5KJ7E

Structure of the ca2+-bound synaptotagmin-1 snare complex (long unit cell form) - from xfel diffraction
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
278
structure length
278
Chain Sequence
KLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 3
publication title Advances in X-ray free electron laser (XFEL) diffraction data processing applied to the crystal structure of the synaptotagmin-1 / SNARE complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis,exocytosis
total genus 43
structure length 278
sequence length 278
chains with identical sequence F, K
ec nomenclature
pdb deposition date 2016-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5kj7E01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 5kj7E02
2UZPA 1BCIA 1E90A 3T8MA 2CM6A 2K3HA 4FJZA 2QZQA 3KWTA 4IHBA 1WFJA 2Y3AA 4NS0A 4XE0A 3CSTA 3QAQA 3PRZA 1CJYA 4TS6A 3OHMB 4IQHA 3F01A 4F1SA 1A25A 2Z0UA 3PS6A 2CJSA 2CHXA 5H4ZA 2ENPA 4BFRA 1E8YA 4PS7A 4G11A 4NPJA 4WWOA 3TWYA 2K4AA 3KWUA 4FJYA 1W15A 3PYCA 5KJ7E 2NSQA 4TUUA 3F04A 4A55A 2RD0A 2WXNA 2ENQA 3L9BA 3L17A 2DMHA 1UOWA 3ML8A 2KI6A 2K8MA 3JZYA 4FLHA 2Q3XA 3W56A 4FADA 1HE8A 5EDSA 4WEEA 5CCHE 1UGKA 3RPBA 2WXMA 1RLWA 3QR0A 1DJIA 4DNLA 4FA6A 4L1BA 1DQVA 2K45A 4OVVA 1V27A 2V4LA 3DBSA 4TV3A 2WXPA 4F91B 3APFA 3OAWA 5CCJA 5H4YA 3ENEA 4MJJA 4QAMB 3MJWA 2N1TE 3QJZA 4FULA 4EZJA 4LCVA 3PREA 3ZW3A 2CM5A 3HN8A 1E7VA 1DSYA 1RSYA 2DMGA 2WXOA 1E8ZA 2FK9A 3M7FB 4QJ5B 1BDYA 4FHKA 4EZKA 2CHZA 2WXKA 1BYNA 1TJXA 2WXHA 3FBKA 3L08A 4L2YA 1GMIA 4ICXA 3NSJA 3QR1A 3L54A 2WXLA 3LJ3A 3ZVVA 4L23A 4PS3A 2FJUB 4GNKB 4WWPA 2B3RA 3FDWA 5T8IA 2A4ZA 3N5AA 2JQZA 3APDA 4KZ0A 4NPKA 4URKA 2Q0ZX 4AJWA 2ISDA 1TJMA 4Y1SA 4WAFA 3ZIMA 1YRKA 4JPSA 4ANVA 5JHAA 4OVUA 3ML9A 3IM1A 3GPEA 2CJTA 3HHMA 2X38A 2A5UA 1E8XA 3SD5A 3L4CA 3TJPA 1E8WA 4FHJA 1K5WA 3QARA 1DJZA 4NP9A 5G2NA 2CHDA 4F92B 4HLEA 3RDJA 2WXRA 4GB9A 2NQ3A 2BWQA 2YOAA 1DJGA 5JHBA 1DJHA 1DJXA 3QK0A 1RH8A 2LHAA 2WXJA 3B7YA 3W57A 4F93B 4L1LA 1UOVA 4DK5A 4J6IA 3IBEA 3R7RA 2R83A 3L16A 1W16A 4KITB 2YRBA 2QZ5A 4EZLA 1QASA 2WXFA 4ICWA 5G55A 4XZ4A 2NCEA 4AOFA 3L13A 1WFMA 3F00A 3R7QA 2WXIA 4ANUA 2ZKMX 3DPDA 3S2AA 4BGDA 4Y1TA 5CCGE 1QATA 4XX5A 3CSFA 3PFQA 4V11A 4HVBA 3HIZA 2CHWA 3APCA 4QJ4B 2WXGA 4KZCA 1DJWA 4ANWA 3P2BA 4LDCA 2EP6A 4ANXA 3NZSA 4QJ3B 3NZUA 1E7UA 4LT7A 3F05A 4PS8A 3TL5A 2D8KA 1DJYA 2ENJA 4WWNA 2WXQA
chains in the Genus database with same CATH superfamily
5F7EH 2ESVA 2A9AA 2QZQA 5E9AA 1HOCA 2R0WH 4WJ5A 5EIVA 3MR9A 1ORSA 1A6UH 4W6WB 5I75C 5DUMH 3NIDE 2GJ6B 3NJFA 3C9NA 4K5PA 3KPPB 3LQAC 3WLWD 5H35A 1DVYA 5FUCE 3WJJC 3IU4H 4L8DA 5IFJB 2AEPL 5KS9F 3ESVF 4RISL 2BNUA 3NIGB 3T77B 4NENA 1ESOA 1Q94B 1KYOK 1TETH 1YUHB 5ESAB 4HK0B 4OSUH 5INCB 4CBPA 5ITBH 2Z9TA 5CO1A 3AFLA 1JGLL 3OXRB 5FGBA 3GSQB 4G1MB 4OLYH 1RAMA 1YNLL 1CICB 2GFBA 4BM7A 3LTVA 4P9HC 1WZAA 2R23A 1RJZA 2BVQB 2V3EA 2AAAA 4XN4A 4XR8C 5EO9B 4AIZA 1T83C 2M2DA 2O26U 5JZ7C 2ZX6A 5CHNB 3RB5A 3K6SA 3UAEA 3K5SA 1TLKA 3RWDA 3TCLA 1DBBL 3WLWC 3J07A 4JFOA 1CFBA 3OAUH 2BSSB 4L3FA 1A14L 3ECVA 1TEYA 1W6WA 2OMBA 3SJVD 4KHTL 1M05A 4ONFL 3KYMA 1EEZB 3QQ4A 3MBXH 3WS3A 3TBSA 4AYSA 4ZTOH 3TO4A 2X4OB 4GYBA 1BBJB 4W9IC 5E1HB 5FO7A 5AYQA 1ACYL 1T0NB 2VXQL 3FUIA 5E4IA 4HGWB 1JRHH 4FHJA 3ZKXB 4PGZA 1IQDA 2F58L 2HTKD 3MRBB 3ZHFA 4YHPA 3IE4A 4FZ8L 1IGTA 1CGWA 4XP5H 4UUJA 1F4XL 1M1SA 4DUVA 4XVOA 5D7IB 4I2XB 3LSOA 3L1GA 4HFWB 3GBDA 4LCYB 5GGVH 1O6VA 2MOGA 2FHCA 5B1AB 2W65A 4JFQA 4YWGL 4B9JA 4LQFH 5JIPA 1I53A 2C4XA 2VDML 4U6HA 1XX9C 4B95C 3MPCA 2YRBA 5KYXA 2MQCA 1BXAA 2JB5L 4LEEA 3S3DB 1KEML 2Z64C 4K23H 1NC4D 2XTLA 5D5MF 4BGDA 3LEVH 4PJHA 3X3FH 1KTLA 1SY6A 2KC0A 3FQXA 4FQCH 3R18A 4M02A 4M7KL 1J9TA 3DX2A 5KVGE 3UZEC 2FATL 3VWJA 4P06A 4GFXA 1FGNL 4HCRL 2OR7A 3WN5A 4I4WA 4JJ5A 4HP5A 2NY1B 4B96A 4TSCH 3IJEA 5I1DA 1QO3B 2IWEA 4NQCE 4XOAA 5DYOB 4Z7WF 4UYPA 3DVIA 4AM0B 3LYRA 1KFGA 3MUHL 2P8PA 5I1LB 1E28A 4KQ0A 2O1AA 1WZKA 3L3DB 4QHMB 4R26L 3F7YB 4L8SB 3OLGA 1IL1A 2ZWYA 3WUWA 3FCGA 4IM8A 3N55A 4PR5B 1G7JB 3SDXF 5CEYB 1UZ8B 2FX7L 3Q6GL 1EX0A 3AS3A 1YEHH 4PHXA 1DSFL 3WNPA 2BY1A 3EDKA 3O3EB 4MD4B 5DJAA 3EUUA 5IESH 4XVUC 5DJ0B 1AJ7H 3IMUA 5EU5B 4XBEH 3K2MC 1OK0A 3FU7B 4OIBA 5J57B 3QO1B 2BIMA 3PL6A 5HGGS 5HYIA 1HXYA 2P4AB 4GW5A 2IANA 2OXGA 2EDQA 5GSRA 4AI7A 1S9YA 4DK6A 4UANA 1GZQA 2YGNA 5J6SA 5D7LD 3J7HA 3PJLA 2EC9U 1AYRA 3ZZSA 3LKNB 4GRLD 4BQCA 1X9RA 1EHKB 2CHNA 5SWQA 4PJGA 5IQMA 5FV2A 2R69A 4JPQA 1NLDH 2WXLA 3PG2A 2PETA 4LDOB 1OARL 3WSQH 3LNIA 4HX1A 4F7TB 4HDIA 2EUVA 2FHFA 1J87A 1T20B 5B8CB 3VNYA 3L6FB 4OZFG 5BJTA 5KYWA 5E2WL 2VLRD 4G80A 4HHGA 4PJFA 5CILH 2IGLA 4IDLA 1X7QA 2FT8A 5K9JH 3LS4L 5CJOL 4N86A 4JFED 5D7SL 3S97C 1X5KA 2FWLB 3LV3A 4GRLC 5EOCL 4DTGL 3SGDH 1OP3K 3X11B 1K4DB 4YFEA 1NEZG 4NZ8A 3RX9A 1SNRA 4F7MB 4BZ2L 1J5CA 4DP8X 3WFHB 3GBLA 4RDQG 3UPCA 1IFHH 4FXTA 1CFTB 5E8PA 3QWRA 3WJJA 5IVXB 3VH8B 1V54B 4NQEB 1PZSA 4O02A 1N5AB 4OD3H 3CDGA 1N26A 4K71B 3D18B 3O41A 1HWGB 1M2VA 4JKWA 3F05A 5DI8A 3KCPB 2MCPH 3D1MC 4E9TA 5KYYA 4U05A 2K3HA 1U6AL 2ZZUT 3NVQA 5ACZA 3JTSB 1P1VA 1JPTL 4GAAA 3TVMA 1T83A 2Y36H 4WI6A 1YN7B 2EE9A 3ZMEA 1A7OH 3F01A 4QT5A 1M71A 4G82A 2FBJH 4Z8FH 2XN2A 4RQQB 2WN3A 5DEZA 4KRNA 5TE7L 3B2DC 4PB0H 4X5WB 5ABAA 4PIRF 2XQBL 2WLZA 1ITBB 2VSKB 4D9RD 4ZMOA 2BP5M 1OHZA 3BKMH 4N3UA 4D8OA 4LCWB 4LFHD 4WJKB 3V55A 1QVOA 4XMVA 4Z77B 4QHPA 3KW7A 4I18C 4MXQC 2NPLX 4EO5A 4N25A 4P99A 1IBHA 4FLRA 1RLWA 2C9PA 3HLKA 1M9WA 3CH8A 2RTTA 1TSRA 3LRKA 3DGDA 1TENA 4FG4A 4F3FB 1S9KC 1E4XL 3ZTJH 1U8KB 4PREB 4HXBH 4OZGF 2EO1A 1QBLL 4XNQB 2WZ0A 1JV2A 5D1XB 4YGVA 5DHDA 5D1ZB 3SOBH 5E6YA 1PY9A 1PG7L 5K9OA 1E65A 3FCTA 3ZTNH 2A9DA 2LOEA 3KJ6L 4J2QA 1WFOA 1X6LA 4G83A 5D2LE 4AJ0A 5C8JA 4HBQA 1IC1A 4I3GA 4TL5A 1Z9NA 2XTJE 3KHOA 5IV2B 3DV6B 4ZX4A 4TVPD 1CFQA 3DYMA 4YSPA 5DR5L 1MY5A 5JIHA 5HGHB 1N59A 1IM9D 3VFGL 1XH2A 3FHEA 4N2MA 4AQEA 3ML9A 3UZEA 2ZCLH 2WTRB 3TA3B 4PSRA 5DEFA 2HJFA 4EIZC 5BS0D 4X5PA 4XCFL 3MRKB 2D4FA 3AB0B 3R1GH 1AZNA 3JWNE 3QZWG 3PXHA 4ZFFB 5A16A 4QXTA 4YSEA 1R5WB 3CVDA 4F8QA 3RDJA 1NSNL 1I8KB 4PGCB 1U92A 1R3HB 2BVPA 1Z9PA 3C6SA 1XGUB 4X42A 2GTZB 3NTCH 4NQDD 3BUDA 2ZNXA 5IB5A 4P5KB 1BZOA 2IH9A 4PJ8D 4UTBA 1NC4A 4L3EB 4ZD3L 3SZ6A 2UZXB 1P5VA 4XC1H 2CK2A 4KX7A 4N9GA 2G60H 4MSWB 4OZ4B 3U6RB 1ZVYA 3T2PA 4IW4C 1PDKB 4G6AD 1RZFL 2EACA 2F18A 4L8CA 2BOCB 3KCWA 3EGDA 1CXLA 1CR9H 1II4E 4KJYA 2C34A 3ATDA 4NO2A 5DRNB 4PGEB 3TL5A 5L6YL 4AEHL 5F7WC 1BD2D 1BIHA 3K71A 2G9HB 2JI2A 3RVVD 3I84A 1W0WA 1QUPA 5CAYB 4OLEA 4U6XA 1K4CA 3MREA 3MSPA 4X98B 5B1KA 5KVDE 4U6TA 4LPYA 2FB4L 2N01B 2NTFA 2ZOWA 4W6YB 2DJMA 5B21A 3C5SB 5KJ4A 3GC3A 4PRDA 2P47B 3B9KA 1I7TB 3G5ZB 1KJ2A 4XBGB 5E1AA 1KB5L 1E0OB 1JK8B 4PBWD 4NX0A 4ZMAT 2HMID 5IY5B 3OR6B 4PVBA 1MZZA 5DUPH 5DJCA 2UYLB 3BIAX 3CN0A 4GAYB 5E5UB 4FQIL 4HW6A 2VDLB 1KBPA 3HR6A 3NG5A 1J0IA 3RVVC 2DMCA 1OY3B 4YIQB 3LH2L 5L4FA 3ZX1A 3KPOA 2Z93B 2X1PA 4WW2C 1J8HB 3V4PL 3LX9A 4QRPA 5D7LA 2WGXA 3VB9A 3D08A 4PJCF 2YPLA 3O8XC 2EDKA 1AKJD 4GRLA 3FFCE 4XH2B 3IDJB 1MNNA 2HMIC 2EADA 1JYVA 3KGRA 3Q6FB 3ZDXF 4A7GA 4I77L 3L5IA 1YMME 3HZYB 4Z3IA 1OPGL 4OJFL 5DEJA 1T5KA 5JOPD 5SX4H 1CLOL 4JREB 5I1HH 1VZGA 4NQQA 3CPUA 4X7TA 1XIWD 3HG4A 3MRLB 1OTTD 4F37K 1JZGA 3DXAB 1GL4B 2HFFB 2VN6A 1A7RL 1QTSA 1SBBA 1HN1A 3UP1A 3BHBA 3EKCA 3K91A 4HIJA 4G7SB 2X6BA 5FFLA 4HOMA 4ZUSA 2Q3AA 1KJVB 5E56A 1U30A 1G7MA 2DQHH 2PW2A 4O2CB 4LARH 4IJ3C 5JXED 2D7PA 2B3IA 4UM8B 4Z7UE 3IF1A 1YJDC 3HE6C 5F3HA 2FBRA 5BO1H 1G7IB 2XG4B 3MLWH 4KHXH 4EMZA 4H0IA 5IM7B 5KN5A 1XIWC 1L0QA 1WO2A 4NO5A 2DB8A 3MUUA 1OTTC 4WVRA 1Z9MA 3V4VA 3GMRA 5F7KC 3N1PC 3DMMB 1KXTA 3CFKB 3L1OL 1S9WA 3VX0A 4LE8A 2AV7B 2HLAA 2JCCB 3O9WD 1SMAA 4I18A 5HGAA 5FUCC 5AKVA 1UD2A 5C0IB 4YXHL 4FA7B 1MUJA 5MEOB 3SBRA 2NY6B 1XGTB 1KXQE 2FZ3B 5JXEC 2G3MA 3ZN6A 3G5WA 4GW1A 4N2EA 3TIEA 2E6JA 4NN6C 3L4TA 3UYRL 4Z7NB 1VZIA 1KCBA 2JF1A 3CN4A 4BK4A 4UTAH 1TZAA 1NBYB 1YECH 3FOMB 3H0TB 4QAWA 1EMTH 3MV8B 2QQKL 2YD7A 3HVNA 1TJHL 3MODL 1G7HB 2ENQA 4JRYE 2Q2EB 4LLVB 4OIIH 3DX6B 1FZJA 2MPVA 3O9WC 4JO1L 4RRPG 4GG6B 3CZJA 1FZKB 5CU5A 3EG9A 1U8CA 4EEEA 5IJVA 1IGCL 3GRGA 3FXIC 3GI8H 5JUEH 3TC9A 4QRUB 4ES9A 3FUHA 4GP4B 4MNGB 3CSPA 3GXPA 3OJMB 3WDJA 1HJBC 2XFXA 5IR1B 4XN8A 4OB5H 4RFEB 3RYMA 3MTRA 4EQ3A 3S3CB 2EH7L 1XH3A 2PMZA 1MH5B 1XGRB 3NABH 2FYVA 2XYBA 4HLJA 3SDAB 1ORQA 2CGYA 2J88L 1NKRA 4NKMB 2AVGA 1SJXA 2NUPA 3ZDWA 1MCLA 1BAFH 3U4AA 2XWRA 3HFFA 4XCYB 5ES4B 5C0RL 4UT9L 1CIDA 4DN4L 4M5YH 2VTFA 1QD0A 2N0MA 4BD4A 4XMZA 4NQCD 3RKPA 4BCZA 3GO1L 3P0VL 4IIQC 5F3BA 4ENED 1N7MH 5LNGA 3ZZQA 3GS4A 4ALAC 4BH8A 3CHSA 1W72B 3ATFA 4YSDA 3JWDL 4B0MB 1MDAA 5T33L 3OKDB 5F1NA 1BLNB 3LD8B 4GRMA 2UWEB 4HS3B 2C1OA 4WUUA 3G6AA 3F5WB 5I28A 1G1YA 3FTZA 5G5DA 1A6WH 1I7UA 1H3VA 1QLEB 4NJ9H 3GUFA 2YD4A 1MFBL 2W60B 3QXTA 4P2QA 4PG9B 4YXKH 3O6MH 3VXNA 3H9SB 1PLCA 2QVKA 4G1EB 4Y19A 5LBGA 3UMNA 2F8XC 1NEZB 4ZUTA 5TK4A 4Z6AT 1NCHA 3VFWA 1S8DB 5DMIL 3HFML 1ZTXH 3L13A 1SXSA 1QFPA 3GQFA 5MEQB 4IEFA 4MJID 2VR7A 4UT6A 3D3VE 5DMGD 3VD4A 4OFQA 4XB7A 1MDTA 1NC2D 3FU5A 3PFQA 4RFNC 1P4IL 5H2BA 3AQDA 4HS6A 1SHMA 1IC5L 4FNLL 4ESKA 3BGFB 2NDGA 3BPOB 4YBLB 3NMEA 3DJTA 6PAZA 2OJEA 1TQWA 1BD2A 1OPOA 1ILSA 2ZP0T 4PBDA 4QY8B 2MH4A 1UD8A 4RH4A 4WFHE 3RILA 4UU9B 3U83A 4DVBA 5FPIA 2IH3A 4HC1H 1C16B 2IBZY 1CFSB 3DX7A 4P4KD 3RIKA 4FNUA 4G8EB 1KNOA 4PJEB 4WUKL 5CM1A 1K6QL 4WW2A 3B1TA 1CT8A 1FFRA 3MOAL 5SWZB 3KPSB 3PS6A 2PWEA 3O8XA 1JZ8A 5KZCD 4OY9A 1BX2B 1BQHA 5DMGC 1CIUA 4F58L 1J9CT 2A83B 4HPYH 2BVOB 4IRJB 5D93B 2XXCB 3IDMA 5FHBH 3RVWD 5BRZB 3KDMA 3HOGA 3ALXA 1Q0EA 3WFDH 1D5XB 1UWYA 3EYOB 1HE8A 3NESA 4DGYH 2AW2A 5GS0L 2BS71 3H1ZA 4DKEL 5IF0B 1IEAB 4MMXC 3MUZ1 2IQ9L 2ED7A 4G72B 2GY7B 5ICZA 2XWBA 1N2RB 1ACZA 3HTLX 3LOWA 3X12A 3OAWA 1B0RB 5ESQB 4YLBA 3BZEB 4YX2H 3VG0L 5I16B 2D3LA 1MRDL 4PV9B 3NZHH 2W91A 3HE7B 1AKJA 1ED3A 5BQ7B 1ND0A 4HWBA 2FK9A 4E41B 3WXWL 4WWKC 3RVWC 2HJKA 3CQQA 4KH2A 4Y2DB 4XAWL 4OF6A 2BCMA 4B3EA 4NRXB 3NFSH 4JY6A 5A2LH 1MQKH 3HE6A 3X3GH 1R19A 3N44F 3ZKMD 1WC7B 3E6FB 1CK0H 1WCBB 1PGRB 1XIWA 2I07B 2R2EB 4JFZL 5E5MB 3VXRE 3ASNB 1D5BA 2BVYA 1BFOA 3HHMA 2NW3B 3TF4A 3EYUL 2IV8A 1ZVNA 5DLML 1FO0A 2E74C 3QZBA 5FO8A 1HKLL 2MTPA 3GYRA 3HC4H 4XC3L 2NQ3A 3QZWB 1I8MA 3MXVH 4PYHA 5HHVH 5JXEA 4PPTA 1Q72L 2FQDA 3WTUA 2F7IA 2XIDA 4AKPA 3LIZA 4APQB 1BVLB 3ZKMC 3BGMB 3CVIH 4AQ1C 3FU9A 5I66A 5C1MB 2AGJL 3VMNA 4QOKE 2EVJA 1QHPA 5CP7A 1WFMA 4U1LB 1T03L 3E2HB 3TO2B 1RIHL 3CLFH 4U1MB 2PO6B 3OSVA 4X5XA 4XX5A 1XF3A 3MFGB 2YAOA 3A6BH 3DRQA 5AVQB 2P24A 3O9WA 2YQ2A 4JFPB 2QSQA 2A9BA 3EBAA 4PRAB 3RU8H 1G9HA 2R59A 4PJIE 4KKRA 4LASL 2WCPA 1P9MC 3C12A 3U0TA 4JO4H 2XTJD 4Q6KA 1DBJH 3C60B 2JKRM 2NY2C 3DVNA 2QHLA 2TSBA 1H3UA 2Y6SD 4X5LA 2R4SL 4JDZA 2ERJB 3G6JF 4LBEA 4U1HA 5IW3A 3UTTA 3CZFB 2HX9A 4QTIL 4GEIA 2H6UA 2EEXA 1G7QB 4G5ZH 1VIWA 1Q0YH 4X6EB 12E8L 4HWZB 5FYKL 4FNQA 1A3LH 5KBDA 2BNRB 1BW8A 3PPEA 3CH1B 2Y1VA 4ZW3A 4E9LA 3IDUA 4IIQA 4LCCB 3VB8A 1JMXA 2WLNA 2Z35B 2XTJC 3VFRB 3QRFM 1K2DA 4UDTB 2XFGB 4ZX5A 4GW4B 3T0WA 5I1EL 4NO0B 2Y6SC 2O6EA 4B7LA 3HC3L 1SUHA 1NOLA 2CH8A 5K39B 4ZDHA 3OZ9L 3MLXL 1Q9OA 1HH6B 2QPDB 4JW3A 5GGQL 3R06A 2A9NL 5I8EB 3QUMH 3GZQA 3JWNC 1UHVA 4XGZA 3L54A 2DWEB 5L2KB 5DXWA 2FJUB 3OLEA 5CR8A 1F86A 1J1PL 3NJXA 4NQCA 2VXVH 3CTTA 2YQGA 3NACH 2GSMB 5E03A 1TJMA 2YMXH 2AJUH 1GTNA 2BFGA 2KQNA 2V33A 4N2LA 1F4HA 1FLRH 2P5EB 5DCCA 2J8UB 5ADOH 1LK2A 5LAXA 3JWOC 1K5NA 1SXNA 1M3JA 3ILDA 1KBGL 5MEPA 2VM4A 3S3JA 1SFHA 3QZLA 2Y3NA 4J27A 4G8IA 3EO9H 1NAML 2ATPA 1N10A 5CS7A 1VFAA 1DUZB 1XHHA 4NKQB 3VXQA 3QP3A 2J2ZA 4HJ0D 2X2JA 4JKKA 4L4TE 4ODTL 5AOLA 4BKLA 2D7TH 3UJIL 1TQBB 2C8NA 2R83A 2XHNA 3D12B 3L9RB 3MRRB 3O3BA 3KLSA 5CLZA 4QYOA 3AY2A 3M17B 1HE7A 3M86A 3EDJA 5DS1A 1GY1A 4XMKL 4GKSA 1P5UA 3C8DA 4HLZH 3QFJE 4HS8H 4ZPTA 3VRLE 2OTUB 1RMFH 1UFUA 4ZTPL 4KQ3L 2R0ZL 1YMHB 1ACCA 3ARQA 2BW5A 3GHPA 5SWSD 1HAWA 3NZUA 3FFCD 4ODHL 4L5FH 4Y2OA 1AXIB 2X0WA 3CFDB 4U2YA 5GGSB 3TCXA 3GUTA 4HJ0C 2IQAA 3FOLA 3WTXA 1YMMD 5ID1B 3RGBA 3M1CA 2Y3AA 3ARGB 5EC1B 3OD3A 4MZIA 3P3RA 2UX7A 3PGFH 3QORD 1EZLA 2D0FA 5AVUB 4AE1A 4Q9QL 4AL8L 4LCIL 3UROR 2D7OA 3CFIC 1X6NA 1TPXC 5BOJA 3QO0B 3RFZB 2XVKA 3ZL1A 3WGVB 4AH2A 4IU2A 3LEYL 2B1HL 4WWKA 3SDXE 2X2IA 3PDOA 5LCVH 1FBIL 1KV7A 1A22B 4YSAA 3MZGB 4XMPH 2X2YA 2WZ6A 1HZHH 2GIXA 2XWDA 5BZWA 3W5MA 4GT0A 1NUDA 2DDQH 3QDGE 2HN7B 2QR0A 3W3BA 3HMXA 3C5JB 2XXMB 4X0KB 1DQVA 3SCMB 3IXAB 3UIZA 3C6LB 4H0HB 4Z7OF 4E9RA 3CHOA 3MNZA 1DQLL 1TXKA 4OLVL 3INUH 4AQAA 3QORC 4HIEB 4K3JL 3RWJA 1SVCP 2F6AA 3FB8B 3C5ZD 1A1MA 3QXWA 5M7QA 1AP2B 3OPZL 4ACPA 2CO6A 1DDTA 2R1WA 4JO2L 5EN2A 3UGEA 2Y7MA 3MYJA 2M1KA 3LKQB 4BK5C 2H32A 1MNUH 1T6WA 3GMQA 3GXTA 1NANH 4O5LH 4P59L 4GNKB 4RLDA 3WFEH 3CIQA 1UWGL 1UWXH 4JG9A 3VFTB 1A7QL 2C9QA 1XV8A 3F6IA 2Z4QA 1TFPA 4G42B 5CZXD 7FABH 4X6CB 3MCG1 3QRGL 2VDQH 4X99A 2NSXA 1YPZE 1QWNA 2N7AA 1P7QD 4M1GL 4Y5VB 5D71L 3PGDB 4M6NL 4UNTA 1JGUL 1NWOA 3A22A 3D39A 5LGHL 2R29A 1P9MA 2ADYA 4JRYD 1CE1L 4Q97A 1ZT1B 3MO1B 1CL7L 2OMXB 4ZBJA 5B39A 4GSDL 1NCAL 1S7TA 2R0LH 1ITCA 3VXOA 4JDEA 3ZZLA 2FH8A 3Q5TA 4ZFOA 4DWHA 1HQ4A 3FH5A 3NFPB 1TSHA 5CZXC 2CDEB 3LVEA 1JTTA 5DMYA 2BS8A 2JK5A 2QV2A 2DKMA 1MCFA 1RIVH 2HVKB 3MV9E 3ABKB 4GAGH 5CLYA 2C3XA 4K94L 4R7LA 1FG2A 4X8XA 2EP6A 1YDPA 2DQJH 3MLTA 1NIAA 3AU1B 3BEVA 2H6PA 4JFXB 3V0VB 1OOAA 3DURB 4TLUA 3SPGA 2D8KA 2V5YA 3FH7A 2G75A 2BIHA 1E90A 2Z7UA 1KF9B 1A9EB 5BVJB 1VERA 2WY3B 5JORB 1JZHA 3VQMA 3BD4A 1V7ML 3PRZA 4NRZB 2XV3A 1R24B 4W70A 4YFLI 5TF1L 1YEKL 5FXCH 5DT1L 3NUKA 2HJLA 2AEQL 2AVFA 4KTGA 1F97A 1IBZA 3BWSA 1GHFH 2QVTA 3SYOA 3FONA 2DOCA 3EJSA 1FVDA 1X9QA 4XPFH 1N67A 5I15H 2LTQB 2VSMB 4BUQA 1YEGL 3ARFA 3PQYE 3H53A 1U8QA 3L3IB 1HXMA 3GFUA 4C54A 5C86A 1WHOA 3U9UA 2EICA 2XA8L 2EXYD 2IAMD 3BWUC 4GP8B 1JXFA 1NEUA 1FFPA 3L3OC 2F19H 4LB8A 2BIPA 1ZHLA 4UWQB 1A02N 5AENA 1T0MA 3V52L 4PGBB 3FZUD 1B4TA 2OKMA 1DLFH 4GSRA 1P1ZA 1MI5E 5E00B 3WHE0 4BDVB 4GRWB 1AD0A 2Q7YA 3WG7B 4I3RL 4NN7B 3I74A 2Q5BA 5HHQB 3DK2A 5FA3B 5JO5A 1GS8A 4E0RB 4L4JA 2CKNA 1JJUA 2MJWA 2H9GB 4M4RB 4WFHD 2Q7AA 1EJOH 1OB0A 5KBKA 3QNXA 2EXYC 2IAMC 1RK0B 3SKJL 4MD5A 3QUZD 3VCLB 7PAZA 3WUWG 4ZMVA 1J9RA 4NFCA 5H94B 2YPVA 4KROD 4WO0A 3O4LB 4O2EA 2QKIC 1TU2A 3A24A 3AUWB 4RX4A 4D0DA 2OP4L 1MHPH 3HS0C 4MLSA 1ES0B 1A9BA 2HWZL 3FZUC 1U8OA 3QVAA 3T65A 4XMLL 2J6EA 3WEBA 1A6TB 4GUQA 2R9HC 4AZ8B 4ISVA 4RWHA 1DJGA 4XOBA 3BDYH 5T3XH 3AY4C 2CCLA 4F33A 2YD6A 1WS7A 4YHKH 5DO2D 1Y7VA 3ZQWA 3N1QC 3NRFA 1BXXA 1IVLA 1RU9L 1S7XB 2Q9OA 2BMKA 3CHPA 8CGTA 3CFJB 2X88A 3V0GA 3U46B 5MI0B 1E5AA 4KROC 2ZKMX 4N0RA 5EBWB 2R2HB 1YEEL 1X5YA 1G7PA 1T6VN 2O6PA 1U3ZA 3A6CL 3CVHL 1P4BH 4NM8L 3OR7A 5H37G 5AW7B 4ZFZA 1RUAH 2IH1B 3GGWA 4NGHH 2VLKE 2EYRB 2MOQA 4X4MA 4P5RA 3GSNB 2ZUVA 1JFQH 5GISH 1YNKH 2ZAGA 5AOZA 4WHYH 1YMMA 2ITEA 4Y8AA 4A6YB 1UWFA 4KK5C 3O2WH 2CR6A 5DO2C 1J05A 1FFOB 4K3EH 4J3VA 2X4TB 3CK0L 2C9VA 3P0GB 4P3DB 2B4CH 4E9YA 4RGMB 1U0QA 3DSNA 3VXRD 3TYFB 4E5XG 2EIEA 3ULUE 4J4PD 1FVCA 1T21A 1F3JB 3O0RH 4M43L 2DQUH 3U9PH 2X28A 3K72B 3HPLB 4S1QL 5I1GL 4BK5A 4MCYA 3WL9A 5FS5A 4GAJL 5DJ8A 4TNEA 1NL0L 2AQNA 5I71B 1R3IH 3LQMA 2W07A 1GC1H 4QRRE 3EIFA 2Y06L 4PJBE 5TPWH 1O7DC 5TE6L 1M7IB 1LO3L 3OAZK 1J0HA 2NNRA 3BXNB 4GMTH 3WIHL 4WNSA 1ZHNA 4A68A 3HC2A 2C3VA 2Z0BA 1VZHA 5T1LB 2IG2H 4OJCA 1EPFA 5D4HA 1KMGA 5HYQA 1T22B 4QOKD 2PW1A 3S96A 2KKQA 2LABA 3KYNB 3M88A 1MLCA 2EYTB 4J4PC 2AJYL 4Y4FB 4AYDC 2NX5E 1YY8B 1PKOA 2VDPB 3CFCL 3QGVA 4C56B 5H8DA 1IC7L 4UM9D 4M5SA 3ZDXE 1S3KL 1ZAGA 4CC4A 3GIZL 5HYSA 3ZL2A 1H8SA 1JD9A 3LHPH 4RA3A 2B1AH 1RJLA 3PUCA 3MJ7B 1KXQA 1H3XA 3RAJH 3QNZB 1SN2A 2CO7B 3H55A 4M7JH 5DJ6A 3N1MC 4CGTA 1S7QA 1Q9LA 2IDQA 4Z7QB 5ALCL 4Y88A 5EU6A 1CCZA 1P7QA 3F7PC 5AQ0A 1SN5A 4D94A 1ZHKA 5CZRA 2BXZA 5HI5C 2IAAC 4A7QA 3WENA 1KIUB 1NAKL 2BVUA 1H5BB 4JRYA 1U95A 5BUGA 2DMKA 2ZWLT 4K7FB 1M3IA 4QUOA 2QLYA 1TZIB 4L37A 5HDQH 3SDDB 2Q86B 4OZIB 1RP9A 1B9ZA 1DN0A 2V2WB 3QR2A 4UMGA 2ITCB 1THCA 2CUHA 2HRLA 3WE1A 1D9KB 1HNYA 5C3TA 5E1IA 1H6TA 3ARED 2K1MA 5EZOH 2YC1A 3MX0B 5DSCB 5FYJH 4TQIA 4X7DC 4LCUB 2CLVA 2TRHA 1ZXQA 1PD0A 3RIFK 1FL5B 4Y0GA 3QWNA 4J3XA 1I3GL 4Y5YC 4ADGA 3OGCB 2W1NA 4OLXH 3VXUA 1NIFA 3ABZA 4LLDB 3CDCA 1CGSH 2WD0A 1ZA6A 4JFFD 4KMLB 2I32A 1CD1A 4Z0XB 1GYVA 1NIDA 2F54B 1HOEA 3K1KC 2GC7C 4J3BA 4BELD 3GKWH 5A6LA 2ENJA 1OZUA 1VACA 3WU1A 3QDJB 3OXSA 3SPVA 1OP9A 4D8PB 1A6PA 4JPKH 3L3OA 4L29B 1EHAA 2Y7NA 1F6FB 3SN6N 3FB6A 4K4KA 2CAKA 1ZOXA 5ICYB 4ZW6A 3AREC 1XTLA 2I25N 3X13B 4F7CA 4NPJA 1PG7W 3HG1B 1RJYB 2IGFH 1NUGA 2EDTA 2BC4B 2E7LC 4AT6B 2P46B 4LLUB 1AOHA 5HP5A 1SOKA 4H8WC 3S34L 2YD8A 1U8LA 3FQ4A 5DHVB 4CVWA 5DS8B 5GGVY 2ICEC 1EEYB 3DETD 2MCG1 2IAMA 2OSLA 1QNIA 3T3PE 2VMFA 4N8VB 5FKPA 1NA8A 4WQOA 4OVVA 4L4TD 2GAZB 3G6DL 4HF5L 3KBFA 4XCCL 1RVFH 1ERNA 2QKIA 1NGZA 3O45A 1R6VA 3O4OB 4Z7VF 9PCYA 3MJWA 2HUHA 2BINA 1CYXA 3HS0A 4ODXA 1LYQA 1VEOA 4AGOA 5F72S 3D3VA 4RGNE 3RTQB 3Q13A 1E3XA 2YGOA 4JVUA 2EDMA 3F6JA 3OHXB 3QFJD 2OMTA 1A21A 2MTAA 5IOPB 2WXKA 3DOSB 4JY5H 3AY4A 4BFIA 2UVFA 2NXZD 4Y4HB 5IEKA 4PJDA 5EBGA 1HXKA 1E2VA 3LJ3A 1C5BH 1T5WB 2WLKA 4MBRA 4CJ1A 2OM5A 2ESVB 3DETC 4JM2D 2X1WL 3AZUA 4N2AA 1HOCB 1OAZH 4IBYA 4WJ5B 2Y7LA 3MR9B 3BPCA 4UV7L 1ORSB 4CGUB 1JRHI 5T5FL 4E42A 1KYUA 4OM1L 4KJQD 4BZ1L 1SBSH 3ILPA 2M8XA 3C9NB 4HKXA 4QTHA 4M3KB 4DF9A 5H35B 5DFWH 3IN2A 4L8DB 2VISA 4FN0A 2AABH 2BNUB 4R90H 1LK3L 4NENB 4R97B 1XH1A 2L3BA 5DVMA 5GRUL 4Z0BH 3E8VA 3HNSL 2WWOA 1EAJA 3A67H 1I75A 4UQ2A 5HHNA 2GFBB 3QDGD 4JM2C 4XP9H 5I74C 3SO5A 2R23B 3LAFA 1RUKL 1RJZB 3LNEA 4ZZKA 1F1DA 4AIZB 2AXGA 5DQJB 2NRDA 3ARZA 2AQPA 1R9FA 1PZ2A 1FFNA 4XOCA 3K6SB 2X70A 1PAZA 1ZLVH 3RWDB 3TCLB 1KELH 5TDNA 2FLBT 4C59B 4JFOB 3NIGE 4LP4A 4QRAA 1L6PA 1E42A 1OT2A 5HGDA 2X10A 1M05B 3KYMB 3KL5A 5J8OA 3IS1X 1YYCA 2FQEA 3QQ4B 4NCDA 3WS3B 1XGPA 3TBSB 1G6RA 2FJFA 2JH2A 2H0PA 3TO4B 4W9DC 3VDBA 1K9TA 2Y2WA 2F7QA 1L7TH 1GAFL 1VEMA 3OJ2C 2IPUK 4B9PA 3BP5A 1U8JA 2VC2H 4FFZL 3QBTB 4J4PA 5TDOA 3O2DH 2OMWA 3ZE0F 3ATBA 1IQDB 3GHEL 5FX3A 5F8RC 3OMNB 4YHPB 1TVDA 1W15A 4K2UH 2NSQA 1IGTB 1JBJA 4UUJB 3OGOE 4GH7B 4GIAA 3ZGHA 4XO9A 2W65B 4JFQB 3QW9A 2NT1A 4OCMC 1KXVC 2CRYA 4U6HB 1JGIA 3BZ4A 1EXHA 5KYXB 2ZSVA 3MV01 2AEPH 3AT8A 3ARRA 4RISH 2DF3A 2XNAA 2ZUTA 3LHAA 4LEXL 1KCUH 1WTLA 4QOKA 3ULVF 2WZ5A 1WA2X 4PJHB 1KTLB 3FQXB 4AVIA 1JGLH 4IDJL 4U6VL 3ULVH 3VWJB 2DLFL 5D7IE 4I2XE 5DEGB 1QFOA 3N43B 2YLKA 3LVTA 3WN5B 2ETWA 2VCOA 4I4WB 1NDTA 4JJ5B 1WITA 3MV9D 1S2EA 2D9QB 3IJEB 5I1DB 3B9AA 4PJIA 4L23A 4AV5A 4P8QA 1PSKH 2YFNA 4NNXA 1LEIA 1NCOA 3W11C 1DBBH 5SX5K 2P8PB 3VSQA 1E28B 4A37A 1DHKA 5TFSL 2J8HA 2FIKA 4KVCL 2Y25A 3P9LA 4R4FL 3F58H 2ROYA 3NJGA 3Q2CA 4KHTH 4GUCA 4LFHG 2ZWKA 2HT4D 4R5TA 1IL1B 4Y5YA 1SUJA 5F9DC 3RX7A 4BSJA 3F65A 3WUWB 4Q0XL 3SE4C 3QC5X 4N28A 4QI3A 4QRSA 1DJZA 3SGDI 5CIPH 1VFMA 4HPHA 5DJAB 5GZOD 3P4MA 2R39A 5LUMA 1ACYH 3IPBA 4BFFA 2VXQH 3G08A 2CIKA 2AXWA 4ECNA 3PQYD 3CXHJ 3SODB 3N1GC 5CP3H 3Q06A 4OKVA 3PL6B 3AREA 1DYZA 1L0YA 4LL1A 1HXYB 4GW5B 2IANB 2OXGB 5GSRB 5HVWA 1OT1A 1ASOA 1DEEA 1JIBA 1CTMA 1S9YB 3O11A 2E7LA 2HT4C 4Y89A 1GZQB 4YWGH 5GS2D 1JK9A 3N0PB 2O72A 4KI5D 4P5TD 3VSVA 1T4KA 3LZPA 3D0VA 4OGAC 2DIBA 4MA3A 5SWQB 3IRPX 4PJGB 5DZLA 1ILUA 2JB5H 2ICEA 3BD3A 3BUPA 4P57A 5GZOC 1QR1A 5KSVA 1JHTB 1KEMH 4IBWA 3EYVA 2P28B 1MI5D 1U3JA 1G5AA 4M7KH 2FATH 4LVHC 4HX1B 5C08E 1XF5A 4HDIB 5LGJA 4IMKC 1FGNH 3B3BA 4HCRH 1CXFA 4I89A 4JZJC 3S5LA 5BJTB 3L5XL 5KYWB 4ABWA 4J2XA 4Y1AE 5HVGB 5PCYA 4G80B 4PJFB 3ALWA 5K1VA 4V2BA 1X7QB 5F89A 4P5TC 2ZXCA 4CA4A 3IJ9A 2GYSA 3LV3B 1G4RA 1ZD6A 4JGMA 3GINA 2I69A 4R26H 3M45A 5HYJE 3SGJA 1PCSA 5EDSA 3KS0J 2NYZA 3UEZA 5BV7L 4L4TA 4PJ9D 4L48A 1KIQA 4L1BA 3MLYL 5I75B 3K6IA 5FW7A 4TV3A 3Q6GH 1NTDA 5EORL 1DSFH 3OKYA 2B1OA 5LO7A 1E4KC 5E8PB 1IC4L 4IOIA 2OL3A 1TEGA 2OA9A 5D5MA 3GZKA 4RMTA 3GMPA 4GQZA 4O02B 5FOBA 2FWOA 3CDGB 5KSUA 5IJKA 1BPLB 4RMBA 3Q2LA 5K9KA 3FHAA 3D4ZA 4ELDA 3O41B 1M2VB 1A8ZA 3WBDA 2VLKD 4E9SA 5EIIA 1KPVA 2A6DA 5KYYB 4AUJA 3NCFB 3VI3E 4G9FA 1VESA 5ACZB 1MPAH 1K85A 3ARVA 1RERA 3QPKA 4XO3A 4Y2LA 2B77A 3TVMB 5EBMA 3UTQA 2YD3A 1JHLH 1CXKA 3T0EC 3U7YL 5AW3B 4QT5B 1M71B 5IVXE 1WAAE 1YEDA 1OARH 2HCZX 3TJPA 4AYGA 2DM2A 4G6FD 4R7VA 5LQBL 1QHOA 5J1AA 1TTAA 3ULUD 2P8MA 3SDXA 2WBWB 5FO2A 3VQ1C 1QVOB 3K0YA 3IDIA 3US9A 1QW9A 3QXAA 1PNCA 3W2DL 2ZOUA 4M8RA 4U4BA 4FI6A 5E2WH 3EJTA 1MW1A 2YFOA 1WD8A 5AOKA 3LS4H 4QRRD 4O58H 5T5NG 3SE3C 4EI5B 4B0MM 4DTGH 1FIGL 2OR9H 2ZG3A 1UM5L 1JV2B 4YGVB 5JOEA 4GUOA 2OQJA 2FECL 3C08H 5CEZL 3U2SA 4XO5A 5K9OB 5E7BA 2YO3A 3Q1EA 3FCTB 2PF6A 4WI3A 4LCWE 4YEEA 4Z3TA 3BDXA 2NNCA 2MKWA 3ULUC 5D7EA 2NX5D 4OF0A 3T2LA 2GIMA 5CD5D 3MRIA 2ZAIA 1NM9A 3ILEA 1NMCC 5C8JB 1LO2L 4ZUWA 4H25A 2JTYA 5IT2L 3OKMA 1I1AD 3TU6A 1NFIA 4MB3A 4YPJA 5I6NA 4NHUA 1CFQB 3L3HB 4NM4L 4BFEA 1WA0X 1N59B 3DUSA 4AQEB 1HU8A 2XV6B 5DEFB 2HJFB 1DO6A 4WCYH 5HHXH 5E1GA 1RZPA 1INEL 5A16B 3DTDA 4QXTB 3V9CA 1ZE3H 5FM4A 4R2GB 3WY2A 2VO5A 1U92B 2EDBA 4G7YL 1R5IA 2BVPB 3C6SB 5E6ZA 5CD5C 1RUPL 4ZAKD 1Y07A 5IB5B 4KC3B 1DJIA 3PV7A 3NK3A 4JRWA 2XQBH 1F8TL 1O75A 4LLAA 1NC4B 1XMEB 4Z7OE 5JYMA 1W6LA 1E9PA 1P5VB 2L7JA 2NY5C 4N9GB 3SE4A 4KOCA 4NB7A 3BSGA 3LXAA 5AYUL 3CDFA 1NPJA 4DEPB 4MYPA 2HFGL 5EEVA 4AC4A 3Q0HA 3PY9A 3D07A 4L8CB 3EGDB 1JPGA 1J8RA 1ASQA 4KJYB 2NLJA 1E4XH 4NO2B 2BK8A 2DQ6A 4A04A 2Y2TA 5SX4I 3N0AA 4ZAKC 1QBLH 1IGYA 2XWZA 1FPTH 2V7NA 4HQQL 3TIDA 3K71B 4L0YA 4HV8A 5EF0A 1B4RA 5CBEA 1E5CA 5KVFL 3DX0A 4L3EE 3C09C 3QA3A 1W0WB 2EIKB 2LVCA 4DKTA 1OM3L 5C9JA 5HSFA 3VQLA 1F0LA 4U6XB 1K4CB 3MREB 4LVEA 4QTFA 1CGXA 2FLMA 3UTSA 2NTFB 5C6PB 3PAYA 2Y5QA 1WV7T 2Z31D 3D8MA 4PRDB 3AC0A 2YN3A 3B9KB 3TM6A 1KJ2B 2IJ0C 5GZOA 5E1AB 3GHBL 5INDA 3PV6A 5EULV 1OAKL 2EIZA 3CMOL 5DR5H 3V5DA 1X5AA 1CURA 4NUPA 3VFGH 5I5MA 1P4LA 4HCIA 1MEXH 5DJCB 4BJLA 3C8KA 1RH8A 5LBSL 1KBBA 2EZ0C 5F1IA 3PQYA 3LKRA 4X83A 3X2QB 4NXKA 4JZJA 3X1NA 1OAUL 4CBZA 3BWAA 5F97E 1OCZB 1E5UI 1YEFL 4G3YL 4TOYH 3KPOB 3HAEH 4JFYA 2V7HA 3NJNA 5PAZA 3ARBD 4QRPB 5D7LB 4OZGA 2Z31C 2YPLB 3A4FA 1MXGA 4GRLB 4XPGL 3DYOA 3AGWA 2K9FB 4NUJA 1I1YA 2OMNA 2LQRA 4PJ7E 1IAIM 4KBPA 2YA1A 1UOKA 1ZS8A 2CKBA 2XRAL 1JGEA 5AZ2H 5FW8A 5C2BL 1QTYT 4UIMA 1R0AL 1E4KA 1QFWM 2HG5A 3KHQA 4IYKA 5DWPA 4X7TB 1I7RA 5HD8D 4HJJL 4IRZH 4BRJA 2X4QA 1XEDA 3RWEA 4KXZH 4MCMA 5FM8A 3A3YB 4LSSH 4GSUA 5L6YH 3ARBC 4FQQA 4AEHH 2J12B 3PHOA 4I87A 4KZEL 2YPKA 5ADPH 2BP8A 3BHBB 3H6JA 4IBZA 3ES6A 4HIJB 5HJDA 3RPKA 4RGNC 2GG1A 4ZUSB 5GZNA 3QXVA 4YHOL 1G7MB 2PW2B 2X42A 3NCMA 1XL6A 2FB4H 2NW2A 2HFTA 1N0XH 2XU9A 3AT0A 3MJ9L 5J12C 1BYPA 3IF1B 4ZNEE 3T0EA 1HI6A 5F3HB 4FTVE 1KB5H 4F91B 5HD8C 4Y9CA 5I8CA 5KN5B 3BDBA 2VQUA 3SBWC 1KG0A 2IXQA 3DXAE 4NO5B 1UD4A 3D30A 2Y22A 2GJ6D 3US1A 5F88A 3GMRB 1G6VK 5FB8A 1O9WA 1BBDL 1G9NC 1SLWA 1KXTB 2XKSA 4POZD 2B0SL 4OCSH 5IB4A 1S9WB 4I18B 2HLAB 5HGAB 5JIDA 3HN5A 2VLKA 3SKOA 2OCFD 4Z78A 5ELIA 1P6FA 5FGRA 2GI0A 5ITFA 4XO8A 1MUJB 2B59A 3V4PH 4O2FA 3DX9B 3DDGA 4QR7A 2OXHA 5FWRA 2BLFA 4ODVL 3CXDH 1UACH 2ZWZA 3CMGA 4XWOD 5HGBA 4WWID 4A63A 2Q0ZX 4GW1B 1A3RL 3TIEB 2AS5M 4D0BA 3KM2A 4PAZA 2Z3FA 2VXTL 3N40P 4OVUA 4RZCB 4I77H 4EDWH 2WVVA 2WKOF 3TH2T 5EA0L 1OPGH 4OJFH 4WGWB 1KEGL 2ZAHA 2JCCE 2E46A 1T2QL 3CBJB 1CLOH 4KVNH 1FZJB 5TH2A 2CIIA 2NZ9C 3ZQ9A 1U8CB 5IJVB 3KPRE 1OCWL 4WFGE 1UCBL 4AENA 1A7RH 4QRRA 4P46D 2UXGA 4FC3E 4XWOC 1MCBA 1U3NA 4Z7NE 5KW9L 2XFXB 3UG3A 2K3TA 3IE9A 1O7SA 4PJ6A 4ANUA 1RI8A 2H3KA 5FYLE 4OD1L 1XH3B 5FAAA 4YSUA 5I0DA 3DJSA 5ICXA 1A65A 1ORQB 1PFCA 2WB1A 4PJCA 3ZMNA 1MWAL 2FNBA 3SZKC 4NNYA 4XHJC 5J6HA 4TNVF 4ELKA 1YEWA 2G2NA 3HC0A 2NUPB 2ODIA 4HSQA 3RVXC 3QUGA 2Q8AH 3T8MA 2OCCB 4MNGE 4W68A 1J10A 4P46C 3CJJA 5IHZA 2EEDA 5F3BB 3RWFA 2HZHA 4F2FA 4LLMA 4BH8B 1EUTA 5AAWC 3KH3A 4G8AC 1LTXA 1NEPA 2CNZA 5F1NB 2IDTA 3GRWH 4GRMB 3KWUA 4DP1X 1B90A 2NY4C 2C1OB 4WUUB 3G6AB 3WGUB 1CI3M 2NNXA 3EHBC 5G5DB 1I7UB 2ZUWA 5B39G 4F9LC 2DKUA 1O9VA 2UUDK 4HK3N 4P2QB 3ESOA 3BSZA 3UYRH 3VXNB 5HXMA 3ROLA 3RL1A 5K9QI 3BCDA 2OX5B 5J6GA 3PGCA 2FNWA 4Y19B 1SZNA 3VD5A 1X5FA 2QVIA 4OT1L 4U0RB 4R5XA 3T1WA 4ZUTB 1TJHH 1UUSA 2ORBL 3MODH 4KAQL 3VFWB 4JO1H 3HZVA 5H4YA 1RZJL 2K4WA 2KBGA 3OMIB 4IEFB 2ZE0A 1TCRB 4C57C 3G7TA 5H2BB 1UJ3C 4HS6B 4TXVB 4WO4C 3QJXA 5C6TL 1YYLL 3U0WH 2FEEI 1C08A 4FABH 2OJEB 1BD2B 3H9SE 3L3JA 4RRPM 3BUIA 3I50L 4DVBB 5FECA 2IH3B 4FMFA 3DX7B 2Z8WC 4KWUA 5JPNC 1H8NA 1KNOB 4YGAB 4WW2B 1F90L 1CT8B 4N2FA 4H0LC 3U7WL 3V9FA 3JWNG 2Z31A 1V05A 3O8XB 3DJZA 5F7EL 5C7ZA 6FABH 2FEDC 1BQHB 4KKAC 4JPWH 4DN4H 2GEQA 4Y1AD 5JNYA 2L04A 1OCRB 1A6UL 3WKPA 1TQSA 3IDMB 4X4ZA 5DUML 3KDMB 4LAJH 4PI0A 3P0VH 3V7MA 5FUOL 1SXAA 3P3SA 1E3ZA 2BY2A 3IU4L 5HYJD 2KT6A 3TBYA 1VGEH 3BAWA 3OLIA 1N8ZA 3V0AC 1EZVY 1M53A 2HUEA 1OGPA 1W16A 2JLLA 3NP4A 2XWBB 3QIBC 4NNPL 5HDRA 5JW4M 3KPSE 4N2GA 3X12B 2NCEA 2DQCL 4OSUL 5ITBL 2H2SD 3ARBA 4BZYA 2F53A 4U33A 1WQVT 4OLYL 3U6XA 1AKJB 1ED3B 2NTSP 2DWSA 4P3CH 1ND0B 2VDRH 4IBSA 5IHBA 2Q3ZA 3UGUA 2HJKB 4JHWL 4RCAA 3TEUA 1A7NL 4IJ3B 5A7EA 1R5VA 3BVWA 4WIQA 1OCOB 4JY6B 3HE6B 4PCKA 4KY1L 1F18A 3OAUL 1GGIH 1P4IH 1IC5H 1VF5C 1XIWB 2DEWX 5FM5M 3ABMB 1D5BB 1AGFA 1YEIL 2J57A 1BFOB 3MBXL 2B15A 2H2SC 1X4YA 4I5BA 3VXTA 2G4EA 3NIDB 5DO8A 5T3ZE 2PWFA 4QD2E 4E41E 1LEKA 1BQRA 3BPLB 1FO0B 3P40A 3VFSA 5BRPA 5FO8B 1AZVA 1ICTA 3JT0A 5KANI 4TVSa 2D2OA 3ZRCC 2PCPA 4WUKH 1I8MB 5GGUA 4NFDA 4W9JC 4DFHA 1E4WH 3QEUA 3ALPA 4JNXA 4KXBA 4ODBD 4F58H 2K70A 4NN6B 5IHWA 4JANA 3CUPA 5C9KA 1YA5A 1UD3A 5I66B 3JYCA 5E6UB 4DPAX 3M8OL 5CP7B 4Z7VE 3M1BA 4U7SA 1Z0NA 4OQTA 4X5XB 1XF3B 2YAEA 3AWGA 2P24B 4WTWA 3O9WB 3DO7A 4MLIA 2P7TA 4K23L 1J0YA 4LCWD 4K71C 3LEVL 3X3FL 2DL9A 4AZUA 2P26A 3OV6A 4HC1A 4P3WA 1MRDH 3CHRA 4K0OA 1T7ZA 4XVSH 3Q43A 3U0TB 2FO4A 1O7VA 3SPHA 3OAZH 3DVNB 3WXWH 3PWLA 1KPRA 2R8SH 3IRZA 1AIZA 3K74B 1WFUA 4GO8A 1E6OL 4JDZB 4XAWH 4JN1L 4LBEB 4U1HB 5DVOA 3UTTB 3DUHA 1JDCA 3BI9X 4P9HL 2CWRA 2RGSA 3TT1H 3BCFA 4N0YH 1ID2A 2DTML 4RETB 2EKSA 3HNVL 4JFZH 3T2OA 1E67A 3BZ5A 3MKKA 2DIAA 4TLTA 2KZKA 4XZUA 4GKNA 2OYKA 1UOVA 4P46A 3G9AB 3JUZA 2EDWA 1AXSA 1YEHL 4IIQB 4XI5D 5DLMH 4M48H 2WXFA 1HKLH 4JRFA 1K2DB 4XC3H 5HI3D 5AAWA 5IESL 1WG3A 4P5MA 3TA3D 4XBEL 3BIBX 3KR3L 1FC1A 3BISA 4ZDHB 1DVTA 4F8LA 1Q1PA 1Q9OB 3X1GA 1HWHB 5HYSG 5DGQA 1UC6A 3R06B 4L3AA 3RPIA 4TQHA 1NGWA 3CLEH 1T1WA 2WVTA 2FUQA 1CF1A 2X9WA 4JO5A 2X2HA 1DCLA 2AGJH 2N7SA 5D7JD 4XGZB 1WLHA 1SF3A 2BNRE 4TPRH 1PVHA 3EYQC 4H5SA 3LKPA 4NQCB 4BSVA 3OAYK 2W8CA 2MOVA 4XI5C 5DD0L 1B6DA 1OTSD 2RB8A 5HI3C 4L3ED 2OMYA 4HXAH 3K1DA 4RFNB 1LK2B 1UJ3A 5LAXB 1K5NB 4LASH 4WO4A 3WHE1 3ZE0E 1ECYA 3QQXA 3EGXA 5MEPB 3EH5B 3NJHA 4MDJA 3GMNA 2RD0A 3WIAA 4G8IB 2ATPB 4LPVA 4DSYA 1VFAB 5L2KE 1XAKA 3NQIA 5D7JC 4XN1A 3VXQB 2R4SH 2J2ZB 3T6QC 5CILL 5FUZL 2BZDA 2R2BA 4J3OF 1M2OA 1UGKA 3ZHDA 5JPNA 5L4MA 4BKLB 1HEHC 1ZLEA 3O3BB 3L81A 2XJKA 3JTTA 4J3OH 5ACMA 3SBQA 4ZZFA 4ODUA 4QYOB 4N68A 4CU7A 3NEXA 3MRFA 1BIIA 3LRLA 5FYKH 1URLA 4GKSB 1P5UB 2Q87A 3V9EA 4ZPTB 1LP9E 3QAZC 3L3KA 2QPEB 5JQ6H 2PTUA 2VERN 1IFHL 5DQDH 1MCKA 2H1PH 4LSTL 4Y2OB 3DX8A 4KV5E 4PRIE 3ZVVA 3HC3H 5E23A 3GUTB 2R1XA 4ZYKA 1EEQA 3QIBA 4DETA 5C97A 2IQAB 3FOLB 4OD3L 1RUMH 4A7TA 4GG8A 2YD5A 3N5AA 3DOHA 3P2TA 2FL5A 3ZHKA 1R46A 2YXFA 1EGJH 3AG2B 5C08A 4JO8A 3UO8B 2A9NH 3E1ZA 4KGJA 2CGZA 4L1DA 4DERA 4M93C 4G6KL 1J8HD 4Y1AA 3LN9A 3G6JA 4AH2B 4IU2B 4WWKB 5AG8A 3CQPA 4WFEE 1A7OL 1UG9A 3WAKA 3FU6A 2YOAA 2FBJL 4HWEL 1NJ9A 5IMMA 4Z8FL 2WINA 3B56A 3GDBA 5BZWB 5HYJA 4PB0L 3QCVH 2QR0B 4G7RB 1NIBA 1KBGH 3BKML 5AVTB 4DVRH 2XDHA 3E38A 3MNZB 2VMJA 2FSDA 4AQAB 4LPCA 2EVHA 2DMBA 4XODA 4K55A 4XX1E 3RP1A 3RWJB 3RVTD 4NC1E 4X9GA 4MA7L 3DXAD 1A1MB 3UJIH 2CO6B 4IKKA 4Y2NA 2R1WB 1MWOA 5EN2B 3BEWA 4BFNA 4PS8A 4X2UA 3DO4A 2VAAA 3SOBL 2H32B 3T0VA 3GMQB 4N6RA 2F5BH 3NSFA 2W9DL 4XMKH 4YC2B 4YSOA 3ZTNL 2HRPL 3CXHK 3VI3A 4XVJL 5AVRB 2DEYX 4ZTPH 4KQ3H 2R0ZH 2Z4QB 2WQSA 1BQLL 4PRPE 1E27A 4YS4A 1ZLUK 3QUXC 3HR5A 3VH8A 1WAAA 4X99B 3RVTC 1G1CA 4DK3A 4PVLA 5IQLA 1GJWA 2OTWA 3DMMD 3HBPA 5I8KH 1KGWA 5GJSH 1QA9A 2KPNA 3D39B 3QPQD 2XPGA 4KKQA 4MD0A 5MENA 2CPUA 5GGTH 4LCIH 2XVBA 1JGVH 5B39B 1S7TB 4PMEA 2NY6D 3KM1A 4DNLA 3FT0A 5G4MA 2DJSA 2NY2B 2WLMA 3VXOB 4JDEB 3LEYH 3KPRD 4WFGD 1RZGA 1HQ4B 5HDBF 3F7KA 3NTCL 4S1SH 2C4FU 1NGXA 2FX8H 3RWHA 1FNSL 2JK5B 1RZKC 4EDXA 3QEGH 3HPJA 4JMNA 3EFFA 3ZYOA 2FD6L 2X12A 3IDNA 5FYLD 3OF6A 4JHAH 1FG2B 4OFVA 1YDPB 3MLTB 3NCJL 3BEVB 1DQLH 2H6PB 2HRGA 2V3FA 2G75B 4PIBA 4K3JH 1T7XA 1E50A 2HT3D 2XTJB 3IXTA 4NBZB 3FRPA 1CR9L 2ATKA 2B5IB 3RLSA 1BAWA 1FFQA 2VDLH 1DVXA 4HH9A 2AXFA 2PCXA 4BRVA 1TQUA 1IAMA 1UKQA 2HJLB 4MFHA 4PY7A 4C8XA 3CFBB 1BLIA 2JELL 2NDFA 3CZGA 3FONB 5LCVA 3VI4E 2G0LA 1UWGH 1FVDB 4F92B 3MVSA 3DIVA 3SDAD 2WHVA 5B22A 3QQ9D 4EIBA 3W9DA 3KLHD 2VQTA 3MRGA 1WE5A 4FEMA 3P3YA 3ARFB 4CKVX 4CMMA 2WXJA 1U8QB 3QRGH 3F62A 1DDHA 1HXMB 3WY1A 3KPMA 1DEDA 4HJSA 2HT3C 5ALBH 3U9UB 3QZNA 4M1GH 5D71H 1KWKA 3RDTC 5SX5H 4M6NH 43C9A 1FFPB 1IMHC 2Y1AA 4MA1B 3TTYA 3STZA 5DUPL 3QYNA 4A7SA 4A2MA 1RHHA 1ZHLB 1KCWA 3KJ4B 2IOIA 3R0MA 2B4CC 5LB1A 4M7LT 1T0MB 4AIEA 4NAMA 3F7VA 3S88H 2QFPA 1NCAH 1ZANL 4GSDH 1V7NH 4PWEA 1MG3C 5D7JA 4M5TA 4AMWA 5B3JF 1P1ZB 4KK8D 3QQ9C 4LRIC 1XR8A 1XGUA 3D0LA 1AD0B 2DLTA 2Q7YB 1KTCA 3IFOA 4QF1A 1MCIA 3NFNA 4NHCL 4TSAL 3H9SD 5JO5B 3X1FA 4JUSA 3TJEH 3QNXB 4MJ4A 3ATAA 1BVOA 1XWVA 3PXJA 2QSVA 2UZXA 4Y9BA 3WV0A 1DL7L 5DHMC 5A2IH 5DF0A 3GNML 3LMJL 4O2EB 5AB9A 1TU2B 4G11A 2RQEA 1HC1A 5I1HL 1A9BB 2X5PA 3T65B 1U8OB 3G5VA 1IGFL 5TE4H 3CZLA 1V7MH 3GLAA 4ISVB 5FCUH 5LWYH 5TF1H 1ZLWK 5C07B 4CU8A 4F33B 3ARTA 1I4FA 2AEQH 3B5HA 2YK1H 2VZUA 5CKGA 1VCAA 3LNFA 1ZK9A 3GT6A 1OGSA 4K3HA 3WFBH 1NIEA 1I31A 2BMKB 4HH8A 4X98A 2DQHL 1YQVL 3UAJD 1S7RA 3LKOA 1TPXB 3ZDZF 3HS9A 1YEGH 2F74A 3KPSD 1KPUA 3DIDA 1G7PB 1SYVA 1EEUA 4XBGA 3MLWL 3OR7B 4ZFZB 3GGWB 4IRJD 1GSKA 1TOXA 3BKCL 5BRZD 1T6BX 3BGFC 3V79C 3BPOC 1YMMB 4PW9A 1UKTA 4PJ7A 1U2HA 3V52H 3S5LG 1AZCA 1J05B 2P5PA 1A9VA 3PNWA 1P53A 2W88A 5E1QA 3JV0A 1GCYA 3IM1A 3UAJC 3MGAA 4QXGL 3FF8A 3DSNB 4DGIH 3BQUD 2X1XR 2IPTH 1FVCB 1T21B 4NP9A 2HH0H 3NCEB 5T3ZD 4DN3H 3QCUH 4E41D 4X50A 3BAKA 4MCYB 3WL9B 2WXRA 3HW7A 1XBRA 2EKJA 4BE6A 5DJ8B 5GHWL 2H3XC 3HCVA 4Y2DD 4UTAL 1YECL 4UTCA 2W07B 3FULA 2OP4H 1EMTL 4MMZC 4JG0H 1NGPH 2ZICA 3CFTA 4LVNB 4OIIL 4LNVA 1A4KA 4XMLH 2YA2A 3VGHA 4EJ1C 3QUXA 1ZHNB 4FTVA 2C3VB 5HI4D 4HJIA 3VA6A 1AY1L 1S7WA 4R9HA 3S2AA 3GI8L 5HYQB 5JUEL 2PW1B 1NCBH 3S96B 1GYAA 2J3SA 3BQUC 1VPOL 4P05A 1MLCB 4QYAA 1Q38A 2W94A 2CJUL 2O30A 2UWEF 3D4YA 5E0FA 4CN4A 4OZFH 5EIIG 2IFGA 1ZS2A 3ESUF 3MXWL 2YOCA 4JEGB 4NQSA 1JWSA 3DHJA 4OB5L 4TQ8A 5I1KL 5HYSB 3NSXA 3V5HA 1WFTA 4Y2DC 3H6AA 2Z1KA 1RJLB 3J27A 2VRKA 1HHIA 3CVHH 2GB2A 1MIEL 4APQD 4NM8H 5DJ6B 1I9JH 5J7CC 1S7QB 2YJQA 1Q9LB 4OI9A 3UZQA 5HI4C 1ZPUA 4K5OA 3EYSL 5EU6B 1B4JL 1P7QB 2C1PA 4JN2A 4RDQF 1ZHKB 2PO6D 3WJMA 2XWCA 4X6FA 4EVNA 1P0SE 1KULA 2WBXA 1N7ML 5I6PA 4JRYB 1GGCH 1R3JA 1U95B 1BF5A 1ODUA 3EO0A 4L37B 1FL6A 1XGTA 2X6VA 2NQDA 4LHQB 3WKML 2DI8A 3KPRA 1DN0B 2IWGA 1A6WL 4FFWD 4L1HA 4PJEF 1JZ4A 2NZIA 4NJ9L 5I1GH 1AFVL 3C60D 3HJEA 4YXKL 3O6ML 4GAJH 3RGVC 2YC1B 1NL0H 4FXLA 2CLVB 3OG4B 5CGBA 1VFOA 2HB0A 1F3DJ 2ZUQC 4H8VA 5DFVD 5C70A 4M7LL 3VXUB 4QJ5B 5JR1L 1G7HA 1JNNH 5J56B 1ZA6B 1CD1B 2LLLA 4OZIE 3QC6X 1VACB 3OXSB 3SPVB 3RDTA 2BNRD 1UCTA 5E99L 5T8IA 4Q6IC 4FLSA 3L3OB 4AVJA 3I3BA 1DVUA 3FN3A 3FB6B 3POCA 5C09E 3TEXA 3HB3B 3U48A 3C60C 3QEHA 2A9ML 1WUZA 4NO0D 3GIZH 3ZRSA 4DPBX 4F7CB 2ERJC 4YN3A 3D2UA 3O81A 2QVMA 1XF1A 4LRIA 5DFVC 4OF7A 1SHWA 2F54E 4UNIA 3RUGE 1EFXD 1U8LB 4CNIA 4GKOA 4OCYH 1QP1A 2GBUA 4HBCL 3QXDA 4RVBA 1CVRA 2BNQE 5L2KD 5ALCH 4HPYL 2IAMB 2OSLB 4JFVA 4JO3L 3NT0A 1BJ1H 5DDHA 5FKPB 5FHBL 3UADA 1DLHA 1Z5HA 4WK0B 2QKIB 1NGZB 3O45B 3WFDL 2WLYA 3KVQA 3HG1E 2BIQA 1W72A 2P5ED 2VZSA 3HS0B 4ODXB 5EF3A 4BH7A 2QEJA 3D3VB 2APSA 3AACA 4QEGA 2YBRA 2OMTB 4BFIB 2DQFA 5IEKB 3VXPA 2WYTA 4PJDB 4BV1A 4BFBD 3IJYA 3H9SA 5ABDE 4GQ9H 4K9EH 1BMWA 3KPQA 2MCAA 5KVGL 1Z9OA 3BPCB 1IAIH 5IVNA 3FQTA 4KROB 4RMSA 3JYBA 5BNXD 4E42B 1MQKL 3ILPB 3X3GL 2XZQH 2M83A 3NYKA 4HKXB 4QTHB 4PB9L 3TWYA 3WFCH 2WIMA 4PRNA 4FQJH 3WOVA 2HPTA 2VISB 2G5UA 3BP6A 2DQTL 2DMHA 3BMVA 3IWVA 5CSBA 1TVHA 4WFED 5I24A 4HKBA 3ISYA 5I6LA 1C5CL 1BHGA 3IJ7A 4KUZH 5B4MD 4UQ2B 5HHNB 4J5VA 3DBSA 1CG9A 3ARGD 5MHSE 2AXGB 4WHTA 5HHVL 1J5OH 1TO5A 3S34H 4QAMB 3UCRA 1FFNB 2X70B 3QJZA 4FULA 4OBRA 4EZJA 3OKKA 3EH2A 4GFTB 5TDNB 2XICA 1DQJA 5CZVH 2ZJSH 5HGDB 1BM3L 3QR1A 3FQRB 3CLFL 4MMZA 1CFNA 1G6RB 2FJFB 1PX3A 1JN6A 5B4MC 5CN1A 1UD6A 3T8XA 4H88H 3SCMD 3C6LD 1U33A 3FU0A 3A4EA 3ARGC 4IOFD 3BP5B 4PWIA 1U8JB 5J89A 1NKGA 2PLTA 3BQUA 1DQQA 5HVHC 5TDOB 3L4CA 4PRPD 2OMWB 3FRUA 2MRYA 5IBUG 1KDJA 2MPAL 2VQ4A 3EDFA 4JPVH 1NCJA 2NYYC 4NC1C 1MFCL 4UV7H 5M95B 1YNTA 4RIRA 1X9UA 2FT6A 5T5FH 5BUAA 3L3GA 3IKKA 1XSIA 3UIYA 2NY0C 1BFSA 2PYFA 3BZ4B 2Y9RT 2ZSVB 3SCMC 2XNAB 3C6LC 3GXIA 1A3LL 2O93L 2EIJB 3ARXA 4QOKB 1ONQA 3V0WL 1HINH 1MXDA 1HHKA 1X4ZA 4Z7VA 5FLVA 2AJZA 3T0BA 5GRUH 4AYBA 3MRHA 1I3UA 3LZNA 5IQ7L 1A6ZA 3UYOD 2WYZA 1AGBA 2ZCHH 2HFEA 4RNRA 2OW6A 3V4LA 4JAMA 1ZDQA 3PP3H 4JFWA 3ZKND 4AY0A 1QBBA 4PCSA 2FVNA 2HAZA 2W5PA 1DJYA 4PJIB 3OKEB 3ZDYF 1LQBC 3OZKA 1PZAA 3Q8FA 5AW8B 3UERA 1LEIB 3DX4A 4I1PA 1AKPA 3QUML 3ROOA 5KYUA 3VRJA 2EH8H 4RAUA 3RGVA 5I30L 2FIKB 3WXVL 2IDUA 3P9LB 4IQHA 3O2VL 3I9GH 4C55A 4FTDA 4LEOA 4HU2A 4Y5YB 1JTPA 4NIKB 3BESR 3LNGA 4PH8A 3FT9A 3VGDA 2VXVL 4WHCA 3NACL 4FJYA 4JFPA 4AGPA 2HLEB 3BFWA 5ADOL 1GAFH 3P4MB 1CLYH 3ARDA 2KI6A 2WLJA 3ZKNC 1RZIA 3CXFA 2YAFA 2AK1L 4Q6IA 4K8RH 2HKHH 1U2CA 3G08B 2ZYIA 2CIKB 3BP7A 3GHEH 3INOA 4PS4H 3SHSA 3EO9L 4Q9RL 4OKVB 1MFAL 2PP9A 3AREB 5T1JA 3D06A 5GRYA 4KNUA 5DWUL 3KVDD 3KLAA 1DEEB 2KZ1B 3O11B 4TTDD 4X6DF 4FL4C 3PLYA 2A1WL 1JK9B 2GEEA 2CCVA 4HIHA 4MCZA 1T4KB 3D0VB 4MA3B 4HKZA 3VGBA 1QR1B 4P57B 1FHGA 1CDUA 3HBZA 4KKCC 2C26A 5KSVB 4LEXH 3EYVB 3QJQB 1U42A 2YMOA 1JF1A 1XF5B 5LGJB 1OWWA 4WTXA 4L5FL 4QCIA 3N91A 3S5LB 4X4YA 2V17L 3EJYD 4GKLA 5CZKA 4YLCA 1BVKA 2X38A 3O2DA 3V10A 1QLFA 3VSUA 5BOZG 4TTDC 4KVPA 3HUJF 1HH6A 5F89B 4PJGE 3F83A 3PGFL 4MNQA 1EFXA 7PCYA 4J8RA 5TFSH 5LKNA 2VO8A 4X80L 3QUKA 4R4FH 3VD3A 2APTA 4R4ND 1ZY9A 1ETA1 4H0GA 4F24A 4L4TB 4OGZA 4FQLH 4X0NA 1KIQB 3CQFA 3L16A 5F8QC 4KITB 32C2A 1FZMA 1QWUA 4U31A 1HZHL 1CU4H 3QSKB 3Q2NA 4KO6A 2HYMA 2DDQL 4ORZC 5EC2A 4X6CF 4PJFE 1ZSDA 1E6JH 2OL3B 4IOIB 4JMXA 5D5MB 3A6OA 2V2TB 4EKXA 2JJTC 1THAA 2HX8A 3GSVA 3GMPB 5FOBB 5KSUB 1LP9A 2FWOB 1HQRA 5D96C 2TAAA 3RKDD 4AYID 2IFFL 1PTZA 3DROB 3OKLA 3INUL 2QPFA 4GBXD 5TDPA 4BA8A 5K9KB 1JZ6A 1S6NA 4MZ2A 3BE1L 1T7WA 2F8VA 5EIIB 4PRIA 2ZXWB 1HHGA 1KPVB 2A6DB 5I74B 4G9FB 4DPCX 4IHBA 5EBMB 3UTQB 5DJZA 4IGBD 2E0PA 4TS6A 5D1QC 2FX9H 5ECGA 3M17A 2AK4A 4HIXH 1T1YA 1MNUL 1RPKA 2G9KA 2DJUA 1JNHA 3CVBA 4FQHA 4O5LL 5F44A 1YEDB 3WFEL 4LO9A 2ZYRA 1IJ9A 1HTYA 1HCYA 1IB5A 4P07A 1PL3A 1WWCA 5J1AB 1DE4A 4FG6D 2LW3A 2P8MB 4NC2B 3SDXB 5KAQG 4LF3A 3MRPA 2B08A 3IDIB 4GBXC 3QXAB 2VXQA 5LXVA 3OBAA 2X87A 3CSYA 4HUNB 3KL3A 4LRNL 5KVDL 2AQRA 4K7PX 5ID1A 3CX5J 5CP3A 5I82A 3PWPE 3T4AA 4PP1D 3FO0L 3DTUB 4NAQA 4IGBC 3D50A 2CZNA 2XWXA 1KXHA 2WPGA 1UD5A 5FLUA 2FRGP 3FSZA 4LOVA 2R0LL 3MJGX 3BRFA 2EABA 3U2SB 4AEFA 1FORH 4Z5RA 1CXIA 3UG4A 5FFOA 1SVBA 5BPPA 5JA8B 3VE0A 1T3FA 3QQ3A 3L2MA 3MLYH 4FG6C 4TQEH 3PAVA 2EAEA 1LWHA 1M6UA 4NJAH 4MJ5A 3MRIB 2ZOTA 3U2IA 4WGVB 4ZUWB 4OV6F 4H25B 5CBAA 2IIJA 1RIVL 4Y9EA 1TZOA 4YSCA 1NFIB 4ZFGL 4NHUB 4DZ8A 4YZFF 5KWYC 1KT2A 4HCRA 5F7BA 4XPBL 4ANKA 1J12A 3MNVA 4JRXE 3DUSB 3RZWA 1U3HA 4L3CA 2H8PA 4PRPA 5T1LD 4UOJA 2BHZA 1DANU 4GXUM 2WLHA 3KYAA 3WY4A 4Y4FD 3MMEA 2WANA 1MCDA 1XCQA 4M62L 1CDHA 1R5IB 1RQ5A 1U8IA 3OSKA 2XYCA 3K5RA 3LKQA 4GRWF 4Z95L 5JW4N 4HJEA 3QK0A 1MVUA 5DA0B 2EC9T 4GRWH 4G6ML 3MLSH 2X09A 4U7KA 2FIRT 1KC5L 3L4VA 2QZ5A 2BFVL 4YE0A 1GR7A 5C0BE 3O6FC 4Q4EA 3PHQA 1E9PB 4PM1A 4FQPA 4IRSD 1L5GA 2Y1YA 2P52A 1PY0A 1B88A 3U1PA 5IFAH 2W95A 3H2QA 1JPGB 4P2RE 2F19L 5AOMA 4FFYL 2NLJB 4XN7A 1PZ5A 1HVXA 1FIGH 4LSUL 1IGYB 3ARWA 4HJTA 2V7NB 4L1SA 3SDDD 3TIDB 2D7QA 3U0PA 4HV8B 1QRNA 5CBEB 5EB9A 4AW7A 1DLFL 3TT3L 3QA3B 5B1JA 3EH1A 4KXZI 4PWFA 5C9JB 1CF8H 1CYGA 2JIXA 5ID0A 4J23A 4MQTB 1TNNA 4M1CC 4ZS6D 2A38A 3MNWA 3UTSB 5FFGA 5C09D 4FNPA 4HSAC 1LO2H 2IPKA 4YUEL 4IRSC 5IT2H 1EJOL 1IQWH 2HVKA 1DSWA 2E8YA 4JLRA 3VI4A 4Z7IA 5INDB 2EIZB 3V5DB 5J3HD 3S98A 3CFQA 2BOLA 1P4LB 4PJAE 1T66D 3VRIA 3JZYA 5K9QG 3C8KB 2F54D 3MRQA 5F1IB 3GSNH 4DHLA 3PQYB 4J39A 1KB3A 3LKRB 3CFUA 4OZHE 5AL8A 4JZJB 1INEH 2BNQD 4A6YH 1COBA 3BWAB 1PPIA 3BDYL 3QRLA 5F0PB 5T3XL 5HDBE 4JFYB 1XZWA 2V7HB 5IJCC 4ORGA 3A21A 4OZGB 4ZOAA 3IETA 3HG1D 5IROA 4AITA 3GTNA 4BZ2A 2WQXA 4FD0A 1MAKA 4OF8A 1KBKA 4NUJB 3ZSTA 4L2YA 5J3HC 4YHZL 3MCLH 1I1YB 2AXJA 1T66C 4O00A 4PTTA 2QQNH 1ZS8B 2CKBB 4OGQC 1JGEB 1PLGL 2XIBA 5EUKA 1RUAL 1SYSA 4YHIA 4UIMB 5C0JA 4UQBA 2HG5B 1I7RB 1YNKL 1E4HA 4OCXL 2RACA 3EZJB 2X4QB 3RWEB 3BT2H 2YPLE 1AZZC 3O2WL 2A2QT 2GJRA 3PHOB 4FQQB 5IMKA 2YPKB 2GTWA 4HQQH 2BP8B 2EUWA 4A38A 3RTQD 2GBTA 2NSMA 2RFXA 3ES6B 5KVFH 4GQRA 3PWNA 1TJGL 5IBUB 3BUQA 1OM3H 2VDPH 3IPFA 3UL4A 2ENYA 1E3FA 3SYQA 3O0RL 1MCQA 2NW2B 3U9PL 2FDBP 3AS2A 2G4GA 3VG9C 2ESVD 3NCYP 4N2BA 5D1QA 1HI6B 5HY9A 3CZSA 3T0EB 3ZTEA 5B7FA 2KQMA 3DECA 3CMOH 5I8CB 1R3IL 2V8MA 1KG0B 2IXQB 3GIVA 5A6MA 1D5IH 1GC1L 1LWJA 4Z7QF 1VLXA 3WD5L 4FAAB 3TS8A 5LBSH 3UC2A 5F88B 1A2YA 4GLRI 5FB8B 3QIWC 4OD2A 2ATAA 5DHXB 4GBXA 1WUNT 1MCPL 3NQKA 1YLBB 4JX0A 2IG2L 4OJEH 1IZJA 2VLKB 1XBDA 3SKOB 5I1JL 4Z78B 5ITFB 3EW3B 3M07A 1LEGA 4JHBA 2B59B 4O2FB 4HMEA 2DS4A 2OXHB 5HGBB 1DZBA 3ISRA 3KWTA 4IGBA 4MDRA 7CGTA 5E2JA 1XTMA 1ROCA 2ZSWA 5B3SB 4D0BB 1ZJBA 1MF2L 3OMAB 3FKUS 3LHPL 3QULA 3Q8CA 4H13C 4RMRA 5KBMA 3T0XA 2WVVB 4L0ZA 2B1AL 5AKRA 1GOFA 3T6XA 2MQGA 3B2MA 3D4CA 1BZ8A 2OAAA 3QCTL 5KANG 3S35H 4X8CA 2XRAH 1S7UA 3WUZA 1U36A 1CYWA 4MWFA 2J1KA 1R0AH 3UH8A 4ADJA 5TH2B 3NCCB 4N2CA 2QSCH 2CIIB 6TAAA 4FLHA 2DQGH 4W9GC 1PBYA 2WXMA 1CDCA 4AENB 5FGBC 4QRRB 4KZEH 3TO4D 4UOZA 2X4TA 3HAEA 2BCKA 2ICCA 1A64A 4X7FC 4B9KC 2LVEA 2UVEA 2IV9A 1ZLUH 4LCVA 5E9DB 4H1LH 3WTVA 2DLEA 4X7CC 4LXFA 5ICXB 4MHHG 3UG5A 4KPHH 4MXVF 4PJCB 1MHHB 3BLPX 3LRSA 2Y4SA 4L4VA 5EZOL 1T1XA 4NNYB 5J6HB 4ELKB 3HC0B 4IK6A 2F15A 3ZDXB 4LDLB 5I1CH 2MNJB 1DQKA 2WJ7A 3D05A 4OLXL 3FDWA 3JWDC 3O6FA 1CGSL 1OB1A 3LDBC 4JKMA 2CMRH 1VENA 5DD1L 3VH8G 2HT2C 5IHZB 3RWFB 1TDQA 3UBXI 1RK1A 3IKCA 4LLMB 5GXBB 1QNZL 5DURB 3LZOA 1XF2A 4JPKL 3MUGA 4NO3A 4W9KC 4MRCA 3MCKA 4ODVH 3VWJD 3KPNA 5HPMA 5DD6A 3S37X 4HLEA 1NM4A 1CXEA 2ENSA 2RJMA 5HHMB 2WAQA 4L18A 2VXTH 5FR3A 2J55A 4N6QA 3RL1B 3ROLB 4JHUA 5J6GB 3C09B 5E9NA 3DX1A 5EA0H 3KBHE 1YC7A 4XP1H 4I13B 4HGKC 1KB5A 4HLZG 1QI3A 1T2QH 4NKIL 2LLGA 5L88H 3MRCA 3HZVB 4IRSA 2YAMA 1D6EB 5L8JB 4OF5A 4MVBD 2QJDA 1MRCH 3DA0A 4WUUE 4HVBA 1UCBH 3CAFA 2F8IA 2NXYD 2KH2B 3VWJC 1RVFL 2JWYA 2B9AA 1S5IL 3NCBB 4U4IA 4D3CL 1C08B 4P2QE 1J9SA 2PNDA 3FRPG 3V4PA 3OL2A 3L3JB 3MOBL 4Y19E 3H42L 3UC0H 5FECB 4ICWA 3D5OF 5EO1A 3P11H 5FW6A 1ADQL 3GMOA 4OD1H 1VJSA 3ZYIA 1V55B 4JY5L 2V37A 3O3DA 5J0BA 2FO8A 3BVNA 1MWAH 3PL6D 1KGIA 3OMZA 5C09A 3VXSE 4I0CC 1N64L 5CFAA 2YGPA 4MVBC 2WKOA 1OAZL 5JNYB 3EBHA 3ZE1F 5GS0C 4PLOB 1ZHBA 2NXYC 4LLDA 4BQ6A 1WH0A 4FHBD 2YKKA 4J6RH 4LGSB 3M46A 1X5XA 4YHMH 1HYRC 1SBSL 3T5WA 1O6SA 2C3HA 4ZO6A 2EE3A 3RUGA 2DYPA 4XE5B 4TL4A 4P2CG 2BNQA 3TBYB 3NPZB 1N8ZB 2AABL 3OQ3B 1XH0A 2Y7QA 4OFPA 4R90L 1BAGA 5E24E 1JAEA 1T4WA 2NQCA 3PL6C 1PX8A 3ARBB 3IYLW 5EEWA 2AV1A 3ZL4H 1QSFE 2CRIA 2F53B 2BC4A 2XC8A 2GBAA 3DPBA 4IBUA 4Z3HA 4RGNB 1TYJA 1H3TA 2GSIA 2XPZA 2CPCA 3NSDA 2RAMA 1YN6A 1A4JB 4ZO8A 3IMRA 2CNYA 2QPUA 5J12B 1KELL 1RZJH 1R5VB 4PS3A 1ZLWH 3RWIA 4IMLA 2XACC 2GC4C 1NOFA 3CN3A 1QI4A 1RULH 2D9CA 4ZTEA 4MAUL 1M7DA 4CRPA 2I24N 1AGFB 2GHWB 4I5BB 3VXTB 3QIWA 4PJHF 1X5GA 1C12A 3I50H 1D7FA 1FNAA 1LEKB 3VFSB 1L7TL 3N43F 2I60L 3VFUA 5IOPA 1H15A 1UXWA 2V9UA 4YSQA 2PCPB 2BWQA 2KS0A 2VC2L 5DVPA 2QFRA 5GGUB 1NUFA 5CINH 4F57H 1N6VA 4KKNA 3EBIA 4K2UL 3QEUB 2KLSA 3IBEA 1YSOA 2QTEA 4JANB 1FVEA 3CUPB 4EZLA 1QBAA 1PZDA 3TVMD 1P7HL 1XCTA 3LN5A 5JZ7D 4PYGA 1QKZH 2VRQA 1CQYA 1EO8H 1QZ1A 2UXFA 2JCWA 3M1BB 5FUOH 3D87B 2H3NA 4P4RA 4W1TA 5I1IH 1F1AA 3DO7B 4FQ1L 3SE9H 2P7TB 4TNFA 4NNPH 1KCUL 2J1WA 1DR9A 5IUSA 2DQCH 4LKCA 5KSBE 3ULVL 2AJXL 4WWNA 3EFDL 2PP8A 4YDZA 2C9UA 2QGEA 4OV5A 2FO4B 4JFSA 1R3LA 3RWGA 4J3OC 3EJQA 5DQJA 4EI5D 3TVMC 3PWLB 1KPRB 4AMKL 4E9VA 5E08H 4JHWH 3BUBA 3BN9C 1A7NH 2IWFA 3ULSA 1PSKL 5L4IA 3P2DA 4MQSB 3VFVA 3ZJAA 4UT9A 3UBXA 5FA4A 5B7MA 3BQVA 1A6VH 4KY1H 5EFIA 4IBLT 5C0CE 3F58L 2EKSB 2F8OA 1MELA 2OMZA 2P8LB 4BYHA 5JMRA 4ELMF 2WBJA 1YEIH 4XZUB 4GKNB 4NUGL 2R69H 1S5HA 5H37H 4P46B 5E7FA 1AXSB 2PWHA 2E4FA 3H2WA 1MQ8A 2UZYA 1PMYA 2V0AA 1Q0XL 2E59A 3NA9H 5JW3L 2Y72A 4EI5C 4P5MB 4XO4A 3TH3T 5DZNA 3KXFA 3UTTE 5C0BD 4GKZA 4H40A 2GTQA 2NY4B 3SIKA 1OGTA 2LU3A 3EHBB 4RWYH 4LL4A 2HA1A 2O61A 3RPIB 2PXYD 5F7MC 1NGWB 1T1WB 4R2GD 4KJPC 2WQUA 3P0YH 5C0GA 3M8OH 1F6AA 4H5SB 2W0PA 3LKPB 2HKAA 5L9DH 1WEJL 2BSRA 4EUPH 4BSVB 1PF3A 2GQHA 3N44B 4S1RL 4HFUH 3ZY7A 1A66A 4HA1A 1B2WL 2ICWI 2AI0L 2KZWA 2OMYB 1QW8A 1AGEB 1WJ3A 3BSHA 1ZVSA 1J1OL 1UJ3B 4TYUA 4WO4B 4Z3GA 2I26N 1OSPL 3LQAH