5KJ7A

Structure of the ca2+-bound synaptotagmin-1 snare complex (long unit cell form) - from xfel diffraction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
b'GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 3
publication title Advances in X-ray free electron laser (XFEL) diffraction data processing applied to the crystal structure of the synaptotagmin-1 / SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis,exocytosis
total genus 28
structure length 63
sequence length 63
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5kj7A00
2NPSD 4W7ZA 1URQD 4N78E 3HD7C 2HG5D 3PP5A 3RK3D 1HVVA 1GL2D 4JF7A 1URQB 1SFCD 1N7SA 5CCGD 3HD7D 3RK3B 5CCHA 2NPSC 4W7YA 3HD7B 1KILA 3B5ND 1XTGB 1GL2C 1SFCC 4WY4D 2N1TD 5CCGC 2XDJA 4OH8B 2NPSB 1JTHB 1T3JA 2M8RA 3VOPA 2HFED 1L4AD 2PP6A 3B5NC 1GL2B 3KYQA 1SFCB 4WY4C 2N1TC 5KJ7A 3RL0D 2KOGA 1N7SD 5CCHD 1L4AC 2NPSA 4W80A 1JTHA 3B5NB 1URQA 1KILD 4WY4B 2N1TB 3P8CE 1GL2A 2YMYA 3RK2C 3RL0C 1SFCA 3HTKB 5CCGA 3HD7A 2H8PD 1N7SC 5CCHC 1L4AB 3TSIA 3RK2D 1KILC 5KJ7C 3B5NA 1NHLA 2WZ7A 3RK2B 3RL0B 4WY4A 3M0DC 2N1TA 1N7SB 5KJ7D 1URQC 4LGDE 1KILB 3RK3C 1L4AA
chains in the Genus database with same CATH superfamily
5CHXA 1FZCB 3QWOC 1SQBG 3L75E 3M9BA 3CCQP 1YBKA 2GM4A 3CX5I 2M3EA 1IFPA 4EOTA 2W90A 1PFIA 1MUUA 2MKVA 3ITKA 3NFQA 1YYCA 1USDA 1Q81Q 5B5EH 2O01J 1JO5A 3HUSA 1TU3F 2OTLP 1JCDA 1KC8Q 1E5WA 1ZN5A 1NVOA 4Y99B 4PD4I 3JC22 1QGKB 1VQ4P 2FYUK 2IYPA 2ZT9D 3H1JD 1X22A 2KNCB 3L71E 3HRNA 4PV1C 2AEFA 4HKZH 3SSUA 2E74D 2OYHB 2BCCG 4XA4A 3IN6A 1VF5B 3MIWA 5KLVJ 2FYNC 5CCHC 1EXJA 2C0XA 1R5SA 3H1JJ 4HJGH 4I7ZB 1J1DC 1FS0E 3L75G 5BU5A 4N78D 3U1AA 3V2PA 1H88A 1J1EB 2RH0A 3TF5A 1U7JA 1QX8A 3CXHH 1BDDA 2WT7A 4QMAA 2E76C 3TDKA 1SQQK 2PGDA 2B88A 4YXWH 4AQRD 1A02F 4IFMA 1N8RQ 2H7HA 1BDCA 3W68A 3C1LA 3I5CA 2OYIC 1EZVI 1YQ4C 1LTJB 1DEEG 2LKMA 2Q6QA 1RF1B 4TLFA 3VMXA 2A06E 2A45G 1L0LD 3L71G 2M0BA 1SQVK 1SP4A 1OW8A 1XTGB 1KORA 2YIUB 1VQNP 1PGJA 5APSA 2XDJA 3H1KG 2P7JA 3LIDA 4IL6E 2SPZA 1OMIA 2R44A 3M06A 2CPBA 3P8MC 1SFCB 2LXBA 3A5TA 3A7OA 1S5LX 4YXDC 1LTIC 2Y9YA 3CC4P 2ZXXA 1ZRTE 1IJDB 5CJ0A 2WSFJ 3GHGA 1R8EA 3FXDA 1L0NJ 4Z1MH 3D6ZA 1CZQA 2KXPB 2JWDA 2BEQD 4C7NA 5TISH 2WSSH 3V2RA 3E1IA 3U59A 4K3AA 2E5TA 4GKGA 1KILE 1FZCC 3AE7C 2R5DA 1KFMA 5L8RJ 1N7SB 1GD2E 1YJWP 1RQUA 3AEDC 1DX7A 4YTPC 1CI6B 2A06G 2ZYDA 4TT3H 2WSEH 1KYOH 3L35A 5KAFH 5B5EE 1JY2N 2Z5HA 5M1BA 1XTCC 1SQBD 3AE4C 1LTBC 4K35A 2I8DA 2V7QH 3HTKA 4Y99C 3GG2A 2PAJA 1N73B 5H2FH 3M0DA 1NTMK 4OH8B 2IBZI 4PJ0H 3HE4B 1M1JA 2DW3A 2QSIA 2IPPA 1FC2C 2HFED 1L4AD 3D71A 1Z56A 2OYHC 2J59M 1Q2NA 1VF5C 3HE5B 2FXMA 2KS1A 4W80A 1LT9A 2Y0DA 2FYUE 1OFCX 3Q1MA 4GODA 4I7ZC 3BVHA 1QL1A 3TGUJ 1KQLA 1AVYA 2BCCD 5AW9B 1J1EC 3CXHE 2WPSA 3MD0A 3A2AA 1QEXA 3G6EP 1KQSO 3L75D 5KJ7D 3S9OA 3H25A 2OGUA 4EIJA 1LTJC 2D2CD 1K8AQ 2HLOA 2O1JA 4RJTA 1L4AA 4H44D 1JY3P 2NPSD 1RF1C 1NOHA 2QVAA 1KQGB 4CPGA 5KAIH 1EXIA 1NKNA 3KQGA 5AW8B 2WITA 3R4YA 2YIUC 1SQQE 3AEGC 1S9KE 4ASWA 3Q5PA 3L72G 3PHLA 3L75J 1Y8AA 2B89A 1VDFA 5BU8B 1RF0A 3RK3E 4DT0A 3L71D 1YIJP 1SFCC 4OVNF 1S72P 5AVZB 1KFNA 1T3JA 5AVSB 2JDIH 1SQVE 1FZFA 3OA7A 2WT7B 3CMAP 2JEEA 5KJ7A 2YKPA 5AW6B 5TISE 1T6AA 2ZT9B 1GK4A 3SWFA 2JJLA 1UIXA 2NPSA 2KYVA 3L71J 1FAVA 3K5BA 4WY4B 2N1TB 1M8OB 1JMMA 3T97A 3WU2H 1N7SC 2MJZA 3H1KJ 1NU1K 2YKQA 2KP8A 3RK2D 1KYOE 1G2CB 1BE3J 3G71P 3U1CA 5KAFE 2WZ7A 1SQQG 2W6AA 3SWKA 3KDPB 1RE3A 3A0HH 1OX3A 2OTKE 2HODA 1H0TB 2HPCA 4IL6X 2A06D 3FWLA 1VQ6P 1HJ0A 3AE2C 1M1KQ 3IR9A 1NTKK 1JEKA 3PP5A 5H2FE 1HVVA 4U7JA 1GL2D 1N73C 4RO0A 1SQVG 4PJ0E 4RKUJ 2KI7B 1T2KD 1PL5A 4RESB 2IZ1A 2QJYB 3G3ZA 5GTIH 3IAOA 2FBWC 3MTUE 4XFJA 1PV3A 1AQ5A 1E79H 1RY3A 2CK3H 1ZRTD 3V5BA 3KHUA 1YJ9P 4JYCA 1NTME 2IZ0A 3C9IA 3H1IE 2WMMA 1OVRA 2KOGA 3CCEP 2QEXP 4KT0J 3CLQA 1JTHA 1ZP0C 2OARA 3PJSK 3D6YA 5K5GB 2YNYA 1KILD 4OGQD 5AVTB 1K04A 1GL2A 2ZAEB 3HTKB 3MP7B 1J2JB 1IFDA 1R5LA 1RE4A 3TSIA 2K9JA 2KSJA 1S1CX 2Z4EA 2QJKB 5APVA 1D7MA 2Z5IA 3VMYA 1NJIQ 5KAIE 1M1JB 4DCKA 2ZJSE 1LTAC 1FDOA 5KKZB 1LTGC 4U3FE 3I56P 1SVFA 1SQPJ 2P67A 1UIIA 4B86A 1GK6A 1JY2O 1G1IA 2K88A 2KLVA 1JOCA 1IK9A 3G4SP 3M9HA 3H1HE 4I6MC 4GOEA 1KILA 2NZ2A 3H1IG 5AVUB 2W8ZA 1M56D 2R32A 1ZOYC 2LXCB 1YITP 2L91A 1M7LA 5APTA 2M8RA 2ZT9C 5AW2B 3Q3DA 1SQXK 2FYUD 3V4WA 1PIXA 2B9BA 1BGYJ 4WY4C 2N1TC 3GW6A 1VQ9P 1AA0A 3PLNA 3CXHD 3WU2E 3L4FA 5AVVB 3AE5C 3I55P 3L72J 1W2BO 1SS1A 4LLHA 1NTZE 2ZFCA 5APWA 5BVZA 1WRGA 3A0HE 1GTWA 4U3FG 1IK7A 2KB7P 2XNDH 1EDIA 2JR8A 2ITAA 5DJUB 1ZV8A 4H13D 1K05A 2C9NY 1Q82Q 4DOJA 1GZLA 3RL0B 3Q2YA 2YKOA 5AVQB 3H1HG 5APXA 1VQPP 3A0BH 1NU1E 1SQQD 1S9KD 2J58A 4LGDE 2AXTH 3EFGA 5CJ4A 2WPVB 2QJYC 5GTIE 3RK3D 5AW7B 3HD7D 1AQTA 5KLVK 2O01H 3ZDMA 1SQVD 1NTKE 1NWQA 2Y0CA 2OQQA 1CW5A 2Y9ZA 1AVOA 1Q86Q 1ZLLA 2Q3IA 4PV1D 3MGNA 1NTZG 2VRSA 5TJHA 4GT1A 3C8VA 3EFFK 1H8AA 1X8YA 1YHQP 3BASA 2HPCB 2A45I 1QVGO 3RL0g 4HYTB 5CCHD 2J5UA 1KYOD 3B5NB 1QL2A 1BCCE 2QJKC 4YPCA 4NPDA 2N9YB 1M1JC 3HD7A 2WSCJ 2FXOA 1OIPA 2I1KA 1FZEA 5KKZC 1L0LJ 1KN7A 3R2PA 2G3AA 1QLED 3B4SA 3WUVA 1JUNA 3RK2B 2R3SA 4BRYA 1PZQA 1YTZI 4GOFA 5APQA 3NXSA 3UIAA 2W27A 3L74E 2KSEA 1BSHA 3GMAA 4L73A 5AVXB 4EDFA 1ZR4A 1EDKA 1L0NK 3S1KA 2FFDB 3CCMP 5CCHA 1JY3N 2WTYA 2GUSA 3LW5J 4D6TE 2JKVA 5B66H 1NTMD 4IFFA 1YJNP 4JPZB 3H1ID 2Q1KA 3FXEA 3H1LE 1BCCG 3VMZA 2E42A 3PH0A 3SFEC 2GUVA 1OVVA 3V4QA 2AXCA 1SQXE 2O1KA 2QIWA 4R4LA 1RF0C 1VQOP 3CWBE 3H1IJ 1YTZT 1IO4A 4N6JA 1NKZB 4UB8H 3RL0C 3A0BE 3O8ZA 1SQBJ 1KD1Q 4OGQB 3L74G 3CPWO 2ZXEB 1FZBA 2AXTE 4U3FD 1P84H 1GDTA 5KJ7C 4EYYQ 3Q5SA 2E75D 4C46A 3PRJA 2BASA 1DH3A 1T8ZA 2B87A 2QRXA 3O6QA 4MN4C 3H1HD 1HGVA 1LJ2A 1H89A 4JQ0D 1U7MA 1URQD 1KB9I 1VQMP 4U3FJ 3HUSB 4JF7A 3Q5RA 3B71A 2ZYGA 1QVFO 1VQ7P 2H88C 3L37A 3GF3A 1FZCA 3AEAC 3H1HJ 2K37A 2BCCJ 3CC2P 3CX5H 5KLVE 1HJBA 1FE6A 1VF5D 1M57D 3CWBG 3GLMA 1OW7A 3V2NA 3OJAB 4O9BA 1PP9E 3WUTA 5GTHH 3VOPA 4H0LD 5DJTB 3B5NC 1NTZD 2Q5UA 1PPJE 1IFJA 1MFTA 3JSVC 4PD4H 2FYUG 1URQA 3EWKA 1LWUA 5AVYB 3TK1A 1FU1A 1RH5B 2QM8A 3VP8A 3RK2C 5CMZA 1FDIA 1W5CE 1NU1D 2KNCA 4IOIH 3CXHI 1NTZJ 4M3LA 2HR3A 1LTTC 1LT1A 2RKLA 1FZAA 1G1JA 3BATA 2OYHA 1U57A 2PRRA 3NMDA 2E74B 2WVRA 2FFDC 3F5HA 3V6IA 1NTKD 2FY8A 2YO2A 5B66E 5KLVG 2W6JH 1PGPA 4UB6H 1PP9G 4N3YB 4ZKPA 4IFDK 3NTNA 1SFCD 4HB1A 3RK3B 5KTBA 1T3UA 2P2UA 3OW2O 1A02J 1PPJG 3HD7B 1L0NE 2CPSA 5C39A 1K73Q 1LP1A 1OXZA 5CCGC 2P10A 3GHGB 1PGOA 1IC2A 1LTJA 2O3JA 4BRYB 1KZUB 3KZIH 1RF1A 1BCCD 2A45H 3KXDA 2W6BA 4UB8E 1GW3A 4JYBA 4C7NB 2P1JA 4ZMDA 2G8YA 2M3BA 3RGUA 1N7SD 3IFMA 3L70E 4OGQC 2N9BA 3CI9A 3CCVP 1P84E 2KZIA 3VP9A 2JP3A 3A3YB 1ZR2A 4WWIA 2YMYA 1SFCA 2H8PD 1NGMB 1GU4A 1BCCJ 2XV5A 3L74D 3ABVC 3AECC 1ZW0A 3OAKA 2GA1A 2C0WA 3F89A 1X9VA 3HUSC 3D70A 2Q9IA 1GMJA 3AE6C 1HWTC 4D6TD 4WVZA 2IYOA 2WQYC 3SFDC 2H43A 2HG5D 1EDJA 3QH9A 1AJYA 3CX5E 3L74J 1JY3O 1N7SA 3H1LD 1GU5A 5GTHE 1CI6A 3BCCE 3RBZA 1LGHB 3TYYA 1JM0A 1NAYA 2FXPA 3MUDA 5AW1B 2QG4A 3TGUE 1DEBA 3L70G 2R3CA 2KS1B 1SQXD 1LT9B 2P58A 5CBOA 2M5AA 4PD4E 5EFWB 3CWBD 3O6QB 2PP6A 1NTMG 1SQPK 2LR2A 2IX7C 1N73A 2YMKA 1X0TA 1NYHA 1OZHA 2ZVNB 1OVUA 5APYA 3HE4A 1L2PA 2QE7H 4DZOA 2PFXA 3CWBJ 1VQ5P 3HE5A 1L4AB 2R5BA 4R4MA 1EDLA 2E74C 3V2QA 3AE9C 1JB0J 1USEA 3PTZA 1PGQA 5AW3B 2IFMA 4UB6E 2OTJP 3CCSP 2KUBA 2E75B 3VTPC 4Y28J 5AW4B 3BCCG 2YXRB 2Q3EA 3FGAD 1KB9H 3RK3C 2FYUJ 3B8EB 1W2EA 1S3JA 3TGUG 4W7ZA 3HD7C 1EZVE 1HBWA 1JNMA 1FZGA 2XZRA 1URQB 5KLVD 3SWYA 1LWUB 1RQVA 1AV1A 3P7KA 1PP9D 2Q7CA 1KTMA 3KZIE 3GHGC 3P32A 2ZVOB 2FKWB 2KK7A 1PPJD 4KJMA 4WY4D 2D2CB 2N1TD 2UWJE 3E1RA 2ZYAA 4H44B 2NPSB 3II6A 3H1KE 1N2DC 1Q90D 1BE3E 2WWWA 3T97B 1PP9J 3CC7P 4H0LB 1SQQJ 4XE5B 1VPCA 2K1AA 3L73E 4L74A 3S4RA 1YI2P 1IFMA 1YQ3C 3P8CE 3CCUP 2RMZA 2BEZF 2HODB 2WPRA 1SQVJ 3CCJP 1JMBA 1LP1B 1EZVG 4I2LC 4JBZA 2W83C 1FJKA 2IFNA 3N7NA 1EC5A 4ZKUA 4WY4A 3M0DC 2N1TA 1NU1G 3CL3D 5KLIB 1HTLC 1G2CA 3JCUH 2E76D 1L0ND 2JWAA 3TNUA 3M9QA 4C7RA 1BE3G 2WSEJ 1NTKG 4W7YA 3VN0A 1LT9C 1KQFB 3AEBC 1H0TA 3BRVB 1L0LK 1BSNA 2AEMA 2IBZE 3N4XA 1JTHB 3L70D 3L73G 2V7QJ 1M90Q 1P84D 3CD6P 1VL2A 1GL2B 3LIEA 3H6PA 3L36A 1KV4A 5AW0B 2V4HA 1SLQA 2K9JB 3M91A 2WSCH 1L4AC 2XU6A 1SQPE 1HGZA 3FWNA 3L70J 3CCLP 2WSFH 2QJPB 2E75C 1KB9E 2OYIA 2I1JA 1CSBA 1LNQA 1KMIZ 1NTMJ 1FDMA 3AEEC 2KZJA 2OYOA 2M5AB 3CX5D 5E79H 1HF9A 1EQ7A 1URQC 1LWUC 1MKMA 1KILB 1WT6A 3BCCD 1HH0A 2IBZG 3LW5H 3W67A 1S5LH 3TGUD 1BGYE 4ASVA 2D2CC 4H44C 4PD4D 1VQKP 3L72E 2NPSC 1SQBK 1GW4A 5AVRB 4D6TG 4L75A 3H32A 3CMEP 5AVWB 3BCCJ 4H0LC 1ZXGA 3H1LG 2H89C 1SQPG 4KHXA 1Y47A 2E43A 5APUA 3USSA 1RE3C 3RL0D 1SQXG 4NPEA 1NH4A 3AE3C 4EI2A 4AYCA 2JO1A 1MV8A 3H1JE 2QA4P 2QM7A 2RN0A 5KLIC 1BGYG 2XNXA 3JCUE 1NHLA 1EZVD 3WUUA 4I1LA 2YO3A 2IDBA 3M0AA 1RHZB 1JY2P 1N86A 1FOSE 3GF7A 1HUCA 4N78E 1NAFA 2E5YA 4H13B 1X79B 4OWFA 3H1KD 2XKMA 1FOSF 3VMAA 1ZMEC 1BE3D 1NTZK 3B5ND 1GL2C 4GDOA 1NU1J 1T2KC 1RE4C 1S2EA 1JCCA 3H1JG 4BXLA 1L0LE 3L73D 1IFNA 1OWAA 3P8CD 4A7PA 3CCRP 2KLUA 2QJPC 1NTKJ 3MUDC 3KPEA 3RBXA 2NRGA 3TNUB 2O01N 3G9RA 5E79E 4PV1B 3BRTB 1DD3A 3L73J 1MFZA 3AE1C 1KILC 2C9LY 2YXQB 1IFIA 3AEFC 3B5NA 3FX0A 1S5LE 4DJGA 2FYNB 5CBNA 1VQLP 2FYZA 2WPQA 1J1DB 4ZNCA 1VQ8P 1Y9BA 2AEJA 1KYOI 3VYIA 2IBZD 1DIPA 2E76B 1WMKA 5CCGD 1L0LG 2HYNA 4GIFA 1FBMA 2OYIB 1L0NG 3MZWB 3EQ2A 1AFOA 1SQBE 1S4XA 2FFDA 4WBAA 1NO4A 1OW6A 1SQPD 1N7LA 3KYQA 4WB4A 1FJPA 4LC1A 2K3RA 1IZNB 3MHVA 1KB9D 4L76A 1LTSC 4D6TJ 1P84I 4IL6H 2L5GB 1K9MQ 2B87B 1MZ9A 5AW5B 3E7KA 5CCGA 3H1LJ 3IF4A 2K9YA 3H32B 3WMM0 2Y0EA 4BWNA 1DD4A 1BGYD 2BCCE 1SQXJ 4HH2A 3AE8C 4NPFX 4AUWA 4H13C 2POHA 3L72D 1Q7YQ 2KIKA
chains in the Genus database with same CATH topology
1H89A 2HPCA 5CHXA 1FZCB 1HTLC 1URQD 1G2CA 3IR9A 1NTKK 3PP5A 1HVVA 3M9BA 1GL2D 3HUSB 4JF7A 1N73C 2GM4A 3TNUA 4EOTA 3M9QA 4C7RA 1T2KD 1PFIA 1MUUA 4W7YA 3VN0A 1LT9C 4RESB 3NFQA 3L37A 1YYCA 3G3ZA 1FZCA 3BRVB 1L0LK 3MTUE 1HJBA 3N4XA 1JO5A 1AQ5A 1RY3A 3HUSA 1JCDA 3V2NA 1JTHB 3OJAB 4O9BA 3V5BA 1E5WA 1ZN5A 4JYCA 4Y99B 3VOPA 3B5NC 1GL2B 3LIEA 3H6PA 2FYUK 3L36A 2Q5UA 5AW0B 1SLQA 3C9IA 1IFJA 3HRNA 3M91A 2KOGA 2WSCH 1L4AC 3CLQA 1JTHA 2OARA 1URQA 2XU6A 1LWUA 5AVYB 2OYHB 3TK1A 1HGZA 1KILD 2YNYA 1FU1A 4XA4A 5AVTB 2QM8A 3VP8A 1GL2A 2WSFH 3MIWA 3RK2C 5CMZA 3HTKB 1J2JB 1IFDA 5CCHC 1RE4A 2C0XA 3TSIA 2OYIA 2I1JA 1CSBA 2KSJA 4M3LA 2Z4EA 1J1DC 5APVA 5BU5A 1LTTC 1FDMA 2Z5IA 4N78D 3VMYA 3U1AA 3V2PA 1FZAA 1G1JA 1H88A 1M1JB 3BATA 2OYHA 1J1EB 1EQ7A 1URQC 1LTAC 3NMDA 2WT7A 1LWUC 2FFDC 1LTGC 1KILB 1WT6A 1SQQK 1SVFA 2P67A 2YO2A 4AQRD 4B86A 1HH0A 1GK6A 1A02F 3LW5H 4IFMA 1JY2O 1G1IA 2H7HA 2KLVA 1JOCA 3I5CA 2OYIC 4N3YB 1IK9A 4ZKPA 4IFDK 3M9HA 3NTNA 1SFCD 1LTJB 3RK3B 5KTBA 1T3UA 2LKMA 2P2UA 1RF1B 2NPSC 4I6MC 1SQBK 1GW4A 1A02J 5AVRB 3VMXA 3HD7B 1KILA 2A45G 5AVUB 1SQVK 1SP4A 1XTGB 2CPSA 3H32A 5AVWB 1OXZA 2R32A 5CCGC 5APSA 2XDJA 1M7LA 3GHGB 1IC2A 5APTA 1LTJA 2P7JA 4KHXA 2M8RA 5AW2B 1KZUB 3LIDA 1SQXK 3V4WA 3M06A 1RF1A 2CPBA 3P8MC 2E43A 2A45H 5APUA 1SFCB 3A5TA 3A7OA 2W6BA 4WY4C 2N1TC 1GW3A 4JYBA 4C7NB 1LTIC 2P1JA 1RE3C 3L4FA 5AVVB 3RL0D 2M3BA 1N7SD 1IJDB 3IFMA 2N9BA 3CI9A 5CJ0A 1NH4A 3GHGA 4LLHA 4AYCA 3VP9A 2ZFCA 1CZQA 1MV8A 5APWA 3A3YB 5BVZA 1ZR2A 1WRGA 2YMYA 1SFCA 1GTWA 2H8PD 2KB7P 4C7NA 1GU4A 2XV5A 2QM7A 3V2RA 3E1IA 1ZV8A 3U59A 2C9NY 4GKGA 2XNXA 4DOJA 1GZLA 1NHLA 1FZCC 3RL0B 2R5DA 1KFMA 2YKOA 3OAKA 5AVQB 4I1LA 5APXA 2C0WA 1N7SB 2YO3A 3M0AA 1GD2E 1DX7A 1X9VA 1JY2P 3HUSC 1CI6B 1S9KD 1N86A 2J58A 4LGDE 1FOSE 2Q9IA 2WSEH 3EFGA 1HWTC 5CJ4A 1HUCA 4N78E 3L35A 2H43A 2HG5D 3RK3D 5AW7B 1JY2N 2Z5HA 1XTCC 1NAFA 1JY3O 1N7SA 3HD7D 1LTBC 1X79B 1GU5A 5KLVK 2O01H 1CI6A 2XKMA 1FOSF 3HTKA 1LGHB 1NWQA 3TYYA 1NTZK 4Y99C 2PAJA 3MUDA 1CW5A 3B5ND 5AW1B 1N73B 1GL2C 3M0DA 1DEBA 1NTMK 2R3CA 1T2KC 1RE4C 1ZLLA 4OH8B 2Q3IA 1LT9B 3MGNA 3HE4B 2VRSA 1M1JA 2IPPA 1JCCA 4GT1A 2HFED 1L4AD 2PP6A 1H8AA 1IFNA 1Z56A 1OWAA 2OYHC 3P8CD 1SQPK 2J59M 1X8YA 2IX7C 3BASA 1N73A 2HPCB 3HE5B 2A45I 2FXMA 4HYTB 5CCHD 5APYA 4W80A 1LT9A 3B5NB 3KPEA 1QL2A 3HE4A 3TNUB 3BVHA 1QL1A 4DZOA 1KQLA 1M1JC 5AW9B 1J1EC 3HD7A 3BRTB 2WPSA 3HE5A 1L4AB 2I1KA 1MFZA 1FZEA 2R5BA 3MD0A 3V2QA 3A2AA 3R2PA 1KILC 2C9LY 5AW3B 1IFIA 3B5NA 1JUNA 2IFMA 3RK2B 1YTZI 5KJ7D 3VTPC 5AW4B 2FYZA 5APQA 4EIJA 2WPQA 3NXSA 3UIAA 1J1DB 1LTJC 2HLOA 2O1JA 2W27A 3RK3C 3B8EB 1L4AA 1W2EA 1JY3P 2NPSD 1RF1C 4W7ZA 1NOHA 3HD7C 5AVXB 1ZR4A 1HBWA 1JNMA 1FZGA 1NKNA 2XZRA 3KQGA 1URQB 3VYIA 5AW8B 1L0NK 1LWUB 3SWYA 2WITA 3P7KA 2FFDB 5CCGD 1S9KE 5CCHA 2HYNA 4GIFA 2Q7CA 1JY3N 2WTYA 2GUSA 3GHGC 1VDFA 3P32A 1FBMA 5BU8B 2OYIB 2FKWB 1RF0A 4IFFA 1SFCC 4WY4D 2N1TD 3EQ2A 5AVZB 1AFOA 2NPSB 3II6A 1KFNA 1T3JA 5AVSB 2FFDA 3VMZA 4WBAA 1N2DC 1NO4A 1FZFA 1N7LA 3OA7A 3KYQA 2WT7B 4WB4A 2E42A 2WWWA 2JEEA 5KJ7A 1FJPA 2GUVA 4LC1A 3V4QA 2YKPA 5AW6B 4XE5B 1GK4A 1VPCA 3SWFA 1LTSC 2JJLA 2O1KA 2NPSA 2KYVA 1RF0C 1YTZT 2L5GB 1FAVA 4WY4B 2N1TB 1IFMA 1IO4A 4N6JA 1MZ9A 3P8CE 1NKZB 1JMMA 3T97A 3RL0C 5AW5B 3O8ZA 5CCGA 1N7SC 2HODB 2MJZA 2ZXEB 3H32B 2WPRA 1FZBA 1NU1K 2YKQA 2KP8A 3RK2D 4I2LC 1G2CB 3WMM0 1GDTA 1FJKA 5KJ7C 3U1CA 4C46A 2IFNA 3N7NA 2WZ7A 4ZKUA 4WY4A 3M0DC 2BASA 2N1TA 2W6AA 1DH3A 3KDPB 1T8ZA 1RE3A 3CL3D 4HH2A 4AUWA 2HODA 2POHA 1HGVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NPS D;  4W7Z A;  1URQ D;  4N78 E;  3HD7 C;  2HG5 D;  3PP5 A;  3RK3 D;  1HVV A;  1GL2 D;  4JF7 A;  1URQ B;  1SFC D;  1N7S A;  5CCG D;  3HD7 D;  3RK3 B;  5CCH A;  2NPS C;  4W7Y A;  3HD7 B;  1KIL A;  3B5N D;  1XTG B;  1GL2 C;  1SFC C;  4WY4 D;  2N1T D;  5CCG C;  2XDJ A;  4OH8 B;  2NPS B;  1JTH B;  1T3J A;  2M8R A;  3VOP A;  2HFE D;  1L4A D;  2PP6 A;  3B5N C;  1GL2 B;  3KYQ A;  1SFC B;  4WY4 C;  2N1T C;  5KJ7 A;  3RL0 D;  2KOG A;  1N7S D;  5CCH D;  1L4A C;  2NPS A;  4W80 A;  1JTH A;  3B5N B;  1URQ A;  1KIL D;  4WY4 B;  2N1T B;  3P8C E;  1GL2 A;  2YMY A;  3RK2 C;  3RL0 C;  1SFC A;  3HTK B;  5CCG A;  3HD7 A;  2H8P D;  1N7S C;  5CCH C;  1L4A B;  3TSI A;  3RK2 D;  1KIL C;  5KJ7 C;  3B5N A;  1NHL A;  2WZ7 A;  3RK2 B;  3RL0 B;  4WY4 A;  3M0D C;  2N1T A;  1N7S B;  5KJ7 D;  1URQ C;  4LGD E;  1KIL B;  3RK3 C;  1L4A A; 
#chains in the Genus database with same CATH topology
 5CHX A;  1FZC B;  3QWO C;  1SQB G;  3L75 E;  3M9B A;  3CCQ P;  1YBK A;  2GM4 A;  3CX5 I;  2M3E A;  1IFP A;  4EOT A;  2W90 A;  1PFI A;  1MUU A;  2MKV A;  3ITK A;  3NFQ A;  1YYC A;  1USD A;  1Q81 Q;  5B5E H;  2O01 J;  1JO5 A;  3HUS A;  1TU3 F;  2OTL P;  1JCD A;  1KC8 Q;  1E5W A;  1ZN5 A;  1NVO A;  4Y99 B;  4PD4 I;  3JC2 2;  1QGK B;  1VQ4 P;  2FYU K;  2IYP A;  2ZT9 D;  3H1J D;  1X22 A;  2KNC B;  3L71 E;  3HRN A;  4PV1 C;  2AEF A;  4HKZ H;  3SSU A;  2E74 D;  2OYH B;  2BCC G;  4XA4 A;  3IN6 A;  1VF5 B;  3MIW A;  5KLV J;  2FYN C;  5CCH C;  1EXJ A;  2C0X A;  1R5S A;  3H1J J;  4HJG H;  4I7Z B;  1J1D C;  1FS0 E;  3L75 G;  5BU5 A;  4N78 D;  3U1A A;  3V2P A;  1H88 A;  1J1E B;  2RH0 A;  3TF5 A;  1U7J A;  1QX8 A;  3CXH H;  1BDD A;  2WT7 A;  4QMA A;  2E76 C;  3TDK A;  1SQQ K;  2PGD A;  2B88 A;  4YXW H;  4AQR D;  1A02 F;  4IFM A;  1N8R Q;  2H7H A;  1BDC A;  3W68 A;  3C1L A;  3I5C A;  2OYI C;  1EZV I;  1YQ4 C;  1LTJ B;  1DEE G;  2LKM A;  2Q6Q A;  1RF1 B;  4TLF A;  3VMX A;  2A06 E;  2A45 G;  1L0L D;  3L71 G;  2M0B A;  1SQV K;  1SP4 A;  1OW8 A;  1XTG B;  1KOR A;  2YIU B;  1VQN P;  1PGJ A;  5APS A;  2XDJ A;  3H1K G;  2P7J A;  3LID A;  4IL6 E;  2SPZ A;  1OMI A;  2R44 A;  3M06 A;  2CPB A;  3P8M C;  1SFC B;  2LXB A;  3A5T A;  3A7O A;  1S5L X;  4YXD C;  1LTI C;  2Y9Y A;  3CC4 P;  2ZXX A;  1ZRT E;  1IJD B;  5CJ0 A;  2WSF J;  3GHG A;  1R8E A;  3FXD A;  1L0N J;  4Z1M H;  3D6Z A;  1CZQ A;  2KXP B;  2JWD A;  2BEQ D;  4C7N A;  5TIS H;  2WSS H;  3V2R A;  3E1I A;  3U59 A;  4K3A A;  2E5T A;  4GKG A;  1KIL E;  1FZC C;  3AE7 C;  2R5D A;  1KFM A;  5L8R J;  1N7S B;  1GD2 E;  1YJW P;  1RQU A;  3AED C;  1DX7 A;  4YTP C;  1CI6 B;  2A06 G;  2ZYD A;  4TT3 H;  2WSE H;  1KYO H;  3L35 A;  5KAF H;  5B5E E;  1JY2 N;  2Z5H A;  5M1B A;  1XTC C;  1SQB D;  3AE4 C;  1LTB C;  4K35 A;  2I8D A;  2V7Q H;  3HTK A;  4Y99 C;  3GG2 A;  2PAJ A;  1N73 B;  5H2F H;  3M0D A;  1NTM K;  4OH8 B;  2IBZ I;  4PJ0 H;  3HE4 B;  1M1J A;  2DW3 A;  2QSI A;  2IPP A;  1FC2 C;  2HFE D;  1L4A D;  3D71 A;  1Z56 A;  2OYH C;  2J59 M;  1Q2N A;  1VF5 C;  3HE5 B;  2FXM A;  2KS1 A;  4W80 A;  1LT9 A;  2Y0D A;  2FYU E;  1OFC X;  3Q1M A;  4GOD A;  4I7Z C;  3BVH A;  1QL1 A;  3TGU J;  1KQL A;  1AVY A;  2BCC D;  5AW9 B;  1J1E C;  3CXH E;  2WPS A;  3MD0 A;  3A2A A;  1QEX A;  3G6E P;  1KQS O;  3L75 D;  5KJ7 D;  3S9O A;  3H25 A;  2OGU A;  4EIJ A;  1LTJ C;  2D2C D;  1K8A Q;  2HLO A;  2O1J A;  4RJT A;  1L4A A;  4H44 D;  1JY3 P;  2NPS D;  1RF1 C;  1NOH A;  2QVA A;  1KQG B;  4CPG A;  5KAI H;  1EXI A;  1NKN A;  3KQG A;  5AW8 B;  2WIT A;  3R4Y A;  2YIU C;  1SQQ E;  3AEG C;  1S9K E;  4ASW A;  3Q5P A;  3L72 G;  3PHL A;  3L75 J;  1Y8A A;  2B89 A;  1VDF A;  5BU8 B;  1RF0 A;  3RK3 E;  4DT0 A;  3L71 D;  1YIJ P;  1SFC C;  4OVN F;  1S72 P;  5AVZ B;  1KFN A;  1T3J A;  5AVS B;  2JDI H;  1SQV E;  1FZF A;  3OA7 A;  2WT7 B;  3CMA P;  2JEE A;  5KJ7 A;  2YKP A;  5AW6 B;  5TIS E;  1T6A A;  2ZT9 B;  1GK4 A;  3SWF A;  2JJL A;  1UIX A;  2NPS A;  2KYV A;  3L71 J;  1FAV A;  3K5B A;  4WY4 B;  2N1T B;  1M8O B;  1JMM A;  3T97 A;  3WU2 H;  1N7S C;  2MJZ A;  3H1K J;  1NU1 K;  2YKQ A;  2KP8 A;  3RK2 D;  1KYO E;  1G2C B;  1BE3 J;  3G71 P;  3U1C A;  5KAF E;  2WZ7 A;  1SQQ G;  2W6A A;  3SWK A;  3KDP B;  1RE3 A;  3A0H H;  1OX3 A;  2OTK E;  2HOD A;  1H0T B;  2HPC A;  4IL6 X;  2A06 D;  3FWL A;  1VQ6 P;  1HJ0 A;  3AE2 C;  1M1K Q;  3IR9 A;  1NTK K;  1JEK A;  3PP5 A;  5H2F E;  1HVV A;  4U7J A;  1GL2 D;  1N73 C;  4RO0 A;  1SQV G;  4PJ0 E;  4RKU J;  2KI7 B;  1T2K D;  1PL5 A;  4RES B;  2IZ1 A;  2QJY B;  3G3Z A;  5GTI H;  3IAO A;  2FBW C;  3MTU E;  4XFJ A;  1PV3 A;  1AQ5 A;  1E79 H;  1RY3 A;  2CK3 H;  1ZRT D;  3V5B A;  3KHU A;  1YJ9 P;  4JYC A;  1NTM E;  2IZ0 A;  3C9I A;  3H1I E;  2WMM A;  1OVR A;  2KOG A;  3CCE P;  2QEX P;  4KT0 J;  3CLQ A;  1JTH A;  1ZP0 C;  2OAR A;  3PJS K;  3D6Y A;  5K5G B;  2YNY A;  1KIL D;  4OGQ D;  5AVT B;  1K04 A;  1GL2 A;  2ZAE B;  3HTK B;  3MP7 B;  1J2J B;  1IFD A;  1R5L A;  1RE4 A;  3TSI A;  2K9J A;  2KSJ A;  1S1C X;  2Z4E A;  2QJK B;  5APV A;  1D7M A;  2Z5I A;  3VMY A;  1NJI Q;  5KAI E;  1M1J B;  4DCK A;  2ZJS E;  1LTA C;  1FDO A;  5KKZ B;  1LTG C;  4U3F E;  3I56 P;  1SVF A;  1SQP J;  2P67 A;  1UII A;  4B86 A;  1GK6 A;  1JY2 O;  1G1I A;  2K88 A;  2KLV A;  1JOC A;  1IK9 A;  3G4S P;  3M9H A;  3H1H E;  4I6M C;  4GOE A;  1KIL A;  2NZ2 A;  3H1I G;  5AVU B;  2W8Z A;  1M56 D;  2R32 A;  1ZOY C;  2LXC B;  1YIT P;  2L91 A;  1M7L A;  5APT A;  2M8R A;  2ZT9 C;  5AW2 B;  3Q3D A;  1SQX K;  2FYU D;  3V4W A;  1PIX A;  2B9B A;  1BGY J;  4WY4 C;  2N1T C;  3GW6 A;  1VQ9 P;  1AA0 A;  3PLN A;  3CXH D;  3WU2 E;  3L4F A;  5AVV B;  3AE5 C;  3I55 P;  3L72 J;  1W2B O;  1SS1 A;  4LLH A;  1NTZ E;  2ZFC A;  5APW A;  5BVZ A;  1WRG A;  3A0H E;  1GTW A;  4U3F G;  1IK7 A;  2KB7 P;  2XND H;  1EDI A;  2JR8 A;  2ITA A;  5DJU B;  1ZV8 A;  4H13 D;  1K05 A;  2C9N Y;  1Q82 Q;  4DOJ A;  1GZL A;  3RL0 B;  3Q2Y A;  2YKO A;  5AVQ B;  3H1H G;  5APX A;  1VQP P;  3A0B H;  1NU1 E;  1SQQ D;  1S9K D;  2J58 A;  4LGD E;  2AXT H;  3EFG A;  5CJ4 A;  2WPV B;  2QJY C;  5GTI E;  3RK3 D;  5AW7 B;  3HD7 D;  1AQT A;  5KLV K;  2O01 H;  3ZDM A;  1SQV D;  1NTK E;  1NWQ A;  2Y0C A;  2OQQ A;  1CW5 A;  2Y9Z A;  1AVO A;  1Q86 Q;  1ZLL A;  2Q3I A;  4PV1 D;  3MGN A;  1NTZ G;  2VRS A;  5TJH A;  4GT1 A;  3C8V A;  3EFF K;  1H8A A;  1X8Y A;  1YHQ P;  3BAS A;  2HPC B;  2A45 I;  1QVG O;  3RL0 g;  4HYT B;  5CCH D;  2J5U A;  1KYO D;  3B5N B;  1QL2 A;  1BCC E;  2QJK C;  4YPC A;  4NPD A;  2N9Y B;  1M1J C;  3HD7 A;  2WSC J;  2FXO A;  1OIP A;  2I1K A;  1FZE A;  5KKZ C;  1L0L J;  1KN7 A;  3R2P A;  2G3A A;  1QLE D;  3B4S A;  3WUV A;  1JUN A;  3RK2 B;  2R3S A;  4BRY A;  1PZQ A;  1YTZ I;  4GOF A;  5APQ A;  3NXS A;  3UIA A;  2W27 A;  3L74 E;  2KSE A;  1BSH A;  3GMA A;  4L73 A;  5AVX B;  4EDF A;  1ZR4 A;  1EDK A;  1L0N K;  3S1K A;  2FFD B;  3CCM P;  5CCH A;  1JY3 N;  2WTY A;  2GUS A;  3LW5 J;  4D6T E;  2JKV A;  5B66 H;  1NTM D;  4IFF A;  1YJN P;  4JPZ B;  3H1I D;  2Q1K A;  3FXE A;  3H1L E;  1BCC G;  3VMZ A;  2E42 A;  3PH0 A;  3SFE C;  2GUV A;  1OVV A;  3V4Q A;  2AXC A;  1SQX E;  2O1K A;  2QIW A;  4R4L A;  1RF0 C;  1VQO P;  3CWB E;  3H1I J;  1YTZ T;  1IO4 A;  4N6J A;  1NKZ B;  4UB8 H;  3RL0 C;  3A0B E;  3O8Z A;  1SQB J;  1KD1 Q;  4OGQ B;  3L74 G;  3CPW O;  2ZXE B;  1FZB A;  2AXT E;  4U3F D;  1P84 H;  1GDT A;  5KJ7 C;  4EYY Q;  3Q5S A;  2E75 D;  4C46 A;  3PRJ A;  2BAS A;  1DH3 A;  1T8Z A;  2B87 A;  2QRX A;  3O6Q A;  4MN4 C;  3H1H D;  1HGV A;  1LJ2 A;  1H89 A;  4JQ0 D;  1U7M A;  1URQ D;  1KB9 I;  1VQM P;  4U3F J;  3HUS B;  4JF7 A;  3Q5R A;  3B71 A;  2ZYG A;  1QVF O;  1VQ7 P;  2H88 C;  3L37 A;  3GF3 A;  1FZC A;  3AEA C;  3H1H J;  2K37 A;  2BCC J;  3CC2 P;  3CX5 H;  5KLV E;  1HJB A;  1FE6 A;  1VF5 D;  1M57 D;  3CWB G;  3GLM A;  1OW7 A;  3V2N A;  3OJA B;  4O9B A;  1PP9 E;  3WUT A;  5GTH H;  3VOP A;  4H0L D;  5DJT B;  3B5N C;  1NTZ D;  2Q5U A;  1PPJ E;  1IFJ A;  1MFT A;  3JSV C;  4PD4 H;  2FYU G;  1URQ A;  3EWK A;  1LWU A;  5AVY B;  3TK1 A;  1FU1 A;  1RH5 B;  2QM8 A;  3VP8 A;  3RK2 C;  5CMZ A;  1FDI A;  1W5C E;  1NU1 D;  2KNC A;  4IOI H;  3CXH I;  1NTZ J;  4M3L A;  2HR3 A;  1LTT C;  1LT1 A;  2RKL A;  1FZA A;  1G1J A;  3BAT A;  2OYH A;  1U57 A;  2PRR A;  3NMD A;  2E74 B;  2WVR A;  2FFD C;  3F5H A;  3V6I A;  1NTK D;  2FY8 A;  2YO2 A;  5B66 E;  5KLV G;  2W6J H;  1PGP A;  4UB6 H;  1PP9 G;  4N3Y B;  4ZKP A;  4IFD K;  3NTN A;  1SFC D;  4HB1 A;  3RK3 B;  5KTB A;  1T3U A;  2P2U A;  3OW2 O;  1A02 J;  1PPJ G;  3HD7 B;  1L0N E;  2CPS A;  5C39 A;  1K73 Q;  1LP1 A;  1OXZ A;  5CCG C;  2P10 A;  3GHG B;  1PGO A;  1IC2 A;  1LTJ A;  2O3J A;  4BRY B;  1KZU B;  3KZI H;  1RF1 A;  1BCC D;  2A45 H;  3KXD A;  2W6B A;  4UB8 E;  1GW3 A;  4JYB A;  4C7N B;  2P1J A;  4ZMD A;  2G8Y A;  2M3B A;  3RGU A;  1N7S D;  3IFM A;  3L70 E;  4OGQ C;  2N9B A;  3CI9 A;  3CCV P;  1P84 E;  2KZI A;  3VP9 A;  2JP3 A;  3A3Y B;  1ZR2 A;  4WWI A;  2YMY A;  1SFC A;  2H8P D;  1NGM B;  1GU4 A;  1BCC J;  2XV5 A;  3L74 D;  3ABV C;  3AEC C;  1ZW0 A;  3OAK A;  2GA1 A;  2C0W A;  3F89 A;  1X9V A;  3HUS C;  3D70 A;  2Q9I A;  1GMJ A;  3AE6 C;  1HWT C;  4D6T D;  4WVZ A;  2IYO A;  2WQY C;  3SFD C;  2H43 A;  2HG5 D;  1EDJ A;  3QH9 A;  1AJY A;  3CX5 E;  3L74 J;  1JY3 O;  1N7S A;  3H1L D;  1GU5 A;  5GTH E;  1CI6 A;  3BCC E;  3RBZ A;  1LGH B;  3TYY A;  1JM0 A;  1NAY A;  2FXP A;  3MUD A;  5AW1 B;  2QG4 A;  3TGU E;  1DEB A;  3L70 G;  2R3C A;  2KS1 B;  1SQX D;  1LT9 B;  2P58 A;  5CBO A;  2M5A A;  4PD4 E;  5EFW B;  3CWB D;  3O6Q B;  2PP6 A;  1NTM G;  1SQP K;  2LR2 A;  2IX7 C;  1N73 A;  2YMK A;  1X0T A;  1NYH A;  1OZH A;  2ZVN B;  1OVU A;  5APY A;  3HE4 A;  1L2P A;  2QE7 H;  4DZO A;  2PFX A;  3CWB J;  1VQ5 P;  3HE5 A;  1L4A B;  2R5B A;  4R4M A;  1EDL A;  2E74 C;  3V2Q A;  3AE9 C;  1JB0 J;  1USE A;  3PTZ A;  1PGQ A;  5AW3 B;  2IFM A;  4UB6 E;  2OTJ P;  3CCS P;  2KUB A;  2E75 B;  3VTP C;  4Y28 J;  5AW4 B;  3BCC G;  2YXR B;  2Q3E A;  3FGA D;  1KB9 H;  3RK3 C;  2FYU J;  3B8E B;  1W2E A;  1S3J A;  3TGU G;  4W7Z A;  3HD7 C;  1EZV E;  1HBW A;  1JNM A;  1FZG A;  2XZR A;  1URQ B;  5KLV D;  3SWY A;  1LWU B;  1RQV A;  1AV1 A;  3P7K A;  1PP9 D;  2Q7C A;  1KTM A;  3KZI E;  3GHG C;  3P32 A;  2ZVO B;  2FKW B;  2KK7 A;  1PPJ D;  4KJM A;  4WY4 D;  2D2C B;  2N1T D;  2UWJ E;  3E1R A;  2ZYA A;  4H44 B;  2NPS B;  3II6 A;  3H1K E;  1N2D C;  1Q90 D;  1BE3 E;  2WWW A;  3T97 B;  1PP9 J;  3CC7 P;  4H0L B;  1SQQ J;  4XE5 B;  1VPC A;  2K1A A;  3L73 E;  4L74 A;  3S4R A;  1YI2 P;  1IFM A;  1YQ3 C;  3P8C E;  3CCU P;  2RMZ A;  2BEZ F;  2HOD B;  2WPR A;  1SQV J;  3CCJ P;  1JMB A;  1LP1 B;  1EZV G;  4I2L C;  4JBZ A;  2W83 C;  1FJK A;  2IFN A;  3N7N A;  1EC5 A;  4ZKU A;  4WY4 A;  3M0D C;  2N1T A;  1NU1 G;  3CL3 D;  5KLI B;  1HTL C;  1G2C A;  3JCU H;  2E76 D;  1L0N D;  2JWA A;  3TNU A;  3M9Q A;  4C7R A;  1BE3 G;  2WSE J;  1NTK G;  4W7Y A;  3VN0 A;  1LT9 C;  1KQF B;  3AEB C;  1H0T A;  3BRV B;  1L0L K;  1BSN A;  2AEM A;  2IBZ E;  3N4X A;  1JTH B;  3L70 D;  3L73 G;  2V7Q J;  1M90 Q;  1P84 D;  3CD6 P;  1VL2 A;  1GL2 B;  3LIE A;  3H6P A;  3L36 A;  1KV4 A;  5AW0 B;  2V4H A;  1SLQ A;  2K9J B;  3M91 A;  2WSC H;  1L4A C;  2XU6 A;  1SQP E;  1HGZ A;  3FWN A;  3L70 J;  3CCL P;  2WSF H;  2QJP B;  2E75 C;  1KB9 E;  2OYI A;  2I1J A;  1CSB A;  1LNQ A;  1KMI Z;  1NTM J;  1FDM A;  3AEE C;  2KZJ A;  2OYO A;  2M5A B;  3CX5 D;  5E79 H;  1HF9 A;  1EQ7 A;  1URQ C;  1LWU C;  1MKM A;  1KIL B;  1WT6 A;  3BCC D;  1HH0 A;  2IBZ G;  3LW5 H;  3W67 A;  1S5L H;  3TGU D;  1BGY E;  4ASV A;  2D2C C;  4H44 C;  4PD4 D;  1VQK P;  3L72 E;  2NPS C;  1SQB K;  1GW4 A;  5AVR B;  4D6T G;  4L75 A;  3H32 A;  3CME P;  5AVW B;  3BCC J;  4H0L C;  1ZXG A;  3H1L G;  2H89 C;  1SQP G;  4KHX A;  1Y47 A;  2E43 A;  5APU A;  3USS A;  1RE3 C;  3RL0 D;  1SQX G;  4NPE A;  1NH4 A;  3AE3 C;  4EI2 A;  4AYC A;  2JO1 A;  1MV8 A;  3H1J E;  2QA4 P;  2QM7 A;  2RN0 A;  5KLI C;  1BGY G;  2XNX A;  3JCU E;  1NHL A;  1EZV D;  3WUU A;  4I1L A;  2YO3 A;  2IDB A;  3M0A A;  1RHZ B;  1JY2 P;  1N86 A;  1FOS E;  3GF7 A;  1HUC A;  4N78 E;  1NAF A;  2E5Y A;  4H13 B;  1X79 B;  4OWF A;  3H1K D;  2XKM A;  1FOS F;  3VMA A;  1ZME C;  1BE3 D;  1NTZ K;  3B5N D;  1GL2 C;  4GDO A;  1NU1 J;  1T2K C;  1RE4 C;  1S2E A;  1JCC A;  3H1J G;  4BXL A;  1L0L E;  3L73 D;  1IFN A;  1OWA A;  3P8C D;  4A7P A;  3CCR P;  2KLU A;  2QJP C;  1NTK J;  3MUD C;  3KPE A;  3RBX A;  2NRG A;  3TNU B;  2O01 N;  3G9R A;  5E79 E;  4PV1 B;  3BRT B;  1DD3 A;  3L73 J;  1MFZ A;  3AE1 C;  1KIL C;  2C9L Y;  2YXQ B;  1IFI A;  3AEF C;  3B5N A;  3FX0 A;  1S5L E;  4DJG A;  2FYN B;  5CBN A;  1VQL P;  2FYZ A;  2WPQ A;  1J1D B;  4ZNC A;  1VQ8 P;  1Y9B A;  2AEJ A;  1KYO I;  3VYI A;  2IBZ D;  1DIP A;  2E76 B;  1WMK A;  5CCG D;  1L0L G;  2HYN A;  4GIF A;  1FBM A;  2OYI B;  1L0N G;  3MZW B;  3EQ2 A;  1AFO A;  1SQB E;  1S4X A;  2FFD A;  4WBA A;  1NO4 A;  1OW6 A;  1SQP D;  1N7L A;  3KYQ A;  4WB4 A;  1FJP A;  4LC1 A;  2K3R A;  1IZN B;  3MHV A;  1KB9 D;  4L76 A;  1LTS C;  4D6T J;  1P84 I;  4IL6 H;  2L5G B;  1K9M Q;  2B87 B;  1MZ9 A;  5AW5 B;  3E7K A;  5CCG A;  3H1L J;  3IF4 A;  2K9Y A;  3H32 B;  3WMM 0;  2Y0E A;  4BWN A;  1DD4 A;  1BGY D;  2BCC E;  1SQX J;  4HH2 A;  3AE8 C;  4NPF X;  4AUW A;  4H13 C;  2POH A;  3L72 D;  1Q7Y Q;  2KIK A; 
#chains in the Genus database with same CATH homology
 1H89 A;  2HPC A;  5CHX A;  1FZC B;  1HTL C;  1URQ D;  1G2C A;  3IR9 A;  1NTK K;  3PP5 A;  1HVV A;  3M9B A;  1GL2 D;  3HUS B;  4JF7 A;  1N73 C;  2GM4 A;  3TNU A;  4EOT A;  3M9Q A;  4C7R A;  1T2K D;  1PFI A;  1MUU A;  4W7Y A;  3VN0 A;  1LT9 C;  4RES B;  3NFQ A;  3L37 A;  1YYC A;  3G3Z A;  1FZC A;  3BRV B;  1L0L K;  3MTU E;  1HJB A;  3N4X A;  1JO5 A;  1AQ5 A;  1RY3 A;  3HUS A;  1JCD A;  3V2N A;  1JTH B;  3OJA B;  4O9B A;  3V5B A;  1E5W A;  1ZN5 A;  4JYC A;  4Y99 B;  3VOP A;  3B5N C;  1GL2 B;  3LIE A;  3H6P A;  2FYU K;  3L36 A;  2Q5U A;  5AW0 B;  1SLQ A;  3C9I A;  1IFJ A;  3HRN A;  3M91 A;  2KOG A;  2WSC H;  1L4A C;  3CLQ A;  1JTH A;  2OAR A;  1URQ A;  2XU6 A;  1LWU A;  5AVY B;  2OYH B;  3TK1 A;  1HGZ A;  1KIL D;  2YNY A;  1FU1 A;  4XA4 A;  5AVT B;  2QM8 A;  3VP8 A;  1GL2 A;  2WSF H;  3MIW A;  3RK2 C;  5CMZ A;  3HTK B;  1J2J B;  1IFD A;  5CCH C;  1RE4 A;  2C0X A;  3TSI A;  2OYI A;  2I1J A;  1CSB A;  2KSJ A;  4M3L A;  2Z4E A;  1J1D C;  5APV A;  5BU5 A;  1LTT C;  1FDM A;  2Z5I A;  4N78 D;  3VMY A;  3U1A A;  3V2P A;  1FZA A;  1G1J A;  1H88 A;  1M1J B;  3BAT A;  2OYH A;  1J1E B;  1EQ7 A;  1URQ C;  1LTA C;  3NMD A;  2WT7 A;  1LWU C;  2FFD C;  1LTG C;  1KIL B;  1WT6 A;  1SQQ K;  1SVF A;  2P67 A;  2YO2 A;  4AQR D;  4B86 A;  1HH0 A;  1GK6 A;  1A02 F;  3LW5 H;  4IFM A;  1JY2 O;  1G1I A;  2H7H A;  2KLV A;  1JOC A;  3I5C A;  2OYI C;  4N3Y B;  1IK9 A;  4ZKP A;  4IFD K;  3M9H A;  3NTN A;  1SFC D;  1LTJ B;  3RK3 B;  5KTB A;  1T3U A;  2LKM A;  2P2U A;  1RF1 B;  2NPS C;  4I6M C;  1SQB K;  1GW4 A;  1A02 J;  5AVR B;  3VMX A;  3HD7 B;  1KIL A;  2A45 G;  5AVU B;  1SQV K;  1SP4 A;  1XTG B;  2CPS A;  3H32 A;  5AVW B;  1OXZ A;  2R32 A;  5CCG C;  5APS A;  2XDJ A;  1M7L A;  3GHG B;  1IC2 A;  5APT A;  1LTJ A;  2P7J A;  4KHX A;  2M8R A;  5AW2 B;  1KZU B;  3LID A;  1SQX K;  3V4W A;  3M06 A;  1RF1 A;  2CPB A;  3P8M C;  2E43 A;  2A45 H;  5APU A;  1SFC B;  3A5T A;  3A7O A;  2W6B A;  4WY4 C;  2N1T C;  1GW3 A;  4JYB A;  4C7N B;  1LTI C;  2P1J A;  1RE3 C;  3L4F A;  5AVV B;  3RL0 D;  2M3B A;  1N7S D;  1IJD B;  3IFM A;  2N9B A;  3CI9 A;  5CJ0 A;  1NH4 A;  3GHG A;  4LLH A;  4AYC A;  3VP9 A;  2ZFC A;  1CZQ A;  1MV8 A;  5APW A;  3A3Y B;  5BVZ A;  1ZR2 A;  1WRG A;  2YMY A;  1SFC A;  1GTW A;  2H8P D;  2KB7 P;  4C7N A;  1GU4 A;  2XV5 A;  2QM7 A;  3V2R A;  3E1I A;  1ZV8 A;  3U59 A;  2C9N Y;  4GKG A;  2XNX A;  4DOJ A;  1GZL A;  1NHL A;  1FZC C;  3RL0 B;  2R5D A;  1KFM A;  2YKO A;  3OAK A;  5AVQ B;  4I1L A;  5APX A;  2C0W A;  1N7S B;  2YO3 A;  3M0A A;  1GD2 E;  1DX7 A;  1X9V A;  1JY2 P;  3HUS C;  1CI6 B;  1S9K D;  1N86 A;  2J58 A;  4LGD E;  1FOS E;  2Q9I A;  2WSE H;  3EFG A;  1HWT C;  5CJ4 A;  1HUC A;  4N78 E;  3L35 A;  2H43 A;  2HG5 D;  3RK3 D;  5AW7 B;  1JY2 N;  2Z5H A;  1XTC C;  1NAF A;  1JY3 O;  1N7S A;  3HD7 D;  1LTB C;  1X79 B;  1GU5 A;  5KLV K;  2O01 H;  1CI6 A;  2XKM A;  1FOS F;  3HTK A;  1LGH B;  1NWQ A;  3TYY A;  1NTZ K;  4Y99 C;  2PAJ A;  3MUD A;  1CW5 A;  3B5N D;  5AW1 B;  1N73 B;  1GL2 C;  3M0D A;  1DEB A;  1NTM K;  2R3C A;  1T2K C;  1RE4 C;  1ZLL A;  4OH8 B;  2Q3I A;  1LT9 B;  3MGN A;  3HE4 B;  2VRS A;  1M1J A;  2IPP A;  1JCC A;  4GT1 A;  2HFE D;  1L4A D;  2PP6 A;  1H8A A;  1IFN A;  1Z56 A;  1OWA A;  2OYH C;  3P8C D;  1SQP K;  2J59 M;  1X8Y A;  2IX7 C;  3BAS A;  1N73 A;  2HPC B;  3HE5 B;  2A45 I;  2FXM A;  4HYT B;  5CCH D;  5APY A;  4W80 A;  1LT9 A;  3B5N B;  3KPE A;  1QL2 A;  3HE4 A;  3TNU B;  3BVH A;  1QL1 A;  4DZO A;  1KQL A;  1M1J C;  5AW9 B;  1J1E C;  3HD7 A;  3BRT B;  2WPS A;  3HE5 A;  1L4A B;  2I1K A;  1MFZ A;  1FZE A;  2R5B A;  3MD0 A;  3V2Q A;  3A2A A;  3R2P A;  1KIL C;  2C9L Y;  5AW3 B;  1IFI A;  3B5N A;  1JUN A;  2IFM A;  3RK2 B;  1YTZ I;  5KJ7 D;  3VTP C;  5AW4 B;  2FYZ A;  5APQ A;  4EIJ A;  2WPQ A;  3NXS A;  3UIA A;  1J1D B;  1LTJ C;  2HLO A;  2O1J A;  2W27 A;  3RK3 C;  3B8E B;  1L4A A;  1W2E A;  1JY3 P;  2NPS D;  1RF1 C;  4W7Z A;  1NOH A;  3HD7 C;  5AVX B;  1ZR4 A;  1HBW A;  1JNM A;  1FZG A;  1NKN A;  2XZR A;  3KQG A;  1URQ B;  3VYI A;  5AW8 B;  1L0N K;  1LWU B;  3SWY A;  2WIT A;  3P7K A;  2FFD B;  5CCG D;  1S9K E;  5CCH A;  2HYN A;  4GIF A;  2Q7C A;  1JY3 N;  2WTY A;  2GUS A;  3GHG C;  1VDF A;  3P32 A;  1FBM A;  5BU8 B;  2OYI B;  2FKW B;  1RF0 A;  4IFF A;  1SFC C;  4WY4 D;  2N1T D;  3EQ2 A;  5AVZ B;  1AFO A;  2NPS B;  3II6 A;  1KFN A;  1T3J A;  5AVS B;  2FFD A;  3VMZ A;  4WBA A;  1N2D C;  1NO4 A;  1FZF A;  1N7L A;  3OA7 A;  3KYQ A;  2WT7 B;  4WB4 A;  2E42 A;  2WWW A;  2JEE A;  5KJ7 A;  1FJP A;  2GUV A;  4LC1 A;  3V4Q A;  2YKP A;  5AW6 B;  4XE5 B;  1GK4 A;  1VPC A;  3SWF A;  1LTS C;  2JJL A;  2O1K A;  2NPS A;  2KYV A;  1RF0 C;  1YTZ T;  2L5G B;  1FAV A;  4WY4 B;  2N1T B;  1IFM A;  1IO4 A;  4N6J A;  1MZ9 A;  3P8C E;  1NKZ B;  1JMM A;  3T97 A;  3RL0 C;  5AW5 B;  3O8Z A;  5CCG A;  1N7S C;  2HOD B;  2MJZ A;  2ZXE B;  3H32 B;  2WPR A;  1FZB A;  1NU1 K;  2YKQ A;  2KP8 A;  3RK2 D;  4I2L C;  1G2C B;  3WMM 0;  1GDT A;  1FJK A;  5KJ7 C;  3U1C A;  4C46 A;  2IFN A;  3N7N A;  2WZ7 A;  4ZKU A;  4WY4 A;  3M0D C;  2BAS A;  2N1T A;  2W6A A;  1DH3 A;  3KDP B;  1T8Z A;  1RE3 A;  3CL3 D;  4HH2 A;  4AUW A;  2HOD A;  2POH A;  1HGV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...