5KJ7E

Structure of the ca2+-bound synaptotagmin-1 snare complex (long unit cell form) - from xfel diffraction
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
278
Chain Sequence
b'KLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 3
publication title Advances in X-ray free electron laser (XFEL) diffraction data processing applied to the crystal structure of the synaptotagmin-1 / SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis,exocytosis
total genus 43
structure length 278
sequence length 278
chains with identical sequence F, K
ec nomenclature
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5kj7E01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5kj7E02
4AJWA 3PS6A 2ENPA 1RLWA 1QASA 2Y3AA 1TJMA 3TWYA 4ICXA 2D8KA 4F92B 1DJZA 2YRBA 3MJWA 4L1LA 2V4LA 4L23A 3T8MA 4QAMB 4DK5A 1DJHA 1YRKA 2DMHA 5CCJA 4ANVA 2CHWA 3KWUA 2WXFA 1E8XA 3RDJA 4GNKB 4XZ4A 5CCHE 3HN8A 3IM1A 2WXQA 4KZ0A 2BWQA 4J6IA 2X38A 4TS6A 2JQZA 2WXRA 2NSQA 4V11A 3B7YA 3L9BA 3GPEA 4BFRA 5H4YA 4LT7A 2WXHA 3IBEA 3HIZA 3ML8A 2ISDA 3DBSA 4Y1SA 2YOAA 1QATA 3PFQA 2A5UA 3NZSA 4L1BA 1UOVA 1BCIA 1DQVA 2DMGA 2QZQA 2WXGA 3APCA 3R7QA 4WWPA 1DSYA 4NS0A 4Y1TA 4GB9A 3SD5A 1HE8A 2R83A 4G11A 4NPKA 2CHZA 4ANUA 4F1SA 1E8YA 3ZVVA 2CJTA 3QR0A 4FJZA 2CJSA 3ZIMA 4QJ4B 3APFA 3P2BA 5G55A 2CHDA 2A4ZA 2FK9A 2N1TE 4F91B 3NSJA 1DJIA 2ENQA 4EZLA 2K3HA 4FLHA 4WEEA 4EZKA 4FJYA 2CM5A 4WAFA 1GMIA 3TL5A 4ANWA 4NP9A 3F00A 4PS3A 4BGDA 5JHBA 5KJ7E 2WXNA 4KITB 4TV3A 1E8ZA 2QZ5A 3QR1A 4FADA 4URKA 4EZJA 4NPJA 1DJGA 2CM6A 3PREA 3CSTA 5JHAA 3S2AA 4TUUA 3F01A 3FDWA 3ZW3A 2Q3XA 3L4CA 4ANXA 2UZPA 3DPDA 1RH8A 3FBKA 2ZKMX 1UOWA 3TJPA 1E8WA 5CCGE 4OVUA 2Z0UA 3ENEA 1DJYA 3M7FB 4LCVA 3W57A 2CHXA 2WXPA 1DJXA 1A25A 2NCEA 4AOFA 2WXOA 5T8IA 1E7VA 4L2YA 4XX5A 4IQHA 3APDA 3PYCA 3NZUA 3OAWA 4MJJA 4F93B 1CJYA 3N5AA 3HHMA 4FULA 1E7UA 4IHBA 4OVVA 2NQ3A 4QJ3B 4DNLA 5EDSA 4HLEA 3ML9A 1UGKA 4XE0A 1K5WA 4FA6A 1WFJA 4PS8A 2RD0A 2Q0ZX 2KI6A 1W16A 3JZYA 4JPSA 3RPBA 4QJ5B 1V27A 2ENJA 1W15A 4KZCA 4WWOA 1WFMA 2K45A 2WXMA 1BDYA 1E90A 4FHKA 4LDCA 4PS7A 3PRZA 2LHAA 2WXJA 3R7RA 1RSYA 3L13A 3QAQA 1BYNA 2FJUB 2K8MA 3F04A 3QK0A 4FHJA 2K4AA 3W56A 2EP6A 2B3RA 3L08A 3L54A 3LJ3A 3QARA 4WWNA 2WXLA 3CSFA 3OHMB 3QJZA 4A55A 4ICWA 4HVBA 3L17A 5G2NA 3KWTA 1DJWA 2WXIA 3L16A 1TJXA 3F05A 2WXKA 5H4ZA
chains in the Genus database with same CATH superfamily
2ENPA 1KCUL 2MPVA 1X7QA 5DRNB 3MU3A 2C9QA 1OF2A 3P0YL 3W11C 1M7DA 4HA1A 3WS6C 3WNJA 1DEEB 3NCMA 3V6OA 1GVIA 3QNYA 4KDVA 4XNYH 5B1JC 3DVFA 1IM9B 4QKTA 1YUKB 1E8XA 5IT2H 5GS1C 1DVXA 1HIMH 2F6AA 2WZPA 3DIVA 4NNPL 4PBXA 2JKIS 4N28A 4LKXA 2BVPB 4JHUA 5FXCH 5H8DA 3MBED 3U9UA 3FN0H 3SDXF 3ILDA 3BWAB 3FW6A 4N87A 5KJRH 3G5XA 3S3BB 4JN2A 3B8YA 3QDGA 3JVGA 1I4FA 2E9IA 3S37X 2DLGA 1A6VH 1P2CA 2CXKA 2G9HA 1HSAB 4XMXA 1AANA 2HG5A 4BK5C 4C59B 4JFTA 4U7KA 3QUKB 4XMWA 2C9UA 1AR1B 5GGVY 3VWJA 1EMTH 3WE6A 1A9BB 4U31A 3N42F 1BZ8A 3MVSA 3TT3L 1NICA 2RGSA 4OH2A 3PNWA 1LP9A 1IC7L 3JWDL 1AQKL 1UM4H 3GNMH 1XB6A 1DQMH 1KLUB 5DUJA 3P73A 4JRXB 5KN5A 1E28A 4N24A 1I3RB 1Z3GH 4NO5B 5FX3A 1BXUA 1MFEH 2P5PA 3D06A 3ZDZB 3S98A 4QRTA 2WKOF 3L95B 1CBJA 1IARB 5H2BB 5FO8A 4K3HA 4R84A 4WWKB 5T1MA 4N85A 5F88A 3KBPA 2R39A 3PPEA 1CFSB 1ASOA 1OY3B 4HFWB 2HLFC 4LRNH 1G4MA 4AVIA 2EDFA 3P30L 4ELMA 5LCVH 4MJHA 4I8DA 3HS0C 5JOPD 4D0BB 2Y25A 3QULA 2YGVA 3EGDB 4LHQB 2X3BA 4IIZA 2PW1B 1CFBA 4X4YB 2VQTA 2EXSA 5EF2A 3GSQB 4FKKA 1U92B 2F54B 4CBPA 2C9RA 2K8MA 3JSSA 2QVKA 3HG1D 1D2PA 1XMEB 1ZMYA 3BSZA 3WEMA 4AXWB 5KZCD 3HUJB 4WW2A 1U3HA 2V8MA 4NQVA 1ZT7A 4WFFE 5TH2A 3T0EE 1KYOK 1NCIA 4ICWA 1HYRC 1EV2E 1T4KB 4KXZI 5T1LB 1UKTA 1BVLA 2HUEA 3G5ZA 3KVQA 3EDKA 1TMCB 3BKYL 4X0NA 2N4IA 2XWJA 1J0IA 2Z31A 4TSCL 5AWNL 5C71A 1FNHA 1JNLL 1QTPA 3JYCA 5DRZB 1HCZA 4F37F 2OMUB 3QCVH 3TBSA 1JIBA 1SXNA 2VGLM 2AGJH 1HHJB 3OF6A 3IXTB 3WMSA 3EH5B 3N2JA 4Q8BA 1SY6L 3FRPA 1OW0C 4KRLB 3FQRA 3IN0A 2FEDD 2X6VA 4K3DL 3TCLB 2VCOA 1TYJA 3CDFA 5DJ0B 3CH8A 2NSQA 3WU1A 2I9LB 1U8KA 1ODUA 2AXWA 3L9YA 4U4IA 5EBGA 5FK9A 1CVSC 1HOCA 1F4XH 3UTZA 2AMUA 3G6JE 1MFBH 3MV9A 1E50A 1L0PA 1N0LA 3VTAA 3WKPA 5JHLA 1IAOA 4MQXC 1DVQA 3VGAC 1TZIB 1BFSA 2EE3A 5L2KA 4C83B 3DX6A 6FABL 3N85L 4PWIA 1VPOL 2EO9A 5EZOL 4UM8B 1GMIA 4B0MM 1AMXA 2C1OB 5I1EH 5J1SC 2UXTA 5AG8A 3N41B 4EI5A 4QRPA 1P84J 2WLHA 2G3ZA 2ZOTA 3DRQB 3TIDB 1EO7A 1VB9A 4H1LH 3GM0A 2JCCA 4F5CA 3QRFM 1JPSH 1QFUH 1U8MB 4PJEA 1FO0L 3SE9H 1XZ0B 5E6ZA 4MJ5B 2ZONA 1PNDA 3HMXA 3B2UD 3QZBA 1GCFA 3TN0D 1LE9A 2YZ8A 2PLTA 3BZ5A 3K2KA 3UADA 5FA3A 4FFZA 2WGNB 2NUPA 1A3RH 4QCIB 5IHUL 2ROXA 4Y4FD 4HFUL 4R0LB 1K5WA 4PS8A 1BPVA 1CG9B 1P4UA 4RISL 4QO1B 3MCG1 4AZUA 1IBFA 2X9YA 4GRWF 4QTIH 1KFAL 5SV3A 3RKPA 3TLRA 2CDGA 3AGWA 4G7VH 1AOZA 3ZL4L 4WW1B 1J1OL 1KJVA 4PRBB 4IRJA 1OO2A 4XNZB 4JKPL 1NCWL 3QK0A 2AXFA 4H8UA 4PM1A 5IMLB 1N5YL 1QW8A 5CEZL 5C70A 3BZ4B 2ZE0A 5AYUL 1C5CH 1DN0A 1UD3A 4KY1H 1CT8B 3OD3A 4I18A 5JOFB 2QMKA 3IGKA 2OTWB 4XXWC 3EIFA 4AY0A 3RWJB 3EZ8A 4F58L 1FVDA 1ILUA 3PWVB 1FIEA 2R0KH 4LL1A 4XVUD 2DOCA 3D51A 2O6PA 4Z7QB 4DN4H 2WCSA 3MN8A 1JYNA 3FQNB 1N8ZA 2B0SL 4UT6L 4NFDA 1V3MA 1DUYB 5IJKC 3FUKA 3SZ6A 4NZUH 5C07E 3BO8A 4P9HH 1FLTX 2GC4C 1Q9KA 4ETQB 1ADQA 4EUPB 2MQGA 4MAYD 1JZHA 2ZD0A 4YLCA 1JZIA 5DJCB 3T2OA 3LEXA 3K81A 2G60L 4ZMVA 4HOXA 2EKSA 1KLFA 3VNYA 2ZUWA 2HCZX 4O2EA 4M4PA 2FGWH 4UQ9A 3HPJB 1IEBA 5JIHA 2XUWA 3OAZH 5K1JA 8PAZA 3DV4B 5GGUB 1U33A 4MNQE 4F7EA 4U6XA 4JMNA 4HIJB 1A6WH 4AZ8A 4AIZB 1A7BA 3MRNA 3MRIB 3UFIA 2L7QA 3DV6A 2BP0B 2V9UA 3H7LA 4PSRA 2JI2A 4YFLF 2F1EA 3F7PC 1TIUA 5GQBA 1Z5LB 2I24N 4EVNB 3GIZL 3T8XA 2Q7YA 2H32B 2ZWNA 3CFNA 1OE2A 1LK3H 4U6VH 4CC0A 4CN4A 2CBPA 4ZPTA 4LESA 4RGND 2AABH 4ALAC 4GLRI 2YBRB 3UTTA 1S46A 1NCOA 3EBIA 4W9FC 3DOIA 4BFFA 1G9ML 5C8JB 4BCZA 1WTGT 5D7HA 4HIEB 1T5WB 4FNUA 5IVXA 5I17A 3UAJD 3IN2A 3A21A 5FOBA 3BE1L 2OXHA 5EN2B 2Z92A 3ARFC 4PV9B 3B1UA 4H20H 3CDZA 5IQ9A 3BRFA 3FO9A 5GISH 4GS7C 3RGVB 1G0XA 4LLWB 4MB4A 2EH7L 3EGXA 1DANT 5F72S 4AV4A 2YA0A 2Z8SA 1GAFL 2QL1A 5D2NC 2ZPKL 3UBXA 5EUKB 3FHEA 3TO2B 1BAFL 3NEEA 5KVMC 1AP2A 1XIWC 3ULVC 5C09A 1IQWL 2CDFB 4YLBA 5AW7B 3ILQC 3MV7D 5DJDA 3TVMD 1J48A 3WS3A 4PWEA 4AYFA 4Y1AE 1QSFD 3CH1B 5DEGB 1NEZG 1WWBX 2P8PA 5ACZB 2UWEE 2XACC 4P5KB 5C0CE 5EIIG 4L5FL 2B3RA 4MZRA 2P1YA 4AEHH 4FZEH 3IEAA 3BW9A 3ZE0E 3IDYB 3HE6D 3VGFA 2NYYC 2P5WA 1FJ1B 4NWTL 4JM0A 3Q8EA 4K3JH 1MAMH 4UQ2A 3GSVB 3ZDYE 1NCCL 4HS6A 4IDJL 4UUJB 1IX2A 5AVVB 5AZEH 2JB5H 1E6OL 3PWPA 3GRGA 2XN9E 4U3CA 5I73C 2XJKA 3HAEA 4NHCH 2QKIC 1IBYA 4PVMA 4AKOA 2G75A 3L7EA 2UXGA 4HGKC 5BOZG 1IKFH 2QMJA 2A83A 1MELA 4EN3D 2HRGA 2X4RA 2XVLA 1AGFA 2XNAA 1JPGA 4KJYA 1DLFL 3QEUA 2AEPH 3SPVB 4BQ8A 4TVUA 1IKNC 4J2QA 1JGEB 3ABLB 1QSEA 4QHMA 5B3SB 2ZXBA 4K94H 1PAMA 1DZ0A 5GRUL 4ZDHB 4YSQA 1UHVA 3VD4A 4FFYA 3Q05A 3C6LA 1P4IH 3QUXB 1NGQH 2FZ3A 3RL2B 1AQHA 4IBWA 1ADWA 1FGVL 1SGKA 3DIFA 4D0CB 5E8NB 3G04B 1XCXA 2P48B 4WY7H 4ZUWB 4Z9KB 4JL2A 4YSSA 2OBGA 4DF9A 1K8DB 3GI9H 3MLXH 3G08B 4HMCA 4XHQA 2AXHA 3F12B 5FUZL 3UGEA 2EEAA 4TQIA 1MFUA 1DUZB 1NOLA 3FT1A 2DKMA 1I7ZB 3O41A 1MHEA 2XZAL 5J9PB 4X6FA 2Q6WA 2P28B 5I8CA 3MODL 1PY9A 2DYPD 2GAZB 1NBZB 3D3VD 5BQ7B 2DD8L 4P4KA 2GHZA 2I7SA 5FGRA 4APXB 2FX7L 4BXSV 2LR4A 1NGZA 3QFGA 4A67A 5DRWA 4L18A 1QHQA 3BXNA 5DS8A 4XC3L 4OD2A 4RGOL 1NAKL 3CFCL 2HKFH 2OMWA 1XZWA 1J5CA 4ZMWA 4Z3FA 4U6YB 1IBBA 3BLBA 3F7QA 1E4XI 1MFCH 5CWSB 3LV3A 2XTJE 5C0BD 5I6OA 2ZYSA 4XX5A 4OF8A 3IKCA 4QHKJ 4Y88A 2Z7WA 3FSZA 4AIEA 4QJ3B 2DBLL 1A6AB 4U05A 3DHJA 4WI4A 5HYEA 4NN5C 4PW4A 1YNKL 2X4QB 5C08E 5B38B 4Y5YC 4PRHB 3X3FH 2BY1A 1URIA 2D3VA 1G0YR 1HXMB 1CU4H 3RA7L 2WXMA 3LH9A 5DTFB 2N01B 2OJ1A 1E90A 4OBRA 4YHPA 2IQ9L 3SBRA 3VRLF 3OKLB 3UJJL 4ODBD 4HWBH 3L5XL 1C9SA 4DO5A 2PYEB 3D85A 1IGTB 4LPTA 3VH8A 1UZ6F 2R2HB 2VIRA 1OARL 1UC6A 4KPHH 3W39B 4JDEA 1F4YL 3ZLQC 2QQNL 1EFQA 4PB9H 5G2NA 1RMFL 3P11L 3PGFH 3Q6FB 4K8RL 2G3MA 4PRAB 1U8CA 4AGPA 4NJAL 5KS9A 4Z7WB 5I19L 2OYKA 5J12B 3BP7A 3V4UH 4FD0A 4AYEC 2VDNH 2W60B 5GGRB 2VW4A 2MCG1 2UUDK 1EHAA 1M9WA 4ZOBA 4ONGH 2OYMA 1F58H 1KY6A 4JRYA 4PJGE 3PWUA 3SKOA 1L9MA 4YHZL 5I18L 4PTUB 4TL5A 5FW6A 2VXVH 2Q1EA 3KHOA 4AI7A 4WSKA 4ZYKB 3X13A 1F6FB 5TJWK 4JN1L 3RWEA 2QVMA 1HOEA 1QBBA 1LO5B 3O6FA 1BFOB 3MJ6A 1T89A 4N9OB 4LCWE 4NRZB 4YE4H 3X14B 4AQZA 4YAQA 2YA1A 3P3RA 5ID1B 3DX8B 3L3GA 5FS5A 3SD5A 2P80D 3QEHA 4L9DA 3BAJA 4DPCX 1BVZA 4PJIF 5I1DA 1I8LC 4Y7OC 3QFDA 4MX7B 1XGQA 2E46A 4NIYE 3T6VA 3ZDWA 3ZE1B 4UM9A 4DP1X 1ZLUH 3V2AR 3NRQA 4PRIA 4CVXA 1EAPB 1F02I 4ZO8A 1YY8B 1TZGL 4HHGA 1U2HA 4XPFH 5L0QB 2BZCA 2DI7A 4LVHC 2PWEA 1E8ZA 3NIGE 4IOIB 1IV8A 3FJTA 3TC9A 1FZJA 1WS8A 2A9BA 3T6QC 1I7UA 5LN8A 2X2HA 1BQHG 4UT9L 1JZDC 5DK2A 4U1LB 4HS8L 1QI4A 3I85A 3PDOB 3BT2H 4HEME 1NGYA 2ILLA 2WCPA 2RB8A 4AK1A 3VSVA 3ZHDA 4XCNB 4E41E 1HI6A 1FNEB 1OTTC 4DWHA 4KJPC 5ITFA 4N0CC 4LP8A 4IIQA 4ELKA 2ESVE 5T3ZD 5IOPB 4HZLA 2AK1H 5CIPB 1BLIA 3BN3B 1WD9A 3NFSH 1MW0A 4ZG1A 3DYPA 3PP4H 4A2GA 5JW5B 1G7LB 3TGXA 3WKMH 1NGXA 2NW2B 3TFBA 3QS3A 4ZFOL 5BXFB 3B3BA 5BZXA 4R6UA 1Z9LA 3HR6A 5HVWA 4MQXD 5EPMA 4XCFH 4NJ9H 3ZYJA 1CICB 1GZHA 3VNZA 3REWA 1YVLA 1KPVB 3LD8C 4U0RC 1HINH 5CJOH 3ZTCC 5D4JA 4ZQKA 3KYNB 5DRXB 3A22A 3UO8B 4OZIB 3V5DB 3TZVC 3QA3A 4OCXL 1IGML 4TVSa 5L9DL 4I1NB 4WCYL 3IF1B 1B0RB 1IL1A 1CXIA 4ODVL 4L1LA 3VFTB 3WFDH 1C08A 3OG4B 5BRQA 4BUQA 3PV6B 4TLSA 2Q76B 1IIKA 5I1KL 3DJRA 1I8IA 3BVUA 3BH9B 1I8KB 4MJIA 4HSAC 3GSUB 4Z3HA 3R06A 5HD8C 5IEKB 5KW9H 1VCBC 3ZYOA 2XG5B 5IVNA 3WNOA 5SWSA 4LVOB 2DM2A 2E9JA 1FL5A 4OAWA 5CS7A 3UG4A 1F56A 1ZLSH 2GCYB 2PCFB 3IDUA 1DQIA 1ORSA 1YN7B 3DJ9A 3FFDB 3JWNG 3V4VH 5A2KH 4GINA 2VZSA 2X4TA 1A7RH 4W4OC 2IAMA 3VXMB 3V0JA 3DXAB 1N9PA 4NC0B 2AVGA 4B9JA 2BIIA 4N8VA 4MJ6A 5D8JL 3VGBA 4BINA 1UH2A 1TJHH 1WH0A 4IMLA 5DJ8B 5CKAA 5FLUA 2O61A 3EO9H 5HDBE 3VSUA 3EO1A 2QGBA 1OWWA 1PKQE 1VERA 4L4TD 5IP4A 3A6OA 2P3YA 4F2ME 3TV3L 5ITBL 3P3YA 3NGBB 1RUAH 5DO2C 3S37H 3HMWL 4WI2A 2NXYB 4TTGA 3AAZB 4FL4C 4JO2H 1ML0A 4TV3A 2Q3AA 3MLZH 3WTWA 1OPGL 4LNVA 2P45B 2Y06H 3S88L 7FABH 4BZ1A 3US0A 2DIBA 2OL3H 3STZA 4JFEE 1KXQA 4CNIA 3US9A 3EHBC 4H8HA 5T1JA 5C6WH 3M8OL 5I1HH 1BBJA 2V17H 3RWGA 3B5GA 3S3DB 5MENA 4P2QD 1OK0A 1SHMA 4ODUB 4PJ5E 5CU5A 4ENZA 4F7MA 3W9EB 2YO3A 2Y1VA 1QPPA 4L9LA 1NC4D 2FO4B 1E7UA 4P46C 1HE7A 1DSFH 1ZHKB 4K9EL 4FMFA 4RDBA 3UERA 4DGIH 5HYJB 1GYVA 3ATAA 4G5AA 4IKKA 4S0SD 3WNPA 4LAQL 4HK0B 3QXUA 3VXPB 4DVBB 4PY8I 1NBVL 3WIIH 4G8GE 3DSNA 1ZSHA 4UF7C 5GHWH 1BJ1H 1IAIM 2VO5A 1W9XA 3ZYIA 1JZJA 5DQDH 4KMTL 4XGZA 5EULV 5DHYB 5FM5O 3NAAH 5I15H 3MNZB 4L0YA 4A6YB 4QOKD 4UV4L 5E8EA 3QAZB 2VE6A 1JWUB 1MCPL 1UB6B 3C2AH 3POHA 4HUCA 4UOJA 5ANME 1JPFA 43CAB 5F7LB 2X6BA 3U6RB 2A0LC 2VDRB 1T6WA 4CN1A 3QEGL 2DQIH 4LLQA 3MJ9L 4PI2A 4H0IA 3H6JA 1ZIAA 3ARGA 3EJYD 4MD0A 2KBGA 4Y16A 2R51A 3K2IA 1EBAA 3OPZL 3QQDA 3ARFD 5FUCE 1XR8B 1M05B 2HAZA 3MRBB 1QI5A 1NUDA 2JNZA 3CAFA 3MJ7A 2LABA 3TEUA 2YLHA 3WTVA 4M7ZB 1BJ8A 4WK0B 4JFZL 4X0KA 3QIBA 1N0XL 3SE4C 3D48R 2WTRA 2O72A 2MCPH 4JJHA 4XN4A 2R83A 4Z0BH 2BMKB 1YC7A 3MRKB 3ULVD 3BAYA 1Q0XL 4DKFL 1EHXA 3A4AA 4G80A 2WJ5A 1RULL 3NIDE 1E4KA 3CU7A 1AYRA 4LPUA 4XX1G 2A4ZA 4Y4KC 5ICUA 4MA1B 1S9XB 4H1LA 4EZLA 5FDWB 5EDXA 2DH2A 3M1BA 4MMZA 5HPOA 2CM5A 2IPUK 2Y69B 3C5ZB 3IDGB 3LH2L 1AXTL 4L3CA 4OI8A 5E5LA 2Z93B 4EE2A 3UCQA 1O7DC 2Z8VC 4ADGA 4ZUUB 2OM5A 3IDMB 4AM0Q 2H6PA 2NYYD 5AB9A 3TXAA 1M7IA 2W0KA 2TRHA 3GJEA 1A4KA 3I84A 5F1IB 5H35A 2FWOA 3LHPL 2IQAB 2NY3C 4I3RL 1NIBA 3N43F 4DKDC 3O9WA 3CZJA 3TH2T 3GJFB 2ZWYA 4G9FA 3AY4A 4R3SB 4TULH 3VYNA 3FHQA 1MRFH 2V9QA 3D87B 4Y8DC 5HHMD 1T20A 2VL5A 2KLTA 3RBSA 4DN3H 4RCAA 4TQEL 3CMGA 1J9QA 3OLIA 3ISRA 2FR4A 1MVFA 3ZKMC 2WYTA 1OP5K 1A7PH 4K7FA 1CYXA 3SBPA 3T6WA 1KB5B 3G6DH 2BRQA 2KH2B 3F7LA 1NFIB 1T3FB 3DUSB 4B3EA 4WKZB 3WY3A 4WTQA 2GJ6E 3K0YA 5J6HB 4NQTA 2E0PA 3BVNA 4WQOA 1FE8H 1JXJA 3WELA 3AQDA 3LIZH 4IBYA 5DT1L 3W0WE 3MRPB 3LKQA 4R4BB 3QDME 3QQ3B 3S5YA 4HJJL 3RDTB 1HXKA 4MQ7B 1KPRA 2VSKB 2VN3A 5D7LB 5T5FH 1NFDB 3UGXA 4PY7A 1I9IH 1MHCB 3W56A 1E2ZA 4WNQA 3CFEB 5AKRA 1D9KB 4WUKH 4JY6B 2IG2H 1Q38A 4U1NA 5FKPB 4F7CA 1KV7A 5EO0A 4MDIB 3GMRB 4A63A 3EFDL 5CEYB 3TWYA 4Z1PA 1E5AA 2Y7SA 4KDTA 1WAAE 3V4PH 4V1DE 4N1CA 5C0AA 1AACA 3NJXA 2B2XH 1BV8A 2DICA 3F5WA 2EDWA 4JE0A 2AK4E 3KPMA 1PLAA 1MQ8A 3KLHD 1IVTA 3NZHH 3D39D 5A16A 4HLJA 2NY0C 2WXRA 4GG8B 3IDNA 4MSWB 4QHUB 5D2LE 5DK0A 1KC5L 1SYSA 2WUCH 3EO0B 4O02L 3TA3B 5IR1B 1Y18B 3AWGA 3I75B 4QGTA 4X5XA 3C08L 5T1KD 2BINA 1JGDB 1FHGA 1K9TA 4HF5L 1E27A 1WSST 1BOGB 1DVFA 3ISYA 3VXSD 6CGTA 3VGDA 4P5TC 4ZSOA 4BRVA 3QPQC 3VI3F 2VLMD 4MQSB 1J0HA 4QY8B 3EYFA 4UT7H 4LHUB 4FTVA 1XSKA 3RPKA 3MREA 1BZ7A 1CF8H 1UACH 4HULB 4NO0B 4OT1L 5H37A 2A9NH 4BSWB 4GAJH 1UWYA 3FPYA 4C4KO 4DQAA 3VFWA 1HH9A 2EDOA 1F11B 2BVOA 3TM6A 5GRZA 4GUPB 3CLWA 4X7TB 2JIXD 5BZWA 4C8XA 5J89A 5KVFH 5LWYL 4QXUH 3RNKA 1U91B 3B7SA 2R69H 3N6YA 4A7UA 1ZA6B 4I87A 1DBAH 4PB0H 2QPDB 1E6JH 3L3OA 5ELIA 2BZDA 4MXWH 2OZNA 4JZJC 4PIBA 3KLQA 1SM3H 1YEJH 3AXLA 2PR9A 2XTJC 2AXJA 4YEFA 4GLRH 1CXFA 1FZOA 3MRGB 3BH8A 1IZJA 3OC5A 1NCHA 3V6BR 3AITA 2DQGH 1F90L 3NIFB 3QUGA 5CBEA 2XXCB 1PZDA 4KX8A 4W9EC 4YMPA 4BQ6A 4YUEH 1O75A 5GGSA 3BUPA 1TTFA 3CVHB 1CFTB 4G8IA 2LLGA 5KVDE 1E5BA 3K71B 1GTNA 2EYRB 1C16A 2A6KB 1QLEH 1ZE3C 2FJGA 5F97E 3SOBH 1A2YB 2EVHA 4LGSB 1M3IA 1T1XA 4RMUA 5EOCH 4GSUA 4EUPG 3QAQA 3S3SA 4ZW5A 4QRRB 1ZSDA 1OF2B 5GZOC 3Q5OA 1M7DB 4LARL 1F8TH 3CSFA 3HZVB 4NZTL 2XTLA 3KNBA 4L3EA 4Z7UE 1SEQL 4X4XA 2H0JA 3HRZC 4P3CL 2NY6C 4DP6X 2JB6A 2ATAA 3R4RA 1UT1A 3QJUB 3FFCE 3U9UB 3G5XB 5ILTL 3HG2A 4MMXB 4JDTL 4K7PX 1W72H 1I4FB 4N0CD 5DHXB 3NCJH 4JFXB 3E8VA 2G9HB 3BVXA 5DJZA 3S0PA 2DQ6A 2HG5B 3NABL 5JMOC 2R0WL 5BNXD 4NI3A 2HYMA 3GK8L 3HG3A 1B4TA 4H13C 2QQLL 4EAEA 3VD9A 2WLNA 1ZCRA 3H54A 4YHIB 4OZFH 4U6HA 3VWJB 2Q8BH 2ZXDA 3S48A 5D1XE 3BIBX 4CMHB 4XPTH 1E65A 3D4CA 4OV5A 4HW6A 3WSQL 1AQ8A 2P9RA 5E2UH 3H9SA 2XN0A 4LF3B 5J3HD 1WG3A 4HAKA 4PJHF 5DJXB 1XCTB 1GC1C 2OW7A 4HBCH 1TPXB 5KANI 2VLRB 3KEHA 3BIKA 4KK5D 1JK9B 1RZKL 1V7NH 1E28B 3WIHL 4WFFD 3T0ED 1DQLH 1BOYA 3K5RA 4F91B 1BXXA 1KGCE 5HDOA 1B2WH 3IRCA 3NJJA 2FH6A 5HGDB 2VLKB 1DO5A 2C26A 5FO8B 1IFGA 5I26A 3S4SB 1C7TA 3BUDA 3L3JA 4Z7VF 5CINL 4Z78B 1G7PB 2FHCA 5B4MC 2F9BT 1H3PH 5K33A 5C86A 4PFEA 4FLOA 3AG4B 3NTCH 4UIMA 3U1SH 2ADGB 4I0KA 1QA9A 5BUAA 4RIRB 1P9MC 5HD8D 4ELMB 1QYGL 4CC4A 1DFBH 3TBWA 3QULB 2ZKYA 5LGHL 3WAJA 2B8OT 2WXPA 4KBPA 1OSPL 3KW7A 1MZYA 2CKBL 4HEPG 3V52L 1QO3A 3LNGA 5AL0A 2D7PA 1IRAY 1FLRH 5B7EA 1AO7B 1IE4A 4E9LA 1XEUA 2XV2A 5CLWA 5JW3L 1DR9A 3WXVL 3AJ7A 4Z7NB 5ABDE 4HWBA 3FYEB 1ZHNA 1NL0H 4JPQA 3D25A 4I13B 1U3HB 5HHNB 1ZT7B 3PP3K 4PGZA 5TH2B 1E4XH 3N44F 4YSEA 3WTUA 1T83C 3TEYA 1BVLB 2ATKA 1YMHA 2C4FT 4KKLC 3LQAC 3U30C 1T5XB 1NKRA 3ZDXF 5I9QC 4OFDA 5GJSL 4MD4A 3II3A 2FAUA 3CN4A 4PJ8A 5DO2D 3VFRA 4H25A 5AALA 2DIAA 3RB7A 4HVBA 1MN4A 4IGBC 1I8MA 4ZFZA 4BUGA 4FQXB 3RZCC 1TJXA 2VC2L 4QRSA 3S35L 5K9OA 3OGCB 3FRPB 1NAML 1CFNA 3WFBH 2WB7A 2E86A 4NQQA 1RIUL 2MPAH 1F6AA 1U8KB 3JWNE 5F1NB 1X3DA 3X3GH 4YDMA 3GRWL 5DGRA 5E1GA 3CU1A 4AVJA 3W9DB 1UZ8A 5GGSY 3MV9B 5D71L 1LEKA 1N0LB 1OB0A 1K4CB 2I07A 4WO4D 5EBWA 1Y0LA 5BUPA 1E9QB 2WW8A 5FYLE 3R8QA 2DLEA 1MW1A 4LCIH 1IAOB 3EOAA 5TK4A 1SFHA 3L4XA 3F3HA 1S5HA 3MUGB 3UDWC 3QG7L 3HC3L 3HIZA 5A6IA 4PN6A 1W8OA 1QATA 3DX6B 4WHYG 5C0ND 3FN3A 3RFZA 1JPST 4HKXA 4JRWA 4LAJH 4F8OA 3IMTA 1RPKA 3EYOA 3KJ6H 3GMMA 5F8RC 2E8ZA 4QRPB 3RIAK 2VB5A 2H7WA 4GAGL 3QUMB 3ALWA 4KMQA 2AJSH 3DOSA 2HH0L 2DQJL 5IW3A 2BOCA 1NCTA 4NRYA 4XVJL 5K1NA 4NP9A 3F00A 4PJEB 2JKSA 4YFLI 4PJFF 1BMZA 1OIOA 1BWWA 4GMTH 4KJQC 5B38G 5T3XL 3PL6A 3RGHA 2A0LD 1X5LA 1XSJA 1MI5E 1LE9B 4NPYA 5GXBB 3DPDA 5EA0L 5C07D 4YX2H 4NUQA 3NG5A 4XPGH 2NUPB 5F3BA 5JPNC 2UZYB 3L6FB 1SDDA 1A4AA 3AM8A 4GQQA 2EACA 3SE8H 1Q94A 2D2CC 1U93B 1D7BA 2YD6A 3C60B 1MCJA 1NPJA 3PF2A 4N6QA 4E0RB 4MNQD 2ZAIA 4IRJB 1SJEA 1VGEH 4CILA 4DAGL 4MNGA 2XN1A 5EU6A 2VKWA 4BH8A 3VXTB 3KDPB 1BF8A 3RB5A 4YXHH 2YS4A 2J1YA 3UGUA 4ERSH 1DN0B 4KI5F 4KUCD 4JFQA 5CUSL 5A43C 1L0QA 2AV7A 2J5WA 4P5MA 4I18B 4ZOAA 5E2VH 4MGXA 3GS7A 2K0RA 1M2OA 2XWBA 4LXFA 5KSBA 2XFXA 1TEGA 2DRUA 1GGCH 3QNXA 4OGAC 2O6DA 3MLRH 1N8ZB 4QLRA 3WJLA 2MCMA 2A9CA 3FUFA 4EOWH 2MQ3A 1AYOA 4X98A 1HS6A 4ODSL 2Y3AA 4G7YH 4HPYL 4LL4A 4YBLB 1VESA 3A6BL 3NJKA 3BKML 3II2A 5HDQH 2BHFA 1RJZB 1WBZB 1F42A 4JRXE 1UYWL 1D6VL 3GBML 4XN5A 4GW1B 3V4VA 4K3EL 4M5ZH 4EDXA 3SYQA 4R96A 4CGUB 1MOEA 4AK2A 1IEBB 2EYSB 5KBPA 3RUGA 1JJUA 1AJ7L 4AZ8B 2MRYA 4M6OH 3HB3B 1A21A 4OD1L 4RAUA 4YSTA 5AOIA 4ZUSA 4XX1E 3BQVA 1OAXH 3GB7A 4ZMOA 1OF0A 2XWCA 4WLCA 5CN1A 4YZFE 4Y1AD 2DB8A 2YPLA 4YBHA 4RMBA 3CFMA 2CO3A 4Y5XA 1OP9A 3NPZB 2Q7YB 1BMGA 4XP5H 4BQCA 2MQCA 1C5BH 4ZPTB 5C0CD 3U6XS 1MXDA 4YSAA 4HCIA 1RSFA 1JMZA 1EO8H 4JO1H 4FMKA 4YO0B 2OL3A 1MCFA 2B4CL 2ZOUA 2I26N 2BC4A 3KR3H 2VISB 2ZOKA 3HE7C 1ONQA 5DA4A 1SMAA 3WNMA 5I17B 5TE7H 1U58A 2O5YH 2OXHB 1IM3D 4X6CF 1DJGA 1FWXA 4IRZH 5KWYC 1LWRA 2XN9D 4N0FA 3LMJL 3ZW3A 2GK2A 4ORZC 5IQ9B 4HCRH 4WSJA 3SPGA 1AS7A 3FO9B 2HFGL 3IDJA 3PJNA 1LO4H 3HI5L 4GRLA 4JFHE 5AOLA 4I0PC 4ZZKA 4RDQG 4LKCB 4FI8A 3UBXB 5B8CA 4JKKA 4GQRA 2PP8A 1A14L 2NY0D 1DE4A 4JCWA 4IQHA 5TQ2H 2F08A 5DJDB 2LQRA 4AYFB 4DW2L 1U4FA 3NJMA 1SOXA 5DJAB 7TAAA 2AHIA 3R18A 5HHOA 4Z7UF 1CIUA 3LS5L 3O4LB 4P5SA 4X6DA 5C97A 2KI6A 2ED6A 4N2KA 5MEOA 3ZBMA 4P2OC 3Q1EA 4FXGA 3OQ3B 4FLQA 3D7PA 3QPQD 1OTUC 1EH9A 3S36X 3W5MA 2BWIA 4PRPB 3QRGH 3S2CA 3AXHA 4OW6A 2XPGA 3IFPA 2FWLB 5IBUB 1QWHA 3SE3A 1JCKA 2EP6A 3VYOA 2XX1A 3V6OC 1CL7L 1UVQA 1G9NC 2A9ML 1SUHA 3HAEB 1XBRA 4NKIL 1VEOA 2EUWA 2VTFA 1XGTA 1FL3A 4FNTA 4DERA 2P8MB 1A6UL 1KIPB 1RLBA 2XNAB 4KJYB 3E0GA 1YHPA 2W95A 3QEUB 4ATTA 4M5YH 4NEHB 1EEZA 1NEPA 2EDDA 5IM7B 4AQ1B 1K6QL 2XTJD 4HXBL 2K70A 2PETA 3KWUA 1UADC 1U8LA 1GJIA 4W9ZA 4BK8A 4GUCA 5DFTA 5JDSA 1FFTB 4J6IA 3C6LB 2WSDA 2FZ3B 1F3JA 3O4OB 5IF0A 1GGYA 3DIFB 4TF4A 5C08D 4YGAB 4RFEA 2YKLL 4Q6KA 5SWZE 1D5RA 3F2LA 2WLJA 3NCYP 3MYZA 4ES9A 3BAEH 3O41B 3CLFH 3I6KB 3K3QA 1WFNA 1CF1A 3CZEA 1NPUA 4TQ8A 3IBOA 1ETZB 3OPUA 3LEYL 4FXKB 3PQYA 5DZVA 1IILE 1Y6MR 2HT4C 3RU8H 1KCSL 2V2WA 2N1TE 4P4KB 5GZOD 5I1JH 2VNCA 3EUDA 2X6AA 1L9RA 1NGZB 4JZOB 4KO7A 5HGAA 3U79A 1J12A 3GHBL 4J3VA 1N4XH 1PAZA 5DS8B 2D2OA 5ALBH 2RCSL 3OMIB 4OUUB 4R26L 5FM4A 3I6LE 2GITB 1I9JH 2NY6D 2ICCA 5JHAA 1YYLL 1ZTXE 4H26B 3LV3B 5CF3A 4H0LC 3S97C 1BREA 5JIDA 1BQKA 1YEWA 2JJUA 4ZUVA 3IAPA 3ATFA 1CBVH 1GYCA 4KQ3L 1JAEA 1X5ZA 4YSOA 1J5IA 4Z7QE 1ACXA 1EAJA 1DJXA 3QJTB 3BGMA 3GBEA 3IE9A 4I2XA 1BBDL 5A7EA 4AGQA 1D5BA 2YOCA 4LCWD 2FHFA 5E6SB 4YHPB 2ADJB 3TBYA 4MKMA 3CXDH 2YA2A 4X99A 1S5IL 2VYRE 4P49A 2QHLA 5DGQA 3DDGA 3WL9A 5A7BA 2OS7A 2BFVL 4P8QA 2OSLA 3BVWA 2V2XB 2ZXQA 4NDMA 4NRXA 4YDIL 5T5FA 3VH8B 4J1UB 2F53E 2HVJB 3BCDA 4OCNC 1GGIL 5GS3A 3IE4A 5EEXA 5JXAH 5IGXH 1I1AA 3BWUF 1F00I 2VN7A 3V10A 1U8CB 2Z31C 4G72B 3ES6A 1WUNT 4AH2A 5INDA 3GEFA 3BP7B 1ZWIA 1Q1JH 4HH9A 1NOFA 2HPTA 4HSCX 3H9ZA 1UJ3C 3HOGA 1RLWA 4M6NH 2FNBA 1SF5A 2CUIA 3I6GA 4FNLH 4EO5A 5HPMA 3KS0J 5DMJB 4E41D 5IJVA 3X13B 1FAIL 5LQBL 3VFUA 1YEDA 4JLRB 3C75A 3RWEB 1KEGH 3O6FB 1J8RA 1T7VA 1LO3H 2ESVD 4J8QA 3BLPX 4KWUA 1S4IA 3HI1A 4G8FA 5HYQA 1KLGA 2R2CA 4YAQB 1MWAL 2X4PB 3VRIA 2APWA 4PJDA 3FQTB 5D1ZC 5GS0C 2C9VA 3PWJA 5T3ZH 5C3LD 5I1DB 5ICYA 3E1ZA 3K8MA 3QFDB 4GXUM 5HDWA 3G6AA 1HFUA 2WLKA 4UM9B 1FH2A 2YD0A 1QACA 4FNPA 2VSDA 3F64A 4MA7H 5FO7A 3NN8A 1Q72L 1OCCB 1E4WL 1BA9A 2Y07L 2KPWA 3U7YL 3WO4B 1Q8MA 1FGNH 3IPFA 4N25A 4EI5C 2JJSC 2ZUUA 4BFOA 4MA8H 4N0YH 2ROYA 2Z6FA 1NCDL 2R69A 1WUZA 2VDPB 3C6SB 5DK2B 1AE6H 4HMEA 3D1MC 1AHWB 1MJJB 4P4RB 5TPWH 3U9PL 3VXRB 4BWWA 5HHXH 5BRPA 2HWZL 1NGYB 3IDIB 3K2UL 4HX1A 4LIQE 3HLKA 4IGBD 4PS3A 2GFBB 3RZCD 4PJ9C 5ITFB 1HI6B 4JM4H 1JL8A 1AXSA 2X7LA 3L2NA 4MBOA 4F8NA 4HZLB 2XBDA 4RMSA 1G7HA 4X7DC 3MBEA 5F89A 2B9BA 4BFEA 1AD9A 1GSMA 5E9DB 4A68A 1ZHBA 4CRPA 2YUVA 1RIVL 4RESB 1LE5B 3KJ4B 3BWZA 1NGXB 1TCMA 3THMH 1F1GA 1HHGA 3OKNA 5EPMB 2V7HA 3DSFL 2BM3A 2JJVA 3L1FA 3NRFA 2HKHH 4OSUL 2WVSA 4RAVA 3REWB 5AB0A 3IAQA 2E9WA 1GZPA 3S5LA 3LB6C 4U0QB 5EFIA 1KBGH 4JDZB 1HHHB 3D4YA 3KLAA 3QA3B 3CGTA 1NMAH 1IAKA 3Q8FA 4GQPH 4D0DA 3EOTL 5GIRA 1PZCA 3ZT6A 1IL1B 3VGEA 4K5NA 4ZW8A 1ORQA 5F9WC 3ZDZF 2QDWA 2C3WA 5D7JB 1I8IB 4UIKL 2A77H 2JQMA 2VAJA 3M88A 4FEMA 4JFED 1CIDA 3WE1A 1JG9A 5SWSB 4Y4HC 2YWYA 5DYOA 5FIEA 4OAWB 5CD5C 4N0UA 3JWNC 3IWVA 2OSWA 1MHHB 2WVUA 2X2JA 2GJZA 3FCTA 5L4FA 4M7JL 1V3LA 2VR7A 2IFFL 4PJ5D 4NN6C 5JIIA 3QXWA 4QKXB 3ARDB 3IMWA 4ZTOH 2NY4C 1VIWA 3BN9C 5DMIL 4PW3A 3U7AA 5TGBB 4GAYA 4TMPA 4N8VB 4UB0L 5JHDE 1OM3L 3WHE0 1Z9MA 1KB3A 4HGMA 4LSTH 5FF6B 1EIBA 2O61B 2Z8RA 3GT6A 3O3DB 3UIYA 2VXUH 1AY1L 4B95C 5A2AA 4IBLT 3IAGC 3EO1B 3HUJF 2PPDA 2C9SA 4G8GD 4MCZA 4ODWB 1DSYA 1CGVA 1XX9C 3HG1A 4UZSA 3KPNB 4EJ1C 5TD4A 3LIUA 2H47C 3O2VL 4Q9RH 4K7PH 5ESAA 4ZNEE 4HIXL 4UTAL 3H6AA 3LRLA 1FC1A 1U8OB 4RMQA 4PRHE 4UAOC 2GTWB 5FHAL 4F9LA 12E8L 3O3AB 2UYLB 1XD0A 4KKCC 3STZB 2B39A 2NT1A 2Z1PA 5CLTA 3FUMA 4OGAD 5MEPB 3T09A 1Q9OA 4ZOEA 1KEMH 2WQSA 1QP1A 4JQIL 3QPXL 3CBKB 1XF5B 3T9WA 3RWGB 2PYEE 1CR9L 2QTEA 5E1AA 4ALAH 2WANA 3JQOB 5I76A 2D3NA 3VFMA 3TBBA 1DP0A 2Q20A 1ERNA 1SBSH 3F62A 3L4CA 4L9LB 4LSPH 5C3TA 2EDBA 2X0WA 2FT7A 2J57A 5AVRB 3STLA 3LTVA 2OTUB 3IRZA 3VI4A 4WNSA 3OSKA 1HL9A 4Z7WE 1T03L 2EECA 3JV5A 5DD3L 3LKOA 2KUTA 1CLOH 4JPIA 1AD0A 3D4ZA 3SBQA 1SN2A 3CFJA 1NOAA 3N04A 2BNUA 3MXVH 1L3NA 3ECWA 3ZRSA 2Z9TA 3NZUA 4NO3A 3OKYA 1FYHB 1XF2A 2D9CA 4OCYL 1S9KC 4B9KC 4PG9B 4P57B 2AJVH 4KVCL 3N41F 1DYZA 3U0TA 5E8EB 3ULVH 1C12A 4GG6A 1MCCA 4JFFB 3H85A 4U2YA 1KCUH 1LO2L 4ZMPA 3X1NA 1CK0H 2XICA 3KGSA 3B7UX 4Y5VB 5DR5L 2VRAA 5HJ3B 4KZDL 2F8VA 4JPVL 2X4NA 3ZE1E 5IFJB 5FYKE 3HE7D 2R1XB 3ARGB 5E00B 1JN6A 4Z8FL 3NH7H 4NNPH 4DVRL 4PWKA 3WNLA 3FSVA 2MWCA 1OB1A 5IWLA 2NXZD 4GRWH 5EZIL 1QASA 1Z32X 4KK8D 2E7CA 2MTAA 4AYGA 4GBXC 1FV1A 4U1IA 2ZUVA 3TN0A 3ZUCA 1MKFA 3K72B 1MCOL 4HHWA 5C0FA 3QIBB 3QC6X 4I0PD 1CDUA 4B60A 2F5BL 1T0NA 2WIMA 3WTSA 3H8NA 4K71B 5F7UA 4Y4FA 3SDDB 4HXAL 1NINA 4LEOB 4MNHB 1YEFH 3BKCH 3S4SG 2BSDA 1YEIL 4BXVA 5ID0A 4G80B 2OJEA 4PSPA 4UAHA 3ZTNH 3REVA 3TA4D 2GJ6D 3ML8A 4AMXA 3D2UD 4HOMA 3DX7B 4YS4A 2J8UF 4NNYA 3ARBB 2SEBB 4GXVL 1BCIA 1NCNA 1BZEA 4MMZB 2ED7A 3K7UA 3PNRB 3W0WD 5EU3A 4P2OD 4Y0GA 4L3CB 3QDMD 3MUUA 3V6ZA 5BV7C 3FTGA 2QQKL 4FJZA 4ONGL 2H6PB 1OTUD 2H3NA 1Y6KR 5TE6H 5GJTL 1HHKB 4G6MH 1EXHA 3GJEB 3T2NL 2YGPA 5H35B 2BXYA 3WN5A 3HZ3A 5J57B 1SDAB 4BUHA 1OHZA 2OMTA 4HU2A 5LO7A 2HJFB 3O9WB 4NBXB 3MZTA 3PUCA 4LSSH 4KI1A 4G9FB 2P5EE 4XNQA 3B2VL 4ZX3A 5CN3A 1TT6A 1Z3RA 1WBYA 3ETSA 1S7XA 5JUEH 4PYGA 4GRMA 1T20B 4V1DD 5KSAB 2FO8A 2WUBL 3P30H 3GM8A 3F84A 4MAYA 2AK4D 3FQWA 1UOWA 1GW6A 2CO2A 1LHZA 1FCCA 2A74A 2B5IB 1A9EB 2R4SL 3BSHA 1N6QL 1KN2H 3LZRA 1J87A 3QZWB 4JQXA 1N64H 1TVDA 3SDXB 1P53A 3L4UA 1XQ4A 4JX0A 4KTDL 1F2QA 3FT3A 3BVNB 1UXWA 3COOA 3ME0A 5ESVB 5A6MA 4GEJA 3US1A 3V7MA 3O6KH 1O6VA 2PWFA 3LKQB 1AZZC 3QWOA 5K9QI 5CILH 2M26A 4M43L 4JREB 1HXYA 4PY7B 4H40A 3RPBA 2YD5A 4P99A 1AZRA 3HFML 2CO4A 2OR9H 1ET5A 1A4JA 3VXME 4TSAH 1XB8A 3DXAE 1WBXA 3VTMA 4BH7B 3VD1A 4TSCH 4P3WA 2HT4D 1JNLH 3ULUL 4YR6A 4WV1A 1QMUA 1IJ9A 1BM7A 5E70A 2WNXA 3HPLA 2ADFH 4GSDL 5EUOF 5C0AB 2FCBA 2FYYA 1EGJH 1N59A 1SY6H 1SUJA 3UBHA 2BZ7A 4PRDA 1K4DA 3WMPA 4R2GC 3T08A 5EF3A 1JNJA 3UAJA 4RMTA 2BP8B 2UUDH 1U8NB 4ICXA 5A16B 5F3HA 4M93C 3FU9A 3PJSA 1SYSB 5FGBA 1TTBA 3WEBA 3RWCA 3U82B 2R4RL 4X5XB 2EDJA 5F70A 3D0VA 4DESA 1Y6NR 3TBVA 3AROA 9CGTA 3OHXA 3QJVB 2BCMA 2IANE 3WFEL 3VDBA 1CFVH 1J5OL 3ZPDA 1E2VA 1W2KT 3LN5A 4N6RA 4BEIA 4ZSOB 6FABH 2YRZA 5IBLC 4WSGA 3MV7A 3EYFB 4M7KH 3TVMA 1DANU 1QSFA 3F65A 1E4HA 1BZ7B 4R0LC 4F9PA 2QZQA 4FHBD 5C92A 2OR7A 4Y1TA 1AKPA 1FN4A 3FMGL 5CZXC 3VFWB 5IW1B 4YWGH 2BVOB 1XH1A 3U46B 2BCKA 4C58B 3TEZA 5HYJE 5BZWB 3OR7B 5AZ2L 2H4EA 3HE6A 3RNKB 2XVKA 2R2EA 1FO0H 1TU2B 1WZKA 1S7RB 1T7ZA 4BD4A 5DMKB 2C5DC 3OC8A 4FP8H 4HCRA 3MQIA 5TDPA 1FNAA 5AVQB 1BX2B 5I75C 3FO2A 4OZGE 2YMXH 2J20A 4XP1H 2J12B 3FFCD 4IIQC 3EGSA 3E2HB 3BOVA 4NZ8A 3WIAA 5BCAA 3BH8B 3T65A 5AVTB 5IHUH 1F4WL 4EN3A 4JM2D 2JWYA 5L8KB 1SNRA 3D69B 5DZAA 1NSNH 1A25A 3LS4H 4HGWA 5F1OB 1E43A 4G6KH 5D1ZD 3TYFB 4XAWH 4PRNA 5D1XD 1J1OH 3BFOA 1T1XB 4ZPVA 5D96C 4AEEA 4NUJA 1GZHC 3L1OL 3P2TA 3TU6A 2E59A 5CSGA 1MQKH 1R0AL 5CZKA 2WWNA 5AYUH 2CA3A 1KXVA 5BZZA 4QYOA 4YH6A 2F68X 2OCJA 3SGKC 4M9OA 3BESR 2ZF8A 4B96A 3GLAA 1KGCD 5F96H 5G5DB 3KNBB 1IT9H 4L3EB 1BVKA 3KPLB 2DYPA 4LPXA 1TDQA 3F04A 5CR8A 3H3PL 1UQSA 2B0SH 3D3VA 3K46A 4UT6H 5EHFA 2WLIA 1MJ8H 2CBOA 1JI1A 4Z0XA 3WS6A 5FO2A 1CXKA 2PPCA 1S3KH 4Q74A 5BW7C 2BSBA 4PJ9D 3CQFA 5FYJE 4M8QB 3AS2A 2BRRL 3NVQA 5E4EB 4CW1B 5GS1A 3S36H 3EJJX 4FZ8H 4TTDC 4DT2A 1GTFA 2A6DA 1T6BX 4KKAC 3DX0A 5C0BA 2RFXB 5E4OA 4J3OF 3LEVH 3E6HB 3VAEA 4U6HB 1RK0B 1YRKA 1ULVA 4NBZB 4RETB 5IV2B 2VR9A 2WXFA 3FCUB 4RFNB 3H9SB 4AJYV 4OZFG 1E4JA 2YZ1A 4BK5A 2NNAA 3BIKB 1P4LA 4LASL 3RGVC 1GZQA 3KWWB 3D52A 1AIFB 4Y1SA 3LB6D 1T1WA 3TTYA 2ZQKA 4I77H 2PO6B 1PZSA 3A6CH 4R97B 1LGVA 2Y7QB 5LGJA 4R4FL 2AJXH 2Q5BA 4NAQA 2NMSA 3TP4A 3WV0A 2P24B 1G9MH 3BDBA 5JNYA 3V0VA 4BE6A 4WU7A 1P4BL 4P9ML 3TCXA 4QNPF 3ZIYA 4N2FA 1G6RL 1AHMA 2RMNA 1RV6X 4HD9A 2Z4QA 3O81A 3GHEH 4PD4K 2F2HA 1OPOA 2J5LB 5KYYA 3BAWA 3PAZA 2VLJB 1S9YA 4J3XA 2GJJA 3MLTB 1NFDE 2NZIA 4DP4X 4JNXA 3DVGA 2V37A 4Y4HD 2CUHA 1LDPL 3BPOB 2VL4A 3E80A 2EIMB 3ULUF 5DFAA 2I5YL 1QO3B 1PZ5A 1IGIH 4JG5A 4DP8X 5JYMA 4OFPA 5C7ZA 1AQDA 1VHPA 1W0VB 4KROC 4ZAKB 5HYIA 1N70A 2V2TB 5FYLD 4WKXA 2BX5A 2NY4D 1ZLWK 4A6YL 5IBUG 1IKOP 1LD9A 3AG1B 3OAYK 4LLMA 4X7SL 5JHMA 1WK0A 3MGTA 4AKPA 4GI8A 4G9DA 4HISA 2P80A 4YNYA 3VFOA 2WQRA 1PLGL 2VDRL 3VFSA 4HKZB 1U21A 2KMWA 2DWTA 2X10A 1PZAA 3X12A 3Q8AA 1LEIA 3RVTC 5B21A 5C0JB 5HDLA 5IMMA 3UYOD 1FORH 4P23D 1I8MB 4U3SA 3LN9A 1F41A 2K9FB 1RSYA 1NCCH 1Z9PA 4IDJH 5DSCA 3DURA 4KKCD 1XT5A 3M46A 2YK1L 1F6AB 3MV8B 2P49B 5DI8A 4N2IA 2X4UA 1RP9A 3LNFA 4Y16C 2NTSP 4MTMA 3SCMD 3X1FA 1MI5D 2ZAGA 1IBZA 1UZ8B 2B16A 3QNZA 4WVRA 1LEKB 2D3JA 3II1A 2I07B 4XMKL 3BEVA 1DLFH 3QO0B 2CDEA 1OW0A 1ETA1 1OOWA 4NKOA 1KJ2H 3NCEB 5IFHL 5BS0B 4AV0A 4QR7A 3SDAB 2D3LA 1NBYA 3DGGB 2Q3ZA 1PX3A 1Q9LB 1S5HB 3TV8A 4S1RL 2X70A 4GI6A 5EMYA 1FGVH 1A1MA 1RHHA 5TF1L 5JW4Q 4OZ4A 1RPUA 1M1SA 3WKNA 5IB2B 3RKDC 1H3XA 2AQ3A 2K8QA 3AS0A 2WWMD 3GMMB 1IQDB 3P77A 3GGWB 1KN4H 1SXAA 3GHPA 1F0LA 4QHNA 4Q7DA 2LE9A 4XP4L 5DD0H 4OZIF 3NIFE 1PQZB 5IVZA 4O00A 3R7QA 5D4IA 3TOPA 4NRYB 3I9GL 3I2CH 3FUJA 3IU4H 3WJMA 2WINA 4X42A 4F8QA 1Z9OA 3CFKB 2Y5EA 1VADA 2R23A 3C5SB 3BZDA 4XO3A 4D3CL 1AR1D 4ZODA 3PL6B 1E5UI 3VXUB 3LRSA 3TNMB 1I7TA 2WVVA 4FC3E 4NPYB 3JV4B 3LZOA 5TQ0L 1FDLH 4H8PA 1KB5L 3BPNB 3LX9A 4FLRA 4Z3IA 4QRRE 1UG9A 4CADB 4AW4A 5EOCJ 1SDDB 2OZ4L 2UVEA 4KOCA 1HZKA 5GGVL 1ND0A 4NAJA 5F7EL 4JRXD 1HCYA 1VKXB 1Q94B 1EFXB 4GBXD 4N1EA 1NMCB 1ZJAA 4NERA 3D18A 1S8DA 2DLHA 4PJ7A 1YNTA 1QRKA 1QUNB 3KCWA 5LBSL 3CSGA 1OP5H 2NNFA 1X5MA 1HT6A 2CXGA 4OKVA 3CFUA 1HEZA 4XXCA 3ASNB 3DI2B 5IMKA 3PUUA 2NCEA 2B77A 2WXOA 3INUH 3UJJH 2ZUYA 1FC2D 3APDA 4JFQB 2H1PL 1OVZA 1WV7T 2BVTA 2IMMA 1NIAA 2EDMA 3FB8B 2NQ3A 1TKWA 5KSBB 1KWGA 5ACLA 1R3JB 5CFHA 4L4TA 1NUFA 4XH2B 1RMFH 1MFAL 2WIIA 3QWRD 4NLHA 5EU4A 4YPGB 1WLHA 4X98B 1HX0A 4OLUL 2WK2A 4UILL 2AMGA 4XXWA 4P5RA 1RUML 4GMSL 4KDTC 2K1MA 2TAAA 1IE5A 3ZQXA 2VLRE 4LBEB 2AKRB 3GBNL 2UZXA 3B4NA 3SDCB 1XXDC 2WLLB 2ORBH 1U6AL 4POZC 1SDYA 3L3KA 32C2A 1YQVL 4Q4IA 3V4VB 4F7TA 4M48L 2WM0A 4YHZH 4XN1A 1Z9SB 3N9GL 4R96B 5T1LD 2VLKE 5IJKA 2PYFA 5IIEA 4P2QA 4J3WA 1UURA 2QGEA 3BAIA 3RHWK 1WQVT 2KHAA 4JFHD 4M1CC 2PF6A 3RUGB 4X80L 1DQQB 2XWEA 2ZX6A 2GJRA 5DD6A 5D7SH 2VABB 1NC4A 2IF7A 3KXFB 3O45A 2AQRA 4QAMB 1BZDA 3BPLB 3GB7B 3JUZA 1NM9A 5EC2B 2MKLC 2EEDA 5T5NF 2IH1B 4CBZA 1ZA3B 4OGXL 2NX5B 4NZJA 4TS6A 3MGOA 1CDGA 2XBTA 3F6JA 1B3JA 1D5XB 4JFDB 4L8CA 2XZCL 2OL3B 1AO7E 3PHQA 1HZHL 3WIFA 4QF1A 5IQLA 2N3JA 4U1HA 4F15B 2X53A 3FS9A 1FNGA 1SVBA 4QOKA 3S34H 3HHSB 1HJCA 2OYLA 4FNSA 5BVJA 4YDLB 1H9DA 2Z7UA 3U0PB 5BO1L 4HWZA 4N0FB 3ZO0A 2A1WH 2Q7AA 3RIFF 1DDTA 2LGNA 2ALWA 3CVHL 3QZMA 5JMRA 3X1BA 3IDJB 3K6FA 3V5KA 1G7IB 1IGYB 1LNUB 1N3NB 4OIIL 3SPJA 3KDMA 4ZFGL 4ACTA 2IPKB 3HC2A 3ARFA 1AI1L 1DE4B 1NGPL 1UA6L 3SODB 4E9QA 5EWIH 2V5SA 1OT1A 5JW4N 2XOTA 4HKJB 2WMPA 3A67L 3ZE2F 3N1GC 1LEGA 2ICEC 4NBYB 4E5XG 1FFOB 2IPTL 3K4ZA 4O2CA 2LTQB 3ZKQD 5FUOH 1M71B 4GY4A 5D2NA 1BLNA 1G9NL 3UTQB 5T8IA 2LOEA 4NM8L 4KAQL 5MEOB 2BSSA 3FRUB 2YQGA 3OLGA 5SWZD 1CI3M 2WY3B 4FXGB 2DTMH 1WCQA 5CEXB 3TESA 2DLTA 5IBLD 4NUGL 1H15B 1CZ8H 2VDML 3IFPB 4DQOL 1IGMH 5L9DH 2QPFA 1NIFA 4QI3A 4N8PA 4R5XA 3DARA 5CZXD 4ODVH 3ARVA 1UVQB 2ARJA 4L4VE 1JZ4A 1L9NA 4XZUA 3QZOA 2IOMA 4X9IA 4N5ED 3UXFA 4UTBH 3ARXA 3B6SB 2BSEA 2PCXA 4F80A 3A23A 1FL3B 5AENA 5FV1L 2PXYB 2JKNA 3VXNA 5D72L 4I9WE 3QIWB 2EDRA 3I6LD 4YFDB 3UEQA 1YSOA 1QFWH 3OZ9H 1DBKL 4XMPL 5D4QA 4MWFA 2QKIA 1Q0YL 4NN7B 4X8CA 1U8LB 3QYMA 1AXIB 2EEFA 1HVXA 4Z76B 3GMQB 4ODTL 1F3JB 1VFAB 5DZOA 5IF0B 2I27N 2FBRA 4NENA 2D73A 4GO8A 4OZHF 2CGZA 4HHAA 2XA8L 5FAAA 5E0FA 1MF2H 1MHPL 4HAFA 3UZEC 5B1KA 1NEUA 2DJUA 2NY7L 2R0ZL 1PSKL 2WYHA 4U1MA 3QORC 5KYUB 4M29A 2F53D 2PKDA 4Z7OB 1BM3L 1EANA 5FCSH 2BOLA 1ZV5A 4BFIA 3RI5K 1T22B 4Q14A 1JPTH 4OLWH 4QD2E 2OMXB 3UYRH 4MDJA 3D08A 1GC1H 1BG1A 3S88H 1PMYA 3WEAA 1GRWA 4GKZA 1BEYL 1ZV2A 2AANA 4M5SA 4BE5A 1WWCA 4IK6A 1HTYA 3GSOA 3QS2A 2OKMA 1F4HA 4F8TA 5D5MF 1TVBB 4CKVX 3M8OH 3TBTA 1Z2KA 4BCYA 5GPRA 3ARPA 4A38A 4JZNA 2MNUA 4J5VA 4DKEL 4CC4C 5JHBA 4QRQB 4Y2OB 3BSZL 3QAZC 3JT0A 5IHBA 1BMWA 1A5FH 2J6EH 1MEXL 4NPJA 2AP2A 4DTGH 1P5UB 1RJLA 4PLKC 5A2JH 4D8PA 4QGYA 3KYOA 1D5BB 5DHDA 1ZEAH 3D39A 4KKAD 1Z1WA 3AFLA 4LSUL 4NT6B 4AQ8A 3GBLA 4YHMH 1RY7B 2GSGB 1H3GA 3GQFA 1KCBA 1CL7I 4LAQH 5T1KA 3U0WH 4Y5YA 1N5AA 3ERXA 1TOXA 5L88H 1AGCA 1HWHB 5I6PA 3VXSA 3H7BA 4XPAL 5KUKA 3PP3H 4KMTH 4EF3A 2QR0A 3RGVD 2ERJC 1MJUL 3WUZA 3ZHNA 4M7ZC 3BQUC 5EN3A 5I28A 3Q6GL 3ZRCC 4PCTA 4XBPB 3ES6B 4AH2B 5INDB 1XL4A 1MCPH 2FLRT 4IEFA 4PJ8C 3D9AL 4G5ZL 25C8H 5GZND 4HH9B 1QHPA 2DJSA 1OHQA 1WZLA 3EG9A 3DTUB 2YEZA 3GMPA 1EGJA 1DTUA 5GRXG 3KE0A 3LQAH 2JIXA 1JXGA 4AJ0A 5JHLL 2IVFC 1OAZH 4HPOL 4DGVL 5HPMB 2F58L 3L08A 1M9SA 4CUCA 5IJVB 1L5GA 4TNEA 1WDAA 3EDJA 1JV2A 1Z0NA 2UY6A 3GMNA 2UXVA 5DUPH 2OMYA 1VZGA 3AMLA 1TCRB 3CDCA 3KBFA 5DD1L 5HYQB 3FTYA 4I85A 2CPCA 3LZFH 3DOHA 4RAHA 2JJWA 1XL6A 3GXFA 4PJDB 4WU5B 3IXAA 1H5BC 3PWJB 2HG0A 5E8DL 2JLPA 1N0XH 4Y2DC 3G6AB 4KROD 1NC2B 2DMHA 2OJZH 5BPPA 1DL7H 2H26A 3LXAA 2CCWA 5FO7B 3MBWA 4XZ4A 3RFZC 1BSIA 4RFOL 3UCRA 1A6ZB 5DQJB 1USQA 2VMJA 1ZRUA 3HMXL 2ZOWA 1RULH 4PQXA 3GJFK 1I8LA 2BW5A 3OXSB 1U8HA 1A6TB 3MROA 4YK4B 3LH2H 1AXTH 4WFHE 4FFZL 4FS0A 3K6SB 4UDUB 35C8H 1IFHL 1QVOA 4GB9A 3WLBA 4CU8A 1TFPA 5FM5M 1E8YA 3QUXD 3MLYL 4HX1B 3VSQA 3O4LE 3QZWG 3FUDA 4LRIA 2PABA 4B6ZA 2BP5M 2X7LB 4GEIA 4HD5A 5BUGA 4PRPE 3CVCA 3KPPB 3QHTC 1VEMA 1JDCA 3FK3A 3HRPA 1XD1A 3H0TB 4JHVA 3POCA 2V3FA 1BXAA 3HTLX 1QLEB 3QXAA 2DQFA 1HHGB 1LILA 2I9TA 5EORH 3F83A 5JHDD 4RAVB 3VXOA 2JKRM 2CO6A 5JORA 1GZPB 3QI9B 5D6DC 4XO4A 1LP9F 1PS3A 2YPKA 2ED9A 3WN6A 4M03A 2AJ3B 3IETA 5KVEL 3KLAB 3MNVB 4H8WC 3RKDD 1PIGA 1TEYA 4PHXA 4PBVC 3ABMB 1ADQL 5GIRB 1OGTA 1ZLVK 2VDOL 1QNIA 4PJCE 5LNGA 3NUKA 3T6ZA 5ETUA 1ORQB 2GQHA 5DZJA 1KZYA 3T0EA 1YPZE 3AVEA 4TYUA 1EHLL 2IALA 5C0RH 3IJYA 4UT6A 4PRHD 5IFAL 4WWOA 2GY5A 3FUIA 5E03A 3WJLC 3W5NA 3PG2A 4L1SA 3JTSB 3EFDH 2GVYA 1DVSA 5J1TC 2ICWA 1YMMB 4NXKA 5INCA 3CHRA 2JXMB 3QQ9C 3AG2B 2CNYA 4PJXE 4WEBL 2A9AA 3SQOL 3DX4A 4YDNA 1OM9A 1NCGA 3NSYA 3TJHC 2GSMB 2PYED 2VERA 4ELMF 3TH4T 3QH3A 2QPEB 1CUOA 1NCAH 2OW6A 4Z3GA 5FLVA 2IH3A 3N43B 4XVTL 3BUYA 5I8KL 5H37G 4R7VA 5KSVA 1KJ3L 1CO1A 3QT2A 1OSEA 1O7SA 1EA9C 1KC5H 5SWQA 4U1GB 3ESNA 3S3CB 2BJML 3T0AA 3CQQA 2CAKA 4MS8C 4PTTB 1B0GA 4Z7NF 1C7SA 3GXMA 3RVUD 4LGRB 4PREB 1S6NA 3G6JA 15C8H 4HF5H 4LSDA 3S96B 4ZMNA 1FSKC 4WW2F 3HJEA 3RDJA 3IS1X 4W4OA 3LCYA 5B39B 4PJBE 3HG1B 2CLZA 3TPUA 4Y5XC 1WAEA 5ESAB 5KZCB 3UH8A 1EVTC 2X2IA 3ZTJG 3M1CA 4MVBC 5AW2B 3MRDB 4OFKA 3WGVB 3NZSA 5D70L 4N4YB 1FNSL 4MXQC 1Q9OB 3MO1A 3K8LA 4WO0A 2K6YA 3STBA 3VYPA 1TFHA 4E9RA 3S5ZA 1WVZA 1KDIA 1P7QB 5F7NC 1JGUL 2IAAC 1TMQA 1RZFH 4APQB 4LSRH 5I76B 3CXFA 3C8KB 4J6RH 3C09B 5FYKD 1YYCA 5J0BA 2X4SA 5F3FA 1ZKAA 4UZGA 3CPLB 2R1YB 1CGUA 3PDDA 4LB8A 4OCWL 5EC1A 1EDHA 2JV6A 5KANG 3VW3H 4BKLA 4ECNA 2VDLH 3APMA 4POZD 3VI4B 2ZOLA 3RX8A 3UAEA 1ZVSA 3H2QA 4N2EA 3MRMA 3LKOB 4DEWA 5B8CC 2CALA 5CR1A 1NH6A 4H44C 3CFJB 1TQSA 3SQBA 5F9OL 3IJ8A 3L4YA 4MMXC 1T6VN 2HLEB 2DQCH 1CURA 1BYOA 1YEHL 4AGLA 4TVPE 2HFTA 1O5DT 1R24A 2Q9OA 4GG6B 4Z6AT 1VGKA 1XH3B 2JCCF 1GY2A 4L1HA 5DD5L 4C47A 4Z23A 4RMWA 2TRYA 4PJEF 3VI3B 4BZYA 4BSVB 2X89D 1S9WA 1JN6B 3LDBB 4FFYL 3UJIL 1TPXC 2IBZY 3IFOA 1JTTA 2DV6A 3EJQA 4U49A 1FV1B 2WLYA 4N2NA 4U1IB 2P5ED 1FAKT 3TN0B 3RWDA 1T4WA 2DM3A 5FB8A 1KJ2A 1EEYB 3AREC 5H94A 5FDYA 5C07A 5C0FB 4YHNB 1Q90A 3EYUL 1HKLL 3SHSA 1T0NB 1ZLDA 1V55B 3VXRE 3GK8H 3SB3A 4X5WA 3WENA 1G7MA 1HK6A 4S1DD 4M6ML 4JDVA 3SJVE 4AWJC 4E9SA 5ID0B 2L4OA 2OJEB 1CDYA 1F5WA 4EBQH 1VFMA 1UTDA 2KZKA 4M61A 4ANVA 4NNYB 4CMMB 4AX3A 4MNQA 3SE4A 3T1FA 4CSZA 4MLSA 4OFVA 5E9DE 1JVOA 4N5UA 4C4BA 1HQRB 1RUQL 2H3NB 2HXAA 4O58L 5DC0A 2E6JA 3C2SA 3DDFA 3LKSB 1JZ7A 4PCKA 3VXMD 4OTXL 2B7DT 3QHZL 3DXAD 4R90L 3WN5B 5BRZB 2BHYA 1T66C 1O7VA 2GSIA 2YMOA 2HJKB 4AVHA 3P4LA 2FSDA 4NB7A 3EJZD 3O11B 3QFJE 4P59L 1E0OB 5G4NA 4H8VA 4GRMB 3JVFC 1ZY9A 2FDBP 1YYML 4WEEA 3L3HA 3LHAA 4WI6A 3U25A 3K5SA 5KYNA 2WN3A 3FQWB 3B34A 3ZGHA 5DU7A 2RBLA 2CLVB 3QR1A 4QXVA 3V52H 3FTVA 4LEBA 4GQ9L 5CGBA 3FT3B 4XP9L 4BFGA 2DEXX 2XKSA 4RNRB 1ZXKA 4LLDA 2DQTH 4KV5F 5JW3H 1UXWB 2RA1A 3ME0B 1WIPA 3GSNH 3EH2A 2HB0A 2IAND 3DTXB 3NJNA 5I1IL 4KK6C 3NCWA 2APVA 3U2SA 1IVLA 1HXYB 4E68A 4F57L 1Z9NA 1M56B 2VDQH 4JGNA 4GIAA 4KXBA 4ONFH 3T4AC 3TS8A 4Y1AA 3SGDI 3QORD 1WBXB 3NFNA 5KVDH 3F58H 1TYEB 2UWEA 3RTQB 5C0CA 5GJSH 3CX5J 1UOLA 3ARYA 1HEHC 4WTZG 4WHDA 2Y4SA 3O2DH 2R56H 1WCBB 4YHLH 4BGLA 2ZUQB 2AJUL 2G4EA 5IVXF 4A37A 5HYJD 1OV8A 3U7WL 5FCUH 5EEYA 2K78A 3HPLB 4YDJA 1R3HB 1JF1B 2FYYB 2K45A 1N59B 3ZT7A 2GPZA 5D6CA 4PV8A 2ZJSL 1ZS2A 1G9EA 4G43A 2OK0H 4HLZG 1OAKL 3ZUNC 2I32A 4Z7VB 1IM3A 4GW5A 1KYFA 1P1ZA 4QXTA 2XN9A 2NY2B 1BIHA 3LRMA 4J3TA 4M8VA 3KM2A 4UZUA 4L3AA 1RZIA 5KBMA 2DWEB 2VZ3A 2HKAA 1XWVA 5D71H 4Q97A 5CGYC 2PN5A 3IRPX 4U4BA 4HSQA 1UATA 3S3PA 4CDHA 3HA0A 4JG1H 1ZGLB 4ISVA 2D8KA 5CJ5A 1TQBB 4LDEB 3LN5B 4KK9C 2NUTA 1KGUA 2ITDA 4WWID 3MV7B 2VDPL 3K6IA 3UG3A 5DMYA 2Q8AL 3L81A 1QRNE 2MCAA 1UD2A 2W8CA 2BERA 4ZXBB 2ZCHL 5HHPA 4W6XB 1CI5A 1WP6A 3MMEB 2VJ8A 4X6BB 1W6WA 1TZHA 1I85A 3VSTA 2V5RA 3C60C 3T3PF 3OKEB 1KPUB 1RPQA 3BQUD 3N44B 3HE6B 5E5UB 3B2DC 4GW4A 3LRKA 5DC4B 2X1QA 1EJOL 2W38A 1PDKA 3VACA 3WJJC 5TDPB 1KOAA 3ZDXB 2AERT 4JRLA 3PXLA 3BD3A 1XMWA 1R5IB 4HS3A 2OCFD 4Q9BA 4AYSA 3OGOE 3O6LH 4JFFE 1FVEB 3P9MA 4XNXH 5AAMA 3FU7A 4MHHI 3T65B 1PLCA 5DUMH 2ADIA 4UQ3B 4EN3B 3C5ZD 1YZZA 3L7FB 1AGEB 1CDJA 1MRCH 2EH8L 4O2FA 5FYJD 3ZT5A 1M6OB 4HJGA 4JZJA 4RQQA 8FABB 4PJAA 1XDTT 3MA7A 5ICZB 3V0WL 1II4E 4HGWB 1GSKA 4WTWA 3CFDA 1JHTA 1KBVA 1TJGH 4XNYL 5D1QB 4PRNB 4ZPVB 1PEWA 4Y2DD 4NUJB 5MEQA 5IT2L 3ASOB 3DECA 1JZEA 4TM9A 1BQSA 4M1DL 3FQXB 4OD3H 1MREL 5C08A 2IIJA 5HSFA 4QXWA 5DJ6B 1UFGA 2DLFH 1OL0A 3UOAB 5I1AA 4QYOB 2WNWA 4N2LA 5KJRL 3PYCA 3JTTA 4RA3A 3GZOA 4G70B 3HLAB 2R29H 1A6VL 1BVKB 3MACL 1IBHA 5A2LH 2CIIA 2PR4H 3RLSA 3TNNB 4UTBA 1MWOA 1UQSB 5GZOA 4YPJA 5IHZB 1EMTL 4CSTA 3L5JA 4RBPK 4QRUB 1EX0A 5LAXA 1PPIA 1HU8A 3AT9A 2DY2A 3MYJA 2CH8A 1OAUH 4DGYH 4F3FA 3QCUH 3NQIA 1I9RH 3GXNA 2EUZA 3EFOA 5DEFA 3RDTD 3HRZA 5GS1B 1NUNB 1D6VH 1UM4L 4Q9CA 3GNML 3PGDA 5JLZB 2A6DB 1DQML 1TF4A 4NO2A 5C0BB 1FBIH 3GC3A 4WK2B 1D9KD 3KVPA 1MJ7H 3DC0A 1Z3GL 4GKOA 4PP2B 4PJGA 5CHNA 3LPOA 1MFEL 1P5VA 4AITA 4L2LA 1FNFA 3CSYB 1AGDB 3AU0A 1M2VA 2BP3A 1L6XA 4BZ1L 4LCWA 4UINH 4V2CB 4ZUTB 5LJYH 1GZQB 1E9OB 5FYLH 3EADA 1T1WB 4LRNL 4AUJA 3L1EA 3T4YA 3HHRB 2AS5M 1RI8A 1L6PA 1EXUB 3SDXE 3RPIB 5F8QC 1IBGH 1DBBH 5JNYB 3RG1C 3O6MH 4WU7B 4X4ZA 2B4CH 2X2UA 2DQUL 5AOKA 1QR4A 5IEHA 2CR0A 3BPCA 3HI6L 4DO6A 4DZBA 2ZYRA 4PCYA 2CJUH 2HRPH 2VN5A 3Q3GB 1CDBA 5AL8A 3SKMB 4LBAA 3WNNA 4AE0A 3PIQA 3DVGB 3QQ9D 4KH9A 2J6EA 4HIIA 5KSUA 3TJHD 2DQHL 1EO5A 3HZMA 2BIHA 2FEDC 2VQ1A 1PZ5B 1X4ZA 4NO0D 3HJ0A 4XMUA 1P9MA 1DDHA 4E41A 1KGXA 5KJ7E 1EZSA 5FYJU 3NBNA 3KPSB 5E2TH 4NQDB 5FWQA 4RSVA 3KCPB 1LD9B 2ESVA 3HS0B 4I1RA 3S2AA 2EE0A 3MGTB 1DBJH 3QCVL 4MS8D 2RH0A 2JF1A 4UBDD 1JGLH 1JV5A 3MRLA 1N7MH 5AOJA 5EEUA 5CU9A 5IQOA 4O51A 1WTLA 3I50H 3DYMA 4FA8A 4I88A 3DPBB 2D03H 5J8OA 2Y22A 3X12B 3WFZA 5DC2A 2QT6A 3QUYC 4IW4C 5IMMB 3ILPA 4WIQA 1F4XL 2CKBB 3P9LB 4U3SB 1MFBL 1T83A 1ZIBA 2FJSA 4LCCB 4LPWA 4MVBD 1KXHA 5K1VA 5DSCB 3CMOL 2XV0A 3GSXA 3Q06A 2L8AA 4KH2A 1CL7H 2A7BA 1RKRA 2MKWA 3FOLA 3HN5A 3VE0B 3FF7A 1SYVA 5L2JA 2L7JA 1AZUA 2A4EA 3LZNA 2M83A 5E8OA 2Q2LA 2NR6C 1UXSB 4IGBA 3ZR6A 3RZCA 3BEVB 1IC5H 4QRRD 4XB3A 2CDEB 1PU0A 2QLYA 2OX5A 1W0WB 2CQVA 2XU9A 3RWHA 1JGVH 1JPSL 1QFUL 4FFVC 4G1MB 4OUOA 5IK3B 2O5XH 2B1AH 4QIRA 4Y4FC 2J25A 2X70B 4E9YA 1EVUA 1ASPA 2V7NA 5H4ZA 5AYQA 3CFBB 3SE9L 2VC2B 2NY1C 4LVNC 2YKLH 3QEQE 2DM7A 5DYFA 1YNLH 3NCBB 1NAMB 3P77B 1MUJB 4GXFA 3IFNH 4XXDA 4QHNB 3VGAB 3AZUA 5IVZB 3BI9X 4A7GA 3JV6A 3CV5A 3LEYH 4WDIA 3UZVB 1A3RL 2WINB 2YAQA 3L3DB 5HJGA 3MAWA 1NANI 2PCPB 1KTDB 3AB0B 2FRGP 3C5JA 4JUSA 5I6MA 1PKQA 4YJZL 5E8PB 3GS0A 1LO0H 1A4CA 4XCEB 3AWEA 4F2MA 1I7TB 2WVVB 2C3VA 1MFMA 3FHAA 4QTIL 1H0DA 2DQDL 2RQEA 4FG4A 5L4JA 2FX8H 4NQEE 4G7VL 4TOYH 4NZRH 1QZ1A 5BV7H 2RCSH 3QO1B 3M1OA 1YYLH 4PCSA 4XBGA 3QE5A 2VLRD 3TCTA 4ETYA 4JFEA 2OXGB 2FE0A 1I3GL 1C5CL 3ESVF 1T21A 4L3EE 3QCTL 4QHLA 1YNTB 2VLKD 2HJLB 4OQTH 1HH6B 3PXJA 2YD7A 4F8PA 4PJ5A 5DFWH 4JQXC 1S7QB 3H3BC 1BBDH 1HEZB 3MOAL 4DN4L 5LKNA 2VITB 4GH7B 2X05A 1ICTA 3HNSH 2VJ0A 1S7UA 4NIKB 2UZPA 1S5IH 1S7WA 3Q1SH 4NZUL 4P9HL 4OM0H 3GF8A 4TUOA 2ICWJ 1JHLH 1S7VA 1MIMH 2Z0UA 3LKNB 2BIPA 3LSOA 5G4MA 2VXTH 2L3BA 1GGIH 4DP9X 1NUGA 3DTDA 4G8GA 1A7QH 4YL4A 2WIIB 3BP5A 3VWKC 4L8DA 3PGCB 1A22B 2VT0A 1M53A 2FGWL 1AO7D 4RGNC 1G1YA 3L9RB 1QEWA 2A6JA 3KH3A 4WV1C 2IDSA 5DVLA 4XOCA 1JZ5A 1A6WL 2OV0A 5DCCA 4LL9A 3N1PC 3KW8A 1T66D 4GRWE 4JR9H 2PMZA 3VVWA 2IH9A 2XXMB 5E0QA 32C2B 2EO1A 3ESUF 5EIVA 4U1KA 3UAJC 1LL1A 1ZDQA 2PYFB 5IIEB 1MZZA 3MRFA 4U6VL 4UOW0 1LK3L 5KYWA 3ZZSA 3EOYG 2AABL 1MVUA 3OX8B 4HUWA 1NC4B 3O45B 1GHFH 3RWFA 1CYGA 3K1DA 1A64A 4FQXD 2W0FA 3LNHA 3OHXC 4BKTC 5J13C 2UV3A 3NYKA 4XC1L 1TETL 2VLJE 3NP4A 3MOQA 3WNKA 3RIKA 2X1XR 3MGOB 3SO5A 3WO3B 3WGUB 3QP3A 3TVMC 3CVIH 3MR9A 1E4WH 4KK6D 3UC0H 4LU5H 1KIQA 2GUOA 3PHQB 3KJ4C 4YHOH 4QF1B 5HY9A 4U1HB 4F7PA 1XO8A 2E4FA 3VCLB 2EIZA 4QHKI 5DVNA 4QOKB 4L8BA 2WYIA 4DGUA 1NCDH 2PCYA 5BVJB 1K3ZA 3NSXA 4L4VD 4L8SA 5EBLB 5EU5A 2DMGA 3F7YB 4I4WA 1RJCA 3MUY1 3EYSH 1FQ9C 2D0HA 4GQZA 4LSQH 2Y6TE 5T33H 4XNMB 3H3KA 3V5KB 2FIKA 2Z3FA 5I16A 3HE7A 5E51A 1XF4B 3KDMB 4I9WD 5FKAB 4DOHB 2WZ0A 4FZEL 4AEHL 1UM6H 3GMOA 2WSPA 4AMKH 5FEBA 3EJTA 3ZK0A 4FLHA 1PJ9A 4WAFA 5D7JC 5AVYB 2YQBA 4OGYL 4GS7B 3VJ6A 1RIVH 1UB5A 2QZ5A 1R3LA 4I0PA 2H0FA 4NGHH 3MV8E 5I5RA 5AZEL 1XGPA 3IJSA 1BLNB 2JB5L 3DSFH 5IB3A 2BSSB 4NHCL 4MKTA 5F9JA 2ZXEB 1NEZA 3OKKA 1XIWB 3CC5A 4DHLA 3QQ4A 4A2FA 2YC1A 5EIIA 1IKFL 2C8NA 2DWDA 2J4WH 3FT4A 4NQCB 1UWEH 2N59A 2GJ6A 3GZQA 4XMTA 3D2UA 5BS0E 4EUPH 2NT0A 2VSCA 2ARJB 3W0WA 1LDSA 4P2OA 4XZUB 3L48A 1OGPA 3QDMA 3C60D 1CLYH 4K94L 4MJJA 1JFHA 1BIIB 2GEQA 3N1FC 4UIKH 4WK4B 3HR5B 3T3MF 1BXVA 1NGQL 1WFJA 4NQXA 3RNQA 4GIOA 3BP6A 4JPWL 2A3TA 2FBJL 4HK3J 4MXVF 3UL4A 4HKBB 1PGRB 1KELH 2KC0A 4WY7L 3DVIA 5I73B 4G42A 3GI9L 3MLXL 2QKIB 3P3TA 5DJYA 5B39G 1WT5C 1BYNA 1WAAA 4NNXA 1SLVA 3LZQA 2V0AA 4V1DA 5HHMB 2XLLA 4NENB 4U1JA 3VXUE 2H3XC 2OSYA 4HHAB 2AK4A 2YUWA 3I6SA 4Y7MA 3Q8CA 1TNMA 9PCYA 2KLRA 4HC1H 3FO0H 3GKWH 1RURH 2G5RA 3DUUA 1NDMB 1H8LA 2EIEA 5D2LA 2OP4H 3TIEA 1AG6A 3SBWA 4U1MB 1AZVA 2EDQA 1A1OA 3MRQA 1MFCL 1N6UA 3DKHA 4LLVB 5IB4A 3SN6N 4UTAH 5C0IA 2E5EA 2NNRA 2Y1YA 4PWHA 4Q58C 2E7BA 5C2UB 4TLKA 4FABH 1ZS8A 4EEEA 4K55A 3RWIB 4KQ0A 3HB3D 4EKXA 4JFUA 1B6DA 2NNXA 3DRTB 3GSOB 3O3EA 4I9XA 3X3FL 5L4IA 4JQIH 1V10A 1CU4L 4EI6B 3TBTB 1KXTB 4XB7A 4JZNB 1GJWA 4NSKB 5AD0A 2Q10A 4DCQA 3MA9H 4NKMB 5KTEH 4WNJA 1C1EL 1RVFH 4OJCA 4HUVA 3BMWA 3BUIA 3GXPA 4C56B 3CCHB 1RJLB 4KPHL 3BD4A 4D8PB 3AW5A 3ESPA 4LIQH 4Y5VC 4BDVA 5IY5B 3TEWA 2ZKXA 4PB9L 1T03H 2WWOA 3NDZE 3PGFL 3IGLA 5DD3H 3CDGA 1PY4A 3BYYA 2J1XA 5CLZA 3LXUX 3GSNA 4XO8A 3MJGX 4FADA 2DH3A 4NN5B 2I69A 2BNQE 2DZEA 3O2WL 5T1KB 1ZLWH 3M07A 3RURA 3V4UL 4EIBA 4Y5YB 1RJYA 1N5AB 2VDNL 4QXGH 3OAYH 2NY5L 5KOMC 5CEZE 3UYPB 1UWGH 3VXSB 4RX4D 1TZ8A 1F58L 2QR0B 5D93C 1LMIA 1TLKA 2N0KA 3IS0X 1FP5A 4MFHA 3RUGE 2G2RB 2YXVA 2VXVL 3KXFE 4IEFB 3O2DA 1V3JA 3JWOC 3MRJB 4MCNA 4YIQA 3SDDC 1KGJA 1FG9C 5IMOA 4YE4L 4WFHD 4YSRA 3IJ7A 1EJFA 3L5WA 2ZIDA 4KZDH 5I5MA 4JANA 2E9GA 2JIXB 4DP7X 1H8SA 4F7KA 4BELD 2VM4A 2NX5E 2AAVA 2P4AB 3P4OA 1COBA 3O4LD 2XQYG 3ARBC 4JFDE 1X5FA 1L5GB 1H9VA 2R2BB 1JV2B 3VRLE 2UY6B 2A9DA 4A7TA 2KT6A 1OE1A 3GMNB 4W9LC 2OMYB 3SGDH 5K9QG 4PYHA 1UJ3A 4PRPD 4XPFL 3FFCA 4QEGA 3CX2A