 A;  5AW3 B;  3IF4 A;  1KYO H;  1EDL A;  1BE3 E;  3Q1M A;  2M5A B;  1RQU A;  5BVZ A;  3BCC D;  1EDK A;  4H44 B;  3IFM A;  4PD4 H;  2IFN A;  2JDI H;  4QMA A;  2FYN B;  3A5T A;  2P2U A;  3SFD C;  1J1D C;  2QM7 A;  3A0B E;  2XU6 A;  3AE5 C;  5EFW B;  5AVQ B;  1EDI A;  2QA4 P;  2M8R A;  3H32 A;  1KYO D;  2NPS B;  4GKG A;  1HVV A;  1VPC A;  2FYU E;  1HUC A;  5CJ4 A;  1PP9 J;  2Y9Y A;  3AE1 C;  4PD4 D;  3GHG A;  1KTM A;  5DJU B;  1OZH A;  5DJT B;  1M8O B;  4C46 A;  3BAS A;  5AVY B;  1N8R Q;  1CZQ A;  3FGA D;  2WT7 B;  4WB4 A;  4JF7 A;  1H0T B;  5E79 H;  1AA0 A;  1GTW A;  1BGY J;  4YPC A;  4IL6 E;  1U7M A;  3RK3 D;  4UB8 H;  2P58 A;  3EFF K;  2M0B A;  3HUS A;  3HTK B;  5AVU B;  4C7R A;  3AE4 C;  1A02 F;  1NAF A;  2WWW A;  3B5N C;  4ZNC A;  3Q3D A;  3L35 A;  2KLU A;  4HKZ H;  1TU3 F;  3OJA B;  3G71 P;  4YXD C;  1EZV E;  4ZKP A;  2M5A A;  3G4S P;  3LIE A;  3MP7 B;  4TT3 H;  2Q1K A;  2WSC J;  1M1K Q;  3L73 G;  1J1E C;  1FS0 E;  3H1L E;  1X8Y A;  1CI6 B;  1WMK A;  2AEF A;  2QJY B;  3B8E B;  5M1B A;  1SQQ K;  4DCK A;  2QSI A;  2V4H A;  2IX7 C;  3M06 A;  2PAJ A;  2NPS A;  3TGU E;  1FZG A;  4DZO A;  3CCR P;  3EFG A;  4OVN F;  2SPZ A;  3HE5 B;  1GK6 A;  4HJG H;  4MN4 C;  1GDT A;  2JWA A;  1FZC C;  3V2Q A;  2IBZ E;  2KLV A;  2WT7 A;  4H0L C;  3T97 B;  5GTI H;  1H0T A;  3MD0 A;  2FXM A;  2XNX A;  1NU1 J;  2G3A A;  3L73 D;  1AV1 A;  1L4A D;  2A06 G;  3RK3 B;  5APY A;  1JCD A;  2O01 H;  2WSC H;  1L0N E;  4GT1 A;  3K5B A;  1HWT C;  4JYB A;  4YXW H;  5AW0 B;  3CX5 E;  2IYP A;  1HGZ A;  3HD7 D;  3L72 J;  3V5B A;  4N78 E;  4N3Y B;  1IFP A;  3CC2 P;  1ZRT D;  1OXZ A;  3RK2 D;  1OW8 A;  2J5U A;  5AW6 B;  3P8C E;  1CI6 A;  1MKM A;  2K3R A;  1SQB G;  2BEQ D;  2QM8 A;  2N9Y B;  5AW8 B;  1FU1 A;  1Q82 Q;  1SQQ E;  2KIK A;  3RL0 D;  3S9O A;  1DIP A;  2A06 D;  1NTK J;  1GL2 D;  1UII A;  4BRY B;  1PFI A;  1ZW0 A;  5KKZ B;  5TIS H;  3AED C;  2R3S A;  4PJ0 E;  3HE5 A;  1H8A A;  1E79 H;  2WPV B;  1VQ9 P;  2I1K A;  4L73 A;  3L36 A;  1NTM K;  3GW6 A;  3GF3 A;  3T97 A;  1N7L A;  1QL2 A;  3M0D A;  1JNM A;  2KZI A;  1K9M Q;  4GOF A;  1L4A B;  1Y9B A;  1RE4 C;  2AXT E;  2IBZ I;  2ZYG A;  5KJ7 C;  3VP8 A;  4W7Y A;  1SQB D;  1Q2N A;  2WPQ A;  3H1J J;  2K9Y A;  2E74 C;  1P84 D;  1SQP K;  3HD7 B;  2OTJ P;  3C8V A;  3LW5 H;  3CD6 P;  1PGP A;  1U57 A;  3RK2 B;  1T8Z A;  3CCS P;  3TGU J;  2CK3 H;  5B66 E;  3AE8 C;  1ZLL A;  4JBZ A;  2ZXE B;  1KYO E;  3PHL A;  3CC4 P;  2OAR A;  3RL0 B;  1S72 P;  1GL2 B;  4BRY A;  1NTZ E;  3I5C A;  1LT1 A;  4IOI H;  1N7S D;  2GUS A;  5AVS B;  4NPE A;  3TYY A;  2N1T D;  1UIX A;  3CWB J;  1URQ C;  3FXD A;  3M9H A;  1KZU B;  3VMX A;  3RK3 E;  2KUB A;  1NAY A;  2YXR B;  2O3J A;  3FX0 A;  2B88 A;  3MGN A;  1GU5 A;  1JUN A;  3IAO A;  3H1H G;  1M57 D;  4CPG A;  1T3U A;  1ZN5 A;  2FFD B;  2WSE J;  3P7K A;  1SQQ J;  4W7Z A;  1LWU C;  1R5L A;  5E79 E;  2P1J A;  2Q3E A;  4UB8 E;  1J1D B;  1NYH A;  2KP8 A;  2QVA A;  3IR9 A;  2HR3 A;  1PGJ A;  4XA4 A;  2Q3I A;  1RF1 A;  4U3F J;  1ZME C;  2H8P D;  3BRT B;  1RH5 B;  3R2P A;  2QEX P;  2L91 A;  1KYO I;  2LXC B;  1FAV A;  2W6A A;  3H1H D;  1N7S B;  3G3Z A;  3A2A A;  3NMD A;  2RH0 A;  1LTT C;  3MTU E;  2N1T B;  5APT A;  3KXD A;  3Q5P A;  1HJ0 A;  3PP5 A;  1KIL C;  1SS1 A;  3BCC J;  1S2E A;  3L75 G;  1VQ8 P;  2JP3 A;  1T3J A;  1VF5 D;  5KLV G;  3F89 A;  1BGY E;  1YJN P;  2AEJ A;  1DEE G;  4WY4 D;  1LTJ C;  2E5Y A;  3JCU E;  1OW6 A;  2M3B A;  4I2L C;  2FFD A;  4H13 D;  3AE6 C;  1ZRT E;  1JY3 P;  1U7J A;  5GTI E;  3A3Y B;  3AEF C;  1GD2 E;  1OW7 A;  4GOD A;  2V7Q H;  3G9R A;  4NPF X;  3FWL A;  2PGD A;  4PV1 C;  2K88 A;  3H32 B;  1S5L H;  1DX7 A;  3GLM A;  1EQ7 A;  1S1C X;  3BRV B;  5CHX A;  2W27 A;  4HYT B;  2W6B A;  1VQO P;  4OH8 B;  4I7Z B;  3D71 A;  1RF0 A;  1IZN B;  1W2B O;  5CCH D;  2A06 E;  3L75 D;  3O8Z A;  5KLV D;  3VP9 A;  1ZR2 A;  4TLF A;  4KHX A;  2CPS A;  4I6M C;  1N7S A;  2BAS A;  1JO5 A;  1FOS F;  2B89 A;  2N1T A;  1ZP0 C;  1JM0 A;  1VDF A;  4ZKU A;  1FC2 C;  4JQ0 D;  2KNC B;  1VF5 B;  1SQB E;  1NU1 E;  1KB9 I;  4DT0 A;  4WY4 B;  3ABV C;  1NTM G;  3KPE A;  2N9B A;  1YIT P;  4H13 B;  2J58 A;  1S5L X;  3CCJ P;  2YO3 A;  3L72 E;  2WSF H;  4OGQ D;  3PLN A;  3U59 A;  4L74 A;  3CCQ P;  1T2K C;  4M3L A;  1SQP G;  2OYH C;  5AVV B;  5TJH A;  3V2R A;  1PZQ A;  1KOR A;  3E1I A;  5L8R J;  3L73 J;  2LR2 A;  2E42 A;  3H1I G;  2H43 A;  4AYC A;  1NTK E;  1NTM D;  1LGH B;  1KMI Z;  1Q7Y Q;  2WPR A;  3FXE A;  5CCG D;  1AFO A;  1AJY A;  2WQY C;  4IFF A;  1URQ D;  1WT6 A;  3H6P A;  3MUD A;  3OW2 O;  3NFQ A;  2KNC A;  5BU8 B;  3EWK A;  1GZL A;  1SQP D;  3JSV C;  4WY4 A;  2QG4 A;  1YJW P;  1L2P A;  2YIU C;  2FKW B;  2O01 J;  1X79 B;  1Y8A A;  3SWY A;  4DJG A;  4GIF A;  3WUT A;  3H1J E;  2QJP B;  2KB7 P;  3H1I D;  1XTC C;  4XFJ A;  3L71 G;  3WU2 E;  1XTG B;  1Z56 A;  3FWN A;  4OGQ B;  4UB6 H;  1W5C E;  3AE2 C;  3RBX A;  4HH2 A;  1CSB A;  3L74 G;  2M3E A;  4Y99 C;  3TSI A;  3USS A;  3CC7 P;  4ASV A;  3HE4 B;  1LTI C;  1HJB A;  3CCE P;  5KLV K;  5CCH A;  3VTP C;  3CI9 A;  3GHG C;  5AVR B;  1KQL A;  4R4M A;  5APU A;  3QH9 A;  5CBO A;  1RE3 A;  2ZYD A;  3CLQ A;  1KD1 Q;  2ZXX A;  4Y28 J;  3H1H E;  1SQB J;  2ZVN B;  1QL1 A;  2MKV A;  5CBN A;  3AE3 C;  2GM4 A;  2E43 A;  2Z5I A;  3V4Q A;  1K73 Q;  3HUS C;  1KIL D;  5AW2 B; 
#chains in the Genus database with same CATH homology
 1KFN A;  2OAR A;  2WSE H;  1IFN A;  4C7N A;  1A02 J;  1JY2 P;  3OAK A;  3TNU B;  2H7H A;  1FOS E;  1MUU A;  1NU1 K;  1SQB K;  3RL0 B;  1RF0 C;  4EIJ A;  3U1C A;  2R5B A;  2I1J A;  1SVF A;  1GL2 B;  3LID A;  1W2E A;  3I5C A;  5AW5 B;  4W80 A;  1M1J B;  5AVX B;  1SP4 A;  4IFM A;  1FZC A;  1N7S D;  2GUS A;  5AVS B;  1N73 C;  1N7S C;  3TYY A;  3U1A A;  1H89 A;  2N1T D;  3P8C D;  5AW4 B;  1LTB C;  1GW4 A;  1URQ C;  2N1T C;  5CJ0 A;  3M9H A;  1S9K E;  1FJK A;  2XV5 A;  2C0W A;  2GUV A;  1IFD A;  1KZU B;  3VMX A;  1RF1 C;  1GK4 A;  2OYI A;  2FYZ A;  2OYH A;  2NPS D;  1L0N K;  4Y99 B;  2C9N Y;  2NPS C;  1SFC D;  1N86 A;  3MGN A;  1SFC C;  3HE4 A;  1GU5 A;  1JUN A;  2Z4E A;  3GHG B;  3KDP B;  1MV8 A;  1T3U A;  1ZN5 A;  2IPP A;  3C9I A;  3WMM 0;  2FFD B;  3UIA A;  1DEB A;  4LC1 A;  3P7K A;  3MIW A;  3OA7 A;  5BU5 A;  1IO4 A;  4W7Z A;  2L5G B;  3L37 A;  1J2J B;  3M91 A;  1LWU C;  1M7L A;  1NTK K;  2YKP A;  3EQ2 A;  4O9B A;  2HFE D;  2P1J A;  1FDM A;  2XDJ A;  5CCG A;  1J1D B;  1LT9 C;  1CW5 A;  2YKQ A;  2KP8 A;  2HPC B;  1URQ A;  3A7O A;  3HUS B;  3IR9 A;  4LGD E;  1L0L K;  1KIL B;  4XA4 A;  1N2D C;  2Q3I A;  5AVW B;  1RF1 A;  1DH3 A;  2H8P D;  3BRT B;  5AW3 B;  3VYI A;  3TNU A;  1JY2 O;  1LTG C;  3N4X A;  3NXS A;  1FZE A;  1HTL C;  3R2P A;  1LTJ B;  1IC2 A;  5BVZ A;  1YYC A;  2P7J A;  1M1J A;  3IFM A;  2IFN A;  1FAV A;  1OWA A;  2W6A A;  3A5T A;  1N73 B;  1N7S B;  2P2U A;  1H88 A;  3G3Z A;  3A2A A;  2YMY A;  1J1D C;  3NMD A;  2QM7 A;  1HH0 A;  1LTT C;  1URQ B;  3MTU E;  2N1T B;  2XU6 A;  1SLQ A;  4RES B;  5APT A;  5AVQ B;  4JYC A;  3NTN A;  1RF1 B;  3PP5 A;  2M8R A;  1KIL C;  2P67 A;  3H32 A;  1T2K D;  1RE4 A;  3TK1 A;  2HOD B;  5KJ7 A;  1T3J A;  1JOC A;  1HGV A;  2NPS B;  1FJP A;  4GKG A;  2CPB A;  3HTK A;  1HVV A;  4EOT A;  1VPC A;  1SFC B;  1HBW A;  4WY4 D;  2O1J A;  1HUC A;  1G1J A;  1LTJ C;  5CJ4 A;  4WY4 C;  2KYV A;  3GHG A;  1NO4 A;  2M3B A;  2A45 G;  4I2L C;  2FFD A;  5APQ A;  4C46 A;  2Q7C A;  3BAS A;  4DOJ A;  1JY3 P;  2VRS A;  1LWU B;  5AVY B;  1CZQ A;  3A3Y B;  1GD2 E;  2WT7 B;  4WB4 A;  4JF7 A;  5APW A;  1NKN A;  3P32 A;  1LT9 B;  1GTW A;  1IFI A;  1MZ9 A;  3H32 B;  1S9K D;  1AQ5 A;  2A45 H;  3M0D C;  1DX7 A;  1G2C B;  3M9Q A;  2J59 M;  2PP6 A;  3RK3 D;  2HPC A;  4IFD K;  1EQ7 A;  1IFJ A;  3BAT A;  3BRV B;  3HUS A;  1NKZ B;  3RK3 C;  3HTK B;  5CHX A;  2W27 A;  5AVU B;  4C7R A;  1A02 F;  4HYT B;  1KIL A;  2W6B A;  3B5N D;  4OH8 B;  2A45 I;  2WTY A;  1NAF A;  2WWW A;  3B5N C;  1WRG A;  1NHL A;  3V2N A;  3L35 A;  1RF0 A;  2KSJ A;  5CCH D;  5APS A;  2O1K A;  3OJA B;  3O8Z A;  5CCH C;  5AW7 B;  1LTJ A;  3VP9 A;  1JCC A;  1MFZ A;  2Q5U A;  1NTZ K;  4ZKP A;  1ZR2 A;  3LIE A;  4KHX A;  5AW2 B;  2CPS A;  4I6M C;  1FBM A;  2YO2 A;  1RE3 C;  1N73 A;  1J1E C;  1N7S A;  2WZ7 A;  3N7N A;  2BAS A;  1JO5 A;  1FOS F;  1X8Y A;  1CI6 B;  2N1T A;  3B8E B;  3P8M C;  1SQQ K;  1VDF A;  4ZKU A;  2IX7 C;  3M06 A;  4I1L A;  2HOD A;  2WIT A;  5APX A;  2PAJ A;  2NPS A;  1FZG A;  2HYN A;  4DZO A;  1SFC A;  4WY4 B;  1JY2 N;  2POH A;  1YTZ I;  3EFG A;  3KPE A;  1JMM A;  2N9B A;  3HE5 B;  1KFM A;  1GK6 A;  2JJL A;  1GDT A;  2J58 A;  1FZC C;  1LWU A;  1JY3 O;  3V2Q A;  3KQG A;  2KLV A;  4WBA A;  2WT7 A;  2YO3 A;  2WSF H;  3MD0 A;  1LT9 A;  2FXM A;  5AVT B;  2XNX A;  1ZV8 A;  1YTZ T;  3U59 A;  1G2C A;  1T2K C;  1L4A D;  3M9B A;  4M3L A;  3RK3 B;  5APY A;  1L4A C;  1JCD A;  2O01 H;  2WSC H;  4GT1 A;  1SQX K;  2OYH C;  1RY3 A;  5AVV B;  3V2R A;  3B5N B;  1FZB A;  1HWT C;  4JYB A;  1SQV K;  5AW0 B;  3VOP A;  1FZA A;  5AVZ B;  1HGZ A;  3E1I A;  3HD7 D;  2YKO A;  2Z5H A;  3V5B A;  4N78 E;  3HD7 C;  4N3Y B;  2IFM A;  1IK9 A;  2Q9I A;  2E42 A;  4N78 D;  2R32 A;  1OXZ A;  2H43 A;  4AYC A;  4AQR D;  3RK2 D;  1J1E B;  3L4F A;  1LGH B;  2MJZ A;  3RK2 C;  5AW6 B;  2R3C A;  2WPR A;  1JTH B;  5CCG D;  3P8C E;  3CL3 D;  1AFO A;  1X9V A;  1CI6 A;  1G1I A;  5CCG C;  4IFF A;  1URQ D;  1WT6 A;  2QM8 A;  4AUW A;  3H6P A;  3MUD A;  1NOH A;  1LTA C;  5AW8 B;  1FU1 A;  3NFQ A;  1GW3 A;  4B86 A;  4C7N B;  2WPS A;  1L4A A;  5BU8 B;  3RL0 D;  1GZL A;  1GL2 D;  2FYU K;  3RL0 C;  3V2P A;  4WY4 A;  3V4W A;  3M0A A;  1PFI A;  1GL2 C;  2FKW B;  1X79 B;  3VMY A;  5CMZ A;  3HE5 A;  3SWY A;  1H8A A;  4GIF A;  2HLO A;  1M1J C;  3HD7 A;  1FZC B;  3VN0 A;  2HG5 D;  1GU4 A;  1ZR4 A;  3SWF A;  2C9L Y;  2I1K A;  3L36 A;  1NTM K;  3T97 A;  2KB7 P;  2XZR A;  5APV A;  1XTC C;  1N7L A;  1QL2 A;  1XTG B;  1Z56 A;  3M0D A;  1JNM A;  4HH2 A;  5KTB A;  1FZF A;  1IFM A;  2OYI B;  1L4A B;  1CSB A;  5KJ7 D;  1RE4 C;  2OYH B;  2LKM A;  1NH4 A;  3KYQ A;  5KJ7 C;  3VP8 A;  4W7Y A;  4LLH A;  3B5N A;  1E5W A;  4Y99 C;  3TSI A;  1IJD B;  2JEE A;  2R5D A;  2WPQ A;  3HE4 B;  1LTI C;  1HJB A;  3II6 A;  2YNY A;  5KLV K;  3HRN A;  5CCH A;  3VTP C;  1SQP K;  3CI9 A;  3HD7 B;  3GHG C;  3LW5 H;  5AW1 B;  1NWQ A;  5AVR B;  5AW9 B;  4XE5 B;  2FFD C;  2C0X A;  1GL2 A;  1KQL A;  1LTS C;  5APU A;  1RE3 A;  3CLQ A;  4N6J A;  3RK2 B;  1T8Z A;  1JY3 N;  2KOG A;  1QL1 A;  1ZLL A;  1JTH A;  3VMZ A;  3BVH A;  2OYI C;  2GM4 A;  2E43 A;  2Z5I A;  3V4Q A;  2ZFC A;  3HUS C;  1KIL D;  2ZXE B;  2XKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...