5KJLA

Smyd2 in complex with az378
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
428
structure length
428
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
total genus 141
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjlA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjlA01
4J7FA 4AIFA 3SF4A 3QWVA 2HYZA 2VGXB 3FFLA 5JJTA 5JINA 2FI7A 4UI9J 4J7IA 2XCBA 3M59A 3ASDA 3R9AB 2XGSA 4FMUA 5LCWJ 5DBKA 5FZRA 3CVPA 1NZNA 2VGYA 4GYOA 5F6LA 5LSZA 4JDSA 4N3CA 3PE3A 2GW1A 3LY9A 3AS5A 3FPDA 3F9ZA 3Q5MA 4KYOB 1P5QA 5FZSA 3Q15A 4J83A 4JLGA 3OOIA 3MA5A 3MV2B 2XGOA 5BT1A 2JLBA 3HNAA 4JA7A 3MO0A 2WPVA 4NRHB 2G46A 1PEGA 4RG6A 1XNFA 4C1QA 1IHGA 3QWWA 4HORA 3LY8A 3BO5A 4J8DA 3M56A 4Y6WA 2FO7A 4H7XA 3LPZA 5KJKA 4N3BA 2L6JA 2W5ZA 2E2EA 3MEKA 5T0KA 4HOSA 3RU0A 5CPRB 2W5YA 2KCVA 3OXGA 3CK9A 4UQZA 3ULQA 1ZU2A 3RIBA 2Y4UA 2R5SA 5A7DB 5CCMA 5JJ0A 3Q47B 4I1AA 2LNIA 2JV0A 1KT1A 1WM5A 5TTFA 4IJ8A 5LSXA 3RO2A 2C0LA 2UY1B 4I17A 2MHKA 2QFCA 3PDNA 3IHXA 3TG5A 3OS5A 5T0MA 5JJ7A 4G2VA 3MKRA 2VSYA 4WNEA 4I9CA 3S7FA 4A1SA 3ZHEB 4AM9A 5AYFA 4J8FA 3F9XA 4ABNA 5D0OD 3CKCA 3RAYA 4O6FA 4W9RA 3WXXA 4NVQA 3CKBA 4BUPA 3TGOA 4QENA 5LCWC 2XEVA 5KJNA 2O8JA 4GYYA 4YPAA 1B89A 3PE4A 2DBAA 4CDRA 2I6HA 3SZ7A 4XIFA 2C0MA 4AU7A 4YPUA 4GZ6A 4QEOA 2WQHA 4GCNA 3M55A 4GPKA 5G04C 3MO5A 1QQEA 3ASFA 4J0UA 1ELRA 3UPVA 5TEGA 5EG2A 4UQYA 3ASHA 4ME2A 3ZPJA 4H7YA 4CGWA 3ZN3A 3CK8A 3KAEA 4NJ5A 2OOEA 1WAO1 3S8PA 3EDTB 4GA1A 3U4TA 5CCLA 5EKQD 1ML9A 3VV0A 2PQNA 4RZ0A 3F9YA 3URZA 1MUFA 1NA0A 4N39A 2J9QA 3CK7A 1HZ4A 5EX0A 2KATA 2PQRA 3KS2A 3BEEA 3AS8A 3OXLA 3ZFWA 3M57A 3RO3A 5AYWD 3S7DA 5HQ8A 4H12A 4WNFA 3KMAA 4U04A 4N5CA 3M54A 3FWVA 3ASGA 4O30A 5G04J 3K5KA 3GZ1A 5A6CA 1KT0A 4IN3B 5G05C 1FCHA 3ZGQA 3HYMB 1PC2A 4U07A 4WUYA 3UQ3A 3Q4AB 3CBMA 3RJWA 4GZ3A 3CVNA 4XI9A 3DB5A 4MI0A 4KXKB 3SWCA 3CV0A 4KBQA 2KCKA 2HO1A 2R3AA 3MV3B 2YQ8A 3RJVA 4BTBA 5F6KC 2VGXA 4YPEA 5CHEE 2PZIA 5G05J 4JL0A 3LY7A 3CBPA 2Y4TA 5EX3A 3QWPA 1XQHA 3ESKA 4G26A 1MVXA 1ELWA 4J8OA 5FTPA 2YHCA 4IJDA 1IYGA 5ARGA 2NC9A 5M72A 2VSNA 4B94A 4XI0A 2VYIA 1E96B 2Q7FA 3M5AA 2P58C 2BUGA 3GW4A 4E47A 3TG4A 2IF4A 4BT9A 5BNWA 2XCCA 4NQ0A 2IGQA 2AVPA 3E4BA 2F69A 2QPWA 3DALA 1W3BA 4QEPA 5KJMA 5F59A 1Y8MA 3RQ4A 3FP3A 3VTXA 4F3VA 4U0ZA 3TAXA 3QDNA 3Q49B 3NF1A 4EQFA 4BTAA 4WNDA 4UI9K 4I51A 3U3WA 3F9WA 3M53A 3OPEA 3S7JA 3GZ2A 3LKUA 5T5GA 4G24A 1HH8A 4GA0A 4HOTA 4HOUA 1MT6A 4WNGA 4U0SA 1OUVA 2UY1A 1TJCA 4N2SA 2FEZA 1QZ2A 2XPIA 5KJLA 4AY5A 4I2WA 4U0UA 4JA9A 5JIYA 3SW9A 3LYAA 5FT9A 2LSUA 2KC7A 4I2ZA 1A17A 2PL2A 1N3JA 4APOA 4MI5A 4BT8A 2UWJG 4Y6CA 5C1DA 5BW8C 4YVQC 1N6CA 4YVOA 4G23A 4UQXA 3QOUA 4BWRA 4AY6A 2LSVA 5FJYA 2KCLA 2V5FA 4UI9C 3OXFA 4N2QA 1N6AA 5JHNA 4I9EA 3VUZA 4GA2A 4LEUA 4YNPA 2BQZA 1H3IA 5FZQA 5JJ6A 4RG9A 3ZHEA 3O48A 5ARFA 3VTYA 1NA3A 3AS4A 3RKVA 2IFUA 4J8EA 3QKYA 4GCOA 1ZBPA 3IEGA 3N71A 3KMJA 3CVLA 3UUXA 2RFIA 5D0QD 2XGMA 1ZKKA 1O9SA 3KD7A 3LCAA 2C2LA 4G1TA 5HI7A 5DIZA 5F5EA 4JHRA 4Z4PA 4YNDA 3S7BA 4G25A 3JYSA 4GZ5A 2ONDA 5TH7A 1HXIA 1MVHA 4N3AA 2HR2A 3GYZA 3K9IA 3KMTA 3CEQA 4CGVA 3M58A 4HOQA 4GYWA 4YNMA 3CBOA 1KLXA 3EP0A 1YA0A 3CVQA 4LDGA 2FF4A 2VQ2A 3MO2A 2FBNA
chains in the Genus database with same CATH superfamily
4LCTA 3G2VA 3E34A 2ZXWE 4J7IA 3ASDA 3SI5A 2GRNB 5LCWJ 1NFIE 1MZCA 1NZNA 2VGYA 5FQ8A 5F6LA 2IU1A 3CLJA 5LSZA 3PE3A 2A4ZA 3C3OA 3DBSA 4K5CA 3LY9A 3AS5A 3F9ZA 3Q5MA 3JQ0A 3Q15A 4ACKA 3DEPA 4J83A 4ANXA 3MGBA 3IKOB 3ZVVA 3HG0D 5BT1A 4HBDA 4JA7A 4B8CB 2KZTB 4MRUA 3HRAA 1E8ZA 1Y6IA 1WG0A 4HORA 1UJKA 3LY8A 3NZUA 4DX5D 3D9LA 5AENA 4NIKA 4J8DA 3UXGA 3ZNGA 2FO7A 1U3DA 3LPZA 2WQ6A 2L6JA 3SHFA 2CG3A 2E2EA 2X6IA 3MEKA 3RU0A 4EBAA 1BI8B 4JC8A 1OCCE 1QYMA 2XRYA 3ZYQA 2R5SA 1INZA 1E8WA 1TYQG 3Q47B 3TWRA 1EDUA 1WM5A 3CVUA 3CVVA 2MOWA 5LSXA 2C0LA 3RO2A 3LEWA 4I17A 3FTVA 3NZSA 2QFCA 3UTMA 1N0RA 2B6CA 3IHXA 2LAIA 2IO2C 4ILGA 4C9BB 1Q2ZA 3MKRA 5KWDA 4U7EB 1LD7A 4G8LA 3FH5A 3ZHEB 4ABNA 4HRNA 5D0OD 4W9RA 3WXXA 4BUPA 1BD8A 4L1BA 5FQ7A 5KJNA 2O8JA 4G8KA 3LXUX 4EZJA 4YPAA 3PE4A 4FLBA 2DBAA 4CDRA 4U96D 1S70B 2I6HA 2C0MA 4GCNA 3M55A 4GPKA 5G04C 4EHMA 1H2TC 4DI3A 4J0UA 4DPRA 4ME2A 4H7YA 4CGWA 3KAEA 3CVYA 4JD2G 5BV1A 2L0IA 1O1TA 3CHSA 4K03A 1TN6A 1TR4A 1E90A 1HX8A 1LTXA 3DPYA 2DZOA 3QC1A 3HXDA 4TRQA 1MUFA 4UWGA 3SQVA 1H2VC 5EIDA 1MX6A 4UWFA 2KATA 3LJNA 2PQRA 2ETCA 3HXCA 3OXLA 3M57A 3RO3A 1UJJA 5AJDA 4XKCA 3KMAA 3J5QB 5E75A 4GTVA 3M54A 3ASGA 2ZGGA 4AEZC 4TUUA 2IEJA 4YDWA 3UINC 2CHWA 3RJWA 3S2AA 4HS2A 4IULA 2LAHA 3JCKC 1HS6A 2HM8A 3SWCA 2KCKA 2R3AA 4I1OB 3SNXA 2VGXA 4XE0A 2PZIA 5G05J 3PZ2A 4JL0A 4Z68A 3CBPA 4ATGA 4ILHB 1UOHA 4D10C 3FH8A 5CBNA 2Y4TA 4C48B 3QWPA 1JPLA 1MVXA 1FT2A 4AP2A 4E6HA 4GTRA 1ZB1A 3E33A 4CT4A 2BTDA 1JCSA 3QARA 3FH7A 3ISMC 4DX2A 1NL4A 2BUGA 3RRUA 4E47A 1K1BA 2IF4A 4BT9A 4FJYA 2XCCA 1UG3A 2J49A 4NQ0A 2IGQA 4HI9A 3ASOE 4GMLA 4UWHA 5KJMA 3TAXA 1D8DA 1YCSB 3QDNA 3PRZA 1MHQA 1IQRA 1OCZE 5D66A 3V2OA 4EQFA 4WNDA 2KM4A 3I3NA 4DX6D 4FA6A 3U3WA 3FDHA 3M53A 4LRZA 1BLXB 3CIAA 3R9MA 1Z5SC 1OUVA 1QZ2A 5KJLA 4AY5A 4FADA 2VTBA 3ZUVB 2J4BA 4GB9A 4JA9A 4XKBA 1Z3YA 3Q9UC 3L82A 5JMND 5FT9A 2WMOA 3IHVA 1A17A 2PL2A 1N3JA 5HRYA 3UMVA 4P29A 2UWJG 3LVRE 3EIJA 5LFAA 1IKND 2AJAA 3HXFA 1EF1C 4F53A 4UQXA 4BWRA 3L54A 4B93B 4AY6A 3CHRA 4DUIA 1N6AA 1FVHA 5CMYA 3SFXA 2BQZA 3DSXA 2X6HA 1H3IA 4Q96A 4GMJA 3G2SA 3O48A 4BFRA 5HKPA 3QKYA 4BESA 2OV8A 2Y69E 1N9AA 3TWSA 1JCQA 2V5QC 1JCRA 3FTUA 1L5JA 1G3NB 4ATZD 3LCAA 2C2LA 3ENEA 4Z4PA 2LXMA 4G25A 4FC8A 3TWUA 2WXMA 1N4PA 4N3AA 3K9IA 1D8EA 1O5MA 3CEQA 4KMOA 3RRMB 3AU4A 4GYWA 1DNPA 1KLXA 1YA0A 2FF4A 2NSZA 4GU5A 1HG5A 1O1SA 1N4SA 3R9AB 4L2LA 2IOLA 2LUHA 1TNZA 1LF8A 2VJ8A 4KVOA 5H7PA 4I1MA 4PS7A 3CHMA 3LS8A 3ESLA 4CEMA 1H2UA 4KYOB 4F7AA 4ANUA 5FZSA 5AAOA 2LXLA 3OOIA 2J08A 3MV2B 3Q79A 2DYRE 1VDYA 3B7UX 2JLBA 1UN9A 3JXIA 4X8QA 1H6OA 2WPVA 4BX9A 3FUEA 4NRHB 2X6JA 3FTWA 5D2MC 1PEGA 4RG6A 1HG2A 4C1QA 3PNLB 1YMPA 4U8HA 2F8XK 3KSQA 3G2TA 5KJKA 1S0PA 2RFAA 3NBNB 2B0OE 5CPRB 2F8YA 2P9SG 2R03A 4J7WA 3BG0B 3ULQA 3CHQA 5B1BE 1PAQA 1SW6A 3RIBA 2Y4UA 4HLEA 5BUZA 4R7LA 3U66A 1N4QA 4I1AA 5EDSA 2JV0A 2H6HA 2R02A 4TV3A 2YNQA 4N5QA 2XHEA 4UWKA 4A55A 2MHKA 2OVBA 4AXHA 4M3OA 4B0ZA 3CSFA 4QFVA 1YYHA 4F1SA 4WNEA 3AG2E 3S7FA 4A1SA 4AM9A 2CG2A 3ZXPA 3APFA 4NVQA 3Q9NC 3TGOA 2JEKA 3MX3A 3G2WA 4GYYA 1B89A 3MZLB 5ENTD 2WXHA 3D9PA 4LG6A 3SZ7A 4CDNA 3JUIA 4AU7A 3FHEA 4YPUA 4GZ6A 3FUNA 2WMNA 5LP0A 2WQHA 3P1UA 4JZYA 3EUVA 2P9PG 3ASFA 3ULYA 1S63A 1ELRA 3UPVA 2H6IA 4UQYA 3ASHA 3B7RL 3U4TA 5CCLA 4BERA 3FUFA 3J5PA 3D9OA 4HRLA 2AWIA 3FUIA 3URZA 5ENRD 3PZ1A 1NA0A 2F0YA 2J9QA 3TWVA 1PY1A 4MKTA 5KBAA 4GTQA 4U8VD 1SVXA 3AS8A 3PUJA 5B1AE 2XS8A 3FUKA 4EZKA 3GZSA 3FWVA 2AXVA 4O30A 5G04J 1OY3D 3SBTB 1V55E 1KT0A 5ANRA 5G05C 1HO8A 3HYMB 1PC2A 3KEZA 1AWCB 4WWNA 2PNNA 4WUYA 3V31A 3UQ3A 3Q4AB 2I2OA 3UIOC 3FU0A 4ZHBA 4HB5A 3TWTA 2P9KG 4ZFHA 4GZ3A 4MI0A 4HI8A 4KXKB 3AG1E 4BTBA 4E85A 3SFYA 4PS3A 4I43A 3ZYMA 3UM1A 5LX8A 5CEDB 5HS0A 3ZRHA 1OWLA 2L9BA 2QZAA 4HXIA 3IXEA 4J8OA 2WB2A 3B95A 1DCEA 1IYGA 5BXUA 2NC9A 3BUAA 5M72A 1XGWA 4XI0A 3U64A 1E96B 4DJAA 2Q7FA 1TN8A 2QYJA 1JWGA 3GW4A 4FHKA 2ZGDA 3PZ3A 4TXQA 1N0QA 4AOFA 4F6RD 1JUQA 2AVPA 3E4BA 2F69A 4DI4A 3UKUG 3ZXSA 3L6AA 3KEAA 4LNUD 3B7TA 2YINA 3FP3A 3KSLA 1IHBA 4DK5A 1U2VG 4U0ZA 3UT8A 2IOSA 3OTNA 4FP7A 3C3QA 3O4ZA 4ACLA 3QK0A 4UI9K 2DIWA 4I51A 4CDMA 3HVEB 3FU5A 3S7JA 3L16A 4MLPA 5T5GA 2GROB 4HOTA 1X81A 4DLOA 2UY1A 4N2SA 2FEZA 2XPIA 3HHMA 2CFZA 2VSOE 2EILE 4K0RA 5G2NA 4JPSA 2WXQA 3SW9A 2DCPA 3LYAA 2WXOA 2P9UG 4G11A 3LDZA 3APCA 4MI5A 4JEHA 1OWMA 3SFZA 4JB8P 2V4LA 1LD8A 1N6CA 5T4YA 3QOUA 5BXOA 2LSVA 5FJYA 2KCLA 1ELKA 2IY0C 4TXPA 3ABME 3VUZA 3LVQE 4K5BA 3R7QA 1N52A 4CT0A 2KZTA 1EYHA 3D9NA 3MKQA 4OVUA 3ZHEA 3PREA 3HVEA 5E76A 5ARFA 2DZNA 2AXZA 3SY2A 2R17C 3QNKA 3IEGA 3N71A 3KMJA 3CVLA 3LJ3A 2WXPA 5F5EA 4XEIG 4YNDA 4GZ5A 2NXPA 1SA5A 5TH7A 1MVHA 2HR2A 3GYZA 1O1RA 5ANLA 2IONA 4HOQA 3X2QE 1X5BA 3CBOA 1HE8A 3EP0A 3CVQA 2HE0A 3HXBA 4I6GA 4J7FA 4OAUC 4AIFA 3SF4A 5CERB 3QWVA 5JJTA 3FFLA 4UI9J 2XCBA 2WXRA 3NQPA 2XGSA 4FMUA 4PS8A 4EZLA 5DBKA 1Z3XA 4BETA 3CVPA 4BSXA 5LOZA 4GYOA 3SO8A 1EPUA 4N3CA 4JDSA 1H6KA 2GW1A 4OVVA 4FU3A 3FPDA 3HDXA 5J08A 2P9LG 1P5QA 3FTXA 3CVXA 3PVLA 4JLGA 5KCMA 3EU5A 3MA5A 3W9GA 4CRWA 2XGOA 4RLYA 2WXIA 3HNAA 3MJWA 3QJZA 4GAAA 2JABA 3MO0A 4JHJA 4J8YA 1N54A 1IHGA 4HLLA 1RW2A 3TXNA 2FULA 4Y6WA 4H7XA 4RQIA 3AJIA 3Q75A 4U63A 5T0KA 2OEVA 3TWQA 3DXMG 1TNUA 2KCVA 1TNYA 3C5RA 4UQZA 4UUCA 2WVIA 4CCAA 1RZ4A 3P2BA 5A7DB 2XZTG 2EQXA 3T5XA 5JJ0A 2LNIA 2IQCA 5CRVA 5TTFA 1TJFA 2UY1B 4AJWA 3V30A 3V2XA 4ANWA 1H0AA 3NOGD 2J07A 3ABLE 1IQUA 2WXJA 5FWQA 3TG5A 2IJGX 3OS5A 4M7CA 5T0MA 5JJ7A 2VTBB 1HU3A 4YDEA 5AYFA 3F9XA 2V4HC 2MRIA 2RD0A 5CEAA 3E30A 5C2YA 2BEDA 1KZPA 4O1PA 3FU3A 4EBAG 4GTSA 3BU8A 2OVFA 1H19A 5AIJA 1FT1A 1OXJA 4A63B 3NB2A 2DWZA 3D9KA 4QEOA 5ITZF 3RAUA 5EYPF 2X6KA 3B7SA 2L0TB 1QQEA 3EHNA 3SD5A 4KZCA 5ENOD 3APDA 3TJPA 3ZN3A 4NJ5A 3S8PA 3EDTB 3ZU7B 2P2CP 5EKQD 1ML9A 3VV0A 2PQNA 4RZ0A 1UN8A 3F9YA 3ONLA 5ENQD 5ENPD 4N39A 3JQ1A 1V54E 3NOCD 5BPPA 2VSXE 1Z6TA 3D9HA 3AG4E 3CSTA 3DRAA 3ZFWA 2Y3AA 4QQIA 5AYWD 4RVBA 3L9TA 4B8AA 3FUHA 4H12A 1K1AA 3TWXA 4N5CA 3TXMA 4B89A 2GRRB 3K5KA 4K5AB 4JEUA 5A6CA 4IN3B 3T5VA 5AARA 1FCHA 2CHZA 1IXVA 1UW4B 2CFUA 2WXKA 3CBMA 3DB5A 4XI9A 4I6JA 5IY5E 4ANVA 2WXFA 3CV0A 4KBQA 3MV3B 2YQ8A 3RJVA 3B7BA 3FTZA 4J8SA 5CHEE 3ZIMA 2PM6A 4A3VA 3UM3A 3D9IA 3PUKA 3W9FA 1NP7A 2J4DA 4U8YD 1XQHA 1ELWA 1N11A 3RSEG 2YHCA 1SQMA 3HXEA 2M63A 3U9WA 2VSNA 4OAVB 2VYIA 4DRXE 2P58C 4EPZA 3T8KA 2GGFA 2I1KA 2WQ7A 3EU9A 1MX2A 4GPMA 3DALA 1W3BA 2KXPC 3FUDA 4QEPA 3JUEA 2XPYA 1Y8MA 5F59A 3RQ4A 3VTXA 4L2YA 1MX4A 4F3VA 2R2LA 3FTYA 2XS1A 5EN5D 1SZAA 5T8IA 4F1PA 2GRMA 4L7TA 4XX5A 1FVFA 2KBXA 2P9IG 2XZDG 2WM9A 3F9WA 3OPEA 2EIME 5KNHD 1U3CA 3GZ2A 2F37A 1HH8A 3FU6A 4TXRA 2R59A 3D3MA 3F6QA 4GTOA 3FEYA 1TJCA 5KNGA 4DX1A 2XPZA 3DWLG 5A23A 4I2WA 4AVXA 2AXUA 5JIYA 2H6GA 3UT4A 2EINE 3OAWA 4I2ZA 5JHAA 4APOA 3AAAC 3CGHA 4KZ0A 1E8YA 5ENNA 5C1DA 3FUJA 4PUCA 4BX8A 4LNGA 1S64A 4G23A 4GTPA 3DPDA 2V5FA 4UI9C 3C98A 3OXFA 4N2QA 5JHNA 4HQDA 4I9EA 4LEUA 4OYSA 4GMRA 4YNPA 1MJ0A 5FINA 2BKKB 5JJ6A 3EHMA 4RG9A 3BQOA 1DVPA 5AQBA 3SBSA 1JWFA 3AU5A 1QBQA 3CQCB 3NAWA 5FQ4A 3CHOA 1BU9A 4GCOA 3Q7AA 4WWOA 5AQ7A 3AG3E 2RG8A 2OEWA 4JVSA 5D0QD 1ZKKA 3TL5A 3L13A 1O9SA 3KD7A 4L23A 5HI7A 5DIZA 3PZDA 4JHRA 3S7BA 1A5EA 2VGEA 5JA4D 3FULA 1HXIA 4JW1A 4C0MA 3UT7A 4Q94A 2L6BA 5CECB 3FUMA 1BI7B 2X3MA 3WG7E 1DC2A 4URKA 4IYPA 2VQ2A 2FBNA 4L9PA 4AV7A 3T9KA 5CRUA 2NYJA 4PDXA 3TWWA 1H6PA 2YHEA 2HYZA 2VGXB 5JINA 2FI7A 3M59A 2ETBA 2RKKA 3IV0A 4KT6B 5FZRA 3G2UA 4JXTA 4V3IA 3UX4A 3ZKJA 3JXJA 3DSVA 2MYOA 3CVWA 5EYLA 4A3TA 5FQ6A 3ASNE 2BKGA 1OWPA 3L17A 2EIKE 3ZYKA 5BV0A 2EIJE 2XQ0A 2G46A 1XNFA 4FULA 3QWWA 1SZ9A 3BO5A 2XENA 3M56A 3HIZA 2CHXA 3FY4A 4GZDA 4MBGA 2I1JA 4N3BA 2W5ZA 4HOSA 1FPPA 2FO1E 2W5YA 2ILRA 3E32A 3OXGA 3CK9A 3VLDA 4U95D 1ZU2A 2A5EA 1HF8A 5CCMA 5FIOA 4Q69A 2J8SD 2Y0BG 1KT1A 3D9MA 4IJ8A 4TUMA 2XRZA 3PDNA 4A1GA 5B3SE 3MCXA 3QAQA 1GW6A 4O60A 1BPOA 2QYUA 4LSZE 4G2VA 3V79K 4BEPA 4YDYA 2VSYA 3EIQC 3IHYA 4I9CA 4J8FA 4ILIA 4FJZA 3CKCA 3RAYA 4O6FA 3RK6A 4BSZB 3CKBA 4KVMA 1E7UA 4QENA 5LCWC 2XEVA 4LERA 2GRPB 2LO6A 3BG1B 3MKQB 4XIFA 1E8XA 3MO5A 2X38A 3UKRG 5TEGA 5EG2A 4MS6A 3DSWA 3ZPJA 2I9CA 1SA4A 3CK8A 2J09A 2OOEA 1WAO1 4GA1A 1TNBA 2XEHA 2AW6A 3C3RA 5EIBE 5JHBA 3CK7A 1HZ4A 3Q73A 1KPSB 5EX0A 5AQAA 3KS2A 3BEEA 3DEOA 3S7DA 3DSUA 3R7RA 5HQ8A 4WNFA 3PEUB 4U04A 3FTSA 1TN7A 3ONKA 3I5PA 2V8SE 3UIPC 3GZ1A 1N94A 3ML8A 3ZGQA 3PS6A 3QB2A 4U07A 1OCOE 3DSTA 5AQ9A 1N95A 5CMWA 3CR3A 5CBOA 3CVNA 2WXLA 1MQSA 2ETAA 3I4GA 2HO1A 5F6KC 4GTMA 4YPEA 2ZU6B 3E37A 3LY7A 4PH4B 1TEZA 4XZ4A 5G55A 1NI1A 2RFMA 4CYMD 5EX3A 2WXNA 3ESKA 2DYSE 4G26A 4J6IA 4O1OA 1MYOA 5FTPA 4NURA 4IJDA 5ARGA 4RSYA 3EHRA 3SGHA 4B94A 3ZW3A 4LUNU 1OWNA 4GZCA 4NACA 3M5AA 3CHPA 5T3RA 3T8MA 2GRLA 3TG4A 1OCRE 5BNWA 1N4RA 3PEVB 2IO3C 2QPWA 4DLQA 2R05A 4HNAD 1OT8A 4FLHA 1OWOA 3Q49B 3ABKE 3DXKG 3NF1A 2QC9A 4BTAA 3L08A 5AN8A 2ZISA 4I6EA 1KZOA 2PM7A 2ZIRA 3B13A 3LKUA 4G24A 4HRMB 4GA0A 1D9SA 2A5UA 4HOUA 1QNFA 1MT6A 4WNGA 4U0SA 3VLEA 2BF0X 4JHKA 1E7VA 3Q7FA 3ULEG 2X6FA 2QY7A 4C0EA 4U0UA 3L22A 5AJLA 3ZYLA 3PNTB 4WAFA 1TNOA 2LSUA 2KC7A 3ZEFA 4CZ2D 3VLFA 3I4RB 4BT8A 4Y6CA 2DVWA 5BW8C 3D9JA 4YVQC 1K8KG 4YVOA 4LNBA 2H6FA 1WDYA 4APFA 3MYVA 1WY6A 4GA2A 4WWPA 3EJNA 1DCQA 5FZQA 1AP7A 3EHQA 1K3ZD 2V0PA 3VTYA 1NA3A 3AS4A 3RKVA 3C72A 3Q78A 3UM2A 2IFUA 4J8EA 5J90A 3RRNB 1ZBPA 4IRUA 1HFAA 4HFGA 4HVBA 4GTTA 5EILA 4DX7D 3PH0C 3UUXA 4UWLA 2RFIA 2XGMA 4FHJA 3UM0A 2WXGA 4G1TA 3UI2A 3JYSA 2Y1LE 2OCCE 2XEEA 3IBEA 2ONDA 2GRQB 2E0IA 2P9NG 3KMTA 4CGVA 3M58A 4EECA 4YNMA 3CQGB 3FEXA 3ML9A 5ENSD 3DSSA 4LDGA 4YDOA 3MO2A 4BY6A 3PZ4A
chains in the Genus database with same CATH topology
4AV7A 2NSZA 4J7FA 4LCTA 4AIFA 3G2VA 3SF4A 4PDXA 2YHEA 4GU5A 3QWVA 2HYZA 2VGXB 3FFLA 5JJTA 5JINA 2FI7A 4UI9J 4J7IA 2XCBA 3M59A 2WXRA 3ASDA 3SI5A 3NQPA 1HG5A 3IV0A 3R9AB 2XGSA 4FMUA 4PS8A 5LCWJ 4KT6B 4L2LA 4EZLA 2IOLA 5DBKA 5FZRA 1Z3XA 3CVPA 3G2UA 1NZNA 4BSXA 2VGYA 5FQ8A 1LF8A 2VJ8A 4GYOA 5LOZA 5F6LA 2IU1A 4KVOA 3CLJA 4I1MA 4JXTA 4PS7A 5LSZA 1EPUA 3CHMA 3LS8A 4N3CA 1H6KA 2A4ZA 3PE3A 4V3IA 2GW1A 3DBSA 3ESLA 4OVVA 3LY9A 3AS5A 4FU3A 3FPDA 3F9ZA 3HDXA 4CEMA 5J08A 3Q5MA 3CVWA 1H2UA 3JQ0A 4KYOB 4F7AA 1P5QA 3FTXA 5FZSA 4ANUA 3Q15A 3CVXA 4ACKA 4A3TA 3PVLA 5FQ6A 4J83A 4JLGA 3OOIA 5KCMA 3MA5A 4ANXA 3MGBA 2J08A 3MV2B 3IKOB 4CRWA 1OWPA 3L17A 3ZVVA 2XGOA 1VDYA 5BT1A 3B7UX 2JLBA 1UN9A 2WXIA 3HNAA 3MJWA 3QJZA 4JA7A 4GAAA 3ZYKA 4B8CB 3MO0A 2WPVA 5BV0A 4JHJA 4BX9A 2KZTB 3FUEA 2XQ0A 4MRUA 2X6JA 4NRHB 2G46A 3FTWA 1PEGA 4RG6A 1HG2A 1E8ZA 1XNFA 4C1QA 1N54A 1IHGA 3PNLB 4FULA 1Y6IA 4U8HA 3QWWA 1SZ9A 3TXNA 4HORA 1UJKA 3LY8A 3NZUA 2FULA 3D9LA 5AENA 3G2TA 3BO5A 4J8DA 3M56A 3HIZA 4Y6WA 2CHXA 3FY4A 4GZDA 2FO7A 1U3DA 4H7XA 3LPZA 2I1JA 4N3BA 5KJKA 2WQ6A 2L6JA 3SHFA 2CG3A 4U63A 2W5ZA 1S0PA 2E2EA 2X6IA 3MEKA 5T0KA 4HOSA 3RU0A 4EBAA 5CPRB 2W5YA 2ILRA 2KCVA 3BG0B 4JC8A 3OXGA 3CK9A 3VLDA 4UQZA 3ULQA 3CHQA 1PAQA 2WVIA 1ZU2A 2XRYA 3ZYQA 4CCAA 3RIBA 2Y4UA 1HF8A 3P2BA 2R5SA 5A7DB 5CCMA 4HLEA 5BUZA 2EQXA 1INZA 4Q69A 4R7LA 1E8WA 3T5XA 5JJ0A 3U66A 3Q47B 4I1AA 2LNIA 5EDSA 2JV0A 1EDUA 1KT1A 1WM5A 2IQCA 3CVUA 5TTFA 3CVVA 3D9MA 2MOWA 4TV3A 1TJFA 4IJ8A 5LSXA 2YNQA 2C0LA 2UY1B 3LEWA 3RO2A 2XHEA 4UWKA 4AJWA 4I17A 4A55A 4ANWA 3FTVA 2MHKA 2OVBA 2QFCA 1H0AA 3NZSA 2XRZA 2J07A 3PDNA 3IHXA 4A1GA 1IQUA 2WXJA 3MCXA 5FWQA 3TG5A 4AXHA 3QAQA 2IJGX 3OS5A 2LAIA 5T0MA 5JJ7A 1GW6A 4ILGA 1BPOA 2VTBB 4M3OA 4G2VA 4C9BB 4B0ZA 3CSFA 4QFVA 3MKRA 1HU3A 2VSYA 4F1SA 3EIQC 3IHYA 4WNEA 4I9CA 3S7FA 4A1SA 3FH5A 3ZHEB 4AM9A 5AYFA 4J8FA 4ILIA 3F9XA 4FJZA 2MRIA 2RD0A 4ABNA 2CG2A 5D0OD 3CKCA 3RAYA 4O6FA 3APFA 4W9RA 3RK6A 3WXXA 5C2YA 3CKBA 4NVQA 4BUPA 3TGOA 4KVMA 1E7UA 4L1BA 4QENA 2JEKA 2XEVA 5LCWC 5FQ7A 5KJNA 3FU3A 3MX3A 3G2WA 4LERA 2O8JA 4GYYA 4EBAG 3LXUX 4EZJA 4YPAA 2LO6A 1B89A 3MZLB 3PE4A 2OVFA 3BG1B 4FLBA 2DBAA 4CDRA 1H19A 2I6HA 2WXHA 3MKQB 5AIJA 3D9PA 3SZ7A 4XIFA 4CDNA 2C0MA 3JUIA 4AU7A 3FHEA 4YPUA 4GZ6A 3FUNA 2WMNA 3D9KA 5LP0A 2WQHA 3P1UA 4GCNA 4QEOA 3M55A 1E8XA 4JZYA 2X6KA 3B7SA 2L0TB 5G04C 4GPKA 3MO5A 1QQEA 3ASFA 3EHNA 2X38A 3SD5A 4KZCA 1H2TC 4DI3A 4J0UA 1ELRA 3UPVA 5TEGA 4DPRA 5EG2A 4MS6A 4UQYA 3ASHA 4ME2A 3APDA 3ZPJA 4H7YA 3TJPA 3ZN3A 2I9CA 3CK8A 3KAEA 4CGWA 2J09A 3CVYA 4NJ5A 2OOEA 1WAO1 5BV1A 3B7RL 2L0IA 3S8PA 3EDTB 3CHSA 4GA1A 3U4TA 5CCLA 3FUFA 4K03A 2AW6A 3D9OA 5EKQD 1E90A 1HX8A 1ML9A 3VV0A 2PQNA 2AWIA 3FUIA 1UN8A 3F9YA 3URZA 3QC1A 4RZ0A 3ONLA 4TRQA 1MUFA 1NA0A 4N39A 3JQ1A 4UWGA 1H2VC 2J9QA 5JHBA 1PY1A 3CK7A 1HZ4A 4MKTA 4UWFA 5EX0A 5BPPA 2KATA 2PQRA 2VSXE 3KS2A 1Z6TA 3BEEA 3AS8A 3PUJA 3OXLA 3CSTA 3ZFWA 3M57A 2Y3AA 3RO3A 5AYWD 3S7DA 4RVBA 4B8AA 3FUHA 3R7RA 5HQ8A 4H12A 1UJJA 5AJDA 4WNFA 4XKCA 3KMAA 3PEUB 4U04A 4N5CA 3FUKA 3FTSA 5E75A 4EZKA 3M54A 3TXMA 3ONKA 3GZSA 2V8SE 3I5PA 3FWVA 2AXVA 3ASGA 5G04J 4AEZC 4B89A 4O30A 3K5KA 3SBTB 3GZ1A 4JEUA 5A6CA 1KT0A 4IN3B 5ANRA 3T5VA 5G05C 1HO8A 3ML8A 1FCHA 3ZGQA 3HYMB 4TUUA 1PC2A 3KEZA 2CHZA 3PS6A 1UW4B 4WWNA 3QB2A 4U07A 4WUYA 2CFUA 2WXKA 3UQ3A 3Q4AB 3CBMA 2I2OA 3FU0A 2CHWA 3RJWA 3S2AA 4HS2A 5CMWA 3CR3A 4GZ3A 3CVNA 4XI9A 4I6JA 3DB5A 2WXLA 4MI0A 1MQSA 2LAHA 4IULA 3JCKC 4ANVA 1HS6A 2HM8A 3I4GA 4KXKB 2WXFA 3CV0A 4KBQA 3SWCA 2KCKA 2HO1A 2R3AA 3MV3B 2YQ8A 3RJVA 4I1OB 4BTBA 4E85A 5F6KC 3SNXA 2VGXA 4XE0A 4YPEA 3FTZA 4PS3A 2ZU6B 4I43A 4J8SA 2PZIA 2PM6A 5CHEE 4JL0A 5G05J 4A3VA 3LY7A 3D9IA 3PUKA 4PH4B 3ZYMA 1TEZA 4XZ4A 3CBPA 4ATGA 4ILHB 1NP7A 5G55A 4D10C 3FH8A 5LX8A 2J4DA 2Y4TA 5EX3A 2WXNA 3QWPA 1OWLA 2L9BA 3ESKA 4G26A 4J6IA 3ZRHA 1XQHA 1JPLA 4HXIA 1ELWA 1MVXA 4J8OA 2WB2A 5FTPA 4AP2A 2YHCA 1SQMA 4NURA 4E6HA 4IJDA 1IYGA 5ARGA 2M63A 4CT4A 3U9WA 2NC9A 4RSYA 2BTDA 5M72A 1XGWA 2VSNA 3SGHA 3QARA 4XI0A 4B94A 2VYIA 3U64A 1E96B 3FH7A 3ZW3A 4LUNU 2Q7FA 4DJAA 1OWNA 4GZCA 1JWGA 4NACA 3M5AA 2P58C 2BUGA 3GW4A 4FHKA 3RRUA 3CHPA 4E47A 5T3RA 3T8MA 2GRLA 4EPZA 3TG4A 2IF4A 2GGFA 2I1KA 4FJYA 4BT9A 5BNWA 2XCCA 4AOFA 1UG3A 1JUQA 2J49A 4NQ0A 2AVPA 3E4BA 2WQ7A 3PEVB 2F69A 2IGQA 4GMLA 4UWHA 4DI4A 2QPWA 3DALA 1W3BA 3FUDA 4QEPA 5KJMA 3ZXSA 5F59A 2XPYA 1Y8MA 3L6AA 3RQ4A 3B7TA 2YINA 3FP3A 3VTXA 4L2YA 3FTYA 4DLQA 4DK5A 4F3VA 4U0ZA 4FLHA 3UT8A 1OWOA 1SZAA 3TAXA 3QDNA 3Q49B 3PRZA 1MHQA 5T8IA 2GRMA 1IQRA 3NF1A 2IOSA 3OTNA 4FP7A 4EQFA 4BTAA 4L7TA 4WNDA 3L08A 4XX5A 2KM4A 1FVFA 3O4ZA 3I3NA 4I6EA 3QK0A 4ACLA 4UI9K 2DIWA 4I51A 4FA6A 3U3WA 3FDHA 2WM9A 3F9WA 4LRZA 4CDMA 2PM7A 3M53A 3OPEA 3HVEB 3FU5A 3S7JA 3L16A 1U3CA 3GZ2A 3B13A 3LKUA 4MLPA 5T5GA 4G24A 1HH8A 4GA0A 3CIAA 3FU6A 4HOTA 2A5UA 4HOUA 1QNFA 1MT6A 4WNGA 2R59A 3D3MA 4U0SA 3VLEA 3FEYA 1OUVA 4DLOA 2UY1A 1TJCA 2BF0X 4N2SA 2FEZA 4JHKA 1E7VA 1QZ2A 2XPIA 3HHMA 4AY5A 5KJLA 4FADA 2VTBA 2CFZA 2QY7A 2X6FA 2XPZA 2J4BA 4I2WA 3UX4A 5A23A 4C0EA 4U0UA 4GB9A 4AVXA 4JA9A 2AXUA 3L22A 4XKBA 1Z3YA 2VSOE 5AJLA 5JIYA 4K0RA 3PNTB 4WAFA 5G2NA 4JPSA 3ZYLA 2WXQA 3UT4A 3SW9A 2DCPA 3LYAA 5FT9A 2LSUA 2KC7A 2WMOA 2WXOA 3IHVA 1A17A 3OAWA 4I2ZA 4G11A 3ZEFA 2PL2A 5JHAA 1N3JA 3LDZA 4APOA 3APCA 3VLFA 3I4RB 4MI5A 3CGHA 4JEHA 3UMVA 4KZ0A 2UWJG 4P29A 4BT8A 3LVRE 4Y6CA 3EIJA 1OWMA 1E8YA 5ENNA 5LFAA 3SFZA 5C1DA 3FUJA 4PUCA 5BW8C 1EF1C 3D9JA 2V4LA 4BX8A 4YVQC 4F53A 1N6CA 4YVOA 4G23A 5T4YA 4UQXA 3QOUA 4BWRA 3L54A 4AY6A 2LSVA 5FJYA 2KCLA 3DPDA 2V5FA 4UI9C 1ELKA 3C98A 3CHRA 3OXFA 4APFA 4N2QA 1N6AA 5JHNA 3MYVA 4JDSA 4I9EA 3VUZA 1FVHA 1WY6A 4GA2A 4WWPA 4LEUA 4OYSA 5CMYA 3LVQE 4YNPA 2BQZA 3R7QA 3EJNA 2X6HA 1H3IA 4Q96A 1N52A 4CT0A 2KZTA 1EYHA 4GMJA 5FZQA 5JJ6A 3ZIMA 3D9NA 3EHMA 3MKQA 4RG9A 1DVPA 4OVUA 3ZHEA 3SBSA 3PREA 3G2SA 1JWFA 3HVEA 3O48A 5E76A 5ARFA 3AU5A 3CQCB 2V0PA 3VTYA 1NA3A 3AS4A 3RKVA 4BFRA 2IFUA 2AXZA 5FQ4A 3CHOA 4J8EA 5J90A 3QKYA 4GCOA 3RRNB 2R17C 3QNKA 1ZBPA 4IRUA 1HFAA 3IEGA 3N71A 4WWOA 4HFGA 2OV8A 4HVBA 3KMJA 2RG8A 3FTUA 3PH0C 3CVLA 1L5JA 3UUXA 4UWLA 2RFIA 4JVSA 5D0QD 2XGMA 3LJ3A 1ZKKA 3TL5A 3L13A 4FHJA 1O9SA 2WXPA 3KD7A 3LCAA 2WXGA 2C2LA 4G1TA 4L23A 5DIZA 5HI7A 3PZDA 3ENEA 5F5EA 4JHRA 4Z4PA 4YNDA 3S7BA 4G25A 4FC8A 3JYSA 4GZ5A 2NXPA 3IBEA 2ONDA 5TH7A 2E0IA 3FULA 1HXIA 1MVHA 2WXMA 4N3AA 4JW1A 2HR2A 3GYZA 4C0MA 3K9IA 3KMTA 3UT7A 3CEQA 5ANLA 4CGVA 4KMOA 4Q94A 3M58A 4EECA 2IONA 3RRMB 3FUMA 3AU4A 2X3MA 4GYWA 1DNPA 4HOQA 4YNMA 3CQGB 1X5BA 3FEXA 3CBOA 1HE8A 1KLXA 3ML9A 3EP0A 1YA0A 3CVQA 4LDGA 4URKA 2FF4A 4IYPA 2VQ2A 3MO2A 4BY6A 2FBNA 4I6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7F A;  4AIF A;  3SF4 A;  3QWV A;  2HYZ A;  2VGX B;  3FFL A;  5JJT A;  5JIN A;  2FI7 A;  4UI9 J;  4J7I A;  2XCB A;  3M59 A;  3ASD A;  3R9A B;  2XGS A;  4FMU A;  5LCW J;  5DBK A;  5FZR A;  3CVP A;  1NZN A;  2VGY A;  4GYO A;  5F6L A;  5LSZ A;  4JDS A;  4N3C A;  3PE3 A;  2GW1 A;  3LY9 A;  3AS5 A;  3FPD A;  3F9Z A;  3Q5M A;  4KYO B;  1P5Q A;  5FZS A;  3Q15 A;  4J83 A;  4JLG A;  3OOI A;  3MA5 A;  3MV2 B;  2XGO A;  5BT1 A;  2JLB A;  3HNA A;  4JA7 A;  3MO0 A;  2WPV A;  4NRH B;  2G46 A;  1PEG A;  4RG6 A;  1XNF A;  4C1Q A;  1IHG A;  3QWW A;  4HOR A;  3LY8 A;  3BO5 A;  4J8D A;  3M56 A;  4Y6W A;  2FO7 A;  4H7X A;  3LPZ A;  5KJK A;  4N3B A;  2L6J A;  2W5Z A;  2E2E A;  3MEK A;  5T0K A;  4HOS A;  3RU0 A;  5CPR B;  2W5Y A;  2KCV A;  3OXG A;  3CK9 A;  4UQZ A;  3ULQ A;  1ZU2 A;  3RIB A;  2Y4U A;  2R5S A;  5A7D B;  5CCM A;  5JJ0 A;  3Q47 B;  4I1A A;  2LNI A;  2JV0 A;  1KT1 A;  1WM5 A;  5TTF A;  4IJ8 A;  5LSX A;  3RO2 A;  2C0L A;  2UY1 B;  4I17 A;  2MHK A;  2QFC A;  3PDN A;  3IHX A;  3TG5 A;  3OS5 A;  5T0M A;  5JJ7 A;  4G2V A;  3MKR A;  2VSY A;  4WNE A;  4I9C A;  3S7F A;  4A1S A;  3ZHE B;  4AM9 A;  5AYF A;  4J8F A;  3F9X A;  4ABN A;  5D0O D;  3CKC A;  3RAY A;  4O6F A;  4W9R A;  3WXX A;  4NVQ A;  3CKB A;  4BUP A;  3TGO A;  4QEN A;  5LCW C;  2XEV A;  5KJN A;  2O8J A;  4GYY A;  4YPA A;  1B89 A;  3PE4 A;  2DBA A;  4CDR A;  2I6H A;  3SZ7 A;  4XIF A;  2C0M A;  4AU7 A;  4YPU A;  4GZ6 A;  4QEO A;  2WQH A;  4GCN A;  3M55 A;  4GPK A;  5G04 C;  3MO5 A;  1QQE A;  3ASF A;  4J0U A;  1ELR A;  3UPV A;  5TEG A;  5EG2 A;  4UQY A;  3ASH A;  4ME2 A;  3ZPJ A;  4H7Y A;  4CGW A;  3ZN3 A;  3CK8 A;  3KAE A;  4NJ5 A;  2OOE A;  1WAO 1;  3S8P A;  3EDT B;  4GA1 A;  3U4T A;  5CCL A;  5EKQ D;  1ML9 A;  3VV0 A;  2PQN A;  4RZ0 A;  3F9Y A;  3URZ A;  1MUF A;  1NA0 A;  4N39 A;  2J9Q A;  3CK7 A;  1HZ4 A;  5EX0 A;  2KAT A;  2PQR A;  3KS2 A;  3BEE A;  3AS8 A;  3OXL A;  3ZFW A;  3M57 A;  3RO3 A;  5AYW D;  3S7D A;  5HQ8 A;  4H12 A;  4WNF A;  3KMA A;  4U04 A;  4N5C A;  3M54 A;  3FWV A;  3ASG A;  4O30 A;  5G04 J;  3K5K A;  3GZ1 A;  5A6C A;  1KT0 A;  4IN3 B;  5G05 C;  1FCH A;  3ZGQ A;  3HYM B;  1PC2 A;  4U07 A;  4WUY A;  3UQ3 A;  3Q4A B;  3CBM A;  3RJW A;  4GZ3 A;  3CVN A;  4XI9 A;  3DB5 A;  4MI0 A;  4KXK B;  3SWC A;  3CV0 A;  4KBQ A;  2KCK A;  2HO1 A;  2R3A A;  3MV3 B;  2YQ8 A;  3RJV A;  4BTB A;  5F6K C;  2VGX A;  4YPE A;  5CHE E;  2PZI A;  5G05 J;  4JL0 A;  3LY7 A;  3CBP A;  2Y4T A;  5EX3 A;  3QWP A;  1XQH A;  3ESK A;  4G26 A;  1MVX A;  1ELW A;  4J8O A;  5FTP A;  2YHC A;  4IJD A;  1IYG A;  5ARG A;  2NC9 A;  5M72 A;  2VSN A;  4B94 A;  4XI0 A;  2VYI A;  1E96 B;  2Q7F A;  3M5A A;  2P58 C;  2BUG A;  3GW4 A;  4E47 A;  3TG4 A;  2IF4 A;  4BT9 A;  5BNW A;  2XCC A;  4NQ0 A;  2IGQ A;  2AVP A;  3E4B A;  2F69 A;  2QPW A;  3DAL A;  1W3B A;  4QEP A;  5KJM A;  5F59 A;  1Y8M A;  3RQ4 A;  3FP3 A;  3VTX A;  4F3V A;  4U0Z A;  3TAX A;  3QDN A;  3Q49 B;  3NF1 A;  4EQF A;  4BTA A;  4WND A;  4UI9 K;  4I51 A;  3U3W A;  3F9W A;  3M53 A;  3OPE A;  3S7J A;  3GZ2 A;  3LKU A;  5T5G A;  4G24 A;  1HH8 A;  4GA0 A;  4HOT A;  4HOU A;  1MT6 A;  4WNG A;  4U0S A;  1OUV A;  2UY1 A;  1TJC A;  4N2S A;  2FEZ A;  1QZ2 A;  2XPI A;  5KJL A;  4AY5 A;  4I2W A;  4U0U A;  4JA9 A;  5JIY A;  3SW9 A;  3LYA A;  5FT9 A;  2LSU A;  2KC7 A;  4I2Z A;  1A17 A;  2PL2 A;  1N3J A;  4APO A;  4MI5 A;  4BT8 A;  2UWJ G;  4Y6C A;  5C1D A;  5BW8 C;  4YVQ C;  1N6C A;  4YVO A;  4G23 A;  4UQX A;  3QOU A;  4BWR A;  4AY6 A;  2LSV A;  5FJY A;  2KCL A;  2V5F A;  4UI9 C;  3OXF A;  4N2Q A;  1N6A A;  5JHN A;  4I9E A;  3VUZ A;  4GA2 A;  4LEU A;  4YNP A;  2BQZ A;  1H3I A;  5FZQ A;  5JJ6 A;  4RG9 A;  3ZHE A;  3O48 A;  5ARF A;  3VTY A;  1NA3 A;  3AS4 A;  3RKV A;  2IFU A;  4J8E A;  3QKY A;  4GCO A;  1ZBP A;  3IEG A;  3N71 A;  3KMJ A;  3CVL A;  3UUX A;  2RFI A;  5D0Q D;  2XGM A;  1ZKK A;  1O9S A;  3KD7 A;  3LCA A;  2C2L A;  4G1T A;  5HI7 A;  5DIZ A;  5F5E A;  4JHR A;  4Z4P A;  4YND A;  3S7B A;  4G25 A;  3JYS A;  4GZ5 A;  2OND A;  5TH7 A;  1HXI A;  1MVH A;  4N3A A;  2HR2 A;  3GYZ A;  3K9I A;  3KMT A;  3CEQ A;  4CGV A;  3M58 A;  4HOQ A;  4GYW A;  4YNM A;  3CBO A;  1KLX A;  3EP0 A;  1YA0 A;  3CVQ A;  4LDG A;  2FF4 A;  2VQ2 A;  3MO2 A;  2FBN A; 
#chains in the Genus database with same CATH topology
 4LCT A;  3G2V A;  3E34 A;  2ZXW E;  4J7I A;  3ASD A;  3SI5 A;  2GRN B;  5LCW J;  1NFI E;  1MZC A;  1NZN A;  2VGY A;  5FQ8 A;  5F6L A;  2IU1 A;  3CLJ A;  5LSZ A;  3PE3 A;  2A4Z A;  3C3O A;  3DBS A;  4K5C A;  3LY9 A;  3AS5 A;  3F9Z A;  3Q5M A;  3JQ0 A;  3Q15 A;  4ACK A;  3DEP A;  4J83 A;  4ANX A;  3MGB A;  3IKO B;  3ZVV A;  3HG0 D;  5BT1 A;  4HBD A;  4JA7 A;  4B8C B;  2KZT B;  4MRU A;  3HRA A;  1E8Z A;  1Y6I A;  1WG0 A;  4HOR A;  1UJK A;  3LY8 A;  3NZU A;  4DX5 D;  3D9L A;  5AEN A;  4NIK A;  4J8D A;  3UXG A;  3ZNG A;  2FO7 A;  1U3D A;  3LPZ A;  2WQ6 A;  2L6J A;  3SHF A;  2CG3 A;  2E2E A;  2X6I A;  3MEK A;  3RU0 A;  4EBA A;  1BI8 B;  4JC8 A;  1OCC E;  1QYM A;  2XRY A;  3ZYQ A;  2R5S A;  1INZ A;  1E8W A;  1TYQ G;  3Q47 B;  3TWR A;  1EDU A;  1WM5 A;  3CVU A;  3CVV A;  2MOW A;  5LSX A;  2C0L A;  3RO2 A;  3LEW A;  4I17 A;  3FTV A;  3NZS A;  2QFC A;  3UTM A;  1N0R A;  2B6C A;  3IHX A;  2LAI A;  2IO2 C;  4ILG A;  4C9B B;  1Q2Z A;  3MKR A;  5KWD A;  4U7E B;  1LD7 A;  4G8L A;  3FH5 A;  3ZHE B;  4ABN A;  4HRN A;  5D0O D;  4W9R A;  3WXX A;  4BUP A;  1BD8 A;  4L1B A;  5FQ7 A;  5KJN A;  2O8J A;  4G8K A;  3LXU X;  4EZJ A;  4YPA A;  3PE4 A;  4FLB A;  2DBA A;  4CDR A;  4U96 D;  1S70 B;  2I6H A;  2C0M A;  4GCN A;  3M55 A;  4GPK A;  5G04 C;  4EHM A;  1H2T C;  4DI3 A;  4J0U A;  4DPR A;  4ME2 A;  4H7Y A;  4CGW A;  3KAE A;  3CVY A;  4JD2 G;  5BV1 A;  2L0I A;  1O1T A;  3CHS A;  4K03 A;  1TN6 A;  1TR4 A;  1E90 A;  1HX8 A;  1LTX A;  3DPY A;  2DZO A;  3QC1 A;  3HXD A;  4TRQ A;  1MUF A;  4UWG A;  3SQV A;  1H2V C;  5EID A;  1MX6 A;  4UWF A;  2KAT A;  3LJN A;  2PQR A;  2ETC A;  3HXC A;  3OXL A;  3M57 A;  3RO3 A;  1UJJ A;  5AJD A;  4XKC A;  3KMA A;  3J5Q B;  5E75 A;  4GTV A;  3M54 A;  3ASG A;  2ZGG A;  4AEZ C;  4TUU A;  2IEJ A;  4YDW A;  3UIN C;  2CHW A;  3RJW A;  3S2A A;  4HS2 A;  4IUL A;  2LAH A;  3JCK C;  1HS6 A;  2HM8 A;  3SWC A;  2KCK A;  2R3A A;  4I1O B;  3SNX A;  2VGX A;  4XE0 A;  2PZI A;  5G05 J;  3PZ2 A;  4JL0 A;  4Z68 A;  3CBP A;  4ATG A;  4ILH B;  1UOH A;  4D10 C;  3FH8 A;  5CBN A;  2Y4T A;  4C48 B;  3QWP A;  1JPL A;  1MVX A;  1FT2 A;  4AP2 A;  4E6H A;  4GTR A;  1ZB1 A;  3E33 A;  4CT4 A;  2BTD A;  1JCS A;  3QAR A;  3FH7 A;  3ISM C;  4DX2 A;  1NL4 A;  2BUG A;  3RRU A;  4E47 A;  1K1B A;  2IF4 A;  4BT9 A;  4FJY A;  2XCC A;  1UG3 A;  2J49 A;  4NQ0 A;  2IGQ A;  4HI9 A;  3ASO E;  4GML A;  4UWH A;  5KJM A;  3TAX A;  1D8D A;  1YCS B;  3QDN A;  3PRZ A;  1MHQ A;  1IQR A;  1OCZ E;  5D66 A;  3V2O A;  4EQF A;  4WND A;  2KM4 A;  3I3N A;  4DX6 D;  4FA6 A;  3U3W A;  3FDH A;  3M53 A;  4LRZ A;  1BLX B;  3CIA A;  3R9M A;  1Z5S C;  1OUV A;  1QZ2 A;  5KJL A;  4AY5 A;  4FAD A;  2VTB A;  3ZUV B;  2J4B A;  4GB9 A;  4JA9 A;  4XKB A;  1Z3Y A;  3Q9U C;  3L82 A;  5JMN D;  5FT9 A;  2WMO A;  3IHV A;  1A17 A;  2PL2 A;  1N3J A;  5HRY A;  3UMV A;  4P29 A;  2UWJ G;  3LVR E;  3EIJ A;  5LFA A;  1IKN D;  2AJA A;  3HXF A;  1EF1 C;  4F53 A;  4UQX A;  4BWR A;  3L54 A;  4B93 B;  4AY6 A;  3CHR A;  4DUI A;  1N6A A;  1FVH A;  5CMY A;  3SFX A;  2BQZ A;  3DSX A;  2X6H A;  1H3I A;  4Q96 A;  4GMJ A;  3G2S A;  3O48 A;  4BFR A;  5HKP A;  3QKY A;  4BES A;  2OV8 A;  2Y69 E;  1N9A A;  3TWS A;  1JCQ A;  2V5Q C;  1JCR A;  3FTU A;  1L5J A;  1G3N B;  4ATZ D;  3LCA A;  2C2L A;  3ENE A;  4Z4P A;  2LXM A;  4G25 A;  4FC8 A;  3TWU A;  2WXM A;  1N4P A;  4N3A A;  3K9I A;  1D8E A;  1O5M A;  3CEQ A;  4KMO A;  3RRM B;  3AU4 A;  4GYW A;  1DNP A;  1KLX A;  1YA0 A;  2FF4 A;  2NSZ A;  4GU5 A;  1HG5 A;  1O1S A;  1N4S A;  3R9A B;  4L2L A;  2IOL A;  2LUH A;  1TNZ A;  1LF8 A;  2VJ8 A;  4KVO A;  5H7P A;  4I1M A;  4PS7 A;  3CHM A;  3LS8 A;  3ESL A;  4CEM A;  1H2U A;  4KYO B;  4F7A A;  4ANU A;  5FZS A;  5AAO A;  2LXL A;  3OOI A;  2J08 A;  3MV2 B;  3Q79 A;  2DYR E;  1VDY A;  3B7U X;  2JLB A;  1UN9 A;  3JXI A;  4X8Q A;  1H6O A;  2WPV A;  4BX9 A;  3FUE A;  4NRH B;  2X6J A;  3FTW A;  5D2M C;  1PEG A;  4RG6 A;  1HG2 A;  4C1Q A;  3PNL B;  1YMP A;  4U8H A;  2F8X K;  3KSQ A;  3G2T A;  5KJK A;  1S0P A;  2RFA A;  3NBN B;  2B0O E;  5CPR B;  2F8Y A;  2P9S G;  2R03 A;  4J7W A;  3BG0 B;  3ULQ A;  3CHQ A;  5B1B E;  1PAQ A;  1SW6 A;  3RIB A;  2Y4U A;  4HLE A;  5BUZ A;  4R7L A;  3U66 A;  1N4Q A;  4I1A A;  5EDS A;  2JV0 A;  2H6H A;  2R02 A;  4TV3 A;  2YNQ A;  4N5Q A;  2XHE A;  4UWK A;  4A55 A;  2MHK A;  2OVB A;  4AXH A;  4M3O A;  4B0Z A;  3CSF A;  4QFV A;  1YYH A;  4F1S A;  4WNE A;  3AG2 E;  3S7F A;  4A1S A;  4AM9 A;  2CG2 A;  3ZXP A;  3APF A;  4NVQ A;  3Q9N C;  3TGO A;  2JEK A;  3MX3 A;  3G2W A;  4GYY A;  1B89 A;  3MZL B;  5ENT D;  2WXH A;  3D9P A;  4LG6 A;  3SZ7 A;  4CDN A;  3JUI A;  4AU7 A;  3FHE A;  4YPU A;  4GZ6 A;  3FUN A;  2WMN A;  5LP0 A;  2WQH A;  3P1U A;  4JZY A;  3EUV A;  2P9P G;  3ASF A;  3ULY A;  1S63 A;  1ELR A;  3UPV A;  2H6I A;  4UQY A;  3ASH A;  3B7R L;  3U4T A;  5CCL A;  4BER A;  3FUF A;  3J5P A;  3D9O A;  4HRL A;  2AWI A;  3FUI A;  3URZ A;  5ENR D;  3PZ1 A;  1NA0 A;  2F0Y A;  2J9Q A;  3TWV A;  1PY1 A;  4MKT A;  5KBA A;  4GTQ A;  4U8V D;  1SVX A;  3AS8 A;  3PUJ A;  5B1A E;  2XS8 A;  3FUK A;  4EZK A;  3GZS A;  3FWV A;  2AXV A;  4O30 A;  5G04 J;  1OY3 D;  3SBT B;  1V55 E;  1KT0 A;  5ANR A;  5G05 C;  1HO8 A;  3HYM B;  1PC2 A;  3KEZ A;  1AWC B;  4WWN A;  2PNN A;  4WUY A;  3V31 A;  3UQ3 A;  3Q4A B;  2I2O A;  3UIO C;  3FU0 A;  4ZHB A;  4HB5 A;  3TWT A;  2P9K G;  4ZFH A;  4GZ3 A;  4MI0 A;  4HI8 A;  4KXK B;  3AG1 E;  4BTB A;  4E85 A;  3SFY A;  4PS3 A;  4I43 A;  3ZYM A;  3UM1 A;  5LX8 A;  5CED B;  5HS0 A;  3ZRH A;  1OWL A;  2L9B A;  2QZA A;  4HXI A;  3IXE A;  4J8O A;  2WB2 A;  3B95 A;  1DCE A;  1IYG A;  5BXU A;  2NC9 A;  3BUA A;  5M72 A;  1XGW A;  4XI0 A;  3U64 A;  1E96 B;  4DJA A;  2Q7F A;  1TN8 A;  2QYJ A;  1JWG A;  3GW4 A;  4FHK A;  2ZGD A;  3PZ3 A;  4TXQ A;  1N0Q A;  4AOF A;  4F6R D;  1JUQ A;  2AVP A;  3E4B A;  2F69 A;  4DI4 A;  3UKU G;  3ZXS A;  3L6A A;  3KEA A;  4LNU D;  3B7T A;  2YIN A;  3FP3 A;  3KSL A;  1IHB A;  4DK5 A;  1U2V G;  4U0Z A;  3UT8 A;  2IOS A;  3OTN A;  4FP7 A;  3C3Q A;  3O4Z A;  4ACL A;  3QK0 A;  4UI9 K;  2DIW A;  4I51 A;  4CDM A;  3HVE B;  3FU5 A;  3S7J A;  3L16 A;  4MLP A;  5T5G A;  2GRO B;  4HOT A;  1X81 A;  4DLO A;  2UY1 A;  4N2S A;  2FEZ A;  2XPI A;  3HHM A;  2CFZ A;  2VSO E;  2EIL E;  4K0R A;  5G2N A;  4JPS A;  2WXQ A;  3SW9 A;  2DCP A;  3LYA A;  2WXO A;  2P9U G;  4G11 A;  3LDZ A;  3APC A;  4MI5 A;  4JEH A;  1OWM A;  3SFZ A;  4JB8 P;  2V4L A;  1LD8 A;  1N6C A;  5T4Y A;  3QOU A;  5BXO A;  2LSV A;  5FJY A;  2KCL A;  1ELK A;  2IY0 C;  4TXP A;  3ABM E;  3VUZ A;  3LVQ E;  4K5B A;  3R7Q A;  1N52 A;  4CT0 A;  2KZT A;  1EYH A;  3D9N A;  3MKQ A;  4OVU A;  3ZHE A;  3PRE A;  3HVE A;  5E76 A;  5ARF A;  2DZN A;  2AXZ A;  3SY2 A;  2R17 C;  3QNK A;  3IEG A;  3N71 A;  3KMJ A;  3CVL A;  3LJ3 A;  2WXP A;  5F5E A;  4XEI G;  4YND A;  4GZ5 A;  2NXP A;  1SA5 A;  5TH7 A;  1MVH A;  2HR2 A;  3GYZ A;  1O1R A;  5ANL A;  2ION A;  4HOQ A;  3X2Q E;  1X5B A;  3CBO A;  1HE8 A;  3EP0 A;  3CVQ A;  2HE0 A;  3HXB A;  4I6G A;  4J7F A;  4OAU C;  4AIF A;  3SF4 A;  5CER B;  3QWV A;  5JJT A;  3FFL A;  4UI9 J;  2XCB A;  2WXR A;  3NQP A;  2XGS A;  4FMU A;  4PS8 A;  4EZL A;  5DBK A;  1Z3X A;  4BET A;  3CVP A;  4BSX A;  5LOZ A;  4GYO A;  3SO8 A;  1EPU A;  4N3C A;  4JDS A;  1H6K A;  2GW1 A;  4OVV A;  4FU3 A;  3FPD A;  3HDX A;  5J08 A;  2P9L G;  1P5Q A;  3FTX A;  3CVX A;  3PVL A;  4JLG A;  5KCM A;  3EU5 A;  3MA5 A;  3W9G A;  4CRW A;  2XGO A;  4RLY A;  2WXI A;  3HNA A;  3MJW A;  3QJZ A;  4GAA A;  2JAB A;  3MO0 A;  4JHJ A;  4J8Y A;  1N54 A;  1IHG A;  4HLL A;  1RW2 A;  3TXN A;  2FUL A;  4Y6W A;  4H7X A;  4RQI A;  3AJI A;  3Q75 A;  4U63 A;  5T0K A;  2OEV A;  3TWQ A;  3DXM G;  1TNU A;  2KCV A;  1TNY A;  3C5R A;  4UQZ A;  4UUC A;  2WVI A;  4CCA A;  1RZ4 A;  3P2B A;  5A7D B;  2XZT G;  2EQX A;  3T5X A;  5JJ0 A;  2LNI A;  2IQC A;  5CRV A;  5TTF A;  1TJF A;  2UY1 B;  4AJW A;  3V30 A;  3V2X A;  4ANW A;  1H0A A;  3NOG D;  2J07 A;  3ABL E;  1IQU A;  2WXJ A;  5FWQ A;  3TG5 A;  2IJG X;  3OS5 A;  4M7C A;  5T0M A;  5JJ7 A;  2VTB B;  1HU3 A;  4YDE A;  5AYF A;  3F9X A;  2V4H C;  2MRI A;  2RD0 A;  5CEA A;  3E30 A;  5C2Y A;  2BED A;  1KZP A;  4O1P A;  3FU3 A;  4EBA G;  4GTS A;  3BU8 A;  2OVF A;  1H19 A;  5AIJ A;  1FT1 A;  1OXJ A;  4A63 B;  3NB2 A;  2DWZ A;  3D9K A;  4QEO A;  5ITZ F;  3RAU A;  5EYP F;  2X6K A;  3B7S A;  2L0T B;  1QQE A;  3EHN A;  3SD5 A;  4KZC A;  5ENO D;  3APD A;  3TJP A;  3ZN3 A;  4NJ5 A;  3S8P A;  3EDT B;  3ZU7 B;  2P2C P;  5EKQ D;  1ML9 A;  3VV0 A;  2PQN A;  4RZ0 A;  1UN8 A;  3F9Y A;  3ONL A;  5ENQ D;  5ENP D;  4N39 A;  3JQ1 A;  1V54 E;  3NOC D;  5BPP A;  2VSX E;  1Z6T A;  3D9H A;  3AG4 E;  3CST A;  3DRA A;  3ZFW A;  2Y3A A;  4QQI A;  5AYW D;  4RVB A;  3L9T A;  4B8A A;  3FUH A;  4H12 A;  1K1A A;  3TWX A;  4N5C A;  3TXM A;  4B89 A;  2GRR B;  3K5K A;  4K5A B;  4JEU A;  5A6C A;  4IN3 B;  3T5V A;  5AAR A;  1FCH A;  2CHZ A;  1IXV A;  1UW4 B;  2CFU A;  2WXK A;  3CBM A;  3DB5 A;  4XI9 A;  4I6J A;  5IY5 E;  4ANV A;  2WXF A;  3CV0 A;  4KBQ A;  3MV3 B;  2YQ8 A;  3RJV A;  3B7B A;  3FTZ A;  4J8S A;  5CHE E;  3ZIM A;  2PM6 A;  4A3V A;  3UM3 A;  3D9I A;  3PUK A;  3W9F A;  1NP7 A;  2J4D A;  4U8Y D;  1XQH A;  1ELW A;  1N11 A;  3RSE G;  2YHC A;  1SQM A;  3HXE A;  2M63 A;  3U9W A;  2VSN A;  4OAV B;  2VYI A;  4DRX E;  2P58 C;  4EPZ A;  3T8K A;  2GGF A;  2I1K A;  2WQ7 A;  3EU9 A;  1MX2 A;  4GPM A;  3DAL A;  1W3B A;  2KXP C;  3FUD A;  4QEP A;  3JUE A;  2XPY A;  1Y8M A;  5F59 A;  3RQ4 A;  3VTX A;  4L2Y A;  1MX4 A;  4F3V A;  2R2L A;  3FTY A;  2XS1 A;  5EN5 D;  1SZA A;  5T8I A;  4F1P A;  2GRM A;  4L7T A;  4XX5 A;  1FVF A;  2KBX A;  2P9I G;  2XZD G;  2WM9 A;  3F9W A;  3OPE A;  2EIM E;  5KNH D;  1U3C A;  3GZ2 A;  2F37 A;  1HH8 A;  3FU6 A;  4TXR A;  2R59 A;  3D3M A;  3F6Q A;  4GTO A;  3FEY A;  1TJC A;  5KNG A;  4DX1 A;  2XPZ A;  3DWL G;  5A23 A;  4I2W A;  4AVX A;  2AXU A;  5JIY A;  2H6G A;  3UT4 A;  2EIN E;  3OAW A;  4I2Z A;  5JHA A;  4APO A;  3AAA C;  3CGH A;  4KZ0 A;  1E8Y A;  5ENN A;  5C1D A;  3FUJ A;  4PUC A;  4BX8 A;  4LNG A;  1S64 A;  4G23 A;  4GTP A;  3DPD A;  2V5F A;  4UI9 C;  3C98 A;  3OXF A;  4N2Q A;  5JHN A;  4HQD A;  4I9E A;  4LEU A;  4OYS A;  4GMR A;  4YNP A;  1MJ0 A;  5FIN A;  2BKK B;  5JJ6 A;  3EHM A;  4RG9 A;  3BQO A;  1DVP A;  5AQB A;  3SBS A;  1JWF A;  3AU5 A;  1QBQ A;  3CQC B;  3NAW A;  5FQ4 A;  3CHO A;  1BU9 A;  4GCO A;  3Q7A A;  4WWO A;  5AQ7 A;  3AG3 E;  2RG8 A;  2OEW A;  4JVS A;  5D0Q D;  1ZKK A;  3TL5 A;  3L13 A;  1O9S A;  3KD7 A;  4L23 A;  5HI7 A;  5DIZ A;  3PZD A;  4JHR A;  3S7B A;  1A5E A;  2VGE A;  5JA4 D;  3FUL A;  1HXI A;  4JW1 A;  4C0M A;  3UT7 A;  4Q94 A;  2L6B A;  5CEC B;  3FUM A;  1BI7 B;  2X3M A;  3WG7 E;  1DC2 A;  4URK A;  4IYP A;  2VQ2 A;  2FBN A;  4L9P A;  4AV7 A;  3T9K A;  5CRU A;  2NYJ A;  4PDX A;  3TWW A;  1H6P A;  2YHE A;  2HYZ A;  2VGX B;  5JIN A;  2FI7 A;  3M59 A;  2ETB A;  2RKK A;  3IV0 A;  4KT6 B;  5FZR A;  3G2U A;  4JXT A;  4V3I A;  3UX4 A;  3ZKJ A;  3JXJ A;  3DSV A;  2MYO A;  3CVW A;  5EYL A;  4A3T A;  5FQ6 A;  3ASN E;  2BKG A;  1OWP A;  3L17 A;  2EIK E;  3ZYK A;  5BV0 A;  2EIJ E;  2XQ0 A;  2G46 A;  1XNF A;  4FUL A;  3QWW A;  1SZ9 A;  3BO5 A;  2XEN A;  3M56 A;  3HIZ A;  2CHX A;  3FY4 A;  4GZD A;  4MBG A;  2I1J A;  4N3B A;  2W5Z A;  4HOS A;  1FPP A;  2FO1 E;  2W5Y A;  2ILR A;  3E32 A;  3OXG A;  3CK9 A;  3VLD A;  4U95 D;  1ZU2 A;  2A5E A;  1HF8 A;  5CCM A;  5FIO A;  4Q69 A;  2J8S D;  2Y0B G;  1KT1 A;  3D9M A;  4IJ8 A;  4TUM A;  2XRZ A;  3PDN A;  4A1G A;  5B3S E;  3MCX A;  3QAQ A;  1GW6 A;  4O60 A;  1BPO A;  2QYU A;  4LSZ E;  4G2V A;  3V79 K;  4BEP A;  4YDY A;  2VSY A;  3EIQ C;  3IHY A;  4I9C A;  4J8F A;  4ILI A;  4FJZ A;  3CKC A;  3RAY A;  4O6F A;  3RK6 A;  4BSZ B;  3CKB A;  4KVM A;  1E7U A;  4QEN A;  5LCW C;  2XEV A;  4LER A;  2GRP B;  2LO6 A;  3BG1 B;  3MKQ B;  4XIF A;  1E8X A;  3MO5 A;  2X38 A;  3UKR G;  5TEG A;  5EG2 A;  4MS6 A;  3DSW A;  3ZPJ A;  2I9C A;  1SA4 A;  3CK8 A;  2J09 A;  2OOE A;  1WAO 1;  4GA1 A;  1TNB A;  2XEH A;  2AW6 A;  3C3R A;  5EIB E;  5JHB A;  3CK7 A;  1HZ4 A;  3Q73 A;  1KPS B;  5EX0 A;  5AQA A;  3KS2 A;  3BEE A;  3DEO A;  3S7D A;  3DSU A;  3R7R A;  5HQ8 A;  4WNF A;  3PEU B;  4U04 A;  3FTS A;  1TN7 A;  3ONK A;  3I5P A;  2V8S E;  3UIP C;  3GZ1 A;  1N94 A;  3ML8 A;  3ZGQ A;  3PS6 A;  3QB2 A;  4U07 A;  1OCO E;  3DST A;  5AQ9 A;  1N95 A;  5CMW A;  3CR3 A;  5CBO A;  3CVN A;  2WXL A;  1MQS A;  2ETA A;  3I4G A;  2HO1 A;  5F6K C;  4GTM A;  4YPE A;  2ZU6 B;  3E37 A;  3LY7 A;  4PH4 B;  1TEZ A;  4XZ4 A;  5G55 A;  1NI1 A;  2RFM A;  4CYM D;  5EX3 A;  2WXN A;  3ESK A;  2DYS E;  4G26 A;  4J6I A;  4O1O A;  1MYO A;  5FTP A;  4NUR A;  4IJD A;  5ARG A;  4RSY A;  3EHR A;  3SGH A;  4B94 A;  3ZW3 A;  4LUN U;  1OWN A;  4GZC A;  4NAC A;  3M5A A;  3CHP A;  5T3R A;  3T8M A;  2GRL A;  3TG4 A;  1OCR E;  5BNW A;  1N4R A;  3PEV B;  2IO3 C;  2QPW A;  4DLQ A;  2R05 A;  4HNA D;  1OT8 A;  4FLH A;  1OWO A;  3Q49 B;  3ABK E;  3DXK G;  3NF1 A;  2QC9 A;  4BTA A;  3L08 A;  5AN8 A;  2ZIS A;  4I6E A;  1KZO A;  2PM7 A;  2ZIR A;  3B13 A;  3LKU A;  4G24 A;  4HRM B;  4GA0 A;  1D9S A;  2A5U A;  4HOU A;  1QNF A;  1MT6 A;  4WNG A;  4U0S A;  3VLE A;  2BF0 X;  4JHK A;  1E7V A;  3Q7F A;  3ULE G;  2X6F A;  2QY7 A;  4C0E A;  4U0U A;  3L22 A;  5AJL A;  3ZYL A;  3PNT B;  4WAF A;  1TNO A;  2LSU A;  2KC7 A;  3ZEF A;  4CZ2 D;  3VLF A;  3I4R B;  4BT8 A;  4Y6C A;  2DVW A;  5BW8 C;  3D9J A;  4YVQ C;  1K8K G;  4YVO A;  4LNB A;  2H6F A;  1WDY A;  4APF A;  3MYV A;  1WY6 A;  4GA2 A;  4WWP A;  3EJN A;  1DCQ A;  5FZQ A;  1AP7 A;  3EHQ A;  1K3Z D;  2V0P A;  3VTY A;  1NA3 A;  3AS4 A;  3RKV A;  3C72 A;  3Q78 A;  3UM2 A;  2IFU A;  4J8E A;  5J90 A;  3RRN B;  1ZBP A;  4IRU A;  1HFA A;  4HFG A;  4HVB A;  4GTT A;  5EIL A;  4DX7 D;  3PH0 C;  3UUX A;  4UWL A;  2RFI A;  2XGM A;  4FHJ A;  3UM0 A;  2WXG A;  4G1T A;  3UI2 A;  3JYS A;  2Y1L E;  2OCC E;  2XEE A;  3IBE A;  2OND A;  2GRQ B;  2E0I A;  2P9N G;  3KMT A;  4CGV A;  3M58 A;  4EEC A;  4YNM A;  3CQG B;  3FEX A;  3ML9 A;  5ENS D;  3DSS A;  4LDG A;  4YDO A;  3MO2 A;  4BY6 A;  3PZ4 A; 
#chains in the Genus database with same CATH homology
 4AV7 A;  2NSZ A;  4J7F A;  4LCT A;  4AIF A;  3G2V A;  3SF4 A;  4PDX A;  2YHE A;  4GU5 A;  3QWV A;  2HYZ A;  2VGX B;  3FFL A;  5JJT A;  5JIN A;  2FI7 A;  4UI9 J;  4J7I A;  2XCB A;  3M59 A;  2WXR A;  3ASD A;  3SI5 A;  3NQP A;  1HG5 A;  3IV0 A;  3R9A B;  2XGS A;  4FMU A;  4PS8 A;  5LCW J;  4KT6 B;  4L2L A;  4EZL A;  2IOL A;  5DBK A;  5FZR A;  1Z3X A;  3CVP A;  3G2U A;  1NZN A;  4BSX A;  2VGY A;  5FQ8 A;  1LF8 A;  2VJ8 A;  4GYO A;  5LOZ A;  5F6L A;  2IU1 A;  4KVO A;  3CLJ A;  4I1M A;  4JXT A;  4PS7 A;  5LSZ A;  1EPU A;  3CHM A;  3LS8 A;  4N3C A;  1H6K A;  2A4Z A;  3PE3 A;  4V3I A;  2GW1 A;  3DBS A;  3ESL A;  4OVV A;  3LY9 A;  3AS5 A;  4FU3 A;  3FPD A;  3F9Z A;  3HDX A;  4CEM A;  5J08 A;  3Q5M A;  3CVW A;  1H2U A;  3JQ0 A;  4KYO B;  4F7A A;  1P5Q A;  3FTX A;  5FZS A;  4ANU A;  3Q15 A;  3CVX A;  4ACK A;  4A3T A;  3PVL A;  5FQ6 A;  4J83 A;  4JLG A;  3OOI A;  5KCM A;  3MA5 A;  4ANX A;  3MGB A;  2J08 A;  3MV2 B;  3IKO B;  4CRW A;  1OWP A;  3L17 A;  3ZVV A;  2XGO A;  1VDY A;  5BT1 A;  3B7U X;  2JLB A;  1UN9 A;  2WXI A;  3HNA A;  3MJW A;  3QJZ A;  4JA7 A;  4GAA A;  3ZYK A;  4B8C B;  3MO0 A;  2WPV A;  5BV0 A;  4JHJ A;  4BX9 A;  2KZT B;  3FUE A;  2XQ0 A;  4MRU A;  2X6J A;  4NRH B;  2G46 A;  3FTW A;  1PEG A;  4RG6 A;  1HG2 A;  1E8Z A;  1XNF A;  4C1Q A;  1N54 A;  1IHG A;  3PNL B;  4FUL A;  1Y6I A;  4U8H A;  3QWW A;  1SZ9 A;  3TXN A;  4HOR A;  1UJK A;  3LY8 A;  3NZU A;  2FUL A;  3D9L A;  5AEN A;  3G2T A;  3BO5 A;  4J8D A;  3M56 A;  3HIZ A;  4Y6W A;  2CHX A;  3FY4 A;  4GZD A;  2FO7 A;  1U3D A;  4H7X A;  3LPZ A;  2I1J A;  4N3B A;  5KJK A;  2WQ6 A;  2L6J A;  3SHF A;  2CG3 A;  4U63 A;  2W5Z A;  1S0P A;  2E2E A;  2X6I A;  3MEK A;  5T0K A;  4HOS A;  3RU0 A;  4EBA A;  5CPR B;  2W5Y A;  2ILR A;  2KCV A;  3BG0 B;  4JC8 A;  3OXG A;  3CK9 A;  3VLD A;  4UQZ A;  3ULQ A;  3CHQ A;  1PAQ A;  2WVI A;  1ZU2 A;  2XRY A;  3ZYQ A;  4CCA A;  3RIB A;  2Y4U A;  1HF8 A;  3P2B A;  2R5S A;  5A7D B;  5CCM A;  4HLE A;  5BUZ A;  2EQX A;  1INZ A;  4Q69 A;  4R7L A;  1E8W A;  3T5X A;  5JJ0 A;  3U66 A;  3Q47 B;  4I1A A;  2LNI A;  5EDS A;  2JV0 A;  1EDU A;  1KT1 A;  1WM5 A;  2IQC A;  3CVU A;  5TTF A;  3CVV A;  3D9M A;  2MOW A;  4TV3 A;  1TJF A;  4IJ8 A;  5LSX A;  2YNQ A;  2C0L A;  2UY1 B;  3LEW A;  3RO2 A;  2XHE A;  4UWK A;  4AJW A;  4I17 A;  4A55 A;  4ANW A;  3FTV A;  2MHK A;  2OVB A;  2QFC A;  1H0A A;  3NZS A;  2XRZ A;  2J07 A;  3PDN A;  3IHX A;  4A1G A;  1IQU A;  2WXJ A;  3MCX A;  5FWQ A;  3TG5 A;  4AXH A;  3QAQ A;  2IJG X;  3OS5 A;  2LAI A;  5T0M A;  5JJ7 A;  1GW6 A;  4ILG A;  1BPO A;  2VTB B;  4M3O A;  4G2V A;  4C9B B;  4B0Z A;  3CSF A;  4QFV A;  3MKR A;  1HU3 A;  2VSY A;  4F1S A;  3EIQ C;  3IHY A;  4WNE A;  4I9C A;  3S7F A;  4A1S A;  3FH5 A;  3ZHE B;  4AM9 A;  5AYF A;  4J8F A;  4ILI A;  3F9X A;  4FJZ A;  2MRI A;  2RD0 A;  4ABN A;  2CG2 A;  5D0O D;  3CKC A;  3RAY A;  4O6F A;  3APF A;  4W9R A;  3RK6 A;  3WXX A;  5C2Y A;  3CKB A;  4NVQ A;  4BUP A;  3TGO A;  4KVM A;  1E7U A;  4L1B A;  4QEN A;  2JEK A;  2XEV A;  5LCW C;  5FQ7 A;  5KJN A;  3FU3 A;  3MX3 A;  3G2W A;  4LER A;  2O8J A;  4GYY A;  4EBA G;  3LXU X;  4EZJ A;  4YPA A;  2LO6 A;  1B89 A;  3MZL B;  3PE4 A;  2OVF A;  3BG1 B;  4FLB A;  2DBA A;  4CDR A;  1H19 A;  2I6H A;  2WXH A;  3MKQ B;  5AIJ A;  3D9P A;  3SZ7 A;  4XIF A;  4CDN A;  2C0M A;  3JUI A;  4AU7 A;  3FHE A;  4YPU A;  4GZ6 A;  3FUN A;  2WMN A;  3D9K A;  5LP0 A;  2WQH A;  3P1U A;  4GCN A;  4QEO A;  3M55 A;  1E8X A;  4JZY A;  2X6K A;  3B7S A;  2L0T B;  5G04 C;  4GPK A;  3MO5 A;  1QQE A;  3ASF A;  3EHN A;  2X38 A;  3SD5 A;  4KZC A;  1H2T C;  4DI3 A;  4J0U A;  1ELR A;  3UPV A;  5TEG A;  4DPR A;  5EG2 A;  4MS6 A;  4UQY A;  3ASH A;  4ME2 A;  3APD A;  3ZPJ A;  4H7Y A;  3TJP A;  3ZN3 A;  2I9C A;  3CK8 A;  3KAE A;  4CGW A;  2J09 A;  3CVY A;  4NJ5 A;  2OOE A;  1WAO 1;  5BV1 A;  3B7R L;  2L0I A;  3S8P A;  3EDT B;  3CHS A;  4GA1 A;  3U4T A;  5CCL A;  3FUF A;  4K03 A;  2AW6 A;  3D9O A;  5EKQ D;  1E90 A;  1HX8 A;  1ML9 A;  3VV0 A;  2PQN A;  2AWI A;  3FUI A;  1UN8 A;  3F9Y A;  3URZ A;  3QC1 A;  4RZ0 A;  3ONL A;  4TRQ A;  1MUF A;  1NA0 A;  4N39 A;  3JQ1 A;  4UWG A;  1H2V C;  2J9Q A;  5JHB A;  1PY1 A;  3CK7 A;  1HZ4 A;  4MKT A;  4UWF A;  5EX0 A;  5BPP A;  2KAT A;  2PQR A;  2VSX E;  3KS2 A;  1Z6T A;  3BEE A;  3AS8 A;  3PUJ A;  3OXL A;  3CST A;  3ZFW A;  3M57 A;  2Y3A A;  3RO3 A;  5AYW D;  3S7D A;  4RVB A;  4B8A A;  3FUH A;  3R7R A;  5HQ8 A;  4H12 A;  1UJJ A;  5AJD A;  4WNF A;  4XKC A;  3KMA A;  3PEU B;  4U04 A;  4N5C A;  3FUK A;  3FTS A;  5E75 A;  4EZK A;  3M54 A;  3TXM A;  3ONK A;  3GZS A;  2V8S E;  3I5P A;  3FWV A;  2AXV A;  3ASG A;  5G04 J;  4AEZ C;  4B89 A;  4O30 A;  3K5K A;  3SBT B;  3GZ1 A;  4JEU A;  5A6C A;  1KT0 A;  4IN3 B;  5ANR A;  3T5V A;  5G05 C;  1HO8 A;  3ML8 A;  1FCH A;  3ZGQ A;  3HYM B;  4TUU A;  1PC2 A;  3KEZ A;  2CHZ A;  3PS6 A;  1UW4 B;  4WWN A;  3QB2 A;  4U07 A;  4WUY A;  2CFU A;  2WXK A;  3UQ3 A;  3Q4A B;  3CBM A;  2I2O A;  3FU0 A;  2CHW A;  3RJW A;  3S2A A;  4HS2 A;  5CMW A;  3CR3 A;  4GZ3 A;  3CVN A;  4XI9 A;  4I6J A;  3DB5 A;  2WXL A;  4MI0 A;  1MQS A;  2LAH A;  4IUL A;  3JCK C;  4ANV A;  1HS6 A;  2HM8 A;  3I4G A;  4KXK B;  2WXF A;  3CV0 A;  4KBQ A;  3SWC A;  2KCK A;  2HO1 A;  2R3A A;  3MV3 B;  2YQ8 A;  3RJV A;  4I1O B;  4BTB A;  4E85 A;  5F6K C;  3SNX A;  2VGX A;  4XE0 A;  4YPE A;  3FTZ A;  4PS3 A;  2ZU6 B;  4I43 A;  4J8S A;  2PZI A;  2PM6 A;  5CHE E;  4JL0 A;  5G05 J;  4A3V A;  3LY7 A;  3D9I A;  3PUK A;  4PH4 B;  3ZYM A;  1TEZ A;  4XZ4 A;  3CBP A;  4ATG A;  4ILH B;  1NP7 A;  5G55 A;  4D10 C;  3FH8 A;  5LX8 A;  2J4D A;  2Y4T A;  5EX3 A;  2WXN A;  3QWP A;  1OWL A;  2L9B A;  3ESK A;  4G26 A;  4J6I A;  3ZRH A;  1XQH A;  1JPL A;  4HXI A;  1ELW A;  1MVX A;  4J8O A;  2WB2 A;  5FTP A;  4AP2 A;  2YHC A;  1SQM A;  4NUR A;  4E6H A;  4IJD A;  1IYG A;  5ARG A;  2M63 A;  4CT4 A;  3U9W A;  2NC9 A;  4RSY A;  2BTD A;  5M72 A;  1XGW A;  2VSN A;  3SGH A;  3QAR A;  4XI0 A;  4B94 A;  2VYI A;  3U64 A;  1E96 B;  3FH7 A;  3ZW3 A;  4LUN U;  2Q7F A;  4DJA A;  1OWN A;  4GZC A;  1JWG A;  4NAC A;  3M5A A;  2P58 C;  2BUG A;  3GW4 A;  4FHK A;  3RRU A;  3CHP A;  4E47 A;  5T3R A;  3T8M A;  2GRL A;  4EPZ A;  3TG4 A;  2IF4 A;  2GGF A;  2I1K A;  4FJY A;  4BT9 A;  5BNW A;  2XCC A;  4AOF A;  1UG3 A;  1JUQ A;  2J49 A;  4NQ0 A;  2AVP A;  3E4B A;  2WQ7 A;  3PEV B;  2F69 A;  2IGQ A;  4GML A;  4UWH A;  4DI4 A;  2QPW A;  3DAL A;  1W3B A;  3FUD A;  4QEP A;  5KJM A;  3ZXS A;  5F59 A;  2XPY A;  1Y8M A;  3L6A A;  3RQ4 A;  3B7T A;  2YIN A;  3FP3 A;  3VTX A;  4L2Y A;  3FTY A;  4DLQ A;  4DK5 A;  4F3V A;  4U0Z A;  4FLH A;  3UT8 A;  1OWO A;  1SZA A;  3TAX A;  3QDN A;  3Q49 B;  3PRZ A;  1MHQ A;  5T8I A;  2GRM A;  1IQR A;  3NF1 A;  2IOS A;  3OTN A;  4FP7 A;  4EQF A;  4BTA A;  4L7T A;  4WND A;  3L08 A;  4XX5 A;  2KM4 A;  1FVF A;  3O4Z A;  3I3N A;  4I6E A;  3QK0 A;  4ACL A;  4UI9 K;  2DIW A;  4I51 A;  4FA6 A;  3U3W A;  3FDH A;  2WM9 A;  3F9W A;  4LRZ A;  4CDM A;  2PM7 A;  3M53 A;  3OPE A;  3HVE B;  3FU5 A;  3S7J A;  3L16 A;  1U3C A;  3GZ2 A;  3B13 A;  3LKU A;  4MLP A;  5T5G A;  4G24 A;  1HH8 A;  4GA0 A;  3CIA A;  3FU6 A;  4HOT A;  2A5U A;  4HOU A;  1QNF A;  1MT6 A;  4WNG A;  2R59 A;  3D3M A;  4U0S A;  3VLE A;  3FEY A;  1OUV A;  4DLO A;  2UY1 A;  1TJC A;  2BF0 X;  4N2S A;  2FEZ A;  4JHK A;  1E7V A;  1QZ2 A;  2XPI A;  3HHM A;  4AY5 A;  5KJL A;  4FAD A;  2VTB A;  2CFZ A;  2QY7 A;  2X6F A;  2XPZ A;  2J4B A;  4I2W A;  3UX4 A;  5A23 A;  4C0E A;  4U0U A;  4GB9 A;  4AVX A;  4JA9 A;  2AXU A;  3L22 A;  4XKB A;  1Z3Y A;  2VSO E;  5AJL A;  5JIY A;  4K0R A;  3PNT B;  4WAF A;  5G2N A;  4JPS A;  3ZYL A;  2WXQ A;  3UT4 A;  3SW9 A;  2DCP A;  3LYA A;  5FT9 A;  2LSU A;  2KC7 A;  2WMO A;  2WXO A;  3IHV A;  1A17 A;  3OAW A;  4I2Z A;  4G11 A;  3ZEF A;  2PL2 A;  5JHA A;  1N3J A;  3LDZ A;  4APO A;  3APC A;  3VLF A;  3I4R B;  4MI5 A;  3CGH A;  4JEH A;  3UMV A;  4KZ0 A;  2UWJ G;  4P29 A;  4BT8 A;  3LVR E;  4Y6C A;  3EIJ A;  1OWM A;  1E8Y A;  5ENN A;  5LFA A;  3SFZ A;  5C1D A;  3FUJ A;  4PUC A;  5BW8 C;  1EF1 C;  3D9J A;  2V4L A;  4BX8 A;  4YVQ C;  4F53 A;  1N6C A;  4YVO A;  4G23 A;  5T4Y A;  4UQX A;  3QOU A;  4BWR A;  3L54 A;  4AY6 A;  2LSV A;  5FJY A;  2KCL A;  3DPD A;  2V5F A;  4UI9 C;  1ELK A;  3C98 A;  3CHR A;  3OXF A;  4APF A;  4N2Q A;  1N6A A;  5JHN A;  3MYV A;  4JDS A;  4I9E A;  3VUZ A;  1FVH A;  1WY6 A;  4GA2 A;  4WWP A;  4LEU A;  4OYS A;  5CMY A;  3LVQ E;  4YNP A;  2BQZ A;  3R7Q A;  3EJN A;  2X6H A;  1H3I A;  4Q96 A;  1N52 A;  4CT0 A;  2KZT A;  1EYH A;  4GMJ A;  5FZQ A;  5JJ6 A;  3ZIM A;  3D9N A;  3EHM A;  3MKQ A;  4RG9 A;  1DVP A;  4OVU A;  3ZHE A;  3SBS A;  3PRE A;  3G2S A;  1JWF A;  3HVE A;  3O48 A;  5E76 A;  5ARF A;  3AU5 A;  3CQC B;  2V0P A;  3VTY A;  1NA3 A;  3AS4 A;  3RKV A;  4BFR A;  2IFU A;  2AXZ A;  5FQ4 A;  3CHO A;  4J8E A;  5J90 A;  3QKY A;  4GCO A;  3RRN B;  2R17 C;  3QNK A;  1ZBP A;  4IRU A;  1HFA A;  3IEG A;  3N71 A;  4WWO A;  4HFG A;  2OV8 A;  4HVB A;  3KMJ A;  2RG8 A;  3FTU A;  3PH0 C;  3CVL A;  1L5J A;  3UUX A;  4UWL A;  2RFI A;  4JVS A;  5D0Q D;  2XGM A;  3LJ3 A;  1ZKK A;  3TL5 A;  3L13 A;  4FHJ A;  1O9S A;  2WXP A;  3KD7 A;  3LCA A;  2WXG A;  2C2L A;  4G1T A;  4L23 A;  5DIZ A;  5HI7 A;  3PZD A;  3ENE A;  5F5E A;  4JHR A;  4Z4P A;  4YND A;  3S7B A;  4G25 A;  4FC8 A;  3JYS A;  4GZ5 A;  2NXP A;  3IBE A;  2OND A;  5TH7 A;  2E0I A;  3FUL A;  1HXI A;  1MVH A;  2WXM A;  4N3A A;  4JW1 A;  2HR2 A;  3GYZ A;  4C0M A;  3K9I A;  3KMT A;  3UT7 A;  3CEQ A;  5ANL A;  4CGV A;  4KMO A;  4Q94 A;  3M58 A;  4EEC A;  2ION A;  3RRM B;  3FUM A;  3AU4 A;  2X3M A;  4GYW A;  1DNP A;  4HOQ A;  4YNM A;  3CQG B;  1X5B A;  3FEX A;  3CBO A;  1HE8 A;  1KLX A;  3ML9 A;  3EP0 A;  1YA0 A;  3CVQ A;  4LDG A;  4URK A;  2FF4 A;  4IYP A;  2VQ2 A;  3MO2 A;  4BY6 A;  2FBN A;  4I6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...