5KJLA

Smyd2 in complex with az378
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
428
structure length
428
Chain Sequence
b'LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 141
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjlA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjlA01
4MI0A 2PQNA 3OXLA 4YPUA 3RO3A 4YVQC 2VYIA 2WQHA 2LSVA 1ML9A 3LY7A 2XGOA 5FZRA 3OOIA 1WAO1 4UQZA 1N3JA 3GYZA 5D0OD 3LPZA 4J8FA 3M58A 2FEZA 1XNFA 4G26A 5HQ8A 1IHGA 2LSUA 3O48A 4KBQA 5CCLA 2KCLA 1ZU2A 4RZ0A 3RJWA 5KJLA 3PE4A 3ESKA 4BTBA 3AS4A 3CKBA 2C0LA 3LY9A 4GYWA 5C1DA 3M56A 4IN3B 3KD7A 4O30A 4AY5A 3FFLA 3CVQA 3S7FA 2BQZA 4NQ0A 3F9ZA 2VGXB 4H12A 3QDNA 3TAXA 3URZA 4I17A 1W3BA 2L6JA 4YNMA 4AU7A 3Q15A 4LDGA 4YNDA 3IHXA 4GZ3A 4GZ5A 3FPDA 3FWVA 2XPIA 4J83A 3GZ1A 3HYMB 3CK9A 3VTXA 2VQ2A 3DB5A 3M57A 3CBMA 3AS5A 3UPVA 3AS8A 4BT8A 5JHNA 4GCNA 5ARFA 4MI5A 4QEOA 5M72A 2YQ8A 3CK8A 5A7DB 5LSXA 2GW1A 3S7BA 3SW9A 5F59A 5G05C 2YHCA 5G05J 4GYOA 3F9YA 3ZHEA 4JL0A 1ZBPA 4I1AA 1QZ2A 3NF1A 3Q47B 4WUYA 4CGWA 5TH7A 2W5ZA 4RG6A 4U0ZA 5JJ6A 3KMJA 3MEKA 4G25A 3ASHA 5FTPA 1MT6A 2KC7A 3SF4A 3RIBA 3MA5A 3U3WA 5KJMA 3ASFA 2Y4UA 4GA1A 4N2SA 4BT9A 3HNAA 1HH8A 1P5QA 2Y4TA 5BT1A 3M53A 4N2QA 4EQFA 4KYOB 4KXKB 4GA0A 3BO5A 5G04C 4U07A 2UY1B 3QKYA 5T0MA 2E2EA 2VGXA 3UQ3A 2DBAA 3ASGA 5AYWD 5KJKA 3GW4A 3KS2A 4LEUA 1ZKKA 4JLGA 4QEPA 2J9QA 3ZHEB 2C0MA 5FZQA 5JINA 3LY8A 1HXIA 3S8PA 4YPEA 4I2ZA 2G46A 5EG2A 4JA7A 2FF4A 3F9XA 4O6FA 3KAEA 4FMUA 3OS5A 2XGSA 5TTFA 1HZ4A 3OXFA 1O9SA 4HOSA 5JJ7A 3VV0A 3OPEA 4Z4PA 4BWRA 3EP0A 5HI7A 5CHEE 4HOQA 3K5KA 3K9IA 4WNEA 5ARGA 3TG4A 4BUPA 1QQEA 2KATA 3S7JA 5EKQD 4GPKA 3RU0A 4XI9A 4ABNA 3QWWA 4BTAA 3CKCA 1WM5A 4GZ6A 3LYAA 4HORA 4YPAA 2UY1A 3IEGA 3CVLA 4U04A 3LCAA 2XEVA 2F69A 2HYZA 3UUXA 4I2WA 4WNFA 4N39A 3F9WA 2NC9A 4WNDA 4IJDA 1NA0A 4UQXA 2FI7A 3RKVA 3ASDA 1YA0A 2VGYA 2WPVA 2FBNA 3M54A 3RJVA 4GYYA 3PE3A 4I9CA 4HOTA 4IJ8A 3FP3A 2LNIA 1Y8MA 5T0KA 4CDRA 1KLXA 4Y6WA 5JJ0A 1PC2A 3R9AB 2KCKA 4WNGA 2PZIA 5CCMA 3MO2A 3ZFWA 1MVHA 1B89A 3M5AA 2PQRA 4JDSA 3CBPA 3ZGQA 4AIFA 3CK7A 2ONDA 3CEQA 5F6LA 4JA9A 5EX0A 2QPWA 4J8DA 3TGOA 5FZSA 5D0QD 1H3IA 5BNWA 4G1TA 3RAYA 5JJTA 3EDTB 3MO0A 3QOUA 2P58C 4XI0A 3LKUA 3KMTA 4AM9A 4J0UA 5T5GA 5AYFA 2O8JA 4N3CA 2IGQA 3M59A 5TEGA 4G23A 4NRHB 4J8EA 3QWPA 3U4TA 2VSNA 4U0UA 2R3AA 4JHRA 4UI9C 1XQHA 2BUGA 2KCVA 4UI9J 5BW8C 1NZNA 2RFIA 5FJYA 1E96B 1ELWA 3SZ7A 3CVNA 4U0SA 4Y6CA 2UWJG 2IFUA 2MHKA 2XGMA 4APOA 4XIFA 4A1SA 1TJCA 1PEGA 4B94A 3CVPA 5KJNA 1KT1A 3E4BA 3MO5A 2W5YA 2V5FA 4CGVA 4UI9K 4AY6A 1FCHA 4NVQA 3S7DA 2IF4A 3Q4AB 4N3BA 4C1QA 2Q7FA 3Q49B 3PDNA 2PL2A 2VSYA 5DBKA 1OUVA 3DALA 4I9EA 3ZPJA 4RG9A 3RO2A 2OOEA 5A6CA 4NJ5A 3MKRA 1ELRA 2XCCA 1A17A 1MUFA 3CV0A 5LCWC 5LSZA 5LCWJ 4J7FA 4I51A 5FT9A 1MVXA 2AVPA 3VUZA 3KMAA 4F3VA 3QWVA 4HOUA 2HR2A 2JLBA 4YVOA 1KT0A 3MV2B 4E47A 1N6CA 2HO1A 3WXXA 1IYGA 3VTYA 4J8OA 3BEEA 3MV3B 3RQ4A 3OXGA 3GZ2A 4ME2A 5CPRB 4G24A 2FO7A 2JV0A 5F6KC 5DIZA 3ZN3A 3TG5A 4G2VA 4YNPA 3M55A 2XCBA 3JYSA 4W9RA 2I6HA 4QENA 4N5CA 4UQYA 3SWCA 4H7YA 2R5SA 4GCOA 3ULQA 1N6AA 4H7XA 4J7IA 1NA3A 3CBOA 2C2LA 5EX3A 5G04J 5F5EA 4GA2A 2QFCA 3Q5MA 4N3AA 3N71A 5JIYA
chains in the Genus database with same CATH superfamily
5ENTD 3C98A 4GMJA 3OXLA 5T8IA 3ABLE 3T5VA 3WG7E 2BKGA 1MHQA 3ENEA 3SNXA 5HS0A 2KM4A 3FUEA 1IHGA 4KBQA 3FEYA 1PY1A 4JB8P 1ZU2A 4RZ0A 2WXFA 2CG3A 3MKQB 3CKBA 4XZ4A 1VDYA 3LDZA 3MGBA 3LY9A 3ML9A 3FTZA 3TWVA 4CYMD 3FTUA 3FFLA 3IHYA 5FINA 4UWFA 4GTOA 3S7FA 4PS3A 3PNTB 3QB2A 3CHPA 3F9ZA 4ZFHA 3B7UX 3URZA 1MYOA 1W3BA 1H19A 4AU7A 3ZYQA 4GZ5A 1TN7A 3TWTA 4C0MA 4J83A 3U9WA 3HYMB 5AAOA 3JUEA 5HRYA 2VQ2A 3DB5A 1K8KG 3CBMA 4G11A 3UPVA 2IONA 4BT8A 5ARFA 4QEOA 2YQ8A 5CBNA 3CQGB 4WWOA 2OEWA 2GW1A 3PH0C 3S7BA 3SW9A 1D8EA 4J6IA 4XX5A 1UJKA 2VGEA 4GYOA 1JCSA 4ATGA 1ZBPA 1TNUA 3NF1A 3Q47B 4WUYA 3AAAC 4RG6A 5FTPA 3SF4A 2VTBA 2L0TB 1FT1A 4KT6B 4GA1A 3FUDA 5J08A 5BT1A 1N4RA 4KYOB 1Z6TA 3TXNA 2I2OA 4LCTA 1SQMA 3UQ3A 3Q73A 2JEKA 3ZRHA 4V3IA 3JCKC 2J4BA 3QARA 3ZHEB 4B0ZA 4WAFA 3PZ4A 3TWRA 2VJ8A 3LY8A 1N9AA 2L0IA 2CG2A 1SA5A 4R7LA 4I2ZA 2G46A 1S0PA 4JA7A 2RG8A 2FF4A 3F9XA 3S2AA 4DX6D 1H0AA 5H7PA 2R02A 4GTMA 2GRMA 4BX9A 2WM9A 3JXIA 3OXFA 5JJ7A 3PS6A 4Z4PA 2MYOA 3FEXA 1KZPA 5AQBA 3V79K 2J09A 4BUPA 1QQEA 2PM7A 2XPZA 2ZIRA 4BFRA 4BESA 4GPKA 3QWWA 4F6RD 1PAQA 1UN8A 3IV0A 2UY1A 4YDYA 3CVLA 5CRVA 1D9SA 3Q78A 3UUXA 4I2WA 4IJDA 2AWIA 3SQVA 1TNYA 2FI7A 3KEZA 1UOHA 4KZCA 2WXQA 3E37A 1INZA 2VGYA 3E30A 1HO8A 4I1MA 3ZXPA 3ONKA 3FDHA 4M3OA 4EHMA 3FP3A 2R17C 1Y8MA 4UWHA 4CDRA 3RAUA 4HRNA 3R9AB 3CQCB 4WNGA 4AJWA 5CCMA 1MX6A 5IY5E 1ELKA 4HRMB 3HXEA 3TWXA 3P1UA 5F6LA 3TXMA 3U64A 3G2SA 3UTMA 3PUJA 5D0QD 3UT4A 5BNWA 3RAYA 3L16A 3X2QE 1BI7B 3C3OA 3G2TA 4JVSA 3LKUA 4HS2A 1DNPA 2EILE 1E7VA 5T5GA 1HFAA 2F8XK 5FQ7A 2BTDA 4LNUD 4GTRA 4RVBA 2FULA 2R3AA 3I4RB 1XQHA 2KCVA 2H6FA 2ZU6B 1TR4A 4Y6CA 1FPPA 3D9KA 4YDWA 4O1OA 1BLXB 2LXMA 4XIFA 4LERA 3CVPA 4HVBA 2OVFA 3E4BA 4AV7A 1EPUA 1XGWA 1TJFA 2IF4A 2OV8A 4FADA 1N4PA 2Q7FA 1OUVA 1K1AA 3L9TA 1JPLA 4I9EA 2LAIA 3RO2A 1LD7A 5A6CA 3NOGD 1SZAA 2XCCA 4EPZA 2YHEA 5LSZA 4ILIA 5CERB 5FT9A 2AVPA 3DPYA 1X5BA 3MCXA 3ZIMA 3CLJA 3D9IA 3FH7A 4QFVA 3NAWA 4I6JA 3C3RA 3WXXA 1S70B 3EHNA 3BEEA 2IEJA 5FQ4A 4J8YA 1LD8A 3ULYA 4G24A 2FO7A 1IQUA 3ZN3A 3TG5A 4G2VA 3NB2A 4DJAA 4I6EA 4BEPA 3UI2A 4N5CA 4UQYA 3EHQA 1MQSA 4U63A 3R7QA 5ENNA 4H7XA 5BV0A 1QYMA 2OEVA 3ML8A 3FTXA 5G04J 4DI4A 5F5EA 4GA2A 2WXMA 4N3AA 1OY3D 3UIPC 3PNLB 4GTSA 4YDEA 1DCQA 2PM6A 1H2UA 3LY7A 2XGOA 1N52A 5FZRA 4ATZD 1WAO1 4UQZA 3C5RA 5J90A 4RLYA 3FHEA 3D9JA 2FEZA 1XNFA 3PEVB 5HQ8A 1U3DA 1HG5A 5AJDA 5KJLA 1OT8A 4BTBA 1FVFA 3LJ3A 3ABME 4CRWA 2R05A 5KCMA 3ZW3A 5C1DA 3M56A 4GU5A 2V5QC 4IN3B 3KD7A 1YCSB 1NFIE 4AY5A 3IHVA 2HE0A 3CVQA 4B93B 2BQZA 1E8YA 3KSLA 1HG2A 2P9PG 3QC1A 4N5QA 4F53A 4I17A 2L6JA 4LDGA 4GZ3A 3FU5A 2ZXWE 3GZ1A 3MYVA 3RRNB 3EU5A 3VTXA 2P9IG 3HVEB 4U95D 4U96D 1OWLA 1OCRE 5LOZA 4MI5A 1HU3A 2WXJA 3CK8A 4NACA 3ISMC 5G05C 2YHCA 3FU0A 3IXEA 4IYPA 5G05J 3F9YA 3CVUA 3EHMA 1JCRA 4I1AA 3FUJA 4IULA 4GTTA 3MEKA 3AG2E 5KNHD 3ASHA 2VSOE 4OVUA 1TNOA 1O1SA 3W9FA 3RIBA 5JHBA 5KJMA 3ASFA 3PEUB 4BT9A 4F1PA 1P5QA 4DX5D 4BX8A 4EQFA 3CHQA 4HXIA 4U7EB 3CHMA 3DEOA 5ANLA 2UY1B 3QKYA 5T0MA 1RZ4A 4X8QA 4B8AA 5BPPA 2VGXA 4NIKA 2GRRB 3KS2A 1TNBA 4LEUA 4HLEA 1ZKKA 2YNQA 2J9QA 3DEPA 2C0MA 3ZU7B 1ZB1A 5FZQA 3S8PA 3QJZA 4J8SA 4YPEA 4ANXA 2NYJA 3I4GA 4O6FA 1E90A 5CRUA 2IY0C 2XGSA 5CEAA 5TTFA 2P9UG 1O9SA 4HOSA 4F1SA 3UKRG 3TWUA 1BD8A 2IO3C 4YDOA 4BWRA 2AXZA 3B95A 3DSUA 3W9GA 3K5KA 1YMPA 5ARGA 3L54A 1E8ZA 4FHJA 3TG4A 4Q96A 2QYUA 2KATA 4TXRA 3CVWA 1UN9A 3CKCA 3L82A 3Q79A 1DC2A 4YPAA 4U04A 3L6AA 2F37A 3LCAA 2F69A 2AXVA 1E8WA 3PVLA 4WNFA 1H2VC 2V8SE 5T4YA 1JWGA 4UQXA 3VLEA 3RKVA 3ASDA 2WPVA 3B13A 3KSQA 1WDYA 3PE3A 3LS8A 4A55A 5T0KA 1N11A 2JABA 4Y6WA 4UUCA 2KCKA 4HBDA 3MO2A 4B89A 2I9CA 3ZEFA 4DPRA 3Q75A 4JDSA 3CBPA 1U3CA 3UM3A 3OAWA 4ILHB 2X6FA 4JA9A 4XE0A 2FO1E 2QPWA 4J8DA 3F6QA 1H3IA 2R2LA 4TUUA 3EDTB 3QOUA 3FUHA 2P58C 4XI0A 3P2BA 4DI3A 3TJPA 3IKOB 2O8JA 4K5BA 3M59A 3FH5A 3SI5A 5BV1A 3U4TA 2VSNA 4FLBA 4JHRA 4RQIA 5EIDA 2AJAA 5JHAA 1E96B 1ELWA 3AG4E 2GRQB 3RSEG 1U2VG 2ILRA 3UXGA 1H6KA 2MHKA 4APOA 2V0PA 2DYRE 4A1SA 1TJCA 1PEGA 5KJNA 4FHKA 4JC8A 1KT1A 3MO5A 3ZYLA 2W5YA 3CIAA 4I6GA 4UI9K 1FCHA 4C1QA 4G8KA 3AU4A 3R7RA 2WXIA 4A1GA 3T5XA 4FA6A 3DALA 4EZKA 2DYSE 5CBOA 4JPSA 1OCCE 3SBSA 3G2VA 2V4LA 4DX1A 3MKRA 3ABKE 2XEEA 1H6PA 3NQPA 1NI1A 1MZCA 2BKKB 3PZ2A 3KMAA 3FTSA 1RW2A 4GTQA 2EINE 2WMOA 1FT2A 2X6IA 4GMRA 3MV2B 4E47A 1N6CA 3BUAA 2XEHA 3VTYA 4J8OA 3RQ4A 3MV3B 3DSTA 2CHXA 3DXKG 2ETCA 3GZ2A 4DLOA 5CPRB 2JV0A 3CSFA 5DIZA 4FC8A 4HNAD 2WMNA 2XCBA 4CDMA 3ASOE 4QENA 1DCEA 4ANWA 1A5EA 1SVXA 4M7CA 2R5SA 4GCOA 1N6AA 5EX3A 3U66A 2WXLA 1OCOE 2DZOA 2IOLA 2J08A 5CMYA 3HXFA 4MI0A 2PQNA 3AG3E 3RO3A 4CEMA 2VYIA 3CHOA 2WQHA 4PS7A 4AVXA 3SO8A 1SW6A 3DWLG 2Y1LE 3PREA 1QNFA 1N94A 5D0OD 3TWSA 2CFZA 4G26A 4GB9A 2LSUA 1WG0A 3RJWA 3HXBA 3UT7A 3DSVA 4EBAA 3AS4A 3SHFA 2PNNA 3FULA 4AXHA 3GZSA 5AENA 3V2OA 3TWQA 4BERA 1TN6A 1TNZA 3HXDA 2EIME 5FWQA 4JXTA 5ENQD 2VGXB 4H12A 3QDNA 4BY6A 3LXUX 2CHWA 4I1OB 4LRZA 4YNDA 3IHXA 3FPDA 1E8XA 1UW4B 4CCAA 2DWZA 4URKA 2XPIA 5G55A 2MOWA 5EYPF 4LSZE 1K3ZD 3HIZA 3CVVA 3M57A 1Q2ZA 4D10C 5JHNA 4GCNA 5CEDB 4A3TA 1O5MA 3ZXSA 4UWLA 3LVRE 3PZ3A 5LSXA 1OCZE 3DSXA 3SBTB 3ZHEA 2M63A 5ANRA 4ZHBA 1QZ2A 1MJ0A 4L23A 4JHKA 4CT4A 2W5ZA 4U0ZA 5JJ6A 2ZISA 2Y0BG 2J49A 5AQ9A 1E7UA 2KC7A 3DPDA 3U3WA 4HFGA 1TYQG 3FUIA 2Y4UA 3HNAA 1HH8A 1H2TC 2Y4TA 3J5PA 4N2QA 2I1KA 5EIBE 4GMLA 5FQ8A 1IXVA 3T8MA 4ILGA 5D66A 5G04C 4U07A 4FLHA 4KVMA 3LVQE 4I43A 3D9OA 3GW4A 4GZDA 4HI8A 3V31A 3ZUVB 4JLGA 2DVWA 2WXNA 5JINA 3DBSA 1HXIA 4NURA 3FU6A 2QY7A 2DIWA 3KAEA 2VTBB 1SA4A 1OWPA 1HZ4A 3FTYA 1N4SA 4DX7D 1KPSB 3B7RL 3OPEA 1Z3XA 1SZ9A 3HHMA 3CHSA 3SFZA 5BXUA 3EUVA 3KEAA 3EIJA 3EP0A 5HI7A 2YINA 5CHEE 4HOQA 4PS8A 4TXPA 4QQIA 4CDNA 4CT0A 3TL5A 1OWOA 3LEWA 3S7JA 3RU0A 4XI9A 4MLPA 4ABNA 4PUCA 3ONLA 4BTAA 2XZTG 4TV3A 3NOCD 3LYAA 4HORA 2MRIA 3I5PA 3UM1A 4K5AB 2A5UA 5EYLA 2DZNA 3F9WA 4N39A 2V4HC 4WNDA 3SFXA 1NA0A 2P9SG 1JUQA 2LAHA 4GTPA 1YA0A 4UWGA 4B8CB 5HKPA 2FBNA 3Q9NC 1TN8A 3RJVA 4AEZC 1GW6A 3MJWA 4XKBA 4GYYA 4BETA 4XEIG 4HOTA 4IJ8A 1Z5SC 1MX4A 1KLXA 1YYHA 3UM2A 2VSXE 3HG0D 3ZFWA 3M5AA 2ZGDA 2GRPB 3ZGQA 3CK7A 1IKND 1H6OA 5EX0A 5JA4D 5JMND 3TGOA 2GRNB 2LXLA 2P9KG 3CSTA 2J07A 3T9KA 1K1BA 3D9LA 1JCQA 3RK6A 3MO0A 2X6HA 4EZLA 3B7SA 4AM9A 3UIOC 3V30A 3L17A 5AYFA 5T3RA 4ANVA 2IGQA 4OYSA 4NRHB 3DRAA 3QWPA 4DK5A 4OVVA 3CVXA 3APCA 1DVPA 3BG1B 4UI9C 4UI9J 3O4ZA 3E34A 4GAAA 2KXPC 3VLDA 3BG0B 3CVNA 4U0SA 3SZ7A 2UWJG 2WB2A 3L08A 4K03A 2XGMA 4MRUA 4B94A 1EYHA 3C72A 2CFUA 2V5FA 2ZGGA 3Q4AB 4N3BA 5C2YA 2GROB 3ESLA 2VSYA 4RG9A 4PDXA 2OOEA 1KZOA 2WVIA 4FJYA 4HLLA 2IOSA 4NJ5A 1AWCB 4UWKA 4JD2G 4C9BB 1ELRA 2B6CA 4ACLA 2WXHA 1A17A 4GZCA 2IQCA 3HDXA 4K0RA 3CV0A 3B7TA 3FU3A 5LCWC 5LCWJ 4C48B 2RKKA 4J7FA 4I51A 1MVXA 3HXCA 3UMVA 4F3VA 4ANUA 3QWVA 4HOUA 2HR2A 5KWDA 2JLBA 1O1RA 3ZYMA 4YVOA 1HF8A 4Q69A 1Y6IA 2KZTA 3UINC 2HO1A 3OXGA 5KBAA 4EZJA 2XRZA 2A5EA 2GRLA 2XHEA 3DSWA 1S63A 5F6KC 4RSYA 2E0IA 1IQRA 3VLFA 2X3MA 3V2XA 3M55A 3BQOA 3JYSA 4W9RA 1UJJA 3FUNA 3NBNB 3FY4A 4BSZB 5LP0A 4L1BA 4A63B 3EIQC 1G3NB 3APFA 2Y69E 3JQ1A 2C2LA 2XENA 3N71A 3C3QA 4YPUA 3L22A 4YVQC 5D2MC 3CHRA 3SY2A 3QNKA 4P29A 3ASNE 2LSVA 3AG1E 3MX3A 1ML9A 2RFAA 1BPOA 3NZUA 3OOIA 1N3JA 3GYZA 2BF0X 3HVEA 2BEDA 3LPZA 4J8FA 3M58A 1QBQA 2RFMA 3CR3A 3O48A 5CCLA 2KCLA 2P2CP 3PE4A 3ESKA 2C0LA 3EU9A 4GYWA 3G2UA 2WXKA 5E75A 4O30A 2DCPA 3SD5A 3ZVVA 4NQ0A 4MKTA 4DUIA 2ETAA 4PH4B 2Y3AA 3TAXA 4GTVA 4YNMA 3Q15A 4O60A 2OCCE 3JQ0A 5ITZF 3B7BA 3FWVA 5CMWA 3CK9A 4LG6A 2EIKE 3R9MA 3J5QB 4Z68A 3RRUA 3ZYKA 3G2WA 1L5JA 3AS5A 1EF1C 5AJLA 3AS8A 4O1PA 5M72A 3PZ1A 5A7DB 4L9PA 5A23A 2X6JA 3SGHA 3D9MA 2WQ7A 3EHRA 5F59A 2QYJA 2AW6A 4JL0A 3IBEA 4AOFA 3EJNA 4HRLA 4CGWA 5TH7A 3QK0A 4AP2A 3KMJA 4WWPA 4G25A 1NL4A 1MT6A 2L9BA 4K5CA 1HX8A 4DLQA 2NXPA 3MA5A 1N54A 2WXOA 4N2SA 4KMOA 3MKQA 2J8SD 1N0QA 3M53A 3SFYA 4KXKB 3ZNGA 3FH8A 4GA0A 3BO5A 1HS6A 2X6KA 1WY6A 2E2EA 1OWMA 3RRMB 2DBAA 2WXGA 3ASGA 2P9NG 5AYWD 5KJKA 1S64A 2XS8A 2QC9A 4QEPA 3JXJA 4C0EA 2XPYA 2LO6A 5LFAA 3ZKJA 4U8YD 5EG2A 1IHBA 3APDA 1EDUA 5AIJA 3Q9UC 4GPMA 4JEHA 4MS6A 4J7WA 4FMUA 4WWNA 4F7AA 3AU5A 2KBXA 3OS5A 1N0RA 5AN8A 1LF8A 3VV0A 3DSSA 4L2LA 4EECA 2H6HA 2P9LG 4U8VD 4MBGA 1N95A 3K9IA 5ENSD 3DXMG 3I3NA 4WNEA 3D9PA 1UG3A 5EN5D 2H6IA 3CGHA 1NP7A 5EKQD 3AJIA 4L7TA 2F8YA 1D8DA 1WM5A 1BI8B 4GZ6A 3IEGA 2XEVA 2HYZA 2NC9A 5B1BE 5LX8A 3LJNA 3UM0A 2AXUA 2HM8A 2R59A 4LUNU 5EDSA 3JUIA 3NZSA 2J4DA 3M54A 2IJGX 1FVHA 4EBAG 5ENPD 1Z3YA 4I9CA 4Q94A 2LNIA 4HB5A 1HE8A 4FU3A 4U8HA 3TWWA 4JEUA 5JJ0A 1JWFA 5EILA 1PC2A 2PZIA 5FQ6A 1AP7A 1MVHA 1B89A 4DX2A 2XQ0A 2PQRA 4G8LA 3UX4A 4AIFA 2RD0A 3CVYA 2ONDA 3CEQA 3D9HA 2WXPA 2F0YA 4FJZA 3FTWA 4FULA 1V55E 5FZSA 2NSZA 4TRQA 4G1TA 3Q7AA 5JJTA 3E32A 2R03A 2XS1A 2H6GA 4TUMA 3KMTA 4J0UA 2CHZA 4JZYA 2I1JA 3PRZA 2KZTB 4N3CA 4DRXE 5TEGA 4G23A 3FUMA 4TXQA 4J8EA 3UKUG 4U0UA 5BUZA 3D9NA 4APFA 5FIOA 2BUGA 5ENRD 5BW8C 1NZNA 1OWNA 2RFIA 5FJYA 3PZDA 2IFUA 5AQ7A 3ULEG 5ENOD 2IO2C 2GGFA 2X38A 4CGVA 4L2YA 4AY6A 4NVQA 3S7DA 3E33A 5AARA 5BXOA 4HQDA 3Q49B 3PDNA 4IRUA 2PL2A 5DBKA 2XRYA 4FP7A 3ZPJA 1O1TA 5CECB 2WQ6A 3T8KA 1X81A 2B0OE 3D3MA 3L13A 4E6HA 1MUFA 4A3VA 3MZLB 4LNGA 5E76A 4HI9A 4OAVB 4JHJA 1V54E 4XKCA 3FTVA 5G2NA 3VUZA 2L6BA 3Q7FA 1KT0A 1MX2A 1N4QA 2A4ZA 3UT8A 2XZDG 3HRAA 3OTNA 1IYGA 4OAUC 2EIJE 5KNGA 1LTXA 2ETBA 4ME2A 2QZAA 4LNBA 5B3SE 4YNPA 2EQXA 1TEZA 2I6HA 2WXRA 3FUKA 4E85A 4CZ2D 3SWCA 3PUKA 3BU8A 3QAQA 4H7YA 4KVOA 3ULQA 4ACKA 2IU1A 4BSXA 1OXJA 5B1AE 2LUHA 4KZ0A 4J7IA 1NA3A 3CBOA 5AQAA 1BU9A 2OVBA 2QFCA 3FUFA 3Q5MA 4JW1A 5JIYA
chains in the Genus database with same CATH topology
4MI0A 2PQNA 3C98A 3PNLB 4GMJA 3OXLA 5T8IA 4YPUA 3L22A 4CEMA 3RO3A 3T5VA 4YVQC 2VYIA 3CHOA 3CHRA 2WQHA 3QNKA 4PS7A 4P29A 4AVXA 2LSVA 2PM6A 3MX3A 1ML9A 1MHQA 1H2UA 3LY7A 1BPOA 2XGOA 1N52A 3ENEA 3NZUA 3PREA 1WAO1 4UQZA 5FZRA 1N3JA 3OOIA 3GYZA 1QNFA 3SNXA 5J90A 2BF0X 5D0OD 3HVEA 2KM4A 3FHEA 3LPZA 4J8FA 3FUEA 3M58A 2CFZA 3D9JA 2FEZA 1XNFA 4G26A 4GB9A 3PEVB 5HQ8A 3CR3A 1IHGA 2LSUA 3O48A 4KBQA 5CCLA 3FEYA 1PY1A 2KCLA 1U3DA 1ZU2A 1HG5A 4RZ0A 3RJWA 3UT7A 5AJDA 5KJLA 3PE4A 2WXFA 3ESKA 4BTBA 2CG3A 1FVFA 3LJ3A 4EBAA 3AS4A 3CKBA 2C0LA 3MKQB 3SHFA 4CRWA 4XZ4A 1VDYA 5KCMA 3LDZA 3MGBA 3FULA 4AXHA 3LY9A 3ML9A 3GZSA 4GYWA 3G2UA 3ZW3A 5AENA 4GU5A 4IN3B 5C1DA 3M56A 3KD7A 2WXKA 5E75A 3FTZA 4O30A 2DCPA 3FTUA 4AY5A 3FFLA 3IHYA 3SD5A 5FWQA 3IHVA 4UWFA 3ZVVA 3CVQA 3S7FA 4JXTA 4PS3A 2BQZA 1E8YA 3PNTB 4NQ0A 1HG2A 3QB2A 3CHPA 4MKTA 3F9ZA 2VGXB 4H12A 4PH4B 2Y3AA 3QC1A 3B7UX 3QDNA 4BY6A 3LXUX 3TAXA 2CHWA 4I1OB 3URZA 4I17A 1W3BA 1H19A 2L6JA 4YNMA 3ZYQA 4AU7A 3Q15A 4LRZA 4LDGA 3JQ0A 4YNDA 3IHXA 4GZ3A 4GZ5A 3FPDA 1E8XA 3FU5A 3FWVA 1UW4B 4CCAA 4URKA 4C0MA 2XPIA 5CMWA 4J83A 3GZ1A 3MYVA 3HYMB 5G55A 3U9WA 2MOWA 3RRNB 3CK9A 3VTXA 3HIZA 2VQ2A 3CVVA 3DB5A 3HVEB 3M57A 3RRUA 3ZYKA 3G2WA 3CBMA 1L5JA 4G11A 1OWLA 3AS5A 1EF1C 2IONA 3AS8A 5AJLA 4BT8A 5LOZA 4GCNA 5ARFA 4D10C 4A3TA 1HU3A 4MI5A 4QEOA 2WXJA 5M72A 2YQ8A 3CK8A 3ZXSA 3CQGB 4UWLA 4NACA 4WWOA 3LVRE 5A7DB 5LSXA 2GW1A 3PH0C 5A23A 2X6JA 3S7BA 3SGHA 3SW9A 3D9MA 4J6IA 2WQ7A 5F59A 4XX5A 5G05C 1UJKA 2YHCA 2AW6A 3FU0A 4IYPA 5G05J 4GYOA 3SBTB 3F9YA 3ZHEA 3CVUA 4JL0A 3IBEA 3EHMA 2M63A 4ATGA 4AOFA 1ZBPA 3EJNA 4I1AA 5ANRA 1QZ2A 3NF1A 3Q47B 4WUYA 4CGWA 3FUJA 5JHNA 4L23A 4JHKA 5TH7A 4IULA 4CT4A 4RG6A 2W5ZA 3QK0A 4U0ZA 5JJ6A 4AP2A 3MEKA 3KMJA 4WWPA 4G25A 3ASHA 2J49A 5FTPA 1MT6A 2VSOE 4OVUA 1E7UA 2KC7A 2L9BA 1HX8A 3SF4A 3DPDA 2VTBA 2L0TB 3RIBA 4DLQA 5JHBA 2NXPA 3MA5A 3U3WA 4HFGA 5KJMA 3ASFA 1N54A 2WXOA 3FUIA 4KT6B 2Y4UA 4GA1A 4N2SA 3PEUB 4BT9A 4KMOA 3MKQA 3HNAA 1HH8A 1P5QA 3FUDA 4BX8A 1H2TC 2Y4TA 5BT1A 5J08A 4N2QA 3M53A 4EQFA 2I1KA 3CHQA 4HXIA 4GMLA 1Z6TA 4KXKB 4KYOB 3FH8A 5FQ8A 3CHMA 3T8MA 4GA0A 3TXNA 4ILGA 3BO5A 2I2OA 5ANLA 5G04C 1HS6A 4U07A 2UY1B 3QKYA 4FLHA 5T0MA 4KVMA 2X6KA 1WY6A 3LVQE 4B8AA 2E2EA 5BPPA 4I43A 2VGXA 4LCTA 1SQMA 1OWMA 3RRMB 3UQ3A 2DBAA 2WXGA 3ASGA 5AYWD 2JEKA 3D9OA 5KJKA 3GW4A 4GZDA 3KS2A 4HLEA 4LEUA 4V3IA 3ZRHA 3JCKC 2YNQA 1ZKKA 2J4BA 3QARA 4JLGA 4QEPA 2J9QA 3ZHEB 4B0ZA 2XPYA 4C0EA 2C0MA 2WXNA 4WAFA 5FZQA 2LO6A 5JINA 2VJ8A 3DBSA 3LY8A 1HXIA 3S8PA 2L0IA 3QJZA 3FU6A 4J8SA 4NURA 5LFAA 2CG2A 2QY7A 4R7LA 4YPEA 4I2ZA 4ANXA 2G46A 1S0PA 5EG2A 4JA7A 2RG8A 3I4GA 3APDA 2FF4A 2DIWA 3F9XA 4O6FA 1EDUA 3KAEA 5AIJA 3S2AA 1E90A 1H0AA 4JEHA 4MS6A 2VTBB 4FMUA 4WWNA 4F7AA 3AU5A 2GRMA 3OS5A 2XGSA 5TTFA 4BX9A 1OWPA 2WM9A 1HZ4A 3FTYA 3B7RL 3OXFA 1LF8A 4HOSA 1O9SA 5JJ7A 3VV0A 3PS6A 3OPEA 4Z4PA 4F1SA 1Z3XA 4L2LA 1SZ9A 3HHMA 4EECA 3CHSA 3SFZA 3FEXA 3EIJA 4BWRA 3EP0A 2AXZA 5HI7A 2YINA 5CHEE 4HOQA 4PS8A 3K9IA 3K5KA 3I3NA 4WNEA 5ARGA 4CDNA 3D9PA 3L54A 4CT0A 1UG3A 1E8ZA 4FHJA 4F53A 3TG4A 2J09A 4Q96A 3TL5A 1OWOA 4BUPA 1QQEA 2KATA 2PM7A 2XPZA 3CGHA 3LEWA 3S7JA 1NP7A 5EKQD 4BFRA 3CVWA 4GPKA 3RU0A 4XI9A 4MLPA 4ABNA 3QWWA 4L7TA 4PUCA 3ONLA 4BTAA 1UN9A 3CKCA 4TV3A 1WM5A 4GZ6A 1PAQA 3LYAA 1UN8A 3IV0A 4HORA 4YPAA 2UY1A 2MRIA 3CVLA 3IEGA 3I5PA 4U04A 3L6AA 3LCAA 2XEVA 2F69A 2AXVA 1E8WA 3PVLA 2A5UA 2HYZA 3UUXA 4I2WA 4WNFA 4N39A 3F9WA 1H2VC 2NC9A 5LX8A 4WNDA 2V8SE 4IJDA 5T4YA 1NA0A 2AXUA 2HM8A 1JWGA 2AWIA 4UQXA 2R59A 3VLEA 4LUNU 2FI7A 1JUQA 2LAHA 3KEZA 3RKVA 4KZCA 2WXQA 3ASDA 5EDSA 1YA0A 3JUIA 1INZA 2VGYA 2WPVA 3B13A 4UWGA 4B8CB 3NZSA 2J4DA 1HO8A 4I1MA 2FBNA 3M54A 3ONKA 3RJVA 4AEZC 1GW6A 3FDHA 3MJWA 2IJGX 4XKBA 1FVHA 4GYYA 4M3OA 4EBAG 1Z3YA 3PE3A 4I9CA 4HOTA 4IJ8A 3FP3A 2R17C 3LS8A 2LNIA 4Q94A 4A55A 1Y8MA 1HE8A 4FU3A 5T0KA 4UWHA 4U8HA 4CDRA 1KLXA 4JEUA 4Y6WA 5JJ0A 1JWFA 2VSXE 1PC2A 3R9AB 2KCKA 3CQCB 4JW1A 4WNGA 4AJWA 2PZIA 5CCMA 3MO2A 1ELKA 3ZFWA 5FQ6A 4B89A 1MVHA 1B89A 3M5AA 2I9CA 3ZEFA 2XQ0A 4DPRA 2PQRA 4JDSA 3P1UA 1U3CA 3UX4A 3CBPA 3OAWA 4ILHB 3ZGQA 4AIFA 2RD0A 4N3AA 2X6FA 3CK7A 3CVYA 2ONDA 3CEQA 5F6LA 3TXMA 3U64A 2WXPA 4JA9A 5EX0A 3G2SA 4XE0A 4FJZA 3FTWA 4FULA 2QPWA 3PUJA 3CSTA 4J8DA 3TGOA 5FZSA 2J07A 5D0QD 3UT4A 1H3IA 4TUUA 2NSZA 3D9LA 4TRQA 4G1TA 5BNWA 3RAYA 3L16A 3RK6A 5JJTA 3EDTB 3MO0A 3QOUA 3FUHA 2X6HA 3G2TA 2P58C 4JVSA 3LKUA 3P2BA 4XI0A 3KMTA 4EZLA 3B7SA 4HS2A 3TJPA 4AM9A 1DNPA 4DI3A 4J0UA 2CHZA 1E7VA 3L17A 1HFAA 4JZYA 3IKOB 2I1JA 5T5GA 3PRZA 5AYFA 5T3RA 2O8JA 2KZTB 4N3CA 4ANVA 2IGQA 4OYSA 3M59A 4G23A 3FH5A 2BTDA 3FUMA 5FQ7A 3N71A 3SI5A 5TEGA 4NRHB 5BV1A 4RVBA 2FULA 4J8EA 3QWPA 3U4TA 4DK5A 2VSNA 4OVVA 4U0UA 3CVXA 3APCA 5BUZA 3D9NA 1DVPA 2R3AA 3I4RB 4FLBA 4JHRA 3BG1B 4UI9C 4APFA 1XQHA 2BUGA 2KCVA 3O4ZA 4UI9J 5BW8C 1NZNA 1OWNA 2ZU6B 5FJYA 5JHAA 1E96B 2RFIA 1ELWA 4GAAA 3BG0B 3CVNA 4U0SA 3SZ7A 3VLDA 4Y6CA 3D9KA 2UWJG 2WB2A 3PZDA 2IFUA 3L08A 2ILRA 1H6KA 2MHKA 4K03A 2XGMA 4APOA 2V0PA 4XIFA 4A1SA 1TJCA 1PEGA 4MRUA 4LERA 3CVPA 4FHKA 4B94A 5KJNA 4JC8A 1EYHA 1KT1A 4HVBA 2OVFA 2CFUA 2GGFA 3E4BA 4AV7A 2X38A 3MO5A 3ZYLA 2W5YA 1EPUA 3CIAA 2V5FA 4I6GA 4UI9K 4L2YA 4CGVA 4AY6A 1FCHA 1TJFA 1XGWA 2IF4A 3S7DA 3Q4AB 4N3BA 4NVQA 4C1QA 3AU4A 2OV8A 4FADA 5C2YA 3ESLA 2Q7FA 3Q49B 3PDNA 4IRUA 3R7RA 2WXIA 2PL2A 2VSYA 5DBKA 4A1GA 3T5XA 1OUVA 4FA6A 2XRYA 3DALA 1JPLA 4I9EA 4EZKA 4FP7A 3ZPJA 2LAIA 4RG9A 4PDXA 4JPSA 3RO2A 2OOEA 2WVIA 4FJYA 3G2VA 3SBSA 5A6CA 2WQ6A 2IOSA 4NJ5A 1SZAA 2V4LA 3D3MA 4UWKA 3MKRA 3L13A 4C9BB 1ELRA 4ACLA 4E6HA 2XCCA 1A17A 2WXHA 1MUFA 4A3VA 3MZLB 2IQCA 3HDXA 4GZCA 4K0RA 5E76A 3CV0A 3B7TA 3FU3A 4EPZA 2YHEA 5LCWC 5LSZA 4JHJA 5LCWJ 3NQPA 4ILIA 4XKCA 4J7FA 4I51A 5FT9A 1MVXA 3FTVA 5G2NA 2AVPA 3VUZA 3UMVA 4F3VA 4ANUA 3KMAA 3QWVA 4HOUA 1X5BA 2HR2A 3FTSA 2JLBA 3MCXA 3ZYMA 2WMOA 1HF8A 4YVOA 3ZIMA 4Q69A 1KT0A 2X6IA 1Y6IA 2KZTA 3CLJA 3MV2B 4E47A 3D9IA 1N6CA 3FH7A 2A4ZA 4QFVA 2HO1A 4I6JA 3UT8A 3WXXA 3OTNA 1IYGA 3EHNA 3VTYA 4J8OA 3BEEA 3MV3B 3UPVA 3RQ4A 3OXGA 2CHXA 4EZJA 5FQ4A 3GZ2A 2XRZA 4DLOA 2GRLA 4ME2A 2XHEA 5CPRB 4G24A 2FO7A 1IQUA 2JV0A 5F6KC 3CSFA 2E0IA 4RSYA 1IQRA 5DIZA 3ZN3A 3TG5A 4FC8A 3VLFA 2X3MA 4G2VA 4YNPA 2EQXA 2WMNA 3M55A 2XCBA 4DJAA 3JYSA 4I6EA 1TEZA 4W9RA 2I6HA 2WXRA 3FUKA 4CDMA 4E85A 4QENA 1UJJA 4N5CA 3FUNA 4UQYA 4ANWA 3FY4A 3SWCA 3PUKA 1MQSA 3QAQA 4H7YA 4KVOA 4L1BA 2R5SA 4GCOA 3EIQC 5LP0A 3ULQA 1N6AA 4U63A 4ACKA 2IU1A 4BSXA 3R7QA 5ENNA 4H7XA 4KZ0A 4J7IA 5BV0A 1NA3A 3CBOA 3APFA 3JQ1A 2C2LA 5EX3A 3U66A 3ML8A 2OVBA 3FTXA 5G04J 4DI4A 2WXLA 5F5EA 4GA2A 2IOLA 2QFCA 2WXMA 3FUFA 3Q5MA 2J08A 5JIYA 5CMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MI0 A;  2PQN A;  3OXL A;  4YPU A;  3RO3 A;  4YVQ C;  2VYI A;  2WQH A;  2LSV A;  1ML9 A;  3LY7 A;  2XGO A;  5FZR A;  3OOI A;  1WAO 1;  4UQZ A;  1N3J A;  3GYZ A;  5D0O D;  3LPZ A;  4J8F A;  3M58 A;  2FEZ A;  1XNF A;  4G26 A;  5HQ8 A;  1IHG A;  2LSU A;  3O48 A;  4KBQ A;  5CCL A;  2KCL A;  1ZU2 A;  4RZ0 A;  3RJW A;  5KJL A;  3PE4 A;  3ESK A;  4BTB A;  3AS4 A;  3CKB A;  2C0L A;  3LY9 A;  4GYW A;  5C1D A;  3M56 A;  4IN3 B;  3KD7 A;  4O30 A;  4AY5 A;  3FFL A;  3CVQ A;  3S7F A;  2BQZ A;  4NQ0 A;  3F9Z A;  2VGX B;  4H12 A;  3QDN A;  3TAX A;  3URZ A;  4I17 A;  1W3B A;  2L6J A;  4YNM A;  4AU7 A;  3Q15 A;  4LDG A;  4YND A;  3IHX A;  4GZ3 A;  4GZ5 A;  3FPD A;  3FWV A;  2XPI A;  4J83 A;  3GZ1 A;  3HYM B;  3CK9 A;  3VTX A;  2VQ2 A;  3DB5 A;  3M57 A;  3CBM A;  3AS5 A;  3UPV A;  3AS8 A;  4BT8 A;  5JHN A;  4GCN A;  5ARF A;  4MI5 A;  4QEO A;  5M72 A;  2YQ8 A;  3CK8 A;  5A7D B;  5LSX A;  2GW1 A;  3S7B A;  3SW9 A;  5F59 A;  5G05 C;  2YHC A;  5G05 J;  4GYO A;  3F9Y A;  3ZHE A;  4JL0 A;  1ZBP A;  4I1A A;  1QZ2 A;  3NF1 A;  3Q47 B;  4WUY A;  4CGW A;  5TH7 A;  2W5Z A;  4RG6 A;  4U0Z A;  5JJ6 A;  3KMJ A;  3MEK A;  4G25 A;  3ASH A;  5FTP A;  1MT6 A;  2KC7 A;  3SF4 A;  3RIB A;  3MA5 A;  3U3W A;  5KJM A;  3ASF A;  2Y4U A;  4GA1 A;  4N2S A;  4BT9 A;  3HNA A;  1HH8 A;  1P5Q A;  2Y4T A;  5BT1 A;  3M53 A;  4N2Q A;  4EQF A;  4KYO B;  4KXK B;  4GA0 A;  3BO5 A;  5G04 C;  4U07 A;  2UY1 B;  3QKY A;  5T0M A;  2E2E A;  2VGX A;  3UQ3 A;  2DBA A;  3ASG A;  5AYW D;  5KJK A;  3GW4 A;  3KS2 A;  4LEU A;  1ZKK A;  4JLG A;  4QEP A;  2J9Q A;  3ZHE B;  2C0M A;  5FZQ A;  5JIN A;  3LY8 A;  1HXI A;  3S8P A;  4YPE A;  4I2Z A;  2G46 A;  5EG2 A;  4JA7 A;  2FF4 A;  3F9X A;  4O6F A;  3KAE A;  4FMU A;  3OS5 A;  2XGS A;  5TTF A;  1HZ4 A;  3OXF A;  1O9S A;  4HOS A;  5JJ7 A;  3VV0 A;  3OPE A;  4Z4P A;  4BWR A;  3EP0 A;  5HI7 A;  5CHE E;  4HOQ A;  3K5K A;  3K9I A;  4WNE A;  5ARG A;  3TG4 A;  4BUP A;  1QQE A;  2KAT A;  3S7J A;  5EKQ D;  4GPK A;  3RU0 A;  4XI9 A;  4ABN A;  3QWW A;  4BTA A;  3CKC A;  1WM5 A;  4GZ6 A;  3LYA A;  4HOR A;  4YPA A;  2UY1 A;  3IEG A;  3CVL A;  4U04 A;  3LCA A;  2XEV A;  2F69 A;  2HYZ A;  3UUX A;  4I2W A;  4WNF A;  4N39 A;  3F9W A;  2NC9 A;  4WND A;  4IJD A;  1NA0 A;  4UQX A;  2FI7 A;  3RKV A;  3ASD A;  1YA0 A;  2VGY A;  2WPV A;  2FBN A;  3M54 A;  3RJV A;  4GYY A;  3PE3 A;  4I9C A;  4HOT A;  4IJ8 A;  3FP3 A;  2LNI A;  1Y8M A;  5T0K A;  4CDR A;  1KLX A;  4Y6W A;  5JJ0 A;  1PC2 A;  3R9A B;  2KCK A;  4WNG A;  2PZI A;  5CCM A;  3MO2 A;  3ZFW A;  1MVH A;  1B89 A;  3M5A A;  2PQR A;  4JDS A;  3CBP A;  3ZGQ A;  4AIF A;  3CK7 A;  2OND A;  3CEQ A;  5F6L A;  4JA9 A;  5EX0 A;  2QPW A;  4J8D A;  3TGO A;  5FZS A;  5D0Q D;  1H3I A;  5BNW A;  4G1T A;  3RAY A;  5JJT A;  3EDT B;  3MO0 A;  3QOU A;  2P58 C;  4XI0 A;  3LKU A;  3KMT A;  4AM9 A;  4J0U A;  5T5G A;  5AYF A;  2O8J A;  4N3C A;  2IGQ A;  3M59 A;  5TEG A;  4G23 A;  4NRH B;  4J8E A;  3QWP A;  3U4T A;  2VSN A;  4U0U A;  2R3A A;  4JHR A;  4UI9 C;  1XQH A;  2BUG A;  2KCV A;  4UI9 J;  5BW8 C;  1NZN A;  2RFI A;  5FJY A;  1E96 B;  1ELW A;  3SZ7 A;  3CVN A;  4U0S A;  4Y6C A;  2UWJ G;  2IFU A;  2MHK A;  2XGM A;  4APO A;  4XIF A;  4A1S A;  1TJC A;  1PEG A;  4B94 A;  3CVP A;  5KJN A;  1KT1 A;  3E4B A;  3MO5 A;  2W5Y A;  2V5F A;  4CGV A;  4UI9 K;  4AY6 A;  1FCH A;  4NVQ A;  3S7D A;  2IF4 A;  3Q4A B;  4N3B A;  4C1Q A;  2Q7F A;  3Q49 B;  3PDN A;  2PL2 A;  2VSY A;  5DBK A;  1OUV A;  3DAL A;  4I9E A;  3ZPJ A;  4RG9 A;  3RO2 A;  2OOE A;  5A6C A;  4NJ5 A;  3MKR A;  1ELR A;  2XCC A;  1A17 A;  1MUF A;  3CV0 A;  5LCW C;  5LSZ A;  5LCW J;  4J7F A;  4I51 A;  5FT9 A;  1MVX A;  2AVP A;  3VUZ A;  3KMA A;  4F3V A;  3QWV A;  4HOU A;  2HR2 A;  2JLB A;  4YVO A;  1KT0 A;  3MV2 B;  4E47 A;  1N6C A;  2HO1 A;  3WXX A;  1IYG A;  3VTY A;  4J8O A;  3BEE A;  3MV3 B;  3RQ4 A;  3OXG A;  3GZ2 A;  4ME2 A;  5CPR B;  4G24 A;  2FO7 A;  2JV0 A;  5F6K C;  5DIZ A;  3ZN3 A;  3TG5 A;  4G2V A;  4YNP A;  3M55 A;  2XCB A;  3JYS A;  4W9R A;  2I6H A;  4QEN A;  4N5C A;  4UQY A;  3SWC A;  4H7Y A;  2R5S A;  4GCO A;  3ULQ A;  1N6A A;  4H7X A;  4J7I A;  1NA3 A;  3CBO A;  2C2L A;  5EX3 A;  5G04 J;  5F5E A;  4GA2 A;  2QFC A;  3Q5M A;  4N3A A;  3N71 A;  5JIY A; 
#chains in the Genus database with same CATH topology
 5ENT D;  3C98 A;  4GMJ A;  3OXL A;  5T8I A;  3ABL E;  3T5V A;  3WG7 E;  2BKG A;  1MHQ A;  3ENE A;  3SNX A;  5HS0 A;  2KM4 A;  3FUE A;  1IHG A;  4KBQ A;  3FEY A;  1PY1 A;  4JB8 P;  1ZU2 A;  4RZ0 A;  2WXF A;  2CG3 A;  3MKQ B;  3CKB A;  4XZ4 A;  1VDY A;  3LDZ A;  3MGB A;  3LY9 A;  3ML9 A;  3FTZ A;  3TWV A;  4CYM D;  3FTU A;  3FFL A;  3IHY A;  5FIN A;  4UWF A;  4GTO A;  3S7F A;  4PS3 A;  3PNT B;  3QB2 A;  3CHP A;  3F9Z A;  4ZFH A;  3B7U X;  3URZ A;  1MYO A;  1W3B A;  1H19 A;  4AU7 A;  3ZYQ A;  4GZ5 A;  1TN7 A;  3TWT A;  4C0M A;  4J83 A;  3U9W A;  3HYM B;  5AAO A;  3JUE A;  5HRY A;  2VQ2 A;  3DB5 A;  1K8K G;  3CBM A;  4G11 A;  3UPV A;  2ION A;  4BT8 A;  5ARF A;  4QEO A;  2YQ8 A;  5CBN A;  3CQG B;  4WWO A;  2OEW A;  2GW1 A;  3PH0 C;  3S7B A;  3SW9 A;  1D8E A;  4J6I A;  4XX5 A;  1UJK A;  2VGE A;  4GYO A;  1JCS A;  4ATG A;  1ZBP A;  1TNU A;  3NF1 A;  3Q47 B;  4WUY A;  3AAA C;  4RG6 A;  5FTP A;  3SF4 A;  2VTB A;  2L0T B;  1FT1 A;  4KT6 B;  4GA1 A;  3FUD A;  5J08 A;  5BT1 A;  1N4R A;  4KYO B;  1Z6T A;  3TXN A;  2I2O A;  4LCT A;  1SQM A;  3UQ3 A;  3Q73 A;  2JEK A;  3ZRH A;  4V3I A;  3JCK C;  2J4B A;  3QAR A;  3ZHE B;  4B0Z A;  4WAF A;  3PZ4 A;  3TWR A;  2VJ8 A;  3LY8 A;  1N9A A;  2L0I A;  2CG2 A;  1SA5 A;  4R7L A;  4I2Z A;  2G46 A;  1S0P A;  4JA7 A;  2RG8 A;  2FF4 A;  3F9X A;  3S2A A;  4DX6 D;  1H0A A;  5H7P A;  2R02 A;  4GTM A;  2GRM A;  4BX9 A;  2WM9 A;  3JXI A;  3OXF A;  5JJ7 A;  3PS6 A;  4Z4P A;  2MYO A;  3FEX A;  1KZP A;  5AQB A;  3V79 K;  2J09 A;  4BUP A;  1QQE A;  2PM7 A;  2XPZ A;  2ZIR A;  4BFR A;  4BES A;  4GPK A;  3QWW A;  4F6R D;  1PAQ A;  1UN8 A;  3IV0 A;  2UY1 A;  4YDY A;  3CVL A;  5CRV A;  1D9S A;  3Q78 A;  3UUX A;  4I2W A;  4IJD A;  2AWI A;  3SQV A;  1TNY A;  2FI7 A;  3KEZ A;  1UOH A;  4KZC A;  2WXQ A;  3E37 A;  1INZ A;  2VGY A;  3E30 A;  1HO8 A;  4I1M A;  3ZXP A;  3ONK A;  3FDH A;  4M3O A;  4EHM A;  3FP3 A;  2R17 C;  1Y8M A;  4UWH A;  4CDR A;  3RAU A;  4HRN A;  3R9A B;  3CQC B;  4WNG A;  4AJW A;  5CCM A;  1MX6 A;  5IY5 E;  1ELK A;  4HRM B;  3HXE A;  3TWX A;  3P1U A;  5F6L A;  3TXM A;  3U64 A;  3G2S A;  3UTM A;  3PUJ A;  5D0Q D;  3UT4 A;  5BNW A;  3RAY A;  3L16 A;  3X2Q E;  1BI7 B;  3C3O A;  3G2T A;  4JVS A;  3LKU A;  4HS2 A;  1DNP A;  2EIL E;  1E7V A;  5T5G A;  1HFA A;  2F8X K;  5FQ7 A;  2BTD A;  4LNU D;  4GTR A;  4RVB A;  2FUL A;  2R3A A;  3I4R B;  1XQH A;  2KCV A;  2H6F A;  2ZU6 B;  1TR4 A;  4Y6C A;  1FPP A;  3D9K A;  4YDW A;  4O1O A;  1BLX B;  2LXM A;  4XIF A;  4LER A;  3CVP A;  4HVB A;  2OVF A;  3E4B A;  4AV7 A;  1EPU A;  1XGW A;  1TJF A;  2IF4 A;  2OV8 A;  4FAD A;  1N4P A;  2Q7F A;  1OUV A;  1K1A A;  3L9T A;  1JPL A;  4I9E A;  2LAI A;  3RO2 A;  1LD7 A;  5A6C A;  3NOG D;  1SZA A;  2XCC A;  4EPZ A;  2YHE A;  5LSZ A;  4ILI A;  5CER B;  5FT9 A;  2AVP A;  3DPY A;  1X5B A;  3MCX A;  3ZIM A;  3CLJ A;  3D9I A;  3FH7 A;  4QFV A;  3NAW A;  4I6J A;  3C3R A;  3WXX A;  1S70 B;  3EHN A;  3BEE A;  2IEJ A;  5FQ4 A;  4J8Y A;  1LD8 A;  3ULY A;  4G24 A;  2FO7 A;  1IQU A;  3ZN3 A;  3TG5 A;  4G2V A;  3NB2 A;  4DJA A;  4I6E A;  4BEP A;  3UI2 A;  4N5C A;  4UQY A;  3EHQ A;  1MQS A;  4U63 A;  3R7Q A;  5ENN A;  4H7X A;  5BV0 A;  1QYM A;  2OEV A;  3ML8 A;  3FTX A;  5G04 J;  4DI4 A;  5F5E A;  4GA2 A;  2WXM A;  4N3A A;  1OY3 D;  3UIP C;  3PNL B;  4GTS A;  4YDE A;  1DCQ A;  2PM6 A;  1H2U A;  3LY7 A;  2XGO A;  1N52 A;  5FZR A;  4ATZ D;  1WAO 1;  4UQZ A;  3C5R A;  5J90 A;  4RLY A;  3FHE A;  3D9J A;  2FEZ A;  1XNF A;  3PEV B;  5HQ8 A;  1U3D A;  1HG5 A;  5AJD A;  5KJL A;  1OT8 A;  4BTB A;  1FVF A;  3LJ3 A;  3ABM E;  4CRW A;  2R05 A;  5KCM A;  3ZW3 A;  5C1D A;  3M56 A;  4GU5 A;  2V5Q C;  4IN3 B;  3KD7 A;  1YCS B;  1NFI E;  4AY5 A;  3IHV A;  2HE0 A;  3CVQ A;  4B93 B;  2BQZ A;  1E8Y A;  3KSL A;  1HG2 A;  2P9P G;  3QC1 A;  4N5Q A;  4F53 A;  4I17 A;  2L6J A;  4LDG A;  4GZ3 A;  3FU5 A;  2ZXW E;  3GZ1 A;  3MYV A;  3RRN B;  3EU5 A;  3VTX A;  2P9I G;  3HVE B;  4U95 D;  4U96 D;  1OWL A;  1OCR E;  5LOZ A;  4MI5 A;  1HU3 A;  2WXJ A;  3CK8 A;  4NAC A;  3ISM C;  5G05 C;  2YHC A;  3FU0 A;  3IXE A;  4IYP A;  5G05 J;  3F9Y A;  3CVU A;  3EHM A;  1JCR A;  4I1A A;  3FUJ A;  4IUL A;  4GTT A;  3MEK A;  3AG2 E;  5KNH D;  3ASH A;  2VSO E;  4OVU A;  1TNO A;  1O1S A;  3W9F A;  3RIB A;  5JHB A;  5KJM A;  3ASF A;  3PEU B;  4BT9 A;  4F1P A;  1P5Q A;  4DX5 D;  4BX8 A;  4EQF A;  3CHQ A;  4HXI A;  4U7E B;  3CHM A;  3DEO A;  5ANL A;  2UY1 B;  3QKY A;  5T0M A;  1RZ4 A;  4X8Q A;  4B8A A;  5BPP A;  2VGX A;  4NIK A;  2GRR B;  3KS2 A;  1TNB A;  4LEU A;  4HLE A;  1ZKK A;  2YNQ A;  2J9Q A;  3DEP A;  2C0M A;  3ZU7 B;  1ZB1 A;  5FZQ A;  3S8P A;  3QJZ A;  4J8S A;  4YPE A;  4ANX A;  2NYJ A;  3I4G A;  4O6F A;  1E90 A;  5CRU A;  2IY0 C;  2XGS A;  5CEA A;  5TTF A;  2P9U G;  1O9S A;  4HOS A;  4F1S A;  3UKR G;  3TWU A;  1BD8 A;  2IO3 C;  4YDO A;  4BWR A;  2AXZ A;  3B95 A;  3DSU A;  3W9G A;  3K5K A;  1YMP A;  5ARG A;  3L54 A;  1E8Z A;  4FHJ A;  3TG4 A;  4Q96 A;  2QYU A;  2KAT A;  4TXR A;  3CVW A;  1UN9 A;  3CKC A;  3L82 A;  3Q79 A;  1DC2 A;  4YPA A;  4U04 A;  3L6A A;  2F37 A;  3LCA A;  2F69 A;  2AXV A;  1E8W A;  3PVL A;  4WNF A;  1H2V C;  2V8S E;  5T4Y A;  1JWG A;  4UQX A;  3VLE A;  3RKV A;  3ASD A;  2WPV A;  3B13 A;  3KSQ A;  1WDY A;  3PE3 A;  3LS8 A;  4A55 A;  5T0K A;  1N11 A;  2JAB A;  4Y6W A;  4UUC A;  2KCK A;  4HBD A;  3MO2 A;  4B89 A;  2I9C A;  3ZEF A;  4DPR A;  3Q75 A;  4JDS A;  3CBP A;  1U3C A;  3UM3 A;  3OAW A;  4ILH B;  2X6F A;  4JA9 A;  4XE0 A;  2FO1 E;  2QPW A;  4J8D A;  3F6Q A;  1H3I A;  2R2L A;  4TUU A;  3EDT B;  3QOU A;  3FUH A;  2P58 C;  4XI0 A;  3P2B A;  4DI3 A;  3TJP A;  3IKO B;  2O8J A;  4K5B A;  3M59 A;  3FH5 A;  3SI5 A;  5BV1 A;  3U4T A;  2VSN A;  4FLB A;  4JHR A;  4RQI A;  5EID A;  2AJA A;  5JHA A;  1E96 B;  1ELW A;  3AG4 E;  2GRQ B;  3RSE G;  1U2V G;  2ILR A;  3UXG A;  1H6K A;  2MHK A;  4APO A;  2V0P A;  2DYR E;  4A1S A;  1TJC A;  1PEG A;  5KJN A;  4FHK A;  4JC8 A;  1KT1 A;  3MO5 A;  3ZYL A;  2W5Y A;  3CIA A;  4I6G A;  4UI9 K;  1FCH A;  4C1Q A;  4G8K A;  3AU4 A;  3R7R A;  2WXI A;  4A1G A;  3T5X A;  4FA6 A;  3DAL A;  4EZK A;  2DYS E;  5CBO A;  4JPS A;  1OCC E;  3SBS A;  3G2V A;  2V4L A;  4DX1 A;  3MKR A;  3ABK E;  2XEE A;  1H6P A;  3NQP A;  1NI1 A;  1MZC A;  2BKK B;  3PZ2 A;  3KMA A;  3FTS A;  1RW2 A;  4GTQ A;  2EIN E;  2WMO A;  1FT2 A;  2X6I A;  4GMR A;  3MV2 B;  4E47 A;  1N6C A;  3BUA A;  2XEH A;  3VTY A;  4J8O A;  3RQ4 A;  3MV3 B;  3DST A;  2CHX A;  3DXK G;  2ETC A;  3GZ2 A;  4DLO A;  5CPR B;  2JV0 A;  3CSF A;  5DIZ A;  4FC8 A;  4HNA D;  2WMN A;  2XCB A;  4CDM A;  3ASO E;  4QEN A;  1DCE A;  4ANW A;  1A5E A;  1SVX A;  4M7C A;  2R5S A;  4GCO A;  1N6A A;  5EX3 A;  3U66 A;  2WXL A;  1OCO E;  2DZO A;  2IOL A;  2J08 A;  5CMY A;  3HXF A;  4MI0 A;  2PQN A;  3AG3 E;  3RO3 A;  4CEM A;  2VYI A;  3CHO A;  2WQH A;  4PS7 A;  4AVX A;  3SO8 A;  1SW6 A;  3DWL G;  2Y1L E;  3PRE A;  1QNF A;  1N94 A;  5D0O D;  3TWS A;  2CFZ A;  4G26 A;  4GB9 A;  2LSU A;  1WG0 A;  3RJW A;  3HXB A;  3UT7 A;  3DSV A;  4EBA A;  3AS4 A;  3SHF A;  2PNN A;  3FUL A;  4AXH A;  3GZS A;  5AEN A;  3V2O A;  3TWQ A;  4BER A;  1TN6 A;  1TNZ A;  3HXD A;  2EIM E;  5FWQ A;  4JXT A;  5ENQ D;  2VGX B;  4H12 A;  3QDN A;  4BY6 A;  3LXU X;  2CHW A;  4I1O B;  4LRZ A;  4YND A;  3IHX A;  3FPD A;  1E8X A;  1UW4 B;  4CCA A;  2DWZ A;  4URK A;  2XPI A;  5G55 A;  2MOW A;  5EYP F;  4LSZ E;  1K3Z D;  3HIZ A;  3CVV A;  3M57 A;  1Q2Z A;  4D10 C;  5JHN A;  4GCN A;  5CED B;  4A3T A;  1O5M A;  3ZXS A;  4UWL A;  3LVR E;  3PZ3 A;  5LSX A;  1OCZ E;  3DSX A;  3SBT B;  3ZHE A;  2M63 A;  5ANR A;  4ZHB A;  1QZ2 A;  1MJ0 A;  4L23 A;  4JHK A;  4CT4 A;  2W5Z A;  4U0Z A;  5JJ6 A;  2ZIS A;  2Y0B G;  2J49 A;  5AQ9 A;  1E7U A;  2KC7 A;  3DPD A;  3U3W A;  4HFG A;  1TYQ G;  3FUI A;  2Y4U A;  3HNA A;  1HH8 A;  1H2T C;  2Y4T A;  3J5P A;  4N2Q A;  2I1K A;  5EIB E;  4GML A;  5FQ8 A;  1IXV A;  3T8M A;  4ILG A;  5D66 A;  5G04 C;  4U07 A;  4FLH A;  4KVM A;  3LVQ E;  4I43 A;  3D9O A;  3GW4 A;  4GZD A;  4HI8 A;  3V31 A;  3ZUV B;  4JLG A;  2DVW A;  2WXN A;  5JIN A;  3DBS A;  1HXI A;  4NUR A;  3FU6 A;  2QY7 A;  2DIW A;  3KAE A;  2VTB B;  1SA4 A;  1OWP A;  1HZ4 A;  3FTY A;  1N4S A;  4DX7 D;  1KPS B;  3B7R L;  3OPE A;  1Z3X A;  1SZ9 A;  3HHM A;  3CHS A;  3SFZ A;  5BXU A;  3EUV A;  3KEA A;  3EIJ A;  3EP0 A;  5HI7 A;  2YIN A;  5CHE E;  4HOQ A;  4PS8 A;  4TXP A;  4QQI A;  4CDN A;  4CT0 A;  3TL5 A;  1OWO A;  3LEW A;  3S7J A;  3RU0 A;  4XI9 A;  4MLP A;  4ABN A;  4PUC A;  3ONL A;  4BTA A;  2XZT G;  4TV3 A;  3NOC D;  3LYA A;  4HOR A;  2MRI A;  3I5P A;  3UM1 A;  4K5A B;  2A5U A;  5EYL A;  2DZN A;  3F9W A;  4N39 A;  2V4H C;  4WND A;  3SFX A;  1NA0 A;  2P9S G;  1JUQ A;  2LAH A;  4GTP A;  1YA0 A;  4UWG A;  4B8C B;  5HKP A;  2FBN A;  3Q9N C;  1TN8 A;  3RJV A;  4AEZ C;  1GW6 A;  3MJW A;  4XKB A;  4GYY A;  4BET A;  4XEI G;  4HOT A;  4IJ8 A;  1Z5S C;  1MX4 A;  1KLX A;  1YYH A;  3UM2 A;  2VSX E;  3HG0 D;  3ZFW A;  3M5A A;  2ZGD A;  2GRP B;  3ZGQ A;  3CK7 A;  1IKN D;  1H6O A;  5EX0 A;  5JA4 D;  5JMN D;  3TGO A;  2GRN B;  2LXL A;  2P9K G;  3CST A;  2J07 A;  3T9K A;  1K1B A;  3D9L A;  1JCQ A;  3RK6 A;  3MO0 A;  2X6H A;  4EZL A;  3B7S A;  4AM9 A;  3UIO C;  3V30 A;  3L17 A;  5AYF A;  5T3R A;  4ANV A;  2IGQ A;  4OYS A;  4NRH B;  3DRA A;  3QWP A;  4DK5 A;  4OVV A;  3CVX A;  3APC A;  1DVP A;  3BG1 B;  4UI9 C;  4UI9 J;  3O4Z A;  3E34 A;  4GAA A;  2KXP C;  3VLD A;  3BG0 B;  3CVN A;  4U0S A;  3SZ7 A;  2UWJ G;  2WB2 A;  3L08 A;  4K03 A;  2XGM A;  4MRU A;  4B94 A;  1EYH A;  3C72 A;  2CFU A;  2V5F A;  2ZGG A;  3Q4A B;  4N3B A;  5C2Y A;  2GRO B;  3ESL A;  2VSY A;  4RG9 A;  4PDX A;  2OOE A;  1KZO A;  2WVI A;  4FJY A;  4HLL A;  2IOS A;  4NJ5 A;  1AWC B;  4UWK A;  4JD2 G;  4C9B B;  1ELR A;  2B6C A;  4ACL A;  2WXH A;  1A17 A;  4GZC A;  2IQC A;  3HDX A;  4K0R A;  3CV0 A;  3B7T A;  3FU3 A;  5LCW C;  5LCW J;  4C48 B;  2RKK A;  4J7F A;  4I51 A;  1MVX A;  3HXC A;  3UMV A;  4F3V A;  4ANU A;  3QWV A;  4HOU A;  2HR2 A;  5KWD A;  2JLB A;  1O1R A;  3ZYM A;  4YVO A;  1HF8 A;  4Q69 A;  1Y6I A;  2KZT A;  3UIN C;  2HO1 A;  3OXG A;  5KBA A;  4EZJ A;  2XRZ A;  2A5E A;  2GRL A;  2XHE A;  3DSW A;  1S63 A;  5F6K C;  4RSY A;  2E0I A;  1IQR A;  3VLF A;  2X3M A;  3V2X A;  3M55 A;  3BQO A;  3JYS A;  4W9R A;  1UJJ A;  3FUN A;  3NBN B;  3FY4 A;  4BSZ B;  5LP0 A;  4L1B A;  4A63 B;  3EIQ C;  1G3N B;  3APF A;  2Y69 E;  3JQ1 A;  2C2L A;  2XEN A;  3N71 A;  3C3Q A;  4YPU A;  3L22 A;  4YVQ C;  5D2M C;  3CHR A;  3SY2 A;  3QNK A;  4P29 A;  3ASN E;  2LSV A;  3AG1 E;  3MX3 A;  1ML9 A;  2RFA A;  1BPO A;  3NZU A;  3OOI A;  1N3J A;  3GYZ A;  2BF0 X;  3HVE A;  2BED A;  3LPZ A;  4J8F A;  3M58 A;  1QBQ A;  2RFM A;  3CR3 A;  3O48 A;  5CCL A;  2KCL A;  2P2C P;  3PE4 A;  3ESK A;  2C0L A;  3EU9 A;  4GYW A;  3G2U A;  2WXK A;  5E75 A;  4O30 A;  2DCP A;  3SD5 A;  3ZVV A;  4NQ0 A;  4MKT A;  4DUI A;  2ETA A;  4PH4 B;  2Y3A A;  3TAX A;  4GTV A;  4YNM A;  3Q15 A;  4O60 A;  2OCC E;  3JQ0 A;  5ITZ F;  3B7B A;  3FWV A;  5CMW A;  3CK9 A;  4LG6 A;  2EIK E;  3R9M A;  3J5Q B;  4Z68 A;  3RRU A;  3ZYK A;  3G2W A;  1L5J A;  3AS5 A;  1EF1 C;  5AJL A;  3AS8 A;  4O1P A;  5M72 A;  3PZ1 A;  5A7D B;  4L9P A;  5A23 A;  2X6J A;  3SGH A;  3D9M A;  2WQ7 A;  3EHR A;  5F59 A;  2QYJ A;  2AW6 A;  4JL0 A;  3IBE A;  4AOF A;  3EJN A;  4HRL A;  4CGW A;  5TH7 A;  3QK0 A;  4AP2 A;  3KMJ A;  4WWP A;  4G25 A;  1NL4 A;  1MT6 A;  2L9B A;  4K5C A;  1HX8 A;  4DLQ A;  2NXP A;  3MA5 A;  1N54 A;  2WXO A;  4N2S A;  4KMO A;  3MKQ A;  2J8S D;  1N0Q A;  3M53 A;  3SFY A;  4KXK B;  3ZNG A;  3FH8 A;  4GA0 A;  3BO5 A;  1HS6 A;  2X6K A;  1WY6 A;  2E2E A;  1OWM A;  3RRM B;  2DBA A;  2WXG A;  3ASG A;  2P9N G;  5AYW D;  5KJK A;  1S64 A;  2XS8 A;  2QC9 A;  4QEP A;  3JXJ A;  4C0E A;  2XPY A;  2LO6 A;  5LFA A;  3ZKJ A;  4U8Y D;  5EG2 A;  1IHB A;  3APD A;  1EDU A;  5AIJ A;  3Q9U C;  4GPM A;  4JEH A;  4MS6 A;  4J7W A;  4FMU A;  4WWN A;  4F7A A;  3AU5 A;  2KBX A;  3OS5 A;  1N0R A;  5AN8 A;  1LF8 A;  3VV0 A;  3DSS A;  4L2L A;  4EEC A;  2H6H A;  2P9L G;  4U8V D;  4MBG A;  1N95 A;  3K9I A;  5ENS D;  3DXM G;  3I3N A;  4WNE A;  3D9P A;  1UG3 A;  5EN5 D;  2H6I A;  3CGH A;  1NP7 A;  5EKQ D;  3AJI A;  4L7T A;  2F8Y A;  1D8D A;  1WM5 A;  1BI8 B;  4GZ6 A;  3IEG A;  2XEV A;  2HYZ A;  2NC9 A;  5B1B E;  5LX8 A;  3LJN A;  3UM0 A;  2AXU A;  2HM8 A;  2R59 A;  4LUN U;  5EDS A;  3JUI A;  3NZS A;  2J4D A;  3M54 A;  2IJG X;  1FVH A;  4EBA G;  5ENP D;  1Z3Y A;  4I9C A;  4Q94 A;  2LNI A;  4HB5 A;  1HE8 A;  4FU3 A;  4U8H A;  3TWW A;  4JEU A;  5JJ0 A;  1JWF A;  5EIL A;  1PC2 A;  2PZI A;  5FQ6 A;  1AP7 A;  1MVH A;  1B89 A;  4DX2 A;  2XQ0 A;  2PQR A;  4G8L A;  3UX4 A;  4AIF A;  2RD0 A;  3CVY A;  2OND A;  3CEQ A;  3D9H A;  2WXP A;  2F0Y A;  4FJZ A;  3FTW A;  4FUL A;  1V55 E;  5FZS A;  2NSZ A;  4TRQ A;  4G1T A;  3Q7A A;  5JJT A;  3E32 A;  2R03 A;  2XS1 A;  2H6G A;  4TUM A;  3KMT A;  4J0U A;  2CHZ A;  4JZY A;  2I1J A;  3PRZ A;  2KZT B;  4N3C A;  4DRX E;  5TEG A;  4G23 A;  3FUM A;  4TXQ A;  4J8E A;  3UKU G;  4U0U A;  5BUZ A;  3D9N A;  4APF A;  5FIO A;  2BUG A;  5ENR D;  5BW8 C;  1NZN A;  1OWN A;  2RFI A;  5FJY A;  3PZD A;  2IFU A;  5AQ7 A;  3ULE G;  5ENO D;  2IO2 C;  2GGF A;  2X38 A;  4CGV A;  4L2Y A;  4AY6 A;  4NVQ A;  3S7D A;  3E33 A;  5AAR A;  5BXO A;  4HQD A;  3Q49 B;  3PDN A;  4IRU A;  2PL2 A;  5DBK A;  2XRY A;  4FP7 A;  3ZPJ A;  1O1T A;  5CEC B;  2WQ6 A;  3T8K A;  1X81 A;  2B0O E;  3D3M A;  3L13 A;  4E6H A;  1MUF A;  4A3V A;  3MZL B;  4LNG A;  5E76 A;  4HI9 A;  4OAV B;  4JHJ A;  1V54 E;  4XKC A;  3FTV A;  5G2N A;  3VUZ A;  2L6B A;  3Q7F A;  1KT0 A;  1MX2 A;  1N4Q A;  2A4Z A;  3UT8 A;  2XZD G;  3HRA A;  3OTN A;  1IYG A;  4OAU C;  2EIJ E;  5KNG A;  1LTX A;  2ETB A;  4ME2 A;  2QZA A;  4LNB A;  5B3S E;  4YNP A;  2EQX A;  1TEZ A;  2I6H A;  2WXR A;  3FUK A;  4E85 A;  4CZ2 D;  3SWC A;  3PUK A;  3BU8 A;  3QAQ A;  4H7Y A;  4KVO A;  3ULQ A;  4ACK A;  2IU1 A;  4BSX A;  1OXJ A;  5B1A E;  2LUH A;  4KZ0 A;  4J7I A;  1NA3 A;  3CBO A;  5AQA A;  1BU9 A;  2OVB A;  2QFC A;  3FUF A;  3Q5M A;  4JW1 A;  5JIY A; 
#chains in the Genus database with same CATH homology
 4MI0 A;  2PQN A;  3C98 A;  3PNL B;  4GMJ A;  3OXL A;  5T8I A;  4YPU A;  3L22 A;  4CEM A;  3RO3 A;  3T5V A;  4YVQ C;  2VYI A;  3CHO A;  3CHR A;  2WQH A;  3QNK A;  4PS7 A;  4P29 A;  4AVX A;  2LSV A;  2PM6 A;  3MX3 A;  1ML9 A;  1MHQ A;  1H2U A;  3LY7 A;  1BPO A;  2XGO A;  1N52 A;  3ENE A;  3NZU A;  3PRE A;  1WAO 1;  4UQZ A;  5FZR A;  1N3J A;  3OOI A;  3GYZ A;  1QNF A;  3SNX A;  5J90 A;  2BF0 X;  5D0O D;  3HVE A;  2KM4 A;  3FHE A;  3LPZ A;  4J8F A;  3FUE A;  3M58 A;  2CFZ A;  3D9J A;  2FEZ A;  1XNF A;  4G26 A;  4GB9 A;  3PEV B;  5HQ8 A;  3CR3 A;  1IHG A;  2LSU A;  3O48 A;  4KBQ A;  5CCL A;  3FEY A;  1PY1 A;  2KCL A;  1U3D A;  1ZU2 A;  1HG5 A;  4RZ0 A;  3RJW A;  3UT7 A;  5AJD A;  5KJL A;  3PE4 A;  2WXF A;  3ESK A;  4BTB A;  2CG3 A;  1FVF A;  3LJ3 A;  4EBA A;  3AS4 A;  3CKB A;  2C0L A;  3MKQ B;  3SHF A;  4CRW A;  4XZ4 A;  1VDY A;  5KCM A;  3LDZ A;  3MGB A;  3FUL A;  4AXH A;  3LY9 A;  3ML9 A;  3GZS A;  4GYW A;  3G2U A;  3ZW3 A;  5AEN A;  4GU5 A;  4IN3 B;  5C1D A;  3M56 A;  3KD7 A;  2WXK A;  5E75 A;  3FTZ A;  4O30 A;  2DCP A;  3FTU A;  4AY5 A;  3FFL A;  3IHY A;  3SD5 A;  5FWQ A;  3IHV A;  4UWF A;  3ZVV A;  3CVQ A;  3S7F A;  4JXT A;  4PS3 A;  2BQZ A;  1E8Y A;  3PNT B;  4NQ0 A;  1HG2 A;  3QB2 A;  3CHP A;  4MKT A;  3F9Z A;  2VGX B;  4H12 A;  4PH4 B;  2Y3A A;  3QC1 A;  3B7U X;  3QDN A;  4BY6 A;  3LXU X;  3TAX A;  2CHW A;  4I1O B;  3URZ A;  4I17 A;  1W3B A;  1H19 A;  2L6J A;  4YNM A;  3ZYQ A;  4AU7 A;  3Q15 A;  4LRZ A;  4LDG A;  3JQ0 A;  4YND A;  3IHX A;  4GZ3 A;  4GZ5 A;  3FPD A;  1E8X A;  3FU5 A;  3FWV A;  1UW4 B;  4CCA A;  4URK A;  4C0M A;  2XPI A;  5CMW A;  4J83 A;  3GZ1 A;  3MYV A;  3HYM B;  5G55 A;  3U9W A;  2MOW A;  3RRN B;  3CK9 A;  3VTX A;  3HIZ A;  2VQ2 A;  3CVV A;  3DB5 A;  3HVE B;  3M57 A;  3RRU A;  3ZYK A;  3G2W A;  3CBM A;  1L5J A;  4G11 A;  1OWL A;  3AS5 A;  1EF1 C;  2ION A;  3AS8 A;  5AJL A;  4BT8 A;  5LOZ A;  4GCN A;  5ARF A;  4D10 C;  4A3T A;  1HU3 A;  4MI5 A;  4QEO A;  2WXJ A;  5M72 A;  2YQ8 A;  3CK8 A;  3ZXS A;  3CQG B;  4UWL A;  4NAC A;  4WWO A;  3LVR E;  5A7D B;  5LSX A;  2GW1 A;  3PH0 C;  5A23 A;  2X6J A;  3S7B A;  3SGH A;  3SW9 A;  3D9M A;  4J6I A;  2WQ7 A;  5F59 A;  4XX5 A;  5G05 C;  1UJK A;  2YHC A;  2AW6 A;  3FU0 A;  4IYP A;  5G05 J;  4GYO A;  3SBT B;  3F9Y A;  3ZHE A;  3CVU A;  4JL0 A;  3IBE A;  3EHM A;  2M63 A;  4ATG A;  4AOF A;  1ZBP A;  3EJN A;  4I1A A;  5ANR A;  1QZ2 A;  3NF1 A;  3Q47 B;  4WUY A;  4CGW A;  3FUJ A;  5JHN A;  4L23 A;  4JHK A;  5TH7 A;  4IUL A;  4CT4 A;  4RG6 A;  2W5Z A;  3QK0 A;  4U0Z A;  5JJ6 A;  4AP2 A;  3MEK A;  3KMJ A;  4WWP A;  4G25 A;  3ASH A;  2J49 A;  5FTP A;  1MT6 A;  2VSO E;  4OVU A;  1E7U A;  2KC7 A;  2L9B A;  1HX8 A;  3SF4 A;  3DPD A;  2VTB A;  2L0T B;  3RIB A;  4DLQ A;  5JHB A;  2NXP A;  3MA5 A;  3U3W A;  4HFG A;  5KJM A;  3ASF A;  1N54 A;  2WXO A;  3FUI A;  4KT6 B;  2Y4U A;  4GA1 A;  4N2S A;  3PEU B;  4BT9 A;  4KMO A;  3MKQ A;  3HNA A;  1HH8 A;  1P5Q A;  3FUD A;  4BX8 A;  1H2T C;  2Y4T A;  5BT1 A;  5J08 A;  4N2Q A;  3M53 A;  4EQF A;  2I1K A;  3CHQ A;  4HXI A;  4GML A;  1Z6T A;  4KXK B;  4KYO B;  3FH8 A;  5FQ8 A;  3CHM A;  3T8M A;  4GA0 A;  3TXN A;  4ILG A;  3BO5 A;  2I2O A;  5ANL A;  5G04 C;  1HS6 A;  4U07 A;  2UY1 B;  3QKY A;  4FLH A;  5T0M A;  4KVM A;  2X6K A;  1WY6 A;  3LVQ E;  4B8A A;  2E2E A;  5BPP A;  4I43 A;  2VGX A;  4LCT A;  1SQM A;  1OWM A;  3RRM B;  3UQ3 A;  2DBA A;  2WXG A;  3ASG A;  5AYW D;  2JEK A;  3D9O A;  5KJK A;  3GW4 A;  4GZD A;  3KS2 A;  4HLE A;  4LEU A;  4V3I A;  3ZRH A;  3JCK C;  2YNQ A;  1ZKK A;  2J4B A;  3QAR A;  4JLG A;  4QEP A;  2J9Q A;  3ZHE B;  4B0Z A;  2XPY A;  4C0E A;  2C0M A;  2WXN A;  4WAF A;  5FZQ A;  2LO6 A;  5JIN A;  2VJ8 A;  3DBS A;  3LY8 A;  1HXI A;  3S8P A;  2L0I A;  3QJZ A;  3FU6 A;  4J8S A;  4NUR A;  5LFA A;  2CG2 A;  2QY7 A;  4R7L A;  4YPE A;  4I2Z A;  4ANX A;  2G46 A;  1S0P A;  5EG2 A;  4JA7 A;  2RG8 A;  3I4G A;  3APD A;  2FF4 A;  2DIW A;  3F9X A;  4O6F A;  1EDU A;  3KAE A;  5AIJ A;  3S2A A;  1E90 A;  1H0A A;  4JEH A;  4MS6 A;  2VTB B;  4FMU A;  4WWN A;  4F7A A;  3AU5 A;  2GRM A;  3OS5 A;  2XGS A;  5TTF A;  4BX9 A;  1OWP A;  2WM9 A;  1HZ4 A;  3FTY A;  3B7R L;  3OXF A;  1LF8 A;  4HOS A;  1O9S A;  5JJ7 A;  3VV0 A;  3PS6 A;  3OPE A;  4Z4P A;  4F1S A;  1Z3X A;  4L2L A;  1SZ9 A;  3HHM A;  4EEC A;  3CHS A;  3SFZ A;  3FEX A;  3EIJ A;  4BWR A;  3EP0 A;  2AXZ A;  5HI7 A;  2YIN A;  5CHE E;  4HOQ A;  4PS8 A;  3K9I A;  3K5K A;  3I3N A;  4WNE A;  5ARG A;  4CDN A;  3D9P A;  3L54 A;  4CT0 A;  1UG3 A;  1E8Z A;  4FHJ A;  4F53 A;  3TG4 A;  2J09 A;  4Q96 A;  3TL5 A;  1OWO A;  4BUP A;  1QQE A;  2KAT A;  2PM7 A;  2XPZ A;  3CGH A;  3LEW A;  3S7J A;  1NP7 A;  5EKQ D;  4BFR A;  3CVW A;  4GPK A;  3RU0 A;  4XI9 A;  4MLP A;  4ABN A;  3QWW A;  4L7T A;  4PUC A;  3ONL A;  4BTA A;  1UN9 A;  3CKC A;  4TV3 A;  1WM5 A;  4GZ6 A;  1PAQ A;  3LYA A;  1UN8 A;  3IV0 A;  4HOR A;  4YPA A;  2UY1 A;  2MRI A;  3CVL A;  3IEG A;  3I5P A;  4U04 A;  3L6A A;  3LCA A;  2XEV A;  2F69 A;  2AXV A;  1E8W A;  3PVL A;  2A5U A;  2HYZ A;  3UUX A;  4I2W A;  4WNF A;  4N39 A;  3F9W A;  1H2V C;  2NC9 A;  5LX8 A;  4WND A;  2V8S E;  4IJD A;  5T4Y A;  1NA0 A;  2AXU A;  2HM8 A;  1JWG A;  2AWI A;  4UQX A;  2R59 A;  3VLE A;  4LUN U;  2FI7 A;  1JUQ A;  2LAH A;  3KEZ A;  3RKV A;  4KZC A;  2WXQ A;  3ASD A;  5EDS A;  1YA0 A;  3JUI A;  1INZ A;  2VGY A;  2WPV A;  3B13 A;  4UWG A;  4B8C B;  3NZS A;  2J4D A;  1HO8 A;  4I1M A;  2FBN A;  3M54 A;  3ONK A;  3RJV A;  4AEZ C;  1GW6 A;  3FDH A;  3MJW A;  2IJG X;  4XKB A;  1FVH A;  4GYY A;  4M3O A;  4EBA G;  1Z3Y A;  3PE3 A;  4I9C A;  4HOT A;  4IJ8 A;  3FP3 A;  2R17 C;  3LS8 A;  2LNI A;  4Q94 A;  4A55 A;  1Y8M A;  1HE8 A;  4FU3 A;  5T0K A;  4UWH A;  4U8H A;  4CDR A;  1KLX A;  4JEU A;  4Y6W A;  5JJ0 A;  1JWF A;  2VSX E;  1PC2 A;  3R9A B;  2KCK A;  3CQC B;  4JW1 A;  4WNG A;  4AJW A;  2PZI A;  5CCM A;  3MO2 A;  1ELK A;  3ZFW A;  5FQ6 A;  4B89 A;  1MVH A;  1B89 A;  3M5A A;  2I9C A;  3ZEF A;  2XQ0 A;  4DPR A;  2PQR A;  4JDS A;  3P1U A;  1U3C A;  3UX4 A;  3CBP A;  3OAW A;  4ILH B;  3ZGQ A;  4AIF A;  2RD0 A;  4N3A A;  2X6F A;  3CK7 A;  3CVY A;  2OND A;  3CEQ A;  5F6L A;  3TXM A;  3U64 A;  2WXP A;  4JA9 A;  5EX0 A;  3G2S A;  4XE0 A;  4FJZ A;  3FTW A;  4FUL A;  2QPW A;  3PUJ A;  3CST A;  4J8D A;  3TGO A;  5FZS A;  2J07 A;  5D0Q D;  3UT4 A;  1H3I A;  4TUU A;  2NSZ A;  3D9L A;  4TRQ A;  4G1T A;  5BNW A;  3RAY A;  3L16 A;  3RK6 A;  5JJT A;  3EDT B;  3MO0 A;  3QOU A;  3FUH A;  2X6H A;  3G2T A;  2P58 C;  4JVS A;  3LKU A;  3P2B A;  4XI0 A;  3KMT A;  4EZL A;  3B7S A;  4HS2 A;  3TJP A;  4AM9 A;  1DNP A;  4DI3 A;  4J0U A;  2CHZ A;  1E7V A;  3L17 A;  1HFA A;  4JZY A;  3IKO B;  2I1J A;  5T5G A;  3PRZ A;  5AYF A;  5T3R A;  2O8J A;  2KZT B;  4N3C A;  4ANV A;  2IGQ A;  4OYS A;  3M59 A;  4G23 A;  3FH5 A;  2BTD A;  3FUM A;  5FQ7 A;  3N71 A;  3SI5 A;  5TEG A;  4NRH B;  5BV1 A;  4RVB A;  2FUL A;  4J8E A;  3QWP A;  3U4T A;  4DK5 A;  2VSN A;  4OVV A;  4U0U A;  3CVX A;  3APC A;  5BUZ A;  3D9N A;  1DVP A;  2R3A A;  3I4R B;  4FLB A;  4JHR A;  3BG1 B;  4UI9 C;  4APF A;  1XQH A;  2BUG A;  2KCV A;  3O4Z A;  4UI9 J;  5BW8 C;  1NZN A;  1OWN A;  2ZU6 B;  5FJY A;  5JHA A;  1E96 B;  2RFI A;  1ELW A;  4GAA A;  3BG0 B;  3CVN A;  4U0S A;  3SZ7 A;  3VLD A;  4Y6C A;  3D9K A;  2UWJ G;  2WB2 A;  3PZD A;  2IFU A;  3L08 A;  2ILR A;  1H6K A;  2MHK A;  4K03 A;  2XGM A;  4APO A;  2V0P A;  4XIF A;  4A1S A;  1TJC A;  1PEG A;  4MRU A;  4LER A;  3CVP A;  4FHK A;  4B94 A;  5KJN A;  4JC8 A;  1EYH A;  1KT1 A;  4HVB A;  2OVF A;  2CFU A;  2GGF A;  3E4B A;  4AV7 A;  2X38 A;  3MO5 A;  3ZYL A;  2W5Y A;  1EPU A;  3CIA A;  2V5F A;  4I6G A;  4UI9 K;  4L2Y A;  4CGV A;  4AY6 A;  1FCH A;  1TJF A;  1XGW A;  2IF4 A;  3S7D A;  3Q4A B;  4N3B A;  4NVQ A;  4C1Q A;  3AU4 A;  2OV8 A;  4FAD A;  5C2Y A;  3ESL A;  2Q7F A;  3Q49 B;  3PDN A;  4IRU A;  3R7R A;  2WXI A;  2PL2 A;  2VSY A;  5DBK A;  4A1G A;  3T5X A;  1OUV A;  4FA6 A;  2XRY A;  3DAL A;  1JPL A;  4I9E A;  4EZK A;  4FP7 A;  3ZPJ A;  2LAI A;  4RG9 A;  4PDX A;  4JPS A;  3RO2 A;  2OOE A;  2WVI A;  4FJY A;  3G2V A;  3SBS A;  5A6C A;  2WQ6 A;  2IOS A;  4NJ5 A;  1SZA A;  2V4L A;  3D3M A;  4UWK A;  3MKR A;  3L13 A;  4C9B B;  1ELR A;  4ACL A;  4E6H A;  2XCC A;  1A17 A;  2WXH A;  1MUF A;  4A3V A;  3MZL B;  2IQC A;  3HDX A;  4GZC A;  4K0R A;  5E76 A;  3CV0 A;  3B7T A;  3FU3 A;  4EPZ A;  2YHE A;  5LCW C;  5LSZ A;  4JHJ A;  5LCW J;  3NQP A;  4ILI A;  4XKC A;  4J7F A;  4I51 A;  5FT9 A;  1MVX A;  3FTV A;  5G2N A;  2AVP A;  3VUZ A;  3UMV A;  4F3V A;  4ANU A;  3KMA A;  3QWV A;  4HOU A;  1X5B A;  2HR2 A;  3FTS A;  2JLB A;  3MCX A;  3ZYM A;  2WMO A;  1HF8 A;  4YVO A;  3ZIM A;  4Q69 A;  1KT0 A;  2X6I A;  1Y6I A;  2KZT A;  3CLJ A;  3MV2 B;  4E47 A;  3D9I A;  1N6C A;  3FH7 A;  2A4Z A;  4QFV A;  2HO1 A;  4I6J A;  3UT8 A;  3WXX A;  3OTN A;  1IYG A;  3EHN A;  3VTY A;  4J8O A;  3BEE A;  3MV3 B;  3UPV A;  3RQ4 A;  3OXG A;  2CHX A;  4EZJ A;  5FQ4 A;  3GZ2 A;  2XRZ A;  4DLO A;  2GRL A;  4ME2 A;  2XHE A;  5CPR B;  4G24 A;  2FO7 A;  1IQU A;  2JV0 A;  5F6K C;  3CSF A;  2E0I A;  4RSY A;  1IQR A;  5DIZ A;  3ZN3 A;  3TG5 A;  4FC8 A;  3VLF A;  2X3M A;  4G2V A;  4YNP A;  2EQX A;  2WMN A;  3M55 A;  2XCB A;  4DJA A;  3JYS A;  4I6E A;  1TEZ A;  4W9R A;  2I6H A;  2WXR A;  3FUK A;  4CDM A;  4E85 A;  4QEN A;  1UJJ A;  4N5C A;  3FUN A;  4UQY A;  4ANW A;  3FY4 A;  3SWC A;  3PUK A;  1MQS A;  3QAQ A;  4H7Y A;  4KVO A;  4L1B A;  2R5S A;  4GCO A;  3EIQ C;  5LP0 A;  3ULQ A;  1N6A A;  4U63 A;  4ACK A;  2IU1 A;  4BSX A;  3R7Q A;  5ENN A;  4H7X A;  4KZ0 A;  4J7I A;  5BV0 A;  1NA3 A;  3CBO A;  3APF A;  3JQ1 A;  2C2L A;  5EX3 A;  3U66 A;  3ML8 A;  2OVB A;  3FTX A;  5G04 J;  4DI4 A;  2WXL A;  5F5E A;  4GA2 A;  2IOL A;  2QFC A;  2WXM A;  3FUF A;  3Q5M A;  2J08 A;  5JIY A;  5CMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...