5KJ7E

Structure of the ca2+-bound synaptotagmin-1 snare complex (long unit cell form) - from xfel diffraction
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
278
Chain Sequence
KLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Advances in X-ray free electron laser (XFEL) diffraction data processing applied to the crystal structure of the synaptotagmin-1 / SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis,exocytosis
molecule keywords Vesicle-associated membrane protein 3
total genus 43
structure length 278
sequence length 278
chains with identical sequence F, K
ec nomenclature
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5kj7E01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5kj7E02
4FULA 1K5WA 4DNLA 4PS7A 5H4YA 3IM1A 2K45A 4NPKA 4WWNA 1V27A 2WXNA 5CCHE 3T8MA 3APFA 4ANUA 4URKA 5H4ZA 3QARA 2CJSA 2N1TE 3LJ3A 1DSYA 4MJJA 4IHBA 1DJZA 4L1BA 3TL5A 4TS6A 4F92B 3QR0A 3W56A 4FJZA 1E7VA 3F04A 4ANVA 1E8ZA 4TUUA 3L08A 2K8MA 3NZSA 4XX5A 3TWYA 1DJWA 3OHMB 1UOWA 2WXMA 1BCIA 3IBEA 3QK0A 4XE0A 3ZIMA 3QJZA 3KWTA 3SD5A 2UZPA 3QAQA 3APDA 4Y1TA 1W15A 3L4CA 1DJHA 3RPBA 4F1SA 2WXPA 3ENEA 4WWPA 1WFMA 4PS3A 4F91B 3FBKA 4XZ4A 1TJMA 3ZVVA 1E7UA 5CCGE 1GMIA 2ENJA 2WXHA 2JQZA 3N5AA 2ZKMX 3QR1A 2Q3XA 4DK5A 3FDWA 2ENPA 2DMGA 5T8IA 4LT7A 4AOFA 2BWQA 1TJXA 3HN8A 1HE8A 2YOAA 4ICWA 2WXLA 2Y3AA 3P2BA 4TV3A 4WWOA 4EZKA 1QATA 3HIZA 3ZW3A 4HVBA 1RSYA 4Y1SA 1WFJA 2WXKA 4NPJA 1DQVA 4G11A 4WEEA 3TJPA 3W57A 4ICXA 3L17A 3DBSA 5G55A 4OVVA 4BGDA 4PS8A 2KI6A 4QJ5B 2B3RA 2CJTA 2FK9A 2X38A 2WXGA 1E90A 3PS6A 4HLEA 2DMHA 4IQHA 3PYCA 2CHZA 2NCEA 4KZCA 2QZ5A 4FA6A 3GPEA 1DJXA 4L23A 2Q0ZX 2ISDA 2A4ZA 3L16A 2ENQA 2CHDA 4BFRA 4KITB 3NZUA 1RH8A 4OVUA 3APCA 4A55A 3KWUA 4KZ0A 2LHAA 3HHMA 3CSFA 4L1LA 3L9BA 1RLWA 3ML9A 3F00A 1UOVA 2K4AA 1BDYA 2EP6A 3F01A 2A5UA 2NQ3A 5G2NA 2WXIA 4EZLA 3S2AA 4V11A 4FLHA 1QASA 4NS0A 5JHBA 3DPDA 2CHWA 4FJYA 4FHJA 1UGKA 2CM6A 1YRKA 2QZQA 1E8YA 4J6IA 4LDCA 2CHXA 4GB9A 1DJIA 3ML8A 3L13A 1E8WA 3JZYA 4EZJA 2WXOA 1W16A 1A25A 4NP9A 2FJUB 1BYNA 4LCVA 4L2YA 3B7YA 5EDSA 2YRBA 3PREA 5KJ7E 3CSTA 2WXQA 3R7QA 2V4LA 4GNKB 1E8XA 1CJYA 4F93B 2R83A 2K3HA 3PFQA 4AJWA 1DJYA 2WXRA 3M7FB 3RDJA 3NSJA 1DJGA 5JHAA 2NSQA 4FADA 2CM5A 3MJWA 3OAWA 4JPSA 4WAFA 4QAMB 4QJ3B 4QJ4B 3PRZA 4FHKA 2RD0A 3L54A 2WXFA 2WXJA 3R7RA 5CCJA 2D8KA 4ANXA 3F05A 4ANWA 2Z0UA
chains in the Genus database with same CATH superfamily
3HG1E 1XSOA 5H4YA 4QOKA 2B2XL 3NIDF 4M7LL 4S1DD 3ZTJG 1J5CA 2D3NA 1AMYA 1DJSA 1U4EA 2JB6B 5HHPA 2BFVL 3V2AR 3TJHD 2BP5M 4LSPL 3CFKB 5IBLC 4DPRA 4XP5H 5BZDA 4U3SB 3MREB 5CUSL 1Q0YL 1YQVL 4PJCF 4I87A 1DBMH 1FG2A 2P5ED 4IDJL 2R2HB 2JKJA 3DMMC 1W15A 5ICXA 4NHCL 1EEYB 1KENL 1P5UB 3TEZA 5CM1A 2QHRL 3K3QA 3VM5A 4KRPC 3V6FA 2D7TL 2NSXA 1HWGB 1TYEB 2UXFA 2E0PA 2VZ1A 3JXAA 4O51B 5KOVC 5DMJB 2XWXA 5DDHA 2MPAH 1CYXA 2EXWD 2PW2A 4L4VA 4JFXA 3GMQA 5JHDD 1CFMA 2V3FA 3EOAB 3TIDB 1KB9K 1CLZH 3SCMA 3BUPA 1CR9H 4H25B 2MWCA 1ETZA 2YR3A 1XGRB 1LO0L 3MLRH 5IVXF 3HS0A 4E9VA 3MODH 5ISZB 1LP9B 5E2WL 5IHLB 2VXSH 1C1EL 2XIIA 4FKKA 3F12B 4X7SL 4GKZA 2X9ZA 2R8SH 1A9EA 3QPQC 5JZ7D 1AXSB 5BRQA 1LK2B 1Q72H 4Q6IB 5C07B 1X5JA 4IQHA 1N59B 3RWCA 5GGSA 5L9DL 1B0WA 2E9JA 2PWEA 2H0EA 4Z23A 2VH5L 3HBPA 4LASL 3HRZC 2EDXA 1LNUA 3FUIA 4TLTA 1VZGA 2IQAB 4X0NA 2I9TA 3BH4A 5A2IH 4QWWD 2PABA 2XWDA 3AADB 3NCYS 1ZLVH 1IAKA 4ODSH 3B4NA 4MMZA 4N8VA 2F68X 2NZ9D 1MFDH 5L88L 4K4KA 3FO1B 5FGRA 3ZE2E 4PW9A 5TF1L 2ZKYA 2WWKT 1JWMB 2DQIH 2QT6A 3OR6A 4V33A 5LBSA 4WJ5A 2IV9A 3ALPA 2DQMA 4X8JB 4XB8A 4Q2ZB 3HI1B 1J86A 2FE0A 4KKCC 4NM8L 3HPJA 4YLBA 1HOEA 3I2CL 1M3IA 1SOSA 5K9JH 1QVOB 4JRLA 12E8L 2YXWA 3QZPA 5IV2A 2JKSA 2ODHA 1CFQB 5B7EA 1JRHH 4YC2B 3CN0A 4PG2C 1ZA6B 1IL1A 1UKSA 4NUJA 1LO0H 2WWOA 3NDYE 2IQ9H 1YMMA 1SJMA 1IM9D 4FXGA 3ZR5A 5BOJA 1A6PA 4HOMA 3WIIL 5GZOC 1QHOA 2BMKB 5DJ2B 4YSCA 1BQKA 2CA3A 2DI8A 4HK0B 5DD6A 5C9JB 3G5YB 4JL2A 1J10A 5EC2A 3AZUA 1FL6B 4ORGA 5BZZA 5JQIB 3UZEA 5E08L 4YVUA 1J05B 4PRHE 3MRJA 5AVRB 3E7JA 3UZQA 4DKTA 2YS4A 5G5DA 3NZSA 2OYPA 3Q05A 4YDVB 4XGZB 1DJWA 2VMFA 5CZXC 1KFAL 3FB7B 3QG7H 1BFSA 2YFOA 4Z7UF 2WQSA 2IG2H 2R23B 4PRDA 1A7PL 1A7NH 3KPPB 3BO8A 3H8NA 4DGVL 1W72L 3DI2B 4BA0A 3PHAA 2AC0A 3KPRE 2Z9TA 5EU3A 1ERNA 1P5VB 1YA5A 1DQML 3I74A 4AIZB 1LO5A 4UM8B 3T71A 1QAWA 3K1DA 2FL5B 3T2NH 4K0OA 1TSRA 2AV1B 3D2TA 2GHWB 2IDUA 5D7IF 5FFGA 4IMKC 2R9HD 2QSVA 4M6NH 1HCYA 5F7DB 1T1XA 5TJWK 1MW2A 4GSRA 3DYMA 3GHPA 2IXQB 4GKZB 5H37A 3GMMB 1IJ9A 1I8IA 5CGMA 1J0YA 3Q44A 2K3TA 5DK2B 4JEGB 3EO9L 2DQFA 4N25A 3PS6A 1OWRM 3SKJH 3P9MB 1AC0A 4QPEA 2FR4A 2WWKO 2IFFH 1DQKA 3AQZA 1U8MB 4JM2D 5TDPB 1MCKA 3MBED 1AFVH 4GP4B 3VMPA 3QUKA 1IMHC 1E4KC 4UDUA 1YEJH 3ARDD 4KFZC 4YE4L 1OGAA 3HZKA 3VXSE 1GRWA 3ARUA 2EXYC 4EQ2A 1EZLA 1FH2A 3N43B 2QZQA 2W94A 4LVOC 4TXVB 4LDCA 4XP5L 1QLFA 3HMXH 1M9SA 4IRZH 1TMCB 4X6CE 3U7WH 1KN4L 2KZWA 1TVBB 1RJYA 3GZOA 3OM3B 4JFHE 4TL4A 2A77H 4S2SB 4XNXL 5CEYA 3T04D 2X6VA 1ITBB 1OALA 4JB9H 4K3GA 4XCFL 3V4UL 4HEME 4LLQA 2DQJH 8PAZA 2HH0L 4P49A 1MEXL 3CFKA 1OE2A 3LKOB 1BXUA 3STLA 1AS8A 1X5FA 1BVNT 4NQEB 4S1RL 1O7VA 5JLZB 2BJMH 2Z93A 2V8MA 4JHWL 4MMXA 2XKSA 4FHKA 1SYVB 2RD0A 3KLAB 3FT4A 4YXLL 5D7IA 4ZMNA 3DVNA 2APXA 1LLAA 5D8JH 4DOHE 2CRMA 3HE7C 2X9XA 4Y2NA 3QWOB 3REWA 1BWWA 3VXPB 4QOKE 3LNHA 2EDTA 3M6DA 1IM9B 1XBDA 3GBLA 2H26B 4N2LA 4MAYC 5CO1A 5HHOD 2DDQL 2OMNA 3BMVA 2PR4L 2KLRA 1P4UA 3HZYA 3VRJA 3S8FB 5BJTB 4IIZA 2CK0L 1RZGB 4UOW0 5BS0D 2BS71 4HQQH 4BBWA 1A3LL 3IKCA 4I0PD 4K5OA 4PJIF 4FP8L 3TBYB 2R39A 3IDMB 3RPBA 3QB7C 1I82A 1I7TA 3WKQA 4FQHB 1D9KA 4NLHA 2ENJA 3FQUB 5F0JB 3TO2B 1S2EA 4JPWL 3T3MB 4EI5B 2DWDB 4NO5B 1NLBL 1HL9A 2DMGA 3UJTH 3C6EA 3I9IA 4KVNH 4R4FL 1KYAA 2KZBA 4RAVB 1MRCH 1WITA 2UXGA 4UU9A 4K5NA 4WWOA 2ZT9C 5CZVL 3VI3B 3GIZL 4F33B 1T03H 1A6AA 1FQ9C 4FQLL 1B6DA 3MCYA 1S8DA 2DY2A 1KTJA 2FUTA 5KVMC 3TBBA 4MJ2A 1VGKA 3SE8H 2ESVB 2OMTA 2ZUTA 5D6DC 4BKSC 1E9QA 5F7NC 5HVFB 1A3ZA 1LTXA 3NN8A 3T3PF 2FH6A 4I9WE 5BV7C 4R0LC 5AB0A 1JPSL 3BSZH 4JX0A 5C07D 3P4OB 1GC1C 1KJVA 3QH3A 1QWHA 4XPBL 1I1FA 2R2HA 2OMWB 1QLEH 3QRGL 4MDIB 1AP2B 2Q87A 1DSWA 1RU9H 3MQIA 4HWNA 4OIIL 4Q9BA 2EIMB 5TPWH 2BVUA 4Q6IA 4HCIA 4XBEL 3TBSB 1INQB 2WVSA 3NYKA 3WNNA 1IFHH 5ICZA 1VGEL 3N50A 1S7TA 1XGRA 3SKUD 3T09A 1EHXA 3KBFA 4LBAA 4K3JH 4E41A 3S0PA 1MJ8H 2D7NA 5F21B 1NICA 4RNRA 3U0TB 1O9ZA 2BSTB 3TBCA 3TEYA 3W5MA 4X5WA 4JFTA 1AGCB 5IB5A 4PFEA 5D7IE 1QPPA 3NZ8A 2X2YA 2MHAA 3KGRA 4NZRH 3M88A 4PJ9D 5DJZA 3LN4A 3P4NA 2XZCL 4UV7L 5KVGL 2BSCA 2IGFH 3JWDH 4U7KA 3H9YA 5E9DA 3BN3B 2F18A 5DFVD 3FPXA 3QXWA 4ZSOB 4HCFA 1A7OH 5CWSB 5CCJA 5DD0H 5H35A 2FX7L 1TZAA 1YNKL 4H1LG 3ME0A 5L88H 4K9EH 4PJEA 3RQ3A 2ICEB 2X4PA 4XVTL 2ZCLL 2D2CC 2QQKL 4NAJA 3CZFA 2A9NH 2OSLA 3LH2H 1F18A 3L5WB 5HYJA 4L9DA 3HRZA 3VXUA 1U8OA 2X2HA 1OT2A 3DGGB 5C09D 1WVZA 1CXKA 3EGDB 4P3CL 4HS8H 4CMMA 3WTUA 4DETA 4I9XA 3MRQB 3T2QA 1KDJA 2CMRL 2VXUH 1ZSHA 4N0RA 4NHUB 4WJ5B 3BZ5A 1ULVA 2EH7H 4P46A 3B9KC 4FFYA 1QNIA 2JB5L 4XE0A 1PY9A 2JQAA 4JK0D 3GXPA 4IHOA 3QYCA 4XX1G 4PW4A 1EMTL 3BSHA 4FZ8H 1W72B 4FD0A 3KPRA 2VJ8A 1DBKH 3IU4L 3N9GH 1NFAA 3AQDA 1T2QH 1EQWA 4OQTH 4BHUA 4EIGB 1YO4A 5I1LB 3UYRH 2WBJB 3WMQA 1V8HA 4BZ1L 3FF8A 1SJXA 1UWEL 1NCDL 2XWZA 1BM3H 3F58H 3VB8A 3ARDC 2Y22A 1F4YL 1UJ3A 4QRRD 5FAAA 1XF2A 2ZSVB 1ADQL 3D52A 3VGAC 4QRAA 4O2CB 1E28B 4K23H 3X3GH 1O5PA 4ZS6C 1OARH 2NY7L 4WW1A 1S9VA 4E9QA 4P2OB 2WNWA 4AYFB 4OZGF 3FYIB 4KY1H 5C3IA 2ITDA 3BUBA 1S5IH 3VD7A 1NSNH 3LDBC 1H0DB 3QDMA 2VR5A 4DP6X 1N6VA 4R26H 1BVZA 2A74A 2HVKB 5HHNB 3IVKA 4KITB 3F7KA 5IB2B 1OTTD 3ILEA 3J8F7 4JGUA 3IKKA 1PGRB 5LWYL 5H8DA 3DBXA 3T0EB 4POUB 3HR5A 4GYBA 3L9BA 4JVWA 4Z0XA 3WFEL 4YS4A 3F00A 1EA9C 2VQ1B 3SDDB 2NX5B 3PNWB 5IM7B 1NBYA 1TZGH 2B14A 3LEXB 5T1LD 4FNLH 1XF1A 5IBUG 4CSPA 4M6OH 2O72A 1T1YA 4AM0A 3DHJA 4JDVB 4YDLB 5CR8A 1RKRA 2OZNA 1FFNA 2AJSH 3EH1A 1JZJA 1THAA 2A9AA 3M8OH 1MJJB 3BO8B 2KMWA 1SY6H 5T3XD 2YPLE 2XJLA 2B9AA 2IFFL 5HP5A 3T6WA 4GUOA 4K3EL 4LLUB 4HX1A 1BGXL 1JV5B 2ZG1A 3MRGB 5D1ZI 1ORQA 5C0FB 1ZJBA 4NZDA 3ESMA 3IN2A 3GXFA 5EBLB 1U36A 2JLPA 2MSPA 3BP4B 5F71A 5HHQB 1EAPB 1H9VA 4L1BA 4TMPA 1OP9A 2FZ3B 1ETA1 1JZDC 2TAAA 5LGYA 5EZIL 4QTIH 1UZ8B 4UQEA 1MCWM 4ELMF 4GAYB 4F57H 3RJOA 2PO6B 4HW6A 4MX7A 3QZBA 4LARH 1P6AB 5GGSB 1KIQB 2NY4D 3QNXB 3VRLF 1ZGLB 2QTEA 3EYSL 3L08A 3O45A 1CFNB 2E9WA 4EKJA 4XPFL 5GS1B 3II2A 1L9OA 1EUUA 3VQ1C 2C9QA 4Z7OF 1JHLH 4AIEA 5DS2A 3TURA 2ZF9A 3CDGB 1L6ZA 2DYPA 1PJWA 3ATFA 3VFVA 5IW1A 2OL3L 1GMIA 5SWZA 5HDOA 3CH1A 1VB9A 1QLFB 3RTLA 2P1YA 3MRMA 4GRLA 4PJIB 1OGTB 1F11A 3V6BR 2OX5A 1BZ9A 3UAJD 5K69A 5E6IC 4LLQB 1RZPA 3DOHA 3BI9X 3LX9A 4NUMA 3QUYD 5EZLA 5ITFB 5FKPA 3ARQA 4YHOH 4KV5F 2IPUG 3FT3A 5D2LA 2OSXA 1JRHI 4AM0Q 3MTXA 2BCKB 4NO0A 5JA8B 3BP5A 2DMCA 2XG5A 4K94C 5D7KD 4WU7A 3WHE1 1NQBA 4GP8B 4CN6A 4ZTEA 4D9LH 3NEOA 4Z7VA 1HQRB 3GSXA 2EDNA 4P9HH 1KLGB 4F15B 4XWOC 1OGAB 2Z35B 3RNKB 2ITDB 3LQAC 5EBGA 2EILB 3DRTA 4N0CC 5CJXC 4BK4A 5IB5B 1NC4B 2VIRA 4HKXA 1Z3GL 2JKWA 4AC2A 2F7OA 4KK6C 5MHSE 3LMJL 1PU0A 2IADB 4OFDA 5F0PB 5MEOA 2JJTC 4ETQA 4NDMA 2HX7A 1UOVA 2DI9A 2FJGB 2W91A 3BKCH 4ODWB 4NS0A 5EC1A 3QUGA 1H5BC 4KKLD 1WTLA 1YNKH 2F1EA 4PG2A 3EF7A 4HU8A 3QCTL 3ZRSA 1P6WA 3FU7B 2GK0A 3SKNB 3KGUA 1AH1A 3TTSA 3BSZA 1IVLA 3P3UA 2ARJQ 1H6EA 1KJMA 2P5WA 4X5WB 3NFPA 1SXAA 2ZX8A 4L8DB 5HHQA 1RAMA 2GFBA 3NRPA 1YY8B 1FNLA 3S3DB 2OJEA 1H6TA 4AE1A 1T4KA 3LZOA 1BQSA 4YAQA 2JJUA 2WQVA 4RMVA 5IJKC 1KIRB 1TU2A 1L9MA 1N64H 2R1WA 3OKOA 1BG1A 4DT2A 1DJZA 2JIXD 1DYZA 4X7FC 2QPSA 3O6FB 4F92B 4UZGA 4YQXH 4X5XB 1AP2A 3SQOH 5HSFA 1SGKA 4HLZG 2UWEF 1IAIH 1MW3A 4YBHA 3L3OA 5JHDE 2X2UA 4HPYH 5AKVA 5E9DB 5CLYA 3N40F 4MNGE 5FOBB 1DQJB 1GOHA 1TQCC 2F2HA 2ADIB 4FFVD 3LN4B 3P4NB 3PHOB 3LD8C 1HHJB 3TWCL 4UT7L 3QO0B 2R0LH 1ZLUH 1R75A 2B59A 3I9PA 2FRGP 2EVJA 1UACL 3LZNA 4YSPA 4YUEH 3S5ZA 3FN9A 2GUOA 3VFNA 2BNRE 1WAAE 4FRWA 3NOIA 1PLAA 1N5YH 3O2WH 4QHPA 1IC0A 5EU4B 2XIDA 4ZBJA 2BWQA 1LMIA 3LEYH 3S5LA 3MCKB 4P5KA 2X1QA 2Y4SA 3UG3A 4KVNL 3N9GL 4OF8A 3DX8B 4CDGC 1OCZB 1MUJB 2Q8BL 3MNWA 2P8PB 4O02B 2AJZB 3HG1A 4AT6B 4OGXH 2Z31C 3DBSA 5D6CB 3QDGD 4BGDA 1X7SA 3R8BB 2X4QB 2X87A 5L8JB 2OMUB 2VDLL 1OPGH 1E4JA 4QF1B 1BOYA 3K46A 3BDXA 2G3XA 1J1PL 2VXUL 1A1MA 2DEXX 3VRIA 4IRSB 3B2UD 3BQUD 4L37A 3WTVA 2X9WA 4KXZH 5T1DL 1CCZA 1E4XH 5HJDA 1I3VA 3JSSA 4TQPA 4PREB 3COOA 4FF9A 4JPIA 3MBXL 4NQCA 4Q6IC 5ID0A 1TO4A 4WWKB 3N2JA 4OGYH 4V11A 4D9QD 1ROCA 4A6YB 5GS0C 5IB3A 3N1FC 5C92A 4B9YA 5T3XH 3TYGL 1FGNL 1KPVB 2CDEA 4NWUL 4OZHE 1E28A 3P4LA 1E6OL 1KCRH 4QXWA 1KOAA 1YC7A 1EEYA 2ZSVA 3W39A 1SYSA 3ME0B 3CXDH 3IKCB 4MQXD 1CGSL 4NJ9H 1H9DA 1Q9LB 3RL2B 5D96C 1H3XA 1EH9A 3PWVB 3SJVB 1S5HB 4JFEE 3LS4H 5B4MD 1DJGA 2A9CA 4JFUA 2LU3A 7CGTA 3V95A 2NXYB 1BQ5A 1KIRA 3B3BA 3JUYA 3QO1B 4ZOCA 3GK8L 4O58H 1U8LB 3CQQA 1OAJA 4P46B 3V7MA 1X9QA 4F7KA 1HHHA 5E0FA 4LP8A 4DAGH 5DQJA 3NQIA 4ODHH 1WLHA 5IVXB 2V5MA 1V05A 5CBEB 5ECJE 1R5IB 3SPHA 1A1NB 2AFNA 2VMJA 3BPLC 2P24A 3GF8A 5I18H 3QDJB 5GGRY 1CE6A 4Z7IA 4ADJA 2XWTB 3AFLA 4LKXB 5LUMA 1F0LA 3P9LB 4GKNA 3Q6FB 3OZLA 5GHWL 5L2KD 1CFNA 5GS1A 1JNHB 3I9AA 1B9KA 3O8XB 3VSVA 2CH8A 5KSUB 1BAFH 2C3WA 3ILPB 3L3HA 3QUXD 5GJTL 4GAYA 5LGKA 1ACCA 1FLRL 4P2RD 4FYQA 5IESH 1OTSD 2W1NA 4LEXL 1J5HA 1G4RA 4OCNC 4AXWB 4UQ3B 2FWUA 3NZ8B 1R3IL 4HLJA 5CN2A 1G7JB 4ZT1A 3UACA 3VD3A 1WFJA 2R69A 4QO1A 3V0AC 1IO4C 2OTWA 3DXAD 4M5YL 4KXBA 1OQOA 2D2OA 1AZVA 1MRDL 2OMXA 4DGYL 5HVGB 1AGEA 4MS6A 3B8SA 5I28A 2VDOH 1AHMA 3TH4T 2Y6SC 2F5BL 2LLNA 1KT2A 4DWHA 3TEUA 3EFOB 3IJSA 1U21A 4L37B 1JK8A 5FM5M 4C83A 3HE6B 3BVNB 4PJ8B 3PWPA 5GS3A 5AAWC 3O6FD 4HUXA 3RE0A 4ERSH 1ZANH 3N1QC 5DK0B 4JPIB 5FO7A 4U1LA 3RPIB 3VI4A 5I1JH 4X9YA 1RLWA 2J55A 5E6ID 4KPHH 3THMH 4M43H 1ZMYA 4ZOEA 5E8NA 2H2SC 1O7DE 1H6UA 2AVGA 2EEBA 4RGOL 1LJMA 1PIFA 2CDEB 1DQDL 2RTTA 1ED3A 3S96A 4BFKA 4DP1X 3C60A 3GIVA 5I1GL 4PJEF 2QGBA 3QPQD 4PJ5B 5C97A 3QIWD 5EMYA 1ETB1 1CFVL 1MFVA 2BOBB 2BSSB 3VXNA 1CJYA 1KGWA 4HKJA 3NTCL 3ZKQD 5K9JL 3E1F1 4QCIA 4BFIB 1GHFL 2ZQKA 3PDDA 3ZHFA 5JHAA 1EHAA 1O0VA 4J3UA 5CINH 4Z95H 1EO8L 5I66B 3OB0H 1TQWA 4N8VB 4ZFFA 3CVHH 5J3HC 4MNQD 3SDAC 2Y7SA 2QQQA 2H2PC 5H2BA 4M93B 5TDOB 5AOMA 1KYOK 3B9KA 4H0GA 3AG2B 3IGFA 4R26L 5CCHE 2VMDA 2KPWA 4PMEA 4EMZA 4IRJB 3KWXA 3VFPB 3KXFB 2N0KA 5FUCE 2HJLA 1C12A 1S5IL 1WF5A 3MXWH 2GBTA 4OQTA 1BZ7A 3SPGA 4I1RA 3MCKA 4P5KB 1JPGA 5A7BA 3MRLA 3EUDA 5FUCC 5AD0A 4LSVL 1GH7A 3UTTA 2BHFA 1QFUL 3QUKB 4OI7A 2F54B 5D5MF 1DSFH 3GS0A 1AR1C 2DWTA 3B43A 2WBXA 4I5BA 2J6EH 1I3GH 2P5WB 4KK5D 1B0IA 3MBXH 4H8WH 1LEKA 4HMEA 5AW2B 1BG9A 5D7EA 4L4VB 3IYLW 2YD6A 1QOKA 3E6HB 1XSJA 4H8PA 1XR9B 4PCKA 5HHXL 5C0AE 4R4ND 3T1WA 4OLZH 5HJ3B 3K71B 4JJ5A 2ICCA 2GTZA 2OXHA 4Z78B 1RSYA 1AD0B 4L4TE 3Q6GL 1R17A 1CIDA 1B0RB 1TVBA 2XWBB 2DKSA 2BVEA 1BJ1J 3V4LA 5B39G 1X7QB 4ZXBC 3DUUB 4PS8A 1N59A 3RWCB 4NWTL 4H5SB 4JDEA 5J89A 2GEEA 3MBWB 3BCFA 5LBVA 3DDFA 4JFPB 2ZOLB 5B7FA 3DIVA 2PO6D 2QVKA 3VQMA 3BZ4B 4LSPH 5F7DA 3G6JA 5AUMB 3UTSE 2NYYD 5EWIH 3HEIB 3V5KA 4BWTA 3TU6A 1K9TA 4HGWB 2KERA 4WW2A 3IDXL 4NBZB 3VGAB 4YUEL 1LQSR 3NK4A 1AY1H 3BP7A 2IPKA 5BVJB 5LLIC 1MCHA 2W5PA 4UTBA 3GHEH 2JKXA 4GS7C 2CIIA 5HYIA 3H3PL 3V5HB 4FFVC 4O00A 3V7AG 1OT4A 3LV3A 1FL3B 1A6UH 1MCEA 4X4YB 2HRPL 1BXVA 3TBTA 4QF1A 4AUJA 2YWYA 3QEQB 3BN9D 1P4IL 5D5ME 1HE7A 4TNWF 1OVZA 2XXGA 3QVAA 1PX3A 1FYTB 3FMGH 4CRPA 1R0AH 4WIQA 1YY9D 3LXCA 2DB8A 2P8PA 2QSTA 2YD7A 2IWKA 2DYPB 3ARFA 1IL1B 1FAIH 5J6SA 4YFEA 1J8HB 3CLFH 5GGUB 1OOWA 4LGPB 4BSVA 5IV2B 3UMTA 4N5ED 4BD4A 5F7AA 2DRUA 5LNEA 1AG6A 1T5KA 1O7DC 1P53A 5C9JA 5ID0B 5BS0E 5DJCA 2VZSA 3MSPA 2HG5A 4P9ML 5CP7B 4QTHB 2HJLB 1QLEL 3NT0A 3K2KA 1ZEAH 2ZUQB 3ZX1A 1YUHA 2DQIL 3TT1L 3JWDC 1X4XA 2JJSA 4LVHC 2AABH 2PYED 2YGPA 2ZKXA 5IHZB 1NWOA 1BZ7B 2WB7A 2WLJA 2WGXA 3JQOB 4JZNA 4PBDA 5JYLA 1PD1A 2XTSA 5I1IL 1TVHA 2BC4B 2IGLA 3SD5A 5AW5B 4ETYA 2IANE 3APDA 4Y5VC 3L4CA 1Z5HA 2FEEI 3L6FA 4I5BB 5DRNB 2FWSA 2OKMA 1UTDA 2IBGA 4KO5A 4KGLA 2J7LA 1MCNA 5JW3H 2NSMA 2W9EL 4QRRB 4IKKA 3B9AA 1AO7B 3LKNA 4G7VH 2AVFA 32C2A 1FO0A 3ZL4L 3LTVA 4U0RB 4OZ4B 3HUJA 1UOKA 2DPKA 2ZUXA 4A6YH 4EZKA 3BPNC 1XIWD 3RG1C 4AMXA 4GXVH 1NGXB 4UIMB 2X0VA 1OKEA 1NC2D 4XBGA 1FNEB 3VE0A 1OAKH 1BQUA 3FO1A 4G8GE 5HI5D 3GMNA 2VR6A 2RB8A 1MLBB 4JKWA 1V3MA 2MPAL 2VLLA 4NC0B 1UG9A 3LCYA 1DDHB 3A4DA 4A04A 2FWLB 2XN9D 5F2FA 2QELA 1SLWA 3DX4A 4AT6A 3DPBB 2VUYA 4WW2B 1Z9LA 5E6IB 3IMRA 4ZODA 3WFDH 4AYGA 4EUPB 3CQPA 1TU2B 1AJ7L 4B0MM 4Y16C 4DKEL 4E5XB 4X80L 3EDEA 4ILDA 3NEEA 3VXUD 4KK6D 4N9GB 2RCSL 1D6VH 4J3BA 3WI9A 1G7HA 4WZ9A 4UB0L 5FIEA 4APQC 4ZW3A 1NBVH 4JLRB 4UINH 5DRXA 2Z35A 3L5XH 3RNKA 1ZGLM 2WXOA 4GSQA 3L3DB 4M5SA 5FKAA 1MCIA 2L7UA 3NFPB 1NUGA 4G83A 3ZE1B 5J12B 2VAAA 4LGSB 3N1GC 1U2YA 3V4PB 4QO1B 3QFJA 2YRPA 4Q7DA 4F7EA 2NW3B 3VX1A 4YK4B 1MQKL 3M7FB 1H8NA 1JPFB 1OM3L 3P3TA 3WUWB 5I0XA 1YG9A 2IXQA 1JD9A 1FZKA 5TH2B 3SBWC 4OCLC 2EABA 1BLNA 3EFOA 3IJSB 3CIAA 3UL4A 2P48B 4PJXF 2O61B 1FC2D 3FT4B 2F19L 1F45A 2NY2C 4M93C 4DKDC 5CZKA 2Y1AA 2DQGH 4ERSL 1KJ2H 3QQNA 4GBXB 3ZO9A 5I15H 4ATTA 1LO5B 5SX4I 25C8H 3DETD 1ZT4B 3ULSB 1DVSA 4PHZA 4X4XA 2P3YA 5FYJH 4Q9CA 4HGKC 2FX9H 3IT8D 4Z1PA 4R7VA 1WP6A 3IJEB 3IMSA 2ED8A 1W0VA 3TIEB 3KBPA 2D7MA 2C8NA 3O3UN 1KBGL 1GR7A 4OM0H 1Y18B 3O4LE 3OGOE 3T6XA 3SDXB 2E7BA 4PIRF 4FYTA 3V0WL 3N85H 3A24A 2UUDK 5CGYD 2CZNA 4WTXA 3FTGB 2Q3XA 3OXRA 3O3EA 2SEBA 4LCWE 1OTTC 3GSRB 5DO2D 2QDWA 1NCDH 2BH0A 4L3EA 1J5OL 2CK2A 3MXWL 1W6LA 3RU8L 4ABQA 15C8L 3ARBA 4KZDL 2OS7A 1RJLA 3RGVD 4QCIB 3ARGD 1TTUA 2IAND 2QL1A 5D7HA 3DI3B 4H0LC 4IYKA 3BT2L 3CLFL 1AACA 3F3HA 4QHLB 3WAKA 1KWKA 3KYKH 3B2PA 3BH8A 5HPMA 5EIIG 3L1GA 5BS0B 2PR4H 2X38A 1IBGH 3RDTB 4AMKL 3MV7A 3D3VE 2EE6A 3QO1A 3FOLB 1DQTA 1GAFH 4BH7A 4UM9B 1BPLB 4U6VH 3HR6A 2HFEB 3EOBA 2VSMB 1TZIB 3QHZH 3UZEC 4M7KH 4JM0A 3T77A 1Q9KB 1VDGA 1JVLA 5B1AB 3NPZB 2LHAA 2MNUA 1XR8A 1NCAL 2HTLD 4HKBB 2XNAB 2VDKB 4GLRH 1TITA 4LP4A 3IJYA 3SDXE 2Y23A 3O6ML 2Z1PA 4MSWB 4R3SB 4HUWA 3V9FA 2AF2A 3V6OA 4XCEB 3VXUE 2XACC 5HJBA 1B90A 1JDCA 2LAGB 1CD9B 1ZHNB 3QUYB 4PJCE 2VDPL 5C0RH 2WLKA 4L1HA 1XT5A 2CAKA 3ARFC 4KDWA 3BJ91 1F4AA 3L1OH 1Q1JL 2A9ML 1DVTA 4PRAA 3GUTA 2CKNA 2AJUH 3LVEA 5PCYA 1QI5A 1M7UA 3IB4A 2BDNH 1P6FA 5DQDL 2UZXB 1DUZB 3LH2L 3U6RA 1AR1D 4HZLB 1AGFA 3K2MC 4EZMA 2VDRL 1NFKA 4Z7OE 4RGNE 3ESOA 3C6LD 1USQA 2XWBA 3P2DA 4FFWD 5J6HB 1KJVB 3JYBA 3PWUA 3T1FB 2VDLB 3WFHA 4G8EB 3F6JA 2Z4QB 1PL3A 4HT1H 2GJZB 3B2UC 4X6DE 3MLXH 2HJKB 1CG9A 5E8OA 5C2BH 3ZGIA 2ROYA 2QJDA 2XWRA 3G9AB 1E50A 3K0WA 4HXAH 3TVMD 4F5CE 3FTSA 2UX6A 4XAWH 3RBSA 3ARGB 3BYTA 1PLCA 1BXXA 1X5YA 3MRQA 3KCPA 1UXSA 4G59C 3E1ZA 4ZYKB 2IAMD 3IJEA 4BQ6A 4FFTA 1S4IA 1U8OB 3ZE0B 1KN2L 5DR5L 3BZFB 1PBYA 3V79C 3A23A 4AYDC 5CCGE 2Z7YA 3GBNH 3ARFB 2JB6A 1X9LA 2YO3A 3EJTA 5HHPB 1UWXK 4JQIH 4K9EC 4HHAB 1IAMA 4HJGB 2MPVA 5CSBA 1PW3A 1VPOH 4I3RH 3NIGF 4H26B 3ISWA 4D0BB 1TFHA 3ZDYE 3STLB 4XODA 4M1GH 1GY1A 1RSFA 2WMPB 5HYQA 4KHTH 1B2WL 1JAEA 1JP5A 3SYPA 1ZHKA 3RGVC 1OF0A 4TF4A 3CAFA 3J27A 4G8GA 3V7AE 1JTTA 1AS7A 2WLZA 4S0TD 2D9QB 4NNYB 4MASA 2BSTA 1GS6X 3W81A 4DPBX 5LNGA 3BH8B 5HPMB 1T4KB 1TFPA 4CN1A 3KR3L 2E75C 3MGTA 2DDQH 5AYUH 4UBDD 1KB9J 2W65A 1I8KA 3NBNA 2HLFC 2X3CA 3WY1A 2JELL 1MFEL 5CLTA 1QLEB 1C16A 4HMDA 1KZYA 2ZXQA 3R1GH 2R4SL 4PJGA 4XPAL 2ZSWA 1EAJA 5F9AC 5DO8A 3UGEA 2NMSA 2RH0A 2DJMA 1YZZA 3QQ3B 2EO9A 2YAEA 1BVOA 1W0YT 1WFUA 3NIFE 3RZCC 3MJ7B 1T04A 2FD6L 4OGYL 4XOBA 5DWPA 3EYOA 1AC6A 5F7HA 3KE0A 2ZXCA 3UADA 5DMIH 3X12A 1TQCB 3S34H 4PV8A 4CMMB 4D9RE 2FYYB 1WHOA 2CKBH 3C2AL 1N0LA 4FJ6A 3UAJC 4OJCA 4ZFOB 4P05A 3PWJA 4OD3H 4G1MB 1CXLA 2DS4A 4B6ZA 2MEJB 4P9HL 1KCUL 1HC1A 4ANXA 3CBKB 4HZLA 1R24A 1U8IA 2X4RA 3OKKA 1LEIA 4FLOA 3ARBD 2VLRE 3OAYK 5AOJA 4K7FB 4B60A 1NGPL 5EEWA 3WD5L 1YN6B 2ZUSA 1JPGB 2EH8L 2IMNA 4I0CC 4HMCA 1F90L 1PJ9A 3T0VA 1H3PL 1X7QA 3U79A 3UGUA 5F96L 4XP9L 2BVPA 2DQHH 1E0OB 4Y2LA 1D7DA 4O4YL 1QYGH 5C08D 3EDDA 3RTQB 1ILUA 3AU1A 1S7RA 1XIWB 1ZA6A 4NUJB 1JGDB 4G8FA 4AYEC 2ZXDA 4NP4H 5H2BB 3ZYIA 1ESOA 2ZOWA 3CVBA 5IW1B 4R2GB 4ZMZA 2MOGA 3KPNB 4PJFF 3D69B 3QUYC 4YMPA 3AT0A 2V9RA 2Y1VA 4JLRA 1RK1A 2JQZA 3ZTNH 4ZXBA 1AI1H 1UJ3C 4YHKL 1ECYA 3UXFA 1H3VA 1MY7A 1P2CA 3MBEC 1HZLA 1ZT4A 1TJXA 3RWIB 2D7TH 1OK8A 1TTBA 3BT0A 2ZAGA 1E27A 4J12A 2DW5A 1QR1A 2OMWA 2IDTA 3FSZA 4AQ1B 3QFDA 5DQ9B 1FNAA 2EH7L 3QO0A 5C6PB 1NCTA 2I9LB 5E0QA 3NJKA 3T8VA 2AMGA 3KYMA 5K9OB 4OZFA 3MACL 4IKNA 2MOVA 3W3BA 3PWVA 2MTAA 5E4OA 2D7PA 5ETUA 5HYSB 1IZKA 1F3DH 2C34A 2Q6WA 4PRIE 1U8CB 1XZWA 1HN1A 4NFDA 4LL1A 4JZJA 5E8DH 5C0FA 4HF5H 1QBBA 1A0QL 2C3HA 3FTGA 3NQKA 4PJHF 3RILA 2YMXL 1QEWB 2FLBT 2ESVD 1NFIA 3ATEA 1UVQA 4MD4B 3S2AA 4L5FH 2ZPKH 1AMXA 2VJ0A 4QHLA 2V2TB 1JN6B 4YHNB 3JWOL 4N5UA 5F1SA 3WE6B 5FYKE 4L4TB 2F7RA 2LLGA 2YD4A 1WBZB 2JMRA 3CVDA 3HFML 5BZWB 3F5WA 1P1VA 1ZLSH 1RMFH 1G84A 3LQMA 1KWGA 3GI8H 3VA2C 3H54A 1GTFA 3LOWA 4H40A 3Q8EA 4JFXB 4DTGL 1QPKA 1AAJA 4MJIB 2EO7A 4I77L 4B95C 4R2GD 4O51A 3T77B 1BZOA 2G30A 5LDUA 1SJHA 1NGXA 5AQ0A 4KKAC 4UM9A 1HIMH 4AZ8A 5SWZB 3T4AC 1VA9A 2ZUUA 1JRHL 2XIBA 3ARZA 5ISZA 4Y19B 1GTNA 4IHOB 1NUFA 1SPDA 5E2VL 3CWGA 4XN1A 1JFQL 5L4MA 2OMXB 4FFZL 4D7PA 3EOAA 4PG9B 3MOBH 3MKGA 1EV2E 4KH9A 1BW8A 5IG7B 1A4BA 2WBJA 4Y4FC 1BHGA 3CFMA 1KTLA 2VR3A 2C4FU 3X13B 1GS8A 5EUOF 2XV2A 1C5CL 2BINA 4J6RH 4LNRB 3C8DA 2ADIA 2M8XA 3FH8A 5EU6D 4EBQL 4UF7C 4F7MB 2WXPA 3NABL 3UGXA 5ALCL 3SD2A 1G7QB 3P4MA 1GKOA 5E6IA 1KBWA 2EIZB 3RY4A 3BXNA 5C0CB 3QQ9C 1CLZL 5EO9B 4JFQA 3EYSH 2IFGA 3HC0A 3OWEA 5F3HB 1EERB 4PV9B 5ELIA 3MREA 4G8IA 2JJWA 2PWDA 3L45A 1ZT1A 1CE6B 2ICEC 4JUTA 5CZRA 1ORQB 2AKRA 2AS5M 4PWHA 4NZJA 4ESKA 4ZO8A 1MAKA 1BIIA 5TE6H 2ZCLH 4N24A 1C1EH 4PAZA 4BQCA 3GWJA 4GMTL 2ZWZA 1YEHH 2CHNA 3IWVA 2EKSA 1RULL 1TXKA 1MKFA 3ZSSA 4LCCB 1ID5I 4FFZH 4NOBA 3HG3A 5ADOH 2YJLA 5I6NA 3OSKA 4J2XA 1JFQH 3OHXB 2DWXA 4ZK8A 3ASOB 3G5YA 1T89C 2IOOA 3L4UA 3IAQA 1EFQA 2Z8VC 3MJ9H 1QKZL 1DQQA 2UZIL 2VL5A 4Z0BL 2ARJB 5CILH 1Z7JA 5F1OB 3C5JB 1S8DB 4Y5VB 4OSUH 3C5ZB 3QUML 1YMMB 4DEUA 4JY6B 5KSBA 2LTQC 3D25B 3TNNA 1MHEA 3NAAL 4Z8FL 4DUVA 2N3JA 2TSBA 3CFIC 2NXZD 3WXWH 4CAGA 1IU1A 1XF4B 1VGEH 3S37H 1JZFA 2F54A 4XB3A 3KDPB 4UAHA 4P06A 4XVUC 4GRLC 4WV1C 5FW6A 3U7WL 5IBLD 2IBZX 4X7DC 3GYRA 4OCYL 3TO4C 2UZYA 4MCZA 3MLSL 4DPAX 5F6IB 5FW8A 4LVHB 1HZKA 5CBAB 3G5VA 3OKEA 1D5MA 3D4ZA 5BRZB 3EXJA 2J8UB 1J0JA 1XCXA 2OYKA 2ZUVA 4DIXA 5FDYA 3HNSL 5IHUL 4Z7VE 2ZD0A 4FNTA 4ZMOA 3D69A 3K2UL 3T8MA 5JPMB 2EDMA 3VXOA 1DVFB 4KU1A 4WFED 3MLZH 1IKFH 5ACMA 1CLYH 4HH8A 4ZO6A 2P45B 1ZE3H 4JG5A 4RSYA 3HZVB 4I0PB 4MQTB 1OB1B 1MLCA 3EYFA 1WGVA 5JXAH 1URZA 3F7YA 1Y6MR 2RMNA 3QORC 1V3JA 1QD0A 5GGVY 2B4CC 3UTZA 1JCVA 1QBLH 2UZPA 5AAPA 1ZVNA 3FK3A 2EDWA 1F6FB 3KXFE 3G6DH 4G43A 1N0XH 2JV6A 4GG8B 3V4VA 2OCCB 4P3WA 3CVHA 4YGVA 1FV1A 1F90H 1OGAE 2A6JB 5ES4B 4JO5A 3UTQB 3ZHDA 2Y9RT 2I60L 1RUPH 1PNCA 4FNSA 4JFQB 1BBDH 4WV1B 3AS3A 4Z7WB 4NLAA 2HLEB 5BMFL 4HVBA 5FUZH 4XMUA 2K4WA 1PZBA 1AI1L 2CNYA 4YHKH 1KFAH 3TBTB 2H3NB 3VH8B 4JO4L 4ZG1A 1G0XA 2LFEA 4F2ME 4KVCL 1ZVHA 4JRFA 5C09A 1VF5C 1VEPA 3MUJA 2IVFC 4X6EB 4EO5A 2B3RA 2FK9A 1R24B 1U8IB 3DKHA 2VUKA 3RNQA 1RCYA 4YEEA 3CMOL 4JN2A 4P46D 3W39B 3OKOB 3FONA 4XP9H 1L0QA 4TRPL 4W6YB 3UO8B 4M61A 2XI9A 2QADB 4XCNA 3S9DB 1I8LC 1KBBA 2LVCA 2XXFA 5IVZA 1XF2B 4LF3A 2P5PA 1LWHA 4N0UB 3Q43A 3X12B 5T33L 4JREB 1MCRA 5FYJU 1T7VA 3DV6B 1JHTB 5E8NB 2NY0C 4FQXC 5KTEL 2W38A 2AITA 3TESA 2F58H 2H1LM 2OR9H 4AJVA 4I18A 5JHDB 3QEHB 1PX4A 3NA9L 1NGYB 1W16A 4A66A 5CU9A 4JFYA 4L2YA 4CVZB 1CBVH 4LOVA 4YOKA 2H4EA 4TVPL 3QCUL 4MXQC 1GCFA 4IJ3B 3BWUC 3RWGB 1GJIA 2P9RA 2ADFL 2HFFB 4PU2A 3ESPA 1KZQA 3NCXA 2ZWSA 3T2PA 3JTSA 3ZMNA 2BNRB 5I19H 1ZV9A 3HCVA 3MKKA 5KYWA 4YHIB 4HJGA 2YA1A 1AGEB 2VN3A 4OH2A 2R4RH 3U36A 4Y2DC 5CLWA 5TK4A 3KLQA 1FVDA 1A66A 3QUMB 2CLZB 4ZJ9A 4KMTH 1CXIA 4AEHH 3SE8L 1I7TB 3BWAB 4N87A 43CAA 1NCCL 1OHZA 4L4TA 3U1QA 5CR1A 3CXFA 2C9VA 3CHRA 3H9ZA 3PWNB 4WGKA 2V2TA 5IFJB 2KH2B 3MNZB 1YN7B 4ZS6D 5T1DH 1JPEA 2OCFD 3EHBC 3DETC 4L9LA 1KN2H 3L2NA 2YD2A 1XEDA 3HVNA 3B6SA 3GBEA 3QXUA 3MUHL 4PY8I 4TVPD 4Z9KB 3X1NA 1GJWA 4P99A 1N10A 4RZCB 3ZKND 4JW3A 5BZWA 1MFCL 2XQYA 4QAWA 2ZOKB 4NZTL 1NPUA 4MMXC 1ZANL 1HT6A 3FQXB 3DSNA 3FCSB 3MNVB 4NCDA 5FA4B 3KPQB 3VXPA 5JW4Q 3QORD 2WIIA 5KVEE 1GGBL 5AW4B 1HYSD 3OC8A 2AJZA 4BIKA 1YUHB 1D2OA 2VO5A 5C86A 1MZYA 3KYMB 5K9OA 1TJHL 3K4DA 3NABH 1CFQA 1DLFH 1O6VA 4N9OB 4AKQA 5I5JA 3UJJL 5I1AB 4E9YA 4J6RL 4XRCB 4UQBA 3ROOA 1IGML 3N42B 5KYYA 1YNTF 1TTAA 1ZTXL 2AAVA 3PAZA 3O11B 4JKMA 3R0MA 4KMLB 2EDDA 4F8NA 1JXFA 1VPOL 2Y06H 3GTVA 3WGVB 1WCBB 1JWMA 2VN6A 1KG0B 2FVNA 4U1IB 3VRJB 1G7LB 2YQGA 1FIEA 1U2HA 1QSEA 2B2XH 3K72B 3GZKA 4M7LH 4NKMA 1DN0B 4WTQA 3CHSA 4XVJH 5LBSH 2ADJA 4OVUA 3OKDA 5KVDH 4WEMB 2OPCA 1PYWB 4YXKH 3W9DB 5ILTH 3DARA 2AK4B 4JE0A 1L7IL 3VG0L 3BP7B 4ZUUA 1J9QA 4RAVA 2IALA 2J71A 1DANU 4HGWA 4EE2A 4YSUA 1QASA 5D1XD 5AVWB 1YVLA 4L4VD 1CU4H 1N3NB 3UAJA 5ICZB 4O5LL 4YHPA 1NC2B 4XMLL 4YX2L 4G9FE 3HFMH 1Z9OA 5LAXA 2EIBA 3MV9E 3C5ZA 2D9CA 2GAZA 3RJDA 2WYZA 4BZYA 1YNTB 3I6LD 2V2XA 2VW6A 2NY5C 1KTBA 4CVZA 4XP1H 4OGAC 2M2DA 3QEQD 3PFQA 3BPOC 3D05A 1L6XA 2OTUA 1AO7D 2K9FB 3GM8A 3PJLA 5BUAA 2BNQE 4L3EB 2X3BA 4GKLA 4H20L 4PBWD 5CILL 3HI6L 5D2NA 4F2MB 3LXUX 2VNCA 4Y5VA 4Z7WF 2V0AA 2XY2A 4J27A 5IR1B 2CBOA 3HN3A 4QRTB 1UXWB 3NCCB 4U1KA 5E8EA 4HHGA 4PY7B 4R7LA 5ICUA 2NXYC 3MCLL 1XXDC 1CL7I 2IANA 4LNRA 4WO0A 4MNQB 4WQOA 4O02L 1JVKA 3OVUB 4MMXB 1EAOA 7FABH 1QFWH 2YPLB 3G6JB 5AUMA 3EJPA 3V5KB 4ES8A 1FZOA 1OLLA 5EN2B 1CBVL 4XN2A 1L7TL 3VRLE 3OKNB 2ID5A 2Y7NA 2CLVA 4XNXH 4IBUA 3CN3A 1DDTA 3VNZA 2KBGA 4NN7B 4M7ZC 1I8IB 4WDIA 3G5ZB 1NCAH 2ED6A 3NVQA 4RZCA 3UTOA 1F1GA 2XWCA 3RAJL 2H3XC 3ENEA 1SRDA 1W6WA 1Y6NR 4KJQC 4M9PA 1TJMA 2V7NA 4ZSOA 4F8QA 2CALA 2FHCA 1PTZA 1J8HD 3GKZA 2XG5B 5F9OL 1P9MC 3GSOB 3RNQB 3KYOB 1BQLL 2KYIA 3KXFA 4LT7A 2IAMC 4P4KA 1RHFA 1J5OH 4LE8A 4BFJA 2OW6A 1L0YA 4JKPL 3U82B 4RCAA 1FYTD 3WJLC 5IMMB 5GRYA 3KGSA 2LU7A 3FW6A 4PJHA 3PP4H 3PPSA 4F58L 4QLWA 3BC9A 2FB4H 4JFFB 1PKQE 2DLFH 2W07B 2EXTA 3TA3C 2F53E 1M2OA 5G55A 1JYWA 4QOKB 1T6VN 3P3SA 3LNDA 5D70H 2AZUA 1KB5H 4HX1B 2X2IA 4BDVB 4X6FB 2N7SA 1QSFE 1VIWA 5E00B 2XG4A 3MRRA 1HS6A 2OBGA 5FYJL 5GQBA 1KJ3H 1OD9A 5IFAL 4WSJA 1Y6KR 4LCYA 1NH6A 4ZW8A 3VH8G 3CXHK 4DN3H 3T1FA 2FSEB 2OK0L 1EO5A 1UT9A 3IDYC 4NO3A 8FABA 3ZTCC 1T7ZA 3L6FB 2WOYA 4P2RB 5DRNA 3QNYB 4FS0A 1XQ4A 5CHNB 4NC1E 4Z0XB 1HEJC 3IJ8A 3UYOD 1CGYA 4QHUA 5I8KH 2FZ3A 1OE1A 1NAKH 3IJHB 2JLLA 1G7HB 4K8RH 3LRSB 3PIQA 4FG6C 2XUWA 4AJ0A 3OXSA 1SMAA 2BDNL 4UOZA 1XO8A 3DV4A 3QDGA 5FCSH 4AVHA 5I1KL 5JHLH 2VH5H 5INDB 5AW1B 1ZGLA 1EWHA 3VFTB 2UYLA 7PAZA 4GQRA 1CMOA 2VXVL 1AOHA 1I1YB 1N6QH 1FFPA 2ADYA 3LQZB 4QRTA 3FSAA 3QAZC 4JM2A 1MFAL 3DO4A 4ANWA 3FBQA 4F2MA 2V7HA 2EE0A 3X14A 4QT5B 3QQXA 4A6YL 2TSAA 3EGSB 3MUGA 4LPCA 4L9LC 4R90H 5TQ2L 2P8MA 5M7QA 1WA1X 3LZRA 2NOYA 1ORSA 4L48A 3US9A 2H1XA 2CO4A 3MRCA 1EEQA 2ZYSA 1SN2A 2RGSA 1TOXA 3ROLA 2ZNWA 4MNQE 1FV1B 3RVVD 4JMNA 4A7SA 1DUZA 4Y4FB 2R15A 3O6LH 3OGCA 1N8ZB 3II1A 1FL5B 5A2CA 5DA4A 2CBPA 2YPLD 3N40P 1XHHA 2CJ3A 4HWBL 1S9KC 1XH3B 2WKLA 1ZCRA 3JBG7 1NDTA 3QZMA 4JKKA 3W82A 1FSKB 4BKLB 3EGDA 4QHNA 1T7XA 1RZFH 3FTXA 3NFSH 1DL7H 5MEOB 1ACYH 3G04B 3QR1A 2EDHA 5D7KE 5IGXL 3V8OA 5HHOE 1UEMA 3P0YL 4RESB 4J39A 1QSZA 1OGPA 4HKXB 5TDNA 2SEBB 2DYSB 4J23A 1S7UB 4NKMB 4L3CB 1UZ8A 2EDYA 2ATKA 1RV6X 4Z7QE 4HG4K 2HSIA 1BWMA 4OLVH 4Z76B 1V7NL 3KYAA 4FXGB 2R8SL 4X4ZA 5F9WB 4LVNC 2B39A 4L29A 5EC1B 4GAGL 3M86A 5C0IB 2FAUA 1B9ZA 3D3VA 5I74C 5HXMA 3FQRA 4M4RA 2X09A 5BS0A 5CJBA 4UNIA 1NMAL 4KKBD 1TKWA 2EH8H 3QNFA 4XAWL 4AG4L 2J12B 5HDRA 2IOIA 4UANA 1GMEA 4HAFA 4QRRE 3ZDYF 1V5JA 2I26N 3NZHH 1JGEA 3CH1B 1JGVH 1ZT1B 2ORBH 1W0VB 4G6JH 3TIEA 5F8QC 1LEIB 3O9WB 2HMID 5AEAA 2O30A 1FGVH 3V0EA 3GSVB 4HP5A 1X4YA 3KPQA 1JZ7A 5D4QA 3I85A 1JWUA 2MJWA 5FO9A 3HLAA 5BQDA 4KKCD 3X17A 1KBKA 1RJZB 1OTUC 4FGMA 3S4SG 2HMIC 2GY5A 2MCPH 4DO6A 4PH8A 3L9YA 3NIGE 4MCYA 2WSDA 3QRBA 3EZJB 2DH2A 1Z9NA 4WFGE 1IVTA 1ZWIA 2D3LA 4PJXA 3U7YL 4WTZA 3AM8C 1P1ZB 5DI8B 4UV7H 3KJ4C 1E5YA 4GMSH 4AX3A 3AC0A 5KVGH 4UQAA 5C09E 4DP4X 2NY2D 3FQNA 1QA9B 3UP6A 1QFPA 2J4WH 1B4JL 1MF2L 2YAOA 5BW7A 1A6TB 4AYFA 5AB9A 4MZ2A 4P4KD 4LNVA 4FG0A 4LL9A 5GRZA 4P3DA 1LDPH 1UB5B 4ELMA 4N20A 4M7JL 1U8NB 4KO9A 4WWID 3L3DA 3PP4L 5FKAB 1YDPB 1NMAH 1P4BH 5I71C 1CFTA 5FYJD 1HXYB 4ZFZB 2NX5D 2IIJA 4AYBA 3SDYH 3MLTB 4K71C 5C0DB 4PB0L 3HB3C 5HYSA 3SSGA 4RX4D 1NAMB 2UV3A 4OIIH 4HC1A 2YMTA 4JQVC 1UYWH 1EHKB 1G6RL 4LK4A 4X9IA 4WFEE 35C8H 4HS3A 3SB3A 4LXFA 1FG2B 1XCTB 2ZPKL 4NN7C 4BFGA 4Y7MA 3US1A 2R7EA 2OTUB 2QPEB 3PDOA 1C08A 5EFIB 3FZUD 1WFMA 2YFNA 5CD3B 2DYRB 1J8HE 5E99L 3VXQB 5DEJA 3L3GA 4GRMB 4Z7UB 3L3IB 3BFOA 3KCPB 2BVYA 1L7TH 5GGTL 4MNQA 1OP5H 3LPOA 3HN8A 4KJPD 4Q56A 1QFWL 1WEJH 2VMEA 4JHBA 5D2LF 1VFAB 4LDOB 2XN0A 3N1PC 1CUOA 2LGNA 5HYJD 3WD5H 3X3GL 4PVLA 1FFOB 2BY1A 4B41A 4Z7NF 1ADQH 4X99B 4HJ0D 1T1YB 4Y19E 4NN5B 4X4ME 1GHFH 5F96H 2LTQB 1CGVA 4HJUA 1IGCL 4HIJB 1RZJC 4M02A 4FQXA 3QI9D 4U2ZA 2VERA 2CK0H 5KSBF 2CO6B 1NCHA 5DVLA 3AXLA 4LLDA 1MCPL 5F8RC 4CL7A 1F8TL 3GINA 4P07A 5LAXB 2AXFB 1MI5E 1T83C 3FC8A 5E51A 3SBQA 3SODB 3BP4A 3OJVC 4FQPA 4PP1D 1ADWA 3VFTA 3ULUF 4X6BB 6FABL 3W37A 2WNXA 1OIOA 3RUGE 3QR2A 2VDMB 1QVOA 3DVFA 3FUFA 4K8RD 1LL1A 5MEQA 5D8JL 4B3EA 2E9IA 3VWJB 3FQUA 4WUUE 1TR7A 3JWNH 3L13A 3OV6A 3RDTA 2VR4A 4BFOA 2P24B 4L8BA 5SWSE 4LLVA 5TFSH 4XOCA 4PJBF 4XI5D 4QHUB 3LNEA 5ERWB 5KYWB 4RFNB 4RSVA 3FQNB 5E9AA 5KSAA 2ZWKA 2MMXA 3D30A 3EGXA 3MCG1 1MCJA 2R29H 4HK3N 3MJ7A 2BIHA 4WU7B 2IOMA 1CK0H 4K15A 4R3SA 1P7BA 3EJJX 5ICXB 4JO1H 2EEFA 2NR6C 5JOEA 4HWZB 1A47A 3MRFA 4QYAA 3GXNA 1FO0H 3GDBA 3FO2A 1QRND 3A0OA 3B3IB 2YC1B 1GAFL 4LFHD 5J7CC 4G71B 1QI4A 3FOLA 5FGCE 1GIGH 3GS7A 1M53A 4QRUA 1J9RA 3UBFA 3GJFB 3UIYA 3WO4C 4DVRL 3WGUB 3L1FA 2KLSA 2W0PA 3GSRA 4FNUA 3KPTA 4J4PD 3KWVA 5FXCH 3PWPE 1G9MH 3CZGA 3EO1A 1MCWW 3CFCL 3WFCL 1R6VA 3ILQC 3PL6A 2WAHA 4YGAB 5BQ7B 1F5WA 1A6WL 1DBJL 2C4XA 3EYOB 4UT6L 2GSMB 1WBYB 2BSRA 4G9FB 4RETB 2CU9A 2YZ8A 5E2JA 1E5CA 3VXSD 1G9NH 3B1TA 2GIYA 1P7QA 4QUOA 1PF3A 1LP9F 3BW9A 3DUUA 2G3ZA 2JH2A 2VR7A 2YAHA 4Y4HA 1EVUA 1P9MA 1NKGA 3QULA 4PJCB 4TLKA 3WIHA 3WUZA 1EJ6A 4RGMC 3ZZ1A 1A9VA 1L3NA 3LSOA 4H8WL 2D3VA 3GLZA 4E9SA 5TDPA 1HNGA 1OCWL 3FAXA 4HJIA 2GJPA 4URTB 1BJMA 3U48A 2X6CA 3ARSA 2PYEA 3QDJA 3MRBB 4UT6A 3PJSB 1AQKH 2RALA 3PF2A 4G8AC 4NO2B 4EXPX 3ZE2F 1KXTB 1K5NB 4RMQA 3SKMA 1BX2B 3GPEA 4EUPH 4JPWH 3SPIA 3HI1A 3R8QA 3UIZA 1YMMD 1HL8A 2RJMA 1LK3L 2IDCA 3D3VB 4ISVA 2IH3A 3TXAA 2HT2C 1RJYB 5CEYB 5T5FA 3M1CA 4UTBH 4H26A 4POYA 1F6LL 3ARTA 2EP6A 4DGIH 3FF7A 3VRIB 5D1QE 4GSUA 4KDVA 3FUNA 1C12B 4N2NA 1N8OE 4FQ1L 4QRQA 3OG6B 2ED9A 4OIFA 2BZCA 3BISA 1WBZA 4A67A 1CPUA 1OW0A 3LIZA 3LQZA 2CDGA 3WE6A 2DQUL 5ADPH 3A4AA 2EACA 4YEFA 5IJVA 5AVTB 1CD0A 3CVHB 4YGVB 1FYHB 4GNKB 5FB8A 3GK8H 4O58L 4WHTA 3IE4A 4JFEA 2WXRA 4N3UA 5DUJA 4ZTOL 2RCSH 3CQFA 1G43A 4HWBA 3VFMA 5D4IA 3HS8A 5GGQH 5L4JA 2RIKA 2LABA 2G4EA 3A6CL 5CLZA 3OPZL 1WS8A 3FO2B 5L4IA 1ZS8B 3QHTC 4O9HL 4G5ZH 5A7EA 2WLMA 2P28B 2P5WE 3QHZL 4PJ5A 3L7EB 3OR7A 4LLWA 3B5TA 5FO7B 5DWUL 4Y9FA 1G7IA 2EYRB 2NY4C 3BVVA 4AGPA 4CVXA 3RFRA 1NMCC 4YXHH 5KEZA 4X42A 2A9BA 4UM8A 4PQXA 2DQCH 4GXFA 4PJXB 3I6GB 4RA0C 6TAAA 1RP9A 3ZSTA 4Z3FA 1VFUA 5FHAL 1JTPA 4KJQD 4EN3D 2R0LL 3TFBA 4JDTL 1MCCA 3C8KA 1YEGH 4JFSA 3MLTA 2FH8A 5C0DA 5AVXB 5C0RL 3HG1B 2BOBA 2BSSA 1VHPA 4MAYD 3SKOB 1JN6A 4YHNA 3VXNB 4UU9B 4FXLA 4KKBC 4QWWC 2XDHA 2VLRD 3SGDH 1F8TH 3MBEA 4DGUA 1L6PA 1O9VA 4WF7A 4PS3A 4ELKA 4APQB 3LNGA 2DWDA 4NO5A 2CRIA 3IDJA 4NQSB 3RWJB 1TF4A 1J1XL 3ECVA 1G6RB 4J5VA 2YOAA 3POHA 3IXTA 2QR0B 4IOSD 1MN4A 4MJID 4OLZL 3T6QC 1HAWA 5C0NC 3ETBF 5KVEL 5B38A 4M4RB 1FNSL 4OGXL 5JZ7C 3CK0H 4AEEA 1U3YA 3FSOA 3LKRA 1CZ8H 3L4XA 1EBAA 3KVPA 1DQVA 4XT1C 3RVXD 3N41F 1ZPLA 3KCWA 1TDQA 1K8IA 1G9ML 1KXTA 2JI1A 2FDBP 3I50H 3GSNH 5GGTH 2DLTA 3PABA 2HKFH 3PYCA 4N2IA 3MRBA 2V3EA 1HU8A 3FU8A 3SDDD 4FA6A 4UYPA 2EUZA 2E76C 3FT2A 5GGUA 5FX3A 5FHAH 4P9MH 3RX8A 4M8QB 4XN7A 1IE4A 4QTHA 2XFGB 4Y5YC 3BH9A 3ASNB 1CDCA 1T7YA 2FECI 3WMPA 5MERA 5C6TH 3MDJA 2UY6B 4HAGA 5DF0A 5IROC 1I53A 3S37L 5JOFA 4OT1L 4JY6A 2CUHA 4Z18A 5KSBB 4X0KA 2NR6D 4JM4L 3ZUNC 2JTYA 4XMWA 4DVRH 1MXDA 2PN5A 4UT9L 1NGZA 4ZQKA 3NTCH 5A2BA 3O8XA 1IEBB 4KXDA 5KSUA 3WUWA 5I17A 2AK4E 4LBEB 4XXDA 2WCGA 4MYPA 4OZIA 1AJ7H 4JZOA 1OAXL 2K6WA 4J4PA 4JG1H 2QVMA 1RVFL 3AXHA 4XOEA 3IDIA 5D2LB 4UINL 1U8KA 4PMFA 2HFTA 3QORA 3GJFA 1Z32X 3K0YA 5JTWA 4DZBA 4K5PA 1NIFA 2NYKA 3DX6B 3M45A 2GC7C 3DO7A 1SVCP 1XH2A 1P7QD 3FJTA 3TA3B 3BQUA 5D55A 3WSQH 4ADIA 4M1CC 1L5GB 4Z7QF 3VFWA 1E9PB 5DMGC 2MQGA 2MRYA 3RVVC 1N70A 1G9HA 3HLKA 1QUNA 3WIAA 3W0WE 3L48A 3QE5A 4IHBA 4KPHL 3B83A 1MCFA 5EOQL 4EI5A 2VDQL 4NGHL 4R4NC 3VWJA 4GQQA 5CZXD 5EB9A 1E6JL 4KKNA 4DVBA 2YC1A 4JZJB 1QSEB 1MLCB 4NQXA 4ABWA 4F24A 3H9SD 1E67A 3NCWA 5DD3L 1G7LA 4JCLA 3C8KB 3FCBA 4NZUH 3QAQA 4W9ZA 4XBGB 4FQ2H 5BJTA 1SHXA 4PJ5E 3BQVA 2BIMA 1TMQA 1EVTC 2OV0A 2P8MB 1XDTT 3UTQA 1JVOA 3ZL4H 3LPFA 3SDCC 2HVBA 1BAFL 5GJTH 1R3IH 5G4MA 3I9GH 2VXTL 1Q4NX 3D6GA 5JW3L 3GZQA 4LEXH 4W9GC 3CTTA 5EU6B 5I6OA 1CLCA 1W8NA 5E2WH 4OCWL 4UILH 3RVTD 2ZXBA 1XAKA 1G9NL 4JPQA 4CGUB 3OQ3B 3M17B 1T3FB 5K33A 3AXLB 4LLDB 3CN1A 2CCLA 3DHPA 1ETZB 3GIVB 3FCTB 1E90A 1UATA 1IC4H 3MR9B 1FDLL 3BPOB 4NGHH 5AZ2L 3GMNB 2CDGB 1UM6L 3GI9L 2FBOJ 4OZGB 4WSKA 1GIGL 3VSUA 4B53A 4BFIA 2VQ1A 1NWPA 5DGQA 1P4BL 5KSVA 9PCYA 1DCLA 3ML9A 1D5MB 3RIAF 2FO1A 5B1JC 3LIUA 1FO0B 1Z3RA 1NEZG 8CGTA 1KPUB 1FFQA 5KSBE 1XGZA 5E5MB 1DVUA 3RRQA 1BECA 2OXGB 5KVGE 1T22A 1NFDF 2GPZA 3EZ8A 5JIHA 3DX1A 4FNPA 5DLLA 2HX8A 2YWZA 4AMWA 1RPUA 2R7EB 3PDOB 4I7ZC 4TVUA 1TSHA 1K85A 1HSBB 2XRAL 3RL1A 4ZPTA 4HSAC 4X4MA 1GGCL 5F7KC 2HRGA 3H7LA 4JPSA 3Q9PA 1QKZH 2UZIH 1YPZA 1I4FB 3QCTH 3KL0A 4RGNB 4AL8L 3T0DA 2Y7MA 1KGJA 1BF2A 1BGXH 4L1LA 3SE9H 1T6WA 4QYOB 5KVEH 1QUNB 4KNTA 4XWOD 2IBBA 2IEPA 2Z92A 3LS5L 5ECGA 2QGEA 3PWNA 4LSTL 3SKNA 3FS9A 2FQGA 2ZP8A 1RQ5A 1WUNT 3WNPA 5FGBA 4ODTH 3FU6A 4K71B 5C0BE 4MAUL 4QHMB 4BSWA 2XTJD 3GI9H 1KCWA 4XHJD 5IVZB 2R69L 5I1HL 3AQXA 4JFEB 4L8DA 2FJFA 2E5EA 1TZ8A 5DHVA 5I8EB 5EEXA 3CHOA 4U7MA 4V1DA 1J88A 1S78D 4ZFOA 1EJ8A 3T2LA 3TTYA 2BS9A 1DSFL 4CC1A 2PPEA 3RIAK 5CSZA 2OJZH 1UXMA 3U9UB 5D96B 5E8EB 4PI0A 1L4IA 4U1NA 3UG5A 4WI6A 1JUFA 5HYQB 2X6AA 3HJ0A 3L4TA 3QIUD 3JYCA 2Y2TA 3MRMB 3FB8A 4PYGA 2EDQA 4TQEL 1WISA 3I6SA 2ZYHA 3D1MC 3ZZLA 2Q7YB 2DMBA 3JTTB 3A6CH 5IK3A 2FL5A 3QJOA 4F58H 1EEZB 4K23L 3LHAA 5ICYB 2H3KA 3G5ZA 2J6EA 2M83A 1IBZA 4RBPK 4AC4A 3BYYA 2YUXA 2ITCA 4WLCA 5HDBE 3G5XB 3TX4A 5JR1L 2NDFA 5EU7E 2IGFL 3JWDL 3V5DA 4YFLI 1ZK9A 4G43B 5E2VH 3VG9B 4V2BA 2AI0H 4YDNA 1DR9A 3NJIA 4WI4A 5B3SB 3A67L 4LSQL 4HWEL 4GQZA 5LJYH 4YE0A 3UTTD 3BKMH 2CO7A 2E27L 4YLQT 3MBEB 1TTRA 4MXWL 1EBPA 3DUSA 3IGAA 3SY6A 4OV5A 4XMLH 1D2PA 2HJFB 3FT2B 3CSYA 1QNZH 4IBWA 3MVSA 4HIEA 5KBLA 4GUQA 4Z77A 2AXHA 3IXTB 4M1DH 4Z3TA 4PGCB 2OQJB 1EAPA 4NXKA 1IEAB 3X11B 4AUUA 5GPRA 4YLCA 1MFCH 3AS1A 5ABZA 3IF1B 1Z0MA 3FULA 3MV9A 3P30H 5K9KB 5KYUB 1WH0A 5FUOL 1XH3A 4BKLA 2YRBA 4E9RA 2E46A 5F7LB 3VVVA 5EN3A 4JQXA 5HGHA 5IQ7H 1YNTA 3HJEA 3ETSA 2Z91A 3RX9A 2ZCZA 3VGEA 1EHLH 1MFAH 2NSQA 5J1AA 1NM4A 2A1WL 4FC3E 2VGLM 1RIHH 3I6GA 3MRGA 4PRHD 1MHHB 4UCFA 2BERA 4TNVK 3EYFB 5B1JA 4PY7A 2R4RL 2VISA 5F1IA 2WIIB 3QEUB 3TV8A 3WL9A 5I2IA 5IIEA 1UXWA 1TTGA 3DURB 3B5GA 5I5MA 4HUWB 3FFDB 4LGRB 5E5UB 5AZUA 3WEOA 4FFWC 4TVPH 3MACH 4TSBL 2VDLH 1CU4L 1OF2A 4ALAC 3RB7A 3AJ7A 4HXBH 3US0A 3IFNH 4RRPG 5AENA 1AGFB 4OD2A 4NCC2 1A3LH 2VSKB 1CT8B 4DEPB 2NY1B 4CDHA 2A0LD 1OANA 2OCJA 1JTOA 4DGWC 3RFZC 3ARFD 3QDJE 2ZXGA 1VEMA 1UUNA 2EEAA 3FH5A 4U6HA 3TBYA 2BOLA 4M3KB 4PRPE 1UCBL 4Y4KC 3GM0A 4XNMA 3RLSA 5JPNA 2B77A 1T4WA 3FU5A 1MRCL 3ZRCC 1B4RA 2XYCA 5JPMC 2ZX9A 1E3ZA 2X1OA 5GHWH 3IU4H 5DC0A 4OFQA 5DZOA 4M3HA 5C0JA 4BM7A 4GXUM 4BZ1A 1I3RA 3AS2A 4NIYE 3UJIH 1RZKL 4GKNB 5DJXB 2AGJH 4C54A 2PUQT 3TNMA 1T3FA 4LLMB 1HAUA 1BFOA 2WYHA 3CUPB 3SQOL 1OO2A 2NCEA 3MA7A 1MRFL 5TE4H 1EXUB 3LS4L 4LCYB 1Q9OB 3KWWA 1Q8MA 3NP4A 4XTRD 4YN3A 1BVLA 1IX2A 1IKNC 3DSFL 5IT2H 1AR1B 1UB5A 1JNJA 3T0BA 5HDQH 1CL7L 2D7QA 4X6FA 4J28A 4LSUH 1XH1A 3B9DA 4IRZA 3GLAA 4P23D 1IGIH 4MNGA 5CJOH 1KXVC 4FHJA 2WAQA 4MJ5B 3HNTL 4XCCH 5BV7B 1YYLH 5EA0L 1S7RB 1XIWA 5KG9A 1S7XA 3QG6A 1D7CA 3DSNB 4ODWA 2VXVH 5EZJB 4Z7VB 1ZHKB 2C3VA 3IMWA 1WJ3A 4C4BA 2V33A 4FXKB 4JJOA 2DJUA 3UEQA 3RURA 1RVFH 2WZ0A 4YXLH 5BUPA 1BEYL 4L8CA 4KVCH 1KIUA 4E42B 1NEZB 3WNMA 2APWA 2X6MA 1F13A 1NC4A 2BMKA 2VIRB 2YLHA 5DJ2A 4BZ2L 4G3YH 5IFJA 1UT1A 1JE6A 3E3QE 2W65B 1ID2A 4RMBA 4J8QA 2R2EB 3A6BH 3UBXB 3DJTA 3HC4H 1QLRB 3U9UA 5BXFA 3GMMA 4LFHG 1TQTA 2E9GA 3ARVA 2OK0H 1I3UA 2DEWX 3B2MA 2OMBA 2VDML 2JJVA 4LZKA 4N8PA 5GRUH 5LBSL 1H15B 1WE5A 5AALA 1IGTB 1QA9A 4UOQA 1U58B 3T4AA 4IBQA 3GC3A 1JJUA 3OJMB 3FUDA 3RWDA 1KACB 2VLKD 3SE4A 3W9DA 5B3JF 1T04B 1MW0A 4XN4A 1N8ZA 1UACH 3CG8A 1CVSC 4OR1A 5EF1A 1JF6A 4OZFB 5DD6B 4OM0L 2OP4L 2FATL 3GHBH 1MW1A 1WAEA 4M6NL 4WHYG 1T2QL 2J5LC 2WPGA 4WNJA 2HFGH 4CU7A 5DC4B 1JXDA 1T03L 3EOBB 1U92B 4K3DH 5TE7H 1PG7H 1TENA 4M8UA 3F58L 1BM3L 3P2BA 1IKOP 2OJZL 4ZUTA 1AZUA 2AK4D 2NLJB 2EKSB 1IJNA 1MFBL 2VT0A 3IFOB 4HSCX 1RZIB 3UYRL 5DYOB 1OTSC 4JRXE 1DN0A 3LS5H 1S9YA 1U93A 3TZVB 5JW4R 1MSPA 1S7VB 4HUUB 4HJSA 1SEQL 4IU2B 3GMPA 3WTSA 5KSAD 3RAJH 3FQRB 2BP0B 4M29A 3QT2A 2VCOA 2FEJA 4M8VA 1Z5LB 4ZUUB 4F37F 1F97A 5C0IA 3B37A 4R5VA 2B0SL 1M7XA 3EHBD 3GFUA 2XX1A 3OAYH 4JPKL 3D39D 4TNGA 3MRDB 5ENWA 3FRPA 2ZTBA 4B9IA 4J3TA 2XTJE 1SLXA 3FU0A 1XMEB 1TYRA 1NCOA 3U6RB 2I27N 3PP3K 2YD5A 4IU3B 4PJGE 4QXVA 3X1BA 3VXME 4CC0A 4NKOA 2J2ZB 1AANA 3ZDYB 3D0AA 4NQCB 4WU5A 5EHFA 5CBAA 2AJUL 4PG9A 4KNUA 2NRDA 4K7PY 2ICWI 3L1OL 4F15C 3RZCA 3C60B 3WV0A 5IW6B 2Q76B 2J5LB 2WTOA 3UPAA 3V8CA 3NJXA 2QMJA 2QSCH 1F3DJ 1SYVA 4NIKB 1CFSB 4Y4FA 5CJ5A 1JZHA 1A6TA 4P2QE 5GSRB 3VFPA 1MCBA 5DYFA 5IQOA 2DI7A 4NZ8A 4BFBD 1Q9WB 5JQ6L 4PV9A 3MLRL 2DJSA 4H0IA 2OR9L 3PRZA 4P2OC 3B9KB 4P2RA 4XNYH 2YGOA 3VXRE 1UC6A 3NFNA 3NA4A 1KY6A 2R56H 3LN9A 4Y4HB 4DTGH 3QS2A 5DMKA 4AITA 1AOZA 4TL5A 4XO3A 1A7RL 2L0DA 3MXVH 3A67H 4LSQH 4LCUA 3DXAA 4TS6A 4J3WA 1IT9L 4JR9H 2NUTB 1IC4L 2VTFA 5C0EB 4X98B 1SN0A 3RZWA 2A73B 4JRYE 3WY4A 3GSVA 4TTDC 3VXMD 4ADGA 3S8WA 4KRPB 1D6EA 1NANI 3K6FA 4GBXC 1A21A 4BSVB 1H3WM 3KPSB 3JV0A 2OSYA 5JPNC 1PDKA 1F4YH 5FECA 3WTWA 2X4NB 3NACH 1XTLA 4PI2A 1UWEH 1GYCA 3ARXA 3BGAA 5HDBF 5IZ7A 3D25A 2RHEA 3T6ZA 3TNNB 1XCWA 3WYRA 5I6MA 4I13B 3IMVA 4ZRGA 1IGJB 1ACYL 3C5JA 3UJJH 3CXHJ 5IGXH 4AIZA 2OXHB 2WXLA 3T65B 4G70B 3CPUA 4DK6A 4ZX6A 3PV6A 1SEBB 3MODL 1AVAA 1RZ8B 5F97E 5DD3H 1HSBA 1D5IL 4WWKC 1HDMA 1JZEA 1K4CA 1WO2A 3D2UD 5DD1H 3S48A 3FN0L 2ICES 4IOFC 3P9MA 4PTTB 2OTWB 2BLFA 4MAUH 4LARL 4PB9H 5A1AA 4D9QE 1QR1B 2DQFB 3N91A 3H9SE 3MBWA 4GW5B 2ROXA 1KEMH 1BFOB 1A14L 3DUHA 1KENH 1OK0A 3B9KD 1XEUA 3KWUA 2HFGL 3TCXA 1LQBC 4PJEB 5I9QC 2CBMA 2LV4A 1ZLUK 4X9GA 2C1OA 4ODVL 3W1ZA 4FERA 4LIQH 3H85A 1MCOH 1OB1A 1CICD 2FIKA 4RRPM 4CW1B 2DQ6A 1I1AC 2L8AA 5DHYB 2IPTL 2YEZB 1ACZA 1AIZA 4ZNEA 4WY7L 3WNOA 4Y7OC 1MLBA 3OZKA 3MA9H 1KYUA 2CA4A 3IDXH 5K1NA 2GW5A 5AAMA 4OCSL 1BYNA 1I8MA 5AKRA 3TYFB 3D85B 1PKQB 5F7FA 5BW7C 5EORL 5C0JB 2VDMH 5E8PA 4G8GD 1A4KA 2XOTA 1IC7L 2FX8H 2XLLA 2G3MA 4YDIL 3WU1A 3G5WA 5IF0A 1SMDA 4J3OC 1SOKA 5KBMA 4GRWH 2Z92B 4IGBC 4TQIA 2HPTA 2IJ0C 4ONFH 1HI6A 3DTXA 2YKKA 1ZK5A 1INEH 1ILSA 2IALB 4HWZA 3UCQA 4W81A 5A6LA 1U8QB 2R0ZL 1HK6A 1CI5A 1RP8A 1IBFA 1NIAA 5SV4A 5CLXA 2WXNA 1KJ3L 5IFAH 3BDYH 1UD2A 2KDGA 3VSTA 5FCUH 4RWYL 4Z7UA 4GINA 3IVKB 2JKNA 4JKLA 3E6HA 1MHEB 3GXDA 5J11C 1AR2A 5DHXB 1R46A 5FA4A 1NL0L 1E7VA 1GPOH 4KI5F 1H0DA 1FAKT 4GIOA 1MG2C 1OP5K 3LEXA 3SGJC 4X83A 3O41A 3HZYB 4OGAD 5PAZA 3WN5C 4D0CB 4LKCB 4U2YA 4R0LA 1BD2D 1H15A 1PCXA 1FG9C 5DHEA 2IDFA 4Z7AA 4OZ4A 1S9YB 3TZVA 3QIUC 1DJHA 2A74B 3LRLA 4WWPA 1F1AA 3ZN6A 4EDXA 1AO7A 1CC3A 5ESQA 2AJXL 1KXQA 2V9QA 3GUTB 3VAEA 4U4IA 2ITFA 5JIKA 4GQ9H 4D8PB 1DBKL 2HPOA 2NXYD 3MV9B 5K9KA 1D5ZA 1S9VB 3QQ9D 1FRGH 1QEWA 5IB4A 4MA1B 4ZTPL 5TDOA 4RDQF 3SJVD 1WZKA 2NT0A 3I3BA 4XPGL 4TUJA 4G5ZL 4PJGF 3G6DL 2DWSA 4Y5XA 5F3HA 2KI6A 4PJAF 3FQ4A 4FMVA 4Y4FD 3H42L 1KPRA 1CVRA 3TT1H 3IPBA 1FL3A 4LPVA 4X4YA 5LXGH 2DQCL 3TLRA 4JAMA 3GMPB 3OMNB 5AZEL 4NNXA 5F1KC 1K5NA 2Q76A 4KOBA 2BOCB 1UASA 4U1MA 2IWFA 2QADD 43CAB 4NAQA 2Z31B 4DH2A 1LEKB 2NLJA 3AY4A 4LU5L 2IH3B 1E9PA 2P42B 1Y0LB 4WI9A 1J8HA 4XPTH 5J9PA 1U92A 3MROB 3U2IA 1E4HA 2C9SA 1E9OA 3IFLH 4IRSD 3V52L 1L7IH 4RGND 4Y9BA 1BZ8A 4HYTB 2D4DA 4GB9A 4NC2B 5D7LE 3PY9A 1NFDB 3EBGA 4E42A 3PABB 3VXMA 2PWGA 3FMGL 1JZIA 4S1SL 3BW9B 4M43L 4BE5A 1OAXH 5I1KH 2QLVB 5AYTA 5DLMH 5LGHH 1UH4A 4ZD3L 1BD2B 1IBHA 1NBCA 1MCQA 2I25N 2HJFA 3LSOB 3Q2CA 1BREA 1YDPA 3MJWA 1DCEA 3OL2A 3OAWA 4IIQA 1CE1H 3DV6A 2VQ4A 3HG5A 3G08A 3CFBB 4DP7X 4PGJA 4TTGA 2X6BA 4HCGA 3P54A 4BYHA 2IO5A 2QSCL 3LRHA 1F3JB 1H3GA 2AXJA 2VDRH 4KJYB 4LF3B 2BSRB 4G9FA 1KYFA 1OT1A 1M6OB 4JRXA 2AXGA 3STZA 3K80A 1MHCA 1MNUH 1VACA 2X89A 5E7BA 3N55A 4GBXA 2E7HA 3FU9A 1KELL 3L8QA 4X7SH 2GK2A 3QULB 4PJCA 5ANME 4YIQA 3BAKA 3EBHA 4MZ3A 3DXAB 4R4FH 4AE0A 2YD3A 3D0LA 5LCVA 3S3CB 1SJEB 2PPFA 2ZUQC 3HPLB 3TBWA 3OF6D 2Y0SA 3LV3B 2MCMA 5ITBH 2YMXH 1JZ3A 1LO2H 4K3JL 4JFYB 5JXED 3K72A 3NH7H 1CGTA 2X10A 3D5OF 3F62A 3TC9A 5GRVL 2OSWA 5IIEB 1PD6A 2WZAA 3MRFB 3WFHB 2AEPH 3BPLB 4P2QD 1HQ4A 2XV0A 3U0PB 5L8LB 2E4TA 4ETQB 2FGZA 2CPUA 1N3NA 3EH4B 5CMAA 2QR0A 1PDKB 2W81C 3JTBA 5FECB 4XBEH 2XN9E 1YCSA 2BFGA 4LPYA 1FVCB 1ZT7A 2FO4B 5KAQF 5L2KB 4Z6AT 2PETA 5GIRB 1RU9L 4DGVH 1FE8H 4BUGA 3C12A 4ELKB 3VFGL 1D6EB 4JCWA 5SV3A 2XA8H 3DOSA 4QXTB 4TM9A 4E5XA 5DC2A 2PP8A 3WELA 3U46A 2Y2YA 2P5WD 3SDAD 5J3HD 1NEZA 4HWBH 3TF4A 4ODXB 1VRSA 2YGVA 1JDDA 2C4FT 5CJQH 4IU3A 1SDYA 4N8CH 4RAHA 3GSUB 4M1CD 3GBNL 3L5HA 3HB3D 1RUQL 2AQTA 1LE5B 2F8IA 4JZNB 2VLLB 5TDNB 1CD1B 3IJHA 2IGTA 3N43F 2DKUA 2VKWA 3IJYB 4MVBD 4WI2A 4JFVA 4ZMYA 2VZVA 4A2EA 3F01A 2JIXA 5CINL 1QZ1A 4W9LC 4Z95L 1RY7B 3X3FH 1VKXA 4AEIH 4NWUH 5MP6L 2F1AA 2GBUA 4F9PC 5D1QA 2Z34A 3BAYA 4ZXBB 1AXTL 1AXSA 3D9AL 3MHZA 4NO2A 3FRUA 3U4AA 4MMZB 4ODVH 2CG9X 3VJ6B 2DWEB 2B4CH 2Y2WA 3QC5X 1BXAA 1NUNB 3L81A 3ZDZE 4LQFH 1IQDA 1PAMA 1G1OA 4X8JA 2NCMA 4AJWA 5DU7A 3KEDA 5C0CD 3E0GA 1WV7T 5I1CL 1PKQA 2JJTA 2ZZUT 5E8OB 4PJ9C 2F19H 2ATPB 1MZZA 3AVEA 1NKOA 2Y7QA 4LOUD 4PWFA 3DK0A 4J2QA 1KIPA 1F4WH 2YEZA 1HOCB 4FEIA 4ZMVA 5KVFL 1GVIA 4P8QA 4S1RH 3SGKA 1RIUH 1F42A 3T3PE 4RZKA 4DJMA 4QY8B 1IC5H 4U05A 2DF3A 3GSOA 4O2FA 4P5TC 3EH3B 1X9RA 4N2OA 4PP2A 4KKRA 4NPYB 1YEDB 3QDGE 2X4NA 1S7VA 3PHQB 4GKOA 4GRWE 3EO9H 3WFZA 1FZJB 1IBBA 3FXIC 3KPLB 1KBGH 2B59B 2PPAA 5LQBL 1J9TA 4YC2C 4X4XB 4JFDA 1PY0A 1FWXA 2ICWB 1XB3A 1RK7A 5F89A 4L05A 3OKNA 1J0HA 4YBLC 4I48A 2N4IA 4D0CA 4L0ZA 2FECL 4ZFGL 4H25A 2VMCA 3C08H 4OJDH 1AE6L 5CEZE 1FLRH 1NCJA 5IREA 1OSEA 3N5AA 4R6UA 4PJ9B 4YE4H 5E95B 4DK5A 4HBQA 3EOYG 1DQMH 3QISA 2P26A 5EEZA 3I84A 1J1OL 4G8GB 4UQ2A 4F5CA 1EFXB 2JWYA 4JKPH 1FNGA 1JNLL 5EU3B 1UA6H 1F11B 2K0RA 1BX2A 3TM6A 4APQD 3RWDB 5IR1A 5EUKA 2KL6A 4X0KB 4D0BA 3VFRA 3MGTB 3BUIA 2OMVB 4IM8A 5DRWA 2YPKA 2BNQD 2H1PL 1TQSA 2EDBA 2EAEA