5KJ7A

Structure of the ca2+-bound synaptotagmin-1 snare complex (long unit cell form) - from xfel diffraction
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
63
structure length
63
Chain Sequence
GSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Advances in X-ray free electron laser (XFEL) diffraction data processing applied to the crystal structure of the synaptotagmin-1 / SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis,exocytosis
molecule keywords Vesicle-associated membrane protein 3
total genus 28
structure length 63
sequence length 63
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5kj7A00
5CCHD 1JTHB 1KILC 5KJ7A 4JF7A 4W80A 1NHLA 1SFCB 3B5ND 1KILD 1GL2B 4WY4D 1GL2D 4W7YA 3TSIA 1SFCA 3RK2B 3KYQA 3RK3B 2NPSA 2NPSB 1T3JA 3RL0B 4WY4C 2NPSD 3B5NB 3HD7D 2H8PD 1SFCC 2YMYA 2N1TD 3RK2D 4WY4B 5CCGD 5KJ7D 1JTHA 5CCHC 1L4AC 2HFED 3VOPA 2PP6A 4N78E 3M0DC 5CCHA 3RK3D 1N7SB 3B5NA 2M8RA 3RL0D 3RL0C 4LGDE 5CCGA 1L4AA 3B5NC 1XTGB 3RK3C 2N1TB 3P8CE 2HG5D 2N1TA 1KILB 2WZ7A 3HD7C 1HVVA 4W7ZA 4OH8B 1N7SC 1N7SD 2N1TC 1URQB 3HTKB 2XDJA 3RK2C 1URQA 1GL2C 3HD7A 1L4AB 1SFCD 2KOGA 1L4AD 1URQD 2NPSC 1URQC 1N7SA 3PP5A 3HD7B 5KJ7C 1KILA 1GL2A 4WY4A 5CCGC
chains in the Genus database with same CATH superfamily
4H13B 4D6TE 2PFXA 1BCCG 2ZAEB 1KN7A 1EDKA 4AQRD 3MZWB 2BEQD 2D2CD 1RQVA 3EFGA 4ZMDA 1JTHB 3TF5A 2Q5UA 3TK1A 1LTJB 2YKOA 2V7QJ 2WSFH 3L74G 5AVVB 1VQMP 1KQSO 1AQ5A 2J58A 1FBMA 2WSEJ 1NTZG 2FBWC 2A45H 1NTKG 5APSA 3H1HJ 1U7MA 3PHLA 4ASWA 1NAFA 1ZR2A 4HH2A 1OFCX 4GIFA 5AVWB 1NHLA 2SPZA 1VQNP 3M9BA 3MP7B 3CCJP 1NAYA 1NU1K 4KHXA 2B87A 5CMZA 4U7JA 1PGQA 1SQXD 1NTKJ 3AE2C 1YI2P 1T2KC 5C39A 2P10A 3UIAA 1P84I 2A06G 1KILE 5B66E 1ZV8A 1U7JA 5K5GB 4PV1D 4H44C 1QEXA 1LTBC 4W7YA 5AVTB 5KLIC 2UWJE 3CXHD 1JMBA 3TSIA 3USSA 3GHGC 1LT9A 3B4SA 2NPSA 3RK3B 3G4SP 4BWNA 5TISH 2E5YA 3RL0B 2M0BA 3H1KJ 2NPSD 2Z5HA 2HLOA 3B5NB 2R32A 3L35A 2H88C 2KUBA 3HD7D 5EFWB 3L70J 1SQPG 3GMAA 1YIJP 3GHGB 3RK3E 3F89A 2Y9ZA 5CJ4A 2WPSA 1VF5C 3ZDMA 4N3YB 4BXLA 3RGUA 1EXIA 1QLED 2HODB 2QEXP 1S1CX 4YPCA 3CXHE 1BCCJ 2WT7B 3FWLA 1NTZD 4GT1A 3U1CA 2GM4A 5KAFH 1QVFO 1KQGB 1ZW0A 1S72P 3V6IA 2FFDA 1JTHA 1NH4A 1PZQA 2M3EA 3AE5C 1VQ6P 3WMM0 1IFPA 2R3SA 1GU5A 2WQYC 2AEJA 2DW3A 3KZIH 2HFED 2QRXA 2OYIB 2K9JA 1DD4A 1LT9B 2POHA 1P84E 3LIDA 2Z4EA 4GKGA 1J1DB 2KP8A 2PP6A 3AE7C 3H1KG 1NYHA 3HUSC 4N78E 3MUDA 3A7OA 2K37A 3IR9A 4L76A 4UB6E 5L8RJ 2Q7CA 3WUVA 1IFNA 1CW5A 1Z56A 2FYUG 3L4FA 4I7ZB 4DZOA 3H25A 3Q5RA 1KC8Q 3M06A 4LLHA 1SQQJ 1MUUA 2K9JB 3B5NC 2YXRB 1BSHA 2QSIA 2P67A 3HUSA 3VYIA 1ZR4A 1XTGB 1VQ9P 1EZVG 3VP9A 2KXPB 1SLQA 2D2CB 2HG5D 2N1TA 2R3CA 4K3AA 4R4MA 1IFMA 3H1LE 2QIWA 2IZ0A 2WZ7A 3L37A 5AW4B 1NTME 4O9BA 3U59A 3W67A 3L71E 3AE4C 1HVVA 1RE4A 1SQPE 3A0BH 4OVNF 4IFDK 3VTPC 3MGNA 4OH8B 2I1JA 1H88A 3HE5B 2W27A 3N7NA 1RE3C 4H44B 1DX7A 2FYUJ 4HB1A 1NGMB 2H7HA 2N1TC 1R5LA 2E76C 4PV1B 1URQA 1AJYA 4MN4C 1MFTA 1X8YA 2HYNA 1NTMK 3C1LA 4Y28J 2A06D 1L4AB 2WPRA 1OVVA 3B71A 3KDPB 1SQQG 1SFCD 1YTZI 3LW5H 2OYHA 2OYIA 1KYOD 2J59M 2P58A 1L0NJ 1RE3A 4UB6H 4DOJA 2BCCD 2AEMA 4ZKUA 2OGUA 1QL2A 3BCCD 1PL5A 1OWAA 1URQC 1N7SA 2FY8A 3KZIE 3VMYA 4H0LB 5TJHA 1HH0A 2JWDA 1KILA 1MKMA 1ZRTE 2K1AA 5AW1B 2FYUK 1T3UA 3O6QB 1YJ9P 1FZEA 5CCGC 3CCRP 2WVRA 1J1EB 1G1IA 1JY3O 1OVRA 2FYUE 2QG4A 1QX8A 5AW2B 4TT3H 1EDLA 1LTGC 3M9QA 4IFMA 1GK6A 3V2QA 1DEEG 4BRYA 1H0TA 2FYNC 2JDIH 4EI2A 1HJBA 3AEBC 3C8VA 3I5CA 1LGHB 2JWAA 3JSVC 2MKVA 4KJMA 4Y99C 5GTHE 3H1JG 5BU5A 1VQ4P 1JO5A 1YYCA 1ZMEC 4W80A 1NTMG 3CI9A 1JUNA 1J1DC 5KLIB 3L70D 3F5HA 3H1HD 1K73Q 3AE3C 3VMXA 1IK9A 2P7JA 1SFCB 2JR8A 2VRSA 5APTA 3CCVP 2QJKC 2W6AA 1Q82Q 1N73A 5TISE 1PP9J 1KMIZ 3FWNA 4NPDA 1N8RQ 1BSNA 2OTKE 3I55P 2HPCB 4GDOA 4PD4I 5E79H 2Y9YA 1GL2D 1FDOA 1NU1D 3L75D 5APUA 1L0LK 4RJTA 1S2EA 1M7LA 2IZ1A 3GG2A 2KNCB 2K3RA 2E76B 3NMDA 4OGQB 1SFCA 3E7KA 3KYQA 2B87B 2Q3EA 5AVSB 5AW5B 1FZCC 1FZGA 1JCDA 2QJKB 3K5BA 1GTWA 1AFOA 1VF5B 4YXWH 1JY2N 1M90Q 2LXBA 5KTBA 2Q9IA 5AVZB 3T97A 3T97B 3FXDA 3HRNA 2O01H 4BRYB 1H0TB 4M3LA 1SFCC 3FXEA 2WITA 2ZT9D 4RO0A 1GMJA 1S9KE 3CX5I 1BE3D 5CJ0A 1SQPD 1FAVA 3IAOA 1KORA 2PGDA 4GOFA 4DCKA 1FZCB 1TU3F 3O6QA 1IFDA 3PTZA 5KLVK 3TGUD 3G6EP 4IL6H 2B88A 5KLVE 4IFFA 1FS0E 1FZAA 1RY3A 3H1JE 1CI6B 1IFIA 3LW5J 2W6JH 2FYNB 1Q2NA 2BEZF 2K88A 1E79H 1SQBE 1SQXG 1KV4A 4OGQD 1FDMA 1ZOYC 1OW8A 1QVGO 4L74A 2C9LY 1BDDA 1BGYG 2BCCE 2W8ZA 2RH0A 2M3BA 3H6PA 1IC2A 4UB8E 3OW2O 1G2CB 1VQOP 4L75A 1P84D 2IBZE 1JB0J 3A0HH 5APYA 4ZKPA 3Q3DA 4D6TG 2OQQA 2RMZA 2XNDH 3L74J 1ZN5A 2W6BA 1FDIA 1JY3P 1L0NE 2Y0EA 3MD0A 3RL0D 4DT0A 3CCUP 4Y99B 1IZNB 1SQVJ 3VP8A 3CCLP 1W5CE 2Y0CA 1CZQA 2ITAA 2N1TB 4PV1C 3S1KA 3CCSP 1NTZE 1KILB 1PPJE 2CPBA 4IL6X 1RHZB 3L71D 2G3AA 2QE7H 4XFJA 2OYHC 2OTJP 1K05A 3IF4A 3D71A 3JCUE 1LTIC 2IDBA 2JJLA 4I6MC 2FYZA 1KB9I 2KB7P 2IX7C 2KLUA 2Z5IA 5CCHA 1N7SC 1DD3A 1BE3G 5H2FE 1NU1G 1URQB 5DJTB 1NKZB 1UIXA 1NTZK 2XDJA 3KHUA 2IPPA 3L72D 3L73E 3AEEC 4I7ZC 4N6JA 3TYYA 4DJGA 3A5TA 2WPQA 3CCQP 1N73B 3S4RA 5AW3B 4ZNCA 2WT7A 2AXTE 1SQXK 1J1EC 2JKVA 2PAJA 4PJ0H 3VMZA 2HR3A 2KIKA 1YBKA 1SQXE 3IFMA 3GF3A 1L4AD 1NTMD 3CD6P 1GW4A 3AEDC 5KKZC 1VQPP 2NZ2A 3H1IE 1NJIQ 2FFDB 3L75J 1BGYE 1L2PA 1SQVD 1X0TA 2B9BA 2LKMA 3CWBG 3P7KA 1BCCD 1KTMA 3NFQA 2AXTH 1GL2A 3AECC 1LTTC 1NOHA 1HUCA 4WY4A 3ABVC 1KYOH 4LGDE 1USDA 1FZBA 1VDFA 2W90A 1NU1J 2YXQB 1SQBJ 2E75C 1KFMA 4C46A 5CCHD 1L0NG 5KLVJ 2JEEA 5AW9B 3QH9A 1KZUB 1GW3A 2D2CC 2KNCA 1KB9H 2FKWB 3EQ2A 3V4WA 3CL3D 4RESB 1M8OB 2GA1A 2RN0A 1VQ7P 3RBXA 4JPZB 3PH0A 2QJYB 2HPCA 2ZVOB 5KJ7A 1SQVK 3C9IA 1L0LE 3CX5H 4JF7A 3TNUB 1PGJA 3H1IJ 2OTLP 2WSEH 3GF7A 1SQVE 1BDCA 1OW7A 5AVRB 2O1KA 3BVHA 1SQBK 3B5ND 2OYHB 2OARA 1A02J 2R44A 3CMAP 1FC2C 1GL2B 1UIIA 3BATA 1MZ9A 4U3FD 1BE3E 1WT6A 3NXSA 5AW8B 1K8AQ 2GUVA 1PP9D 1AQTA 2O01N 2QA4P 3L73G 1H8AA 2H89C 1H89A 3HUSB 4I1LA 3EFFK 2FXOA 1Q86Q 1EZVI 1PP9E 1PGOA 2ZVNB 1FZFA 1KD1Q 3BCCG 2YKPA 4D6TD 1KQFB 4UB8H 4WB4A 1EZVD 2YIUC 1T3JA 5AW7B 2E76D 3CWBD 2C0WA 4PD4H 5GTIE 2O01J 1L0LJ 3H1IG 4B86A 2NRGA 3H1LG 2Q1KA 1HF9A 1LT9C 2KZJA 1GDTA 3CWBE 1IFJA 2CK3H 4XE5B 1EXJA 2H8PD 1S9KD 4HYTB 4AYCA 1FU1A 1GZLA 1KB9D 1PPJD 2L5GB 4Z1MH 4QMAA 3CXHI 5KKZB 1N2DC 1JOCA 4IL6E 4I2LC 3H1HE 3MTUE 3L72G 1YTZT 2KZIA 1SQPJ 3L74E 3L71J 4ASVA 4AUWA 1X9VA 4WWIA 1FJPA 3QWOC 2I1KA 3LIEA 2XZRA 5KJ7D 1KYOE 3TDKA 4C7NB 5CCGD 2E75D 2A45I 3HE4A 2I8DA 2RKLA 1L0LG 3MUDC 5KLVD 4NPEA 5CCHC 1GU4A 1K04A 1T6AA 2QJYC 1SQQK 2YKQA 3VOPA 3AE8C 3M91A 3U1AA 3WU2E 4KT0J 1WMKA 4C7RA 2WTYA 1RF0C 1Q81Q 2L91A 2ZJSE 1RH5B 1LTSC 3B5NA 2YO2A 3L73J 1LTJA 4PD4D 3A3YB 5AW6B 1JCCA 2HODA 3E1RA 4H44D 3L72J 3SFEC 5BVZA 4JQ0D 2M8RA 3D6ZA 3L73D 1YJNP 1IO4A 5APXA 1QL1A 1LTAC 3SSUA 1VQKP 5KAIE 1S5LH 3IN6A 3BCCE 3SWYA 1G1JA 1M1JC 1DIPA 1EDIA 1L4AA 1S4XA 2WMMA 3HE4B 1CSBA 1NTMJ 1X22A 3P8CE 4JYBA 1LTJC 2YO3A 3H1LJ 2IYPA 3V2NA 1Q90D 3Q5PA 4H0LD 2AEFA 3D6YA 1RF1B 3G9RA 3HD7C 3VMAA 2KSJA 1U57A 2ZYDA 4W7ZA 1YQ3C 2KI7B 1EC5A 1RQUA 2C0XA 2LXCB 4CPGA 1R5SA 3H1KD 5GTHH 1VL2A 2P1JA 3CX5D 3AE9C 2KSEA 1HJ0A 1KB9E 3H1HG 1USEA 3V4QA 3G3ZA 3L72E 1S5LE 2QVAA 1E5WA 1AA0A 3HTKB 2QM8A 1GL2C 1PV3A 1HTLC 2BASA 2M5AB 1KFNA 2OYOA 3AEAC 3HD7A 1R8EA 1EDJA 3D70A 2ZT9C 2B89A 3A0HE 3TGUJ 1NVOA 1PGPA 3P8CD 3BRTB 2KS1A 2KS1B 2E74D 4U3FJ 1S3JA 1GD2E 3AEGC 3WU2H 4GODA 1JEKA 3GHGA 1JY3N 3PRJA 2NPSC 3O8ZA 1PIXA 1WRGA 3H32B 1IJDB 1NO4A 5CHXA 2JP3A 3HD7B 4EIJA 1YITP 2O1JA 3H1KE 5KJ7C 1ZLLA 4R4LA 3FX0A 2OYIC 1JMMA 3EWKA 4U3FG 3MIWA 3FGAD 1LT1A 1NTKK 3SWFA 3AEFC 1M56D 1OIPA 1A02F 2PRRA 1VF5D 2E74C 3N4XA 3VN0A 2YMKA 3CLQA 4NPFX 1KILC 1LP1B 5H2FH 1MV8A 2FXMA 3BRVB 1D7MA 2IYOA 3P32A 3V2RA 1N73C 2GUSA 3KXDA 1EZVE 3CWBJ 1ZXGA 3SFDC 3OA7A 3W68A 1OXZA 3JCUH 3A0BE 3A2AA 1SQPK 2V4HA 2E74B 3L71G 1SQBG 3HE5A 3S9OA 3B8EB 4OGQC 2A45G 2FFDC 1X79B 3BCCJ 1NTKD 3M0AA 1KILD 4N78D 2CPSA 4PD4E 3NTNA 5GTIH 1JM0A 1ZRTD 2J5UA 2E42A 3RK2C 2Q6QA 2Y0DA 1AVOA 1OVUA 4EOTA 1VQ8P 1HBWA 4WY4D 5AVYB 3Q1MA 3CMEP 1JY2O 1G2CA 2QJPC 3CPWO 1J2JB 4OWFA 3WUUA 1FOSF 3AE1C 4JBZA 1DEBA 1OW6A 2ZYAA 3KQGA 1FOSE 3RK2B 2XU6A 1SQQE 1L0NK 1SP4A 1GK4A 2NPSB 2FYUD 4TLFA 2R5DA 3CC7P 2XNXA 4WBAA 4EDFA 1RF1A 3V2PA 2E43A 3KPEA 1P84H 3TNUA 3GW6A 1QGKB 4HJGH 4WY4C 3TGUE 1BGYJ 1PPJG 2Q3IA 5KAIH 3E1IA 2ZXEB 3PLNA 1VQ5P 2MJZA 2KK7A 5AVUB 1FZCA 1YHQP 3BASA 3CX5E 4U3FE 2FXPA 4GOEA 1LWUB 2YMYA 2G8YA 2V7QH 2WSFJ 2KYVA 2AXCA 3JC22 1XTCC 4LC1A 4H13D 1IK7A 5KAFE 1RF1C 5DJUB 3CC4P 3R2PA 2QM7A 2W83C 1NWQA 2IFMA 1L0ND 1NU1E 2N1TD 3CXHH 2N9YB 4WY4B 3RK2D 4A7PA 1JNMA 1AV1A 2E75B 1KQLA 1FJKA 3ITKA 4XA4A 1JY2P 5AVQB 5M1BA 5BU8B 2WSSH 3Q2YA 1VPCA 3WUTA 1MFZA 1OZHA 5AW0B 1YJWP 2O3JA 1S5LX 4L73A 1K9MQ 1M1JA 2C9NY 4K35A 1L4AC 3Q5SA 4YTPC 1SQBD 2JO1A 2XKMA 3L70E 2WSCJ 1M1KQ 5APQA 1AVYA 3L75G 1OMIA 3MHVA 2M5AA 3M0DC 2IBZD 1YQ4C 4PJ0E 1N7SB 5AVXB 3RK3D 1PFIA 1LP1A 1VQLP 5CBNA 1W2EA 1BGYD 2IFNA 2WSCH 1BE3J 1SS1A 1BCCE 1FE6A 4YXDC 5APWA 3GLMA 1SVFA 4JYCA 3V5BA 1KYOI 3RL0C 5E79E 2ZT9B 5B66H 3H1ID 5CCGA 2QJPB 1OX3A 4WVZA 3M0DA 4HKZH 2ZYGA 3RK3C 3PJSK 3RBZA 1T2KD 3TGUG 3R4YA 3CC2P 1NTKE 1NTZJ 2P2UA 2IBZI 3I56P 1Y9BA 3H1LD 3H32A 3SWKA 1SQVG 4H0LC 4EYYQ 1EQ7A 1M57D 3H1JD 1DH3A 1LJ2A 1M1JB 1N86A 2WPVB 5APVA 1Q7YQ 3H1JJ 1ZP0C 2K9YA 4D6TJ 1Y47A 1N7SD 1LWUC 2A06E 2XV5A 3P8MC 3HTKA 2KLVA 1N7LA 1NKNA 2YNYA 3L74D 1L0LD 1HGVA 3OJAB 5KLVG 2YIUB 3G71P 2H43A 1PP9G 2BCCJ 3M9HA 1LNQA 2ZXXA 4H13C 3II6A 1RE4C 1T8ZA 2E5TA 2N9BA 1SQXJ 2WWWA 3AE6C 1RF0A 2KOGA 3L36A 3RL0g 1Y8AA 5CBOA 1URQD 1LWUA 1SQQD 3OAKA 5B5EE 1W2BO 2ZFCA 3L70G 1CI6A 4C7NA 5B5EH 3PP5A 4IOIH 2BCCG 4RKUJ 3L75E 3CCEP 2LR2A 1HGZA 2R5BA 2IBZG 3CCMP 1HWTC
chains in the Genus database with same CATH topology
4AQRD 3EFGA 1JTHB 2Q5UA 3TK1A 1LTJB 2YKOA 2WSFH 5AVVB 1AQ5A 2J58A 1FBMA 2A45H 5APSA 1ZR2A 1NAFA 4HH2A 5AVWB 4GIFA 1NHLA 3M9BA 4KHXA 1NU1K 5CMZA 1T2KC 3UIAA 1ZV8A 1LTBC 4W7YA 5AVTB 3TSIA 3GHGC 1LT9A 3RK3B 2NPSA 3RL0B 2NPSD 2Z5HA 2HLOA 3B5NB 2R32A 3L35A 3HD7D 3GHGB 5CJ4A 2WPSA 4N3YB 2HODB 2WT7B 4GT1A 3U1CA 2GM4A 2FFDA 1JTHA 1NH4A 3WMM0 1GU5A 2HFED 2OYIB 1LT9B 2POHA 2Z4EA 3LIDA 4GKGA 1J1DB 2KP8A 2PP6A 4N78E 3HUSC 5CCHA 3MUDA 3A7OA 3IR9A 2Q7CA 1IFNA 1CW5A 1Z56A 4DZOA 3L4FA 3M06A 4LLHA 1MUUA 3B5NC 2P67A 3HUSA 3VYIA 1ZR4A 1XTGB 3VP9A 1SLQA 2HG5D 2N1TA 2R3CA 1IFMA 5AW4B 2WZ7A 3L37A 4O9BA 1HVVA 1RE4A 4IFDK 3VTPC 3MGNA 4OH8B 2I1JA 1H88A 3HE5B 2W27A 3N7NA 1RE3C 1DX7A 2H7HA 2N1TC 1URQA 1X8YA 2HYNA 1NTMK 3KDPB 1L4AB 2WPRA 3U59A 2OYHA 1SFCD 1YTZI 3LW5H 2OYIA 2J59M 1RE3A 4DOJA 4ZKUA 1QL2A 1OWAA 1URQC 1N7SA 3VMYA 1HH0A 1KILA 5AW1B 2FYUK 1T3UA 1FZEA 5CCGC 1J1EB 1G1IA 1JY3O 5AW2B 1LTGC 3M9QA 4IFMA 1GK6A 3V2QA 1HJBA 3I5CA 1LGHB 4Y99C 1JO5A 5BU5A 1YYCA 4W80A 3CI9A 1JUNA 1J1DC 3VMXA 1IK9A 2P7JA 1SFCB 2VRSA 5APTA 1N73A 2W6AA 2HPCB 1GL2D 5APUA 1L0LK 1M7LA 3NMDA 5AW5B 1SFCA 3KYQA 5AVSB 1FZCC 1FZGA 1JCDA 1GTWA 1AFOA 1JY2N 5KTBA 5AVZB 3T97A 3HRNA 2O01H 4M3LA 1SFCC 2WITA 1S9KE 5CJ0A 1FAVA 1IFDA 5KLVK 4IFFA 1FZAA 1RY3A 1IFIA 1CI6B 1FDMA 2C9LY 3H6PA 2M3BA 1IC2A 1G2CB 5APYA 4ZKPA 3MD0A 1ZN5A 2W6BA 1JY3P 3RL0D 4Y99B 3VP8A 1CZQA 2N1TB 1KILB 2CPBA 2OYHC 4I6MC 1LTIC 2JJLA 2FYZA 2KB7P 2IX7C 2Z5IA 1N7SC 1URQB 3RK2C 2XDJA 1NKZB 1NTZK 4N6JA 3TYYA 2IPPA 3A5TA 2WPQA 1N73B 5AW3B 2WT7A 1SQXK 1J1EC 3VMZA 2PAJA 3IFMA 1L4AD 1GW4A 2FFDB 2LKMA 3P7KA 3NFQA 1GL2A 1LTTC 1NOHA 1HUCA 4WY4A 4LGDE 1VDFA 1FZBA 4C46A 5CCHD 1KFMA 2JEEA 5AW9B 1KZUB 1GW3A 3V4WA 2FKWB 3EQ2A 3CL3D 4RESB 2HPCA 5KJ7A 1SQVK 3C9IA 3TNUB 4JF7A 2WSEH 5AVRB 2O1KA 3BVHA 1SQBK 3B5ND 2OYHB 2OARA 1A02J 1GL2B 3BATA 1MZ9A 1WT6A 3NXSA 5AW8B 2GUVA 1H8AA 1H89A 3HUSB 4I1LA 1FZFA 2YKPA 4WB4A 5AW7B 1T3JA 2C0WA 4B86A 1LT9C 1GDTA 1IFJA 4XE5B 2H8PD 1S9KD 4HYTB 4AYCA 1FU1A 1GZLA 2L5GB 1N2DC 1JOCA 4I2LC 3MTUE 1YTZT 1X9VA 1FJPA 2I1KA 3LIEA 2XZRA 5KJ7D 4C7NB 5CCGD 3HE4A 2A45I 5CCHC 1GU4A 2YKQA 1SQQK 3VOPA 3M91A 3U1AA 4C7RA 2WTYA 1RF0C 3B5NA 1LTSC 4AUWA 2YO2A 1LTJA 5AW6B 3A3YB 1JCCA 2HODA 5BVZA 1IO4A 2M8RA 5APXA 1QL1A 1LTAC 3SWYA 1G1JA 1M1JC 1L4AA 3HE4B 1CSBA 4JYBA 1PFIA 3P8CE 1LTJC 2YO3A 3V2NA 1RF1B 3HD7C 2KSJA 4W7ZA 2C0XA 2P1JA 3V4QA 3G3ZA 3HTKB 2Q9IA 1E5WA 2QM8A 1GL2C 1HTLC 2BASA 1KFNA 3HD7A 3P8CD 3BRTB 1GD2E 3GHGA 1JY3N 3O8ZA 2NPSC 5CHXA 1WRGA 3H32B 1IJDB 1NO4A 4EIJA 3HD7B 2O1JA 5KJ7C 1ZLLA 2OYIC 1JMMA 3MIWA 3SWFA 1NTKK 1A02F 3N4XA 3VN0A 3CLQA 1KILC 1MV8A 2FXMA 3BRVB 3V2RA 1FZCB 3P32A 1N73C 2GUSA 3OA7A 1OXZA 3A2AA 1SQPK 3HE5A 3B8EB 2A45G 2FFDC 1X79B 3M0AA 1KILD 4N78D 2CPSA 3NTNA 2E42A 4EOTA 1HBWA 4WY4D 5AVYB 1JY2O 1G2CA 1FOSF 1J2JB 1DEBA 3KQGA 1FOSE 3RK2B 2XU6A 1L0NK 1SP4A 1GK4A 2NPSB 2R5DA 2XNXA 4WBAA 1RF1A 3V2PA 2E43A 3KPEA 3TNUA 4WY4C 2Q3IA 3E1IA 2ZXEB 2MJZA 5AVUB 1FZCA 3BASA 1LWUB 2YMYA 4LC1A 2KYVA 1XTCC 1RF1C 3R2PA 2QM7A 1NWQA 2IFMA 2N1TD 3RK2D 4WY4B 1JNMA 1KQLA 1FJKA 4XA4A 1JY2P 5AVQB 5BU8B 1VPCA 1MFZA 5AW0B 1M1JA 2C9NY 1L4AC 2XKMA 5APQA 5AVXB 3M0DC 3RK3D 1N7SB 1W2EA 2WSCH 2IFNA 5APWA 1SVFA 4JYCA 3V5BA 3RL0C 5CCGA 3M0DA 3RK3C 1T2KD 2P2UA 3H32A 1EQ7A 1DH3A 1M1JB 1N86A 5APVA 1N7SD 1LWUC 3P8MC 2XV5A 3HTKA 2KLVA 1N7LA 1NKNA 2YNYA 1HGVA 3OJAB 2H43A 3M9HA 3II6A 1RE4C 1T8ZA 2N9BA 2WWWA 1RF0A 2KOGA 3L36A 1LWUA 1URQD 3OAKA 2ZFCA 1CI6A 4C7NA 3PP5A 1HGZA 2R5BA 1HWTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CCH D;  1JTH B;  1KIL C;  5KJ7 A;  4JF7 A;  4W80 A;  1NHL A;  1SFC B;  3B5N D;  1KIL D;  1GL2 B;  4WY4 D;  1GL2 D;  4W7Y A;  3TSI A;  1SFC A;  3RK2 B;  3KYQ A;  3RK3 B;  2NPS A;  2NPS B;  1T3J A;  3RL0 B;  4WY4 C;  2NPS D;  3B5N B;  3HD7 D;  2H8P D;  1SFC C;  2YMY A;  2N1T D;  3RK2 D;  4WY4 B;  5CCG D;  5KJ7 D;  1JTH A;  5CCH C;  1L4A C;  2HFE D;  3VOP A;  2PP6 A;  4N78 E;  3M0D C;  5CCH A;  3RK3 D;  1N7S B;  3B5N A;  2M8R A;  3RL0 D;  3RL0 C;  4LGD E;  5CCG A;  1L4A A;  3B5N C;  1XTG B;  3RK3 C;  2N1T B;  3P8C E;  2HG5 D;  2N1T A;  1KIL B;  2WZ7 A;  3HD7 C;  1HVV A;  4W7Z A;  4OH8 B;  1N7S C;  1N7S D;  2N1T C;  1URQ B;  3HTK B;  2XDJ A;  3RK2 C;  1URQ A;  1GL2 C;  3HD7 A;  1L4A B;  1SFC D;  2KOG A;  1L4A D;  1URQ D;  2NPS C;  1URQ C;  1N7S A;  3PP5 A;  3HD7 B;  5KJ7 C;  1KIL A;  1GL2 A;  4WY4 A;  5CCG C; 
#chains in the Genus database with same CATH topology
 4H13 B;  4D6T E;  2PFX A;  1BCC G;  2ZAE B;  1KN7 A;  1EDK A;  4AQR D;  3MZW B;  2BEQ D;  2D2C D;  1RQV A;  3EFG A;  4ZMD A;  1JTH B;  3TF5 A;  2Q5U A;  3TK1 A;  1LTJ B;  2YKO A;  2V7Q J;  2WSF H;  3L74 G;  5AVV B;  1VQM P;  1KQS O;  1AQ5 A;  2J58 A;  1FBM A;  2WSE J;  1NTZ G;  2FBW C;  2A45 H;  1NTK G;  5APS A;  3H1H J;  1U7M A;  3PHL A;  4ASW A;  1NAF A;  1ZR2 A;  4HH2 A;  1OFC X;  4GIF A;  5AVW B;  1NHL A;  2SPZ A;  1VQN P;  3M9B A;  3MP7 B;  3CCJ P;  1NAY A;  1NU1 K;  4KHX A;  2B87 A;  5CMZ A;  4U7J A;  1PGQ A;  1SQX D;  1NTK J;  3AE2 C;  1YI2 P;  1T2K C;  5C39 A;  2P10 A;  3UIA A;  1P84 I;  2A06 G;  1KIL E;  5B66 E;  1ZV8 A;  1U7J A;  5K5G B;  4PV1 D;  4H44 C;  1QEX A;  1LTB C;  4W7Y A;  5AVT B;  5KLI C;  2UWJ E;  3CXH D;  1JMB A;  3TSI A;  3USS A;  3GHG C;  1LT9 A;  3B4S A;  2NPS A;  3RK3 B;  3G4S P;  4BWN A;  5TIS H;  2E5Y A;  3RL0 B;  2M0B A;  3H1K J;  2NPS D;  2Z5H A;  2HLO A;  3B5N B;  2R32 A;  3L35 A;  2H88 C;  2KUB A;  3HD7 D;  5EFW B;  3L70 J;  1SQP G;  3GMA A;  1YIJ P;  3GHG B;  3RK3 E;  3F89 A;  2Y9Z A;  5CJ4 A;  2WPS A;  1VF5 C;  3ZDM A;  4N3Y B;  4BXL A;  3RGU A;  1EXI A;  1QLE D;  2HOD B;  2QEX P;  1S1C X;  4YPC A;  3CXH E;  1BCC J;  2WT7 B;  3FWL A;  1NTZ D;  4GT1 A;  3U1C A;  2GM4 A;  5KAF H;  1QVF O;  1KQG B;  1ZW0 A;  1S72 P;  3V6I A;  2FFD A;  1JTH A;  1NH4 A;  1PZQ A;  2M3E A;  3AE5 C;  1VQ6 P;  3WMM 0;  1IFP A;  2R3S A;  1GU5 A;  2WQY C;  2AEJ A;  2DW3 A;  3KZI H;  2HFE D;  2QRX A;  2OYI B;  2K9J A;  1DD4 A;  1LT9 B;  2POH A;  1P84 E;  3LID A;  2Z4E A;  4GKG A;  1J1D B;  2KP8 A;  2PP6 A;  3AE7 C;  3H1K G;  1NYH A;  3HUS C;  4N78 E;  3MUD A;  3A7O A;  2K37 A;  3IR9 A;  4L76 A;  4UB6 E;  5L8R J;  2Q7C A;  3WUV A;  1IFN A;  1CW5 A;  1Z56 A;  2FYU G;  3L4F A;  4I7Z B;  4DZO A;  3H25 A;  3Q5R A;  1KC8 Q;  3M06 A;  4LLH A;  1SQQ J;  1MUU A;  2K9J B;  3B5N C;  2YXR B;  1BSH A;  2QSI A;  2P67 A;  3HUS A;  3VYI A;  1ZR4 A;  1XTG B;  1VQ9 P;  1EZV G;  3VP9 A;  2KXP B;  1SLQ A;  2D2C B;  2HG5 D;  2N1T A;  2R3C A;  4K3A A;  4R4M A;  1IFM A;  3H1L E;  2QIW A;  2IZ0 A;  2WZ7 A;  3L37 A;  5AW4 B;  1NTM E;  4O9B A;  3U59 A;  3W67 A;  3L71 E;  3AE4 C;  1HVV A;  1RE4 A;  1SQP E;  3A0B H;  4OVN F;  4IFD K;  3VTP C;  3MGN A;  4OH8 B;  2I1J A;  1H88 A;  3HE5 B;  2W27 A;  3N7N A;  1RE3 C;  4H44 B;  1DX7 A;  2FYU J;  4HB1 A;  1NGM B;  2H7H A;  2N1T C;  1R5L A;  2E76 C;  4PV1 B;  1URQ A;  1AJY A;  4MN4 C;  1MFT A;  1X8Y A;  2HYN A;  1NTM K;  3C1L A;  4Y28 J;  2A06 D;  1L4A B;  2WPR A;  1OVV A;  3B71 A;  3KDP B;  1SQQ G;  1SFC D;  1YTZ I;  3LW5 H;  2OYH A;  2OYI A;  1KYO D;  2J59 M;  2P58 A;  1L0N J;  1RE3 A;  4UB6 H;  4DOJ A;  2BCC D;  2AEM A;  4ZKU A;  2OGU A;  1QL2 A;  3BCC D;  1PL5 A;  1OWA A;  1URQ C;  1N7S A;  2FY8 A;  3KZI E;  3VMY A;  4H0L B;  5TJH A;  1HH0 A;  2JWD A;  1KIL A;  1MKM A;  1ZRT E;  2K1A A;  5AW1 B;  2FYU K;  1T3U A;  3O6Q B;  1YJ9 P;  1FZE A;  5CCG C;  3CCR P;  2WVR A;  1J1E B;  1G1I A;  1JY3 O;  1OVR A;  2FYU E;  2QG4 A;  1QX8 A;  5AW2 B;  4TT3 H;  1EDL A;  1LTG C;  3M9Q A;  4IFM A;  1GK6 A;  3V2Q A;  1DEE G;  4BRY A;  1H0T A;  2FYN C;  2JDI H;  4EI2 A;  1HJB A;  3AEB C;  3C8V A;  3I5C A;  1LGH B;  2JWA A;  3JSV C;  2MKV A;  4KJM A;  4Y99 C;  5GTH E;  3H1J G;  5BU5 A;  1VQ4 P;  1JO5 A;  1YYC A;  1ZME C;  4W80 A;  1NTM G;  3CI9 A;  1JUN A;  1J1D C;  5KLI B;  3L70 D;  3F5H A;  3H1H D;  1K73 Q;  3AE3 C;  3VMX A;  1IK9 A;  2P7J A;  1SFC B;  2JR8 A;  2VRS A;  5APT A;  3CCV P;  2QJK C;  2W6A A;  1Q82 Q;  1N73 A;  5TIS E;  1PP9 J;  1KMI Z;  3FWN A;  4NPD A;  1N8R Q;  1BSN A;  2OTK E;  3I55 P;  2HPC B;  4GDO A;  4PD4 I;  5E79 H;  2Y9Y A;  1GL2 D;  1FDO A;  1NU1 D;  3L75 D;  5APU A;  1L0L K;  4RJT A;  1S2E A;  1M7L A;  2IZ1 A;  3GG2 A;  2KNC B;  2K3R A;  2E76 B;  3NMD A;  4OGQ B;  1SFC A;  3E7K A;  3KYQ A;  2B87 B;  2Q3E A;  5AVS B;  5AW5 B;  1FZC C;  1FZG A;  1JCD A;  2QJK B;  3K5B A;  1GTW A;  1AFO A;  1VF5 B;  4YXW H;  1JY2 N;  1M90 Q;  2LXB A;  5KTB A;  2Q9I A;  5AVZ B;  3T97 A;  3T97 B;  3FXD A;  3HRN A;  2O01 H;  4BRY B;  1H0T B;  4M3L A;  1SFC C;  3FXE A;  2WIT A;  2ZT9 D;  4RO0 A;  1GMJ A;  1S9K E;  3CX5 I;  1BE3 D;  5CJ0 A;  1SQP D;  1FAV A;  3IAO A;  1KOR A;  2PGD A;  4GOF A;  4DCK A;  1FZC B;  1TU3 F;  3O6Q A;  1IFD A;  3PTZ A;  5KLV K;  3TGU D;  3G6E P;  4IL6 H;  2B88 A;  5KLV E;  4IFF A;  1FS0 E;  1FZA A;  1RY3 A;  3H1J E;  1CI6 B;  1IFI A;  3LW5 J;  2W6J H;  2FYN B;  1Q2N A;  2BEZ F;  2K88 A;  1E79 H;  1SQB E;  1SQX G;  1KV4 A;  4OGQ D;  1FDM A;  1ZOY C;  1OW8 A;  1QVG O;  4L74 A;  2C9L Y;  1BDD A;  1BGY G;  2BCC E;  2W8Z A;  2RH0 A;  2M3B A;  3H6P A;  1IC2 A;  4UB8 E;  3OW2 O;  1G2C B;  1VQO P;  4L75 A;  1P84 D;  2IBZ E;  1JB0 J;  3A0H H;  5APY A;  4ZKP A;  3Q3D A;  4D6T G;  2OQQ A;  2RMZ A;  2XND H;  3L74 J;  1ZN5 A;  2W6B A;  1FDI A;  1JY3 P;  1L0N E;  2Y0E A;  3MD0 A;  3RL0 D;  4DT0 A;  3CCU P;  4Y99 B;  1IZN B;  1SQV J;  3VP8 A;  3CCL P;  1W5C E;  2Y0C A;  1CZQ A;  2ITA A;  2N1T B;  4PV1 C;  3S1K A;  3CCS P;  1NTZ E;  1KIL B;  1PPJ E;  2CPB A;  4IL6 X;  1RHZ B;  3L71 D;  2G3A A;  2QE7 H;  4XFJ A;  2OYH C;  2OTJ P;  1K05 A;  3IF4 A;  3D71 A;  3JCU E;  1LTI C;  2IDB A;  2JJL A;  4I6M C;  2FYZ A;  1KB9 I;  2KB7 P;  2IX7 C;  2KLU A;  2Z5I A;  5CCH A;  1N7S C;  1DD3 A;  1BE3 G;  5H2F E;  1NU1 G;  1URQ B;  5DJT B;  1NKZ B;  1UIX A;  1NTZ K;  2XDJ A;  3KHU A;  2IPP A;  3L72 D;  3L73 E;  3AEE C;  4I7Z C;  4N6J A;  3TYY A;  4DJG A;  3A5T A;  2WPQ A;  3CCQ P;  1N73 B;  3S4R A;  5AW3 B;  4ZNC A;  2WT7 A;  2AXT E;  1SQX K;  1J1E C;  2JKV A;  2PAJ A;  4PJ0 H;  3VMZ A;  2HR3 A;  2KIK A;  1YBK A;  1SQX E;  3IFM A;  3GF3 A;  1L4A D;  1NTM D;  3CD6 P;  1GW4 A;  3AED C;  5KKZ C;  1VQP P;  2NZ2 A;  3H1I E;  1NJI Q;  2FFD B;  3L75 J;  1BGY E;  1L2P A;  1SQV D;  1X0T A;  2B9B A;  2LKM A;  3CWB G;  3P7K A;  1BCC D;  1KTM A;  3NFQ A;  2AXT H;  1GL2 A;  3AEC C;  1LTT C;  1NOH A;  1HUC A;  4WY4 A;  3ABV C;  1KYO H;  4LGD E;  1USD A;  1FZB A;  1VDF A;  2W90 A;  1NU1 J;  2YXQ B;  1SQB J;  2E75 C;  1KFM A;  4C46 A;  5CCH D;  1L0N G;  5KLV J;  2JEE A;  5AW9 B;  3QH9 A;  1KZU B;  1GW3 A;  2D2C C;  2KNC A;  1KB9 H;  2FKW B;  3EQ2 A;  3V4W A;  3CL3 D;  4RES B;  1M8O B;  2GA1 A;  2RN0 A;  1VQ7 P;  3RBX A;  4JPZ B;  3PH0 A;  2QJY B;  2HPC A;  2ZVO B;  5KJ7 A;  1SQV K;  3C9I A;  1L0L E;  3CX5 H;  4JF7 A;  3TNU B;  1PGJ A;  3H1I J;  2OTL P;  2WSE H;  3GF7 A;  1SQV E;  1BDC A;  1OW7 A;  5AVR B;  2O1K A;  3BVH A;  1SQB K;  3B5N D;  2OYH B;  2OAR A;  1A02 J;  2R44 A;  3CMA P;  1FC2 C;  1GL2 B;  1UII A;  3BAT A;  1MZ9 A;  4U3F D;  1BE3 E;  1WT6 A;  3NXS A;  5AW8 B;  1K8A Q;  2GUV A;  1PP9 D;  1AQT A;  2O01 N;  2QA4 P;  3L73 G;  1H8A A;  2H89 C;  1H89 A;  3HUS B;  4I1L A;  3EFF K;  2FXO A;  1Q86 Q;  1EZV I;  1PP9 E;  1PGO A;  2ZVN B;  1FZF A;  1KD1 Q;  3BCC G;  2YKP A;  4D6T D;  1KQF B;  4UB8 H;  4WB4 A;  1EZV D;  2YIU C;  1T3J A;  5AW7 B;  2E76 D;  3CWB D;  2C0W A;  4PD4 H;  5GTI E;  2O01 J;  1L0L J;  3H1I G;  4B86 A;  2NRG A;  3H1L G;  2Q1K A;  1HF9 A;  1LT9 C;  2KZJ A;  1GDT A;  3CWB E;  1IFJ A;  2CK3 H;  4XE5 B;  1EXJ A;  2H8P D;  1S9K D;  4HYT B;  4AYC A;  1FU1 A;  1GZL A;  1KB9 D;  1PPJ D;  2L5G B;  4Z1M H;  4QMA A;  3CXH I;  5KKZ B;  1N2D C;  1JOC A;  4IL6 E;  4I2L C;  3H1H E;  3MTU E;  3L72 G;  1YTZ T;  2KZI A;  1SQP J;  3L74 E;  3L71 J;  4ASV A;  4AUW A;  1X9V A;  4WWI A;  1FJP A;  3QWO C;  2I1K A;  3LIE A;  2XZR A;  5KJ7 D;  1KYO E;  3TDK A;  4C7N B;  5CCG D;  2E75 D;  2A45 I;  3HE4 A;  2I8D A;  2RKL A;  1L0L G;  3MUD C;  5KLV D;  4NPE A;  5CCH C;  1GU4 A;  1K04 A;  1T6A A;  2QJY C;  1SQQ K;  2YKQ A;  3VOP A;  3AE8 C;  3M91 A;  3U1A A;  3WU2 E;  4KT0 J;  1WMK A;  4C7R A;  2WTY A;  1RF0 C;  1Q81 Q;  2L91 A;  2ZJS E;  1RH5 B;  1LTS C;  3B5N A;  2YO2 A;  3L73 J;  1LTJ A;  4PD4 D;  3A3Y B;  5AW6 B;  1JCC A;  2HOD A;  3E1R A;  4H44 D;  3L72 J;  3SFE C;  5BVZ A;  4JQ0 D;  2M8R A;  3D6Z A;  3L73 D;  1YJN P;  1IO4 A;  5APX A;  1QL1 A;  1LTA C;  3SSU A;  1VQK P;  5KAI E;  1S5L H;  3IN6 A;  3BCC E;  3SWY A;  1G1J A;  1M1J C;  1DIP A;  1EDI A;  1L4A A;  1S4X A;  2WMM A;  3HE4 B;  1CSB A;  1NTM J;  1X22 A;  3P8C E;  4JYB A;  1LTJ C;  2YO3 A;  3H1L J;  2IYP A;  3V2N A;  1Q90 D;  3Q5P A;  4H0L D;  2AEF A;  3D6Y A;  1RF1 B;  3G9R A;  3HD7 C;  3VMA A;  2KSJ A;  1U57 A;  2ZYD A;  4W7Z A;  1YQ3 C;  2KI7 B;  1EC5 A;  1RQU A;  2C0X A;  2LXC B;  4CPG A;  1R5S A;  3H1K D;  5GTH H;  1VL2 A;  2P1J A;  3CX5 D;  3AE9 C;  2KSE A;  1HJ0 A;  1KB9 E;  3H1H G;  1USE A;  3V4Q A;  3G3Z A;  3L72 E;  1S5L E;  2QVA A;  1E5W A;  1AA0 A;  3HTK B;  2QM8 A;  1GL2 C;  1PV3 A;  1HTL C;  2BAS A;  2M5A B;  1KFN A;  2OYO A;  3AEA C;  3HD7 A;  1R8E A;  1EDJ A;  3D70 A;  2ZT9 C;  2B89 A;  3A0H E;  3TGU J;  1NVO A;  1PGP A;  3P8C D;  3BRT B;  2KS1 A;  2KS1 B;  2E74 D;  4U3F J;  1S3J A;  1GD2 E;  3AEG C;  3WU2 H;  4GOD A;  1JEK A;  3GHG A;  1JY3 N;  3PRJ A;  2NPS C;  3O8Z A;  1PIX A;  1WRG A;  3H32 B;  1IJD B;  1NO4 A;  5CHX A;  2JP3 A;  3HD7 B;  4EIJ A;  1YIT P;  2O1J A;  3H1K E;  5KJ7 C;  1ZLL A;  4R4L A;  3FX0 A;  2OYI C;  1JMM A;  3EWK A;  4U3F G;  3MIW A;  3FGA D;  1LT1 A;  1NTK K;  3SWF A;  3AEF C;  1M56 D;  1OIP A;  1A02 F;  2PRR A;  1VF5 D;  2E74 C;  3N4X A;  3VN0 A;  2YMK A;  3CLQ A;  4NPF X;  1KIL C;  1LP1 B;  5H2F H;  1MV8 A;  2FXM A;  3BRV B;  1D7M A;  2IYO A;  3P32 A;  3V2R A;  1N73 C;  2GUS A;  3KXD A;  1EZV E;  3CWB J;  1ZXG A;  3SFD C;  3OA7 A;  3W68 A;  1OXZ A;  3JCU H;  3A0B E;  3A2A A;  1SQP K;  2V4H A;  2E74 B;  3L71 G;  1SQB G;  3HE5 A;  3S9O A;  3B8E B;  4OGQ C;  2A45 G;  2FFD C;  1X79 B;  3BCC J;  1NTK D;  3M0A A;  1KIL D;  4N78 D;  2CPS A;  4PD4 E;  3NTN A;  5GTI H;  1JM0 A;  1ZRT D;  2J5U A;  2E42 A;  3RK2 C;  2Q6Q A;  2Y0D A;  1AVO A;  1OVU A;  4EOT A;  1VQ8 P;  1HBW A;  4WY4 D;  5AVY B;  3Q1M A;  3CME P;  1JY2 O;  1G2C A;  2QJP C;  3CPW O;  1J2J B;  4OWF A;  3WUU A;  1FOS F;  3AE1 C;  4JBZ A;  1DEB A;  1OW6 A;  2ZYA A;  3KQG A;  1FOS E;  3RK2 B;  2XU6 A;  1SQQ E;  1L0N K;  1SP4 A;  1GK4 A;  2NPS B;  2FYU D;  4TLF A;  2R5D A;  3CC7 P;  2XNX A;  4WBA A;  4EDF A;  1RF1 A;  3V2P A;  2E43 A;  3KPE A;  1P84 H;  3TNU A;  3GW6 A;  1QGK B;  4HJG H;  4WY4 C;  3TGU E;  1BGY J;  1PPJ G;  2Q3I A;  5KAI H;  3E1I A;  2ZXE B;  3PLN A;  1VQ5 P;  2MJZ A;  2KK7 A;  5AVU B;  1FZC A;  1YHQ P;  3BAS A;  3CX5 E;  4U3F E;  2FXP A;  4GOE A;  1LWU B;  2YMY A;  2G8Y A;  2V7Q H;  2WSF J;  2KYV A;  2AXC A;  3JC2 2;  1XTC C;  4LC1 A;  4H13 D;  1IK7 A;  5KAF E;  1RF1 C;  5DJU B;  3CC4 P;  3R2P A;  2QM7 A;  2W83 C;  1NWQ A;  2IFM A;  1L0N D;  1NU1 E;  2N1T D;  3CXH H;  2N9Y B;  4WY4 B;  3RK2 D;  4A7P A;  1JNM A;  1AV1 A;  2E75 B;  1KQL A;  1FJK A;  3ITK A;  4XA4 A;  1JY2 P;  5AVQ B;  5M1B A;  5BU8 B;  2WSS H;  3Q2Y A;  1VPC A;  3WUT A;  1MFZ A;  1OZH A;  5AW0 B;  1YJW P;  2O3J A;  1S5L X;  4L73 A;  1K9M Q;  1M1J A;  2C9N Y;  4K35 A;  1L4A C;  3Q5S A;  4YTP C;  1SQB D;  2JO1 A;  2XKM A;  3L70 E;  2WSC J;  1M1K Q;  5APQ A;  1AVY A;  3L75 G;  1OMI A;  3MHV A;  2M5A A;  3M0D C;  2IBZ D;  1YQ4 C;  4PJ0 E;  1N7S B;  5AVX B;  3RK3 D;  1PFI A;  1LP1 A;  1VQL P;  5CBN A;  1W2E A;  1BGY D;  2IFN A;  2WSC H;  1BE3 J;  1SS1 A;  1BCC E;  1FE6 A;  4YXD C;  5APW A;  3GLM A;  1SVF A;  4JYC A;  3V5B A;  1KYO I;  3RL0 C;  5E79 E;  2ZT9 B;  5B66 H;  3H1I D;  5CCG A;  2QJP B;  1OX3 A;  4WVZ A;  3M0D A;  4HKZ H;  2ZYG A;  3RK3 C;  3PJS K;  3RBZ A;  1T2K D;  3TGU G;  3R4Y A;  3CC2 P;  1NTK E;  1NTZ J;  2P2U A;  2IBZ I;  3I56 P;  1Y9B A;  3H1L D;  3H32 A;  3SWK A;  1SQV G;  4H0L C;  4EYY Q;  1EQ7 A;  1M57 D;  3H1J D;  1DH3 A;  1LJ2 A;  1M1J B;  1N86 A;  2WPV B;  5APV A;  1Q7Y Q;  3H1J J;  1ZP0 C;  2K9Y A;  4D6T J;  1Y47 A;  1N7S D;  1LWU C;  2A06 E;  2XV5 A;  3P8M C;  3HTK A;  2KLV A;  1N7L A;  1NKN A;  2YNY A;  3L74 D;  1L0L D;  1HGV A;  3OJA B;  5KLV G;  2YIU B;  3G71 P;  2H43 A;  1PP9 G;  2BCC J;  3M9H A;  1LNQ A;  2ZXX A;  4H13 C;  3II6 A;  1RE4 C;  1T8Z A;  2E5T A;  2N9B A;  1SQX J;  2WWW A;  3AE6 C;  1RF0 A;  2KOG A;  3L36 A;  3RL0 g;  1Y8A A;  5CBO A;  1URQ D;  1LWU A;  1SQQ D;  3OAK A;  5B5E E;  1W2B O;  2ZFC A;  3L70 G;  1CI6 A;  4C7N A;  5B5E H;  3PP5 A;  4IOI H;  2BCC G;  4RKU J;  3L75 E;  3CCE P;  2LR2 A;  1HGZ A;  2R5B A;  2IBZ G;  3CCM P;  1HWT C; 
#chains in the Genus database with same CATH homology
 4AQR D;  3EFG A;  1JTH B;  2Q5U A;  3TK1 A;  1LTJ B;  2YKO A;  2WSF H;  5AVV B;  1AQ5 A;  2J58 A;  1FBM A;  2A45 H;  5APS A;  1ZR2 A;  1NAF A;  4HH2 A;  5AVW B;  4GIF A;  1NHL A;  3M9B A;  4KHX A;  1NU1 K;  5CMZ A;  1T2K C;  3UIA A;  1ZV8 A;  1LTB C;  4W7Y A;  5AVT B;  3TSI A;  3GHG C;  1LT9 A;  3RK3 B;  2NPS A;  3RL0 B;  2NPS D;  2Z5H A;  2HLO A;  3B5N B;  2R32 A;  3L35 A;  3HD7 D;  3GHG B;  5CJ4 A;  2WPS A;  4N3Y B;  2HOD B;  2WT7 B;  4GT1 A;  3U1C A;  2GM4 A;  2FFD A;  1JTH A;  1NH4 A;  3WMM 0;  1GU5 A;  2HFE D;  2OYI B;  1LT9 B;  2POH A;  2Z4E A;  3LID A;  4GKG A;  1J1D B;  2KP8 A;  2PP6 A;  4N78 E;  3HUS C;  5CCH A;  3MUD A;  3A7O A;  3IR9 A;  2Q7C A;  1IFN A;  1CW5 A;  1Z56 A;  4DZO A;  3L4F A;  3M06 A;  4LLH A;  1MUU A;  3B5N C;  2P67 A;  3HUS A;  3VYI A;  1ZR4 A;  1XTG B;  3VP9 A;  1SLQ A;  2HG5 D;  2N1T A;  2R3C A;  1IFM A;  5AW4 B;  2WZ7 A;  3L37 A;  4O9B A;  1HVV A;  1RE4 A;  4IFD K;  3VTP C;  3MGN A;  4OH8 B;  2I1J A;  1H88 A;  3HE5 B;  2W27 A;  3N7N A;  1RE3 C;  1DX7 A;  2H7H A;  2N1T C;  1URQ A;  1X8Y A;  2HYN A;  1NTM K;  3KDP B;  1L4A B;  2WPR A;  3U59 A;  2OYH A;  1SFC D;  1YTZ I;  3LW5 H;  2OYI A;  2J59 M;  1RE3 A;  4DOJ A;  4ZKU A;  1QL2 A;  1OWA A;  1URQ C;  1N7S A;  3VMY A;  1HH0 A;  1KIL A;  5AW1 B;  2FYU K;  1T3U A;  1FZE A;  5CCG C;  1J1E B;  1G1I A;  1JY3 O;  5AW2 B;  1LTG C;  3M9Q A;  4IFM A;  1GK6 A;  3V2Q A;  1HJB A;  3I5C A;  1LGH B;  4Y99 C;  1JO5 A;  5BU5 A;  1YYC A;  4W80 A;  3CI9 A;  1JUN A;  1J1D C;  3VMX A;  1IK9 A;  2P7J A;  1SFC B;  2VRS A;  5APT A;  1N73 A;  2W6A A;  2HPC B;  1GL2 D;  5APU A;  1L0L K;  1M7L A;  3NMD A;  5AW5 B;  1SFC A;  3KYQ A;  5AVS B;  1FZC C;  1FZG A;  1JCD A;  1GTW A;  1AFO A;  1JY2 N;  5KTB A;  5AVZ B;  3T97 A;  3HRN A;  2O01 H;  4M3L A;  1SFC C;  2WIT A;  1S9K E;  5CJ0 A;  1FAV A;  1IFD A;  5KLV K;  4IFF A;  1FZA A;  1RY3 A;  1IFI A;  1CI6 B;  1FDM A;  2C9L Y;  3H6P A;  2M3B A;  1IC2 A;  1G2C B;  5APY A;  4ZKP A;  3MD0 A;  1ZN5 A;  2W6B A;  1JY3 P;  3RL0 D;  4Y99 B;  3VP8 A;  1CZQ A;  2N1T B;  1KIL B;  2CPB A;  2OYH C;  4I6M C;  1LTI C;  2JJL A;  2FYZ A;  2KB7 P;  2IX7 C;  2Z5I A;  1N7S C;  1URQ B;  3RK2 C;  2XDJ A;  1NKZ B;  1NTZ K;  4N6J A;  3TYY A;  2IPP A;  3A5T A;  2WPQ A;  1N73 B;  5AW3 B;  2WT7 A;  1SQX K;  1J1E C;  3VMZ A;  2PAJ A;  3IFM A;  1L4A D;  1GW4 A;  2FFD B;  2LKM A;  3P7K A;  3NFQ A;  1GL2 A;  1LTT C;  1NOH A;  1HUC A;  4WY4 A;  4LGD E;  1VDF A;  1FZB A;  4C46 A;  5CCH D;  1KFM A;  2JEE A;  5AW9 B;  1KZU B;  1GW3 A;  3V4W A;  2FKW B;  3EQ2 A;  3CL3 D;  4RES B;  2HPC A;  5KJ7 A;  1SQV K;  3C9I A;  3TNU B;  4JF7 A;  2WSE H;  5AVR B;  2O1K A;  3BVH A;  1SQB K;  3B5N D;  2OYH B;  2OAR A;  1A02 J;  1GL2 B;  3BAT A;  1MZ9 A;  1WT6 A;  3NXS A;  5AW8 B;  2GUV A;  1H8A A;  1H89 A;  3HUS B;  4I1L A;  1FZF A;  2YKP A;  4WB4 A;  5AW7 B;  1T3J A;  2C0W A;  4B86 A;  1LT9 C;  1GDT A;  1IFJ A;  4XE5 B;  2H8P D;  1S9K D;  4HYT B;  4AYC A;  1FU1 A;  1GZL A;  2L5G B;  1N2D C;  1JOC A;  4I2L C;  3MTU E;  1YTZ T;  1X9V A;  1FJP A;  2I1K A;  3LIE A;  2XZR A;  5KJ7 D;  4C7N B;  5CCG D;  3HE4 A;  2A45 I;  5CCH C;  1GU4 A;  2YKQ A;  1SQQ K;  3VOP A;  3M91 A;  3U1A A;  4C7R A;  2WTY A;  1RF0 C;  3B5N A;  1LTS C;  4AUW A;  2YO2 A;  1LTJ A;  5AW6 B;  3A3Y B;  1JCC A;  2HOD A;  5BVZ A;  1IO4 A;  2M8R A;  5APX A;  1QL1 A;  1LTA C;  3SWY A;  1G1J A;  1M1J C;  1L4A A;  3HE4 B;  1CSB A;  4JYB A;  1PFI A;  3P8C E;  1LTJ C;  2YO3 A;  3V2N A;  1RF1 B;  3HD7 C;  2KSJ A;  4W7Z A;  2C0X A;  2P1J A;  3V4Q A;  3G3Z A;  3HTK B;  2Q9I A;  1E5W A;  2QM8 A;  1GL2 C;  1HTL C;  2BAS A;  1KFN A;  3HD7 A;  3P8C D;  3BRT B;  1GD2 E;  3GHG A;  1JY3 N;  3O8Z A;  2NPS C;  5CHX A;  1WRG A;  3H32 B;  1IJD B;  1NO4 A;  4EIJ A;  3HD7 B;  2O1J A;  5KJ7 C;  1ZLL A;  2OYI C;  1JMM A;  3MIW A;  3SWF A;  1NTK K;  1A02 F;  3N4X A;  3VN0 A;  3CLQ A;  1KIL C;  1MV8 A;  2FXM A;  3BRV B;  3V2R A;  1FZC B;  3P32 A;  1N73 C;  2GUS A;  3OA7 A;  1OXZ A;  3A2A A;  1SQP K;  3HE5 A;  3B8E B;  2A45 G;  2FFD C;  1X79 B;  3M0A A;  1KIL D;  4N78 D;  2CPS A;  3NTN A;  2E42 A;  4EOT A;  1HBW A;  4WY4 D;  5AVY B;  1JY2 O;  1G2C A;  1FOS F;  1J2J B;  1DEB A;  3KQG A;  1FOS E;  3RK2 B;  2XU6 A;  1L0N K;  1SP4 A;  1GK4 A;  2NPS B;  2R5D A;  2XNX A;  4WBA A;  1RF1 A;  3V2P A;  2E43 A;  3KPE A;  3TNU A;  4WY4 C;  2Q3I A;  3E1I A;  2ZXE B;  2MJZ A;  5AVU B;  1FZC A;  3BAS A;  1LWU B;  2YMY A;  4LC1 A;  2KYV A;  1XTC C;  1RF1 C;  3R2P A;  2QM7 A;  1NWQ A;  2IFM A;  2N1T D;  3RK2 D;  4WY4 B;  1JNM A;  1KQL A;  1FJK A;  4XA4 A;  1JY2 P;  5AVQ B;  5BU8 B;  1VPC A;  1MFZ A;  5AW0 B;  1M1J A;  2C9N Y;  1L4A C;  2XKM A;  5APQ A;  5AVX B;  3M0D C;  3RK3 D;  1N7S B;  1W2E A;  2WSC H;  2IFN A;  5APW A;  1SVF A;  4JYC A;  3V5B A;  3RL0 C;  5CCG A;  3M0D A;  3RK3 C;  1T2K D;  2P2U A;  3H32 A;  1EQ7 A;  1DH3 A;  1M1J B;  1N86 A;  5APV A;  1N7S D;  1LWU C;  3P8M C;  2XV5 A;  3HTK A;  2KLV A;  1N7L A;  1NKN A;  2YNY A;  1HGV A;  3OJA B;  2H43 A;  3M9H A;  3II6 A;  1RE4 C;  1T8Z A;  2N9B A;  2WWW A;  1RF0 A;  2KOG A;  3L36 A;  1LWU A;  1URQ D;  3OAK A;  2ZFC A;  1CI6 A;  4C7N A;  3PP5 A;  1HGZ A;  2R5B A;  1HWT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...