5KJLA

Smyd2 in complex with az378
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
428
structure length
428
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 141
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjlA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjlA01
3CKCA 3UUXA 4CGVA 3TAXA 2LNIA 3HNAA 1ZKKA 2LSVA 2KCKA 2BQZA 2W5YA 2YQ8A 2RFIA 4APOA 5G04C 4KBQA 5LSXA 2NC9A 5HQ8A 1QZ2A 3TG5A 1WM5A 3CBPA 3RIBA 5FTPA 1OUVA 1P5QA 4WNEA 1ELWA 5HI7A 2AVPA 3RO2A 2FO7A 4U0SA 3MV2B 3O48A 3DB5A 5M72A 3F9ZA 3CVQA 5KJKA 4ME2A 3F9XA 4I9EA 4AY6A 3Q49B 3QOUA 4JHRA 3ZHEB 5FZRA 4WNGA 5EKQD 3ULQA 3VTYA 1TJCA 3MKRA 3FFLA 4RG6A 4YNMA 5JINA 3ASHA 4G26A 3AS4A 3F9WA 4J0UA 3S7JA 5JIYA 5TEGA 4JDSA 5JJTA 2HO1A 4GCOA 3CK9A 2QFCA 4U0ZA 2VYIA 3Q4AB 1KT0A 3FPDA 4IJ8A 3M56A 3SWCA 2OOEA 2QPWA 4GZ3A 3BEEA 3ASFA 1N6CA 3ZN3A 4NRHB 4Y6WA 1N6AA 4GA0A 4YPUA 3RJWA 4YVQC 5JJ7A 4JL0A 3KMAA 3CK7A 4I2ZA 2HYZA 1PC2A 5KJLA 3URZA 5FJYA 5F6KC 4HOUA 2DBAA 4WNFA 5EX0A 4YPEA 5A7DB 3CVPA 3WXXA 4UQXA 2R5SA 2E2EA 4JLGA 4GYYA 4G23A 3CK8A 5CCMA 4G24A 4GZ6A 3SZ7A 2PL2A 4UQZA 5ARGA 2IF4A 2PQNA 3NF1A 2XCCA 1YA0A 2L6JA 3S8PA 3M54A 4J7FA 4A1SA 2LSUA 3ASGA 4I51A 1MVXA 3MA5A 3CVNA 4O30A 4N2SA 4YNPA 3Q5MA 4XI0A 1IHGA 3ESKA 3N71A 1O9SA 5TH7A 4LDGA 3M5AA 4N5CA 3M57A 4AM9A 3LCAA 3MEKA 1B89A 3QDNA 3VV0A 3ZFWA 4YPAA 2W5ZA 4H7XA 1XQHA 3S7BA 4U07A 1N3JA 4HOSA 2VSNA 4AY5A 4J83A 3IEGA 3OS5A 4HOTA 4N3CA 3S7FA 1XNFA 4KXKB 4JA9A 5LCWJ 4G2VA 2F69A 3RQ4A 4RZ0A 4N39A 3S7DA 2ONDA 5TTFA 4GA2A 4CDRA 2FBNA 2PZIA 2R3AA 2C2LA 3EP0A 1MVHA 1KLXA 3RKVA 5T5GA 3KMJA 4J8FA 5D0QD 5F5EA 5FZSA 4MI0A 5AYWD 2FF4A 2P58C 3KAEA 3MO2A 4NQ0A 1PEGA 4GA1A 4BWRA 2YHCA 2Y4TA 5A6CA 5JHNA 4GCNA 4GZ5A 3LPZA 4QEPA 4Z4PA 2V5FA 4G25A 5ARFA 3ZGQA 3MO0A 2WPVA 3GW4A 3EDTB 3HYMB 2C0MA 4GYOA 1NA0A 5DBKA 2GW1A 4LEUA 5LCWC 5KJNA 1KT1A 4I9CA 4W9RA 1MT6A 5FT9A 3SF4A 5BW8C 3UPVA 4FMUA 4JA7A 3U3WA 3U4TA 4J8EA 4J8OA 3JYSA 2VGXA 1ZU2A 3M53A 1ZBPA 5D0OD 4BT8A 2XGSA 1NA3A 3CBOA 2PQRA 3CVLA 4UI9J 4WNDA 3VTXA 3UQ3A 2KCLA 3CKBA 5BT1A 4AIFA 3M58A 5EX3A 3QWPA 2KCVA 4ABNA 1H3IA 3KD7A 4EQFA 3BO5A 2VQ2A 3PDNA 4BUPA 3OXGA 2HR2A 5F59A 1WAO1 4HORA 3GYZA 3RAYA 5EG2A 4H7YA 1W3BA 3IHXA 4H12A 1ML9A 2XGMA 4I2WA 4WUYA 3CEQA 3LY9A 2FI7A 4BT9A 5T0MA 4I1AA 2IGQA 3SW9A 3CBMA 3AS5A 3F9YA 2VSYA 2C0LA 2KC7A 2MHKA 3TG4A 3GZ2A 3QKYA 4MI5A 4UQYA 5C1DA 5T0KA 1HH8A 3CV0A 4UI9C 1HXIA 4O6FA 4C1QA 4GYWA 1A17A 5F6LA 5JJ0A 4BTBA 3M55A 2KATA 5LSZA 4N3AA 4CGWA 2FEZA 4XIFA 4UI9K 3E4BA 4KYOB 2I6HA 2G46A 4F3VA 4B94A 3MO5A 3QWVA 5FZQA 1Y8MA 5AYFA 3KMTA 3RU0A 1IYGA 3Q47B 3ZHEA 3K5KA 4N2QA 3LY8A 2J9QA 3Q15A 2XCBA 2Q7FA 3GZ1A 3OXLA 3RO3A 5G05J 4YVOA 1E96B 3TGOA 4N3BA 3FP3A 1ELRA 2JLBA 4IN3B 4BTAA 1HZ4A 4I17A 2XGOA 3ASDA 4QEOA 2XPIA 2WQHA 3OXFA 2VGYA 2BUGA 3K9IA 3RJVA 4QENA 4AU7A 4Y6CA 2VGXB 2XEVA 5BNWA 4NJ5A 3M59A 4J8DA 3ZPJA 2UY1B 4YNDA 2O8JA 5CHEE 5G04J 5JJ6A 4U04A 4J7IA 3QWWA 2UY1A 3VUZA 1MUFA 4G1TA 3MV3B 4GPKA 1NZNA 3OOIA 3LY7A 3PE3A 2Y4UA 3KS2A 5CCLA 1FCHA 2JV0A 4XI9A 2IFUA 5G05C 3OPEA 3AS8A 3LKUA 3R9AB 2UWJG 3PE4A 4HOQA 4U0UA 3FWVA 5DIZA 3LYAA 3DALA 4NVQA 1QQEA 4RG9A 5CPRB 4E47A 5KJMA 4IJDA
chains in the Genus database with same CATH superfamily
1Y6IA 3UUXA 3HVEB 1ZKKA 5FQ6A 1D9SA 4DX2A 5D2MC 2V5QC 3EU5A 5G04C 1MQSA 1H6OA 2XEEA 1WM5A 5EILA 3L17A 3DB5A 1S70B 3V31A 4BX9A 1LF8A 3ML9A 4MS6A 5E75A 4UWLA 4CYMD 3ULQA 3CHMA 4JPSA 2I2OA 3EIJA 2IO3C 1NP7A 1TJCA 2IU1A 1N4QA 3D9IA 3L6AA 4HFGA 5JIYA 2ZGDA 3HG0D 1HG5A 2HO1A 4GCOA 2LO6A 5D66A 3FPDA 1BU9A 1BD8A 1JUQA 4UWHA 2OVFA 4IULA 2YINA 5JJ7A 2P9SG 3KMAA 4XEIG 3SY2A 3F6QA 2DBAA 4PS8A 3WXXA 4UQXA 4GYYA 4G23A 5CCMA 4UQZA 1OT8A 1EDUA 1YA0A 4BY6A 4DUIA 4GTPA 4FADA 2V4HC 3J5PA 4F53A 3OTNA 3UM0A 3N71A 3L16A 2ZGGA 3P1UA 4OVVA 4I1MA 3G2SA 1H2TC 1OWMA 3QDNA 3VV0A 3UINC 4LG6A 4YPAA 2W5ZA 4H7XA 3S7BA 4D10C 4HOSA 4MBGA 4C48B 2WXNA 4AY5A 4GU5A 3SHFA 3S7FA 3NQPA 2CG3A 5HS0A 4K5AB 4JB8P 5EIBE 3WG7E 4N39A 4XE0A 3TJPA 4GTQA 3UM2A 2J08A 1GW6A 1UJKA 4CDRA 1E8ZA 2R3AA 4NACA 4K03A 2GRQB 3D3MA 1MVHA 2X6JA 1KLXA 5T5GA 3KMJA 5D0QD 5F5EA 5HKPA 5FZSA 2QYJA 3MO2A 3FTSA 2H6HA 1IKND 4AP2A 1QYMA 5EIDA 2Y4TA 4FHJA 3FDHA 4XZ4A 1Q2ZA 2B0OE 4G8LA 5JHNA 4GCNA 5ANRA 3FY4A 4GZ5A 4Z4PA 1O1RA 3ASOE 5KWDA 4G25A 2BKKB 4Q94A 1DC2A 3ZGQA 3FH5A 1UOHA 2R03A 4GTTA 4GMJA 5LCWC 3JXJA 1KT1A 4BSZB 1K8KG 2OVBA 4ANUA 3SF4A 2XQ0A 2DZOA 1TN6A 3UPVA 4F7AA 1KZOA 5ENOD 3ONKA 4TXQA 3JYSA 1PAQA 3B7UX 1BLXB 4B0ZA 4EECA 5D0OD 1NA3A 4FP7A 3FTVA 2PQRA 3C5RA 1X81A 4UI9J 3VTXA 1ZB1A 5KCMA 4P29A 3CVWA 1EPUA 5AQAA 3X2QE 4BX8A 3AG1E 3SBTB 1HX8A 3UMVA 3PDNA 2GGFA 2HR2A 1EF1C 3PUJA 5BXOA 4U63A 3R7QA 4B8CB 2AXUA 5F59A 1WAO1 2OV8A 3RAYA 3AJIA 3B7TA 3HXBA 3PZ4A 4GTVA 1N4SA 4WUYA 1NI1A 4ANVA 3SW9A 2WVIA 1UN9A 1DVPA 2MHKA 3NOCD 3QKYA 4UQYA 3CGHA 4LRZA 3ZU7B 5BUZA 1HXIA 3MX3A 3CHOA 4GYWA 5JJ0A 5FQ8A 2P9PG 3M55A 1O1SA 5FIOA 3FUNA 2KATA 5LSZA 4CGWA 3EUVA 4XIFA 1E8XA 2J8SD 3MO5A 4F1SA 5FZQA 3ZKJA 2WQ7A 5AYFA 3RU0A 3QK0A 2GRRB 1SA5A 1NFIE 3GZ1A 3RO3A 3APCA 3FULA 1Z3YA 2DCPA 4CZ2D 3TGOA 4I1OB 4IN3B 3ZYMA 3FTYA 1TR4A 2WXRA 3U64A 2XGOA 3ASDA 4GTSA 2VGYA 5LFAA 3ZYQA 1IQUA 3BU8A 4DX7D 3MJWA 4HI9A 4AU7A 3B7SA 4XKCA 1SZ9A 4TUMA 4NJ5A 4EHMA 3IHVA 2WXPA 1OXJA 3QWWA 2ETAA 1D8EA 5CERB 3VUZA 1MUFA 4G1TA 3MV3B 3D9JA 1LTXA 5CCLA 1U3CA 2ETCA 4EZLA 2OEWA 1WDYA 2WMNA 2EQXA 2H6FA 3G2VA 3CLJA 3V30A 3PE4A 1JCQA 3L13A 3FWVA 3DALA 3LYAA 2EINE 4I6JA 3KSLA 4DI3A 5CPRB 3IBEA 4GMRA 3PZ2A 1TN8A 2GRPB 3CKCA 3DSWA 3DXMG 3MKQB 3TAXA 4K5BA 1AP7A 2XHEA 3ML8A 3AG3E 2KCKA 2QZAA 2RFIA 4APOA 3MGBA 5LSXA 3TG5A 3TL5A 1SA4A 5FQ4A 3Q9NC 2DYRE 4TRQA 2FO7A 1JCSA 2J49A 3CVQA 5AQ9A 4ME2A 3MYVA 5E76A 4AY6A 3Q49B 4JHRA 4DK5A 4KVOA 3TWRA 4AJWA 1FT1A 1MX4A 3LEWA 2FULA 3PREA 4LSZE 1KZPA 3AAAC 5AENA 3F9WA 3S7JA 3D9KA 3CK9A 2QFCA 3VLFA 3M56A 5AAOA 5JA4D 1HS6A 2OOEA 3ASFA 3JXIA 1N6CA 2JABA 3ZN3A 4NRHB 4Y6WA 3FUFA 4GA0A 3RJWA 4YVQC 3DSSA 4CDNA 4I2ZA 5FINA 1IHBA 3ZXSA 2B6CA 3PZDA 2IO2C 4HOUA 4YPEA 1ELKA 1OCRE 3E37A 3ZRHA 2R02A 2ETBA 2GRMA 1TEZA 4L1BA 2PL2A 2AXZA 4L2YA 5ARGA 4BFRA 2L6JA 3S8PA 4PS7A 1MJ0A 3IV0A 4J8SA 3UKUG 3T5VA 1MVXA 3FEYA 3MA5A 4FHKA 4N2SA 4XI0A 1O9SA 3CVYA 2AXVA 4N5CA 4L23A 3M57A 3LCAA 3MEKA 3V2OA 4JEHA 1NL4A 4MRUA 3ZFWA 4CEMA 1V54E 3TWWA 1E8YA 4O1PA 1XQHA 2L0TB 4U07A 1PY1A 2I9CA 2LXLA 2AW6A 2WB2A 4EZJA 2AJAA 3LS8A 2ILRA 4RQIA 4N3CA 1XNFA 4X8QA 4KXKB 1K1BA 4U8HA 2F69A 3G2UA 4DJAA 3ZXPA 2MYOA 1FT2A 3MCXA 3EP0A 3ULEG 2A5UA 1HE8A 5AARA 3HXDA 5AQBA 1JWFA 4MI0A 4FJYA 5AYWD 3KAEA 3SFYA 3NBNB 4DRXE 4KZCA 3UTMA 4HXIA 4GA1A 4BWRA 3ABLE 3EHQA 4HI8A 2YHCA 3SI5A 4CT4A 3FU6A 5A6CA 4A63B 1JPLA 5G55A 3AU4A 3E32A 1N94A 4Q69A 4HQDA 4TXPA 4HLEA 3MO0A 2WPVA 3TWSA 3NZSA 1TYQG 3Q73A 4GYOA 3ZVVA 3R7RA 3W9GA 2NSZA 5ENRD 2CG2A 1S0PA 4HB5A 5EYPF 3C3RA 2CFUA 3W9FA 4GTOA 5EDSA 4FMUA 3FTXA 3U4TA 4J8EA 2H6IA 2WXJA 2R2LA 4J8OA 4O60A 1JWGA 1ZU2A 3PUKA 1BI7B 2CHZA 1IQRA 3Q79A 4B8AA 3UIPC 2PM6A 3SD5A 2GRNB 3CKBA 5BT1A 3IXEA 4ABNA 3KD7A 4N5QA 3PRZA 2CHWA 4AEZC 3BO5A 2VQ2A 4KVMA 2VSXE 1HF8A 1FVHA 1TNOA 1H19A 5ENSD 3EHNA 4FLHA 2L9BA 3NZUA 5EG2A 4H7YA 3P2BA 2CFZA 4JXTA 4ATZD 3BG0B 1ML9A 1MHQA 2XGMA 1QBQA 5HRYA 3D9HA 3CEQA 3LY9A 4ANXA 2F8XK 4A55A 4EZKA 2BKGA 3F9YA 3GZ2A 4MI5A 1HH8A 1HG2A 2VJ8A 5ENNA 4UI9C 1A17A 4WWOA 3DSUA 3E4BA 4K0RA 4B94A 3QWVA 3DWLG 2DVWA 2Y1LE 1U3DA 4JVSA 4BESA 1N4PA 2XS1A 3FEXA 3E34A 2A5EA 3Q75A 1TNBA 1L5JA 3ZEFA 4YVOA 5ANLA 3KEAA 1DCEA 1S63A 2KZTB 2IEJA 2JLBA 1MYOA 4BTAA 1HZ4A 2AWIA 3C3OA 2WM9A 4G8KA 3NAWA 2XPIA 3OAWA 2JEKA 3UT8A 3OXFA 2BUGA 4GB9A 4HRLA 5B1AE 2RKKA 1OWNA 4Y6CA 3DBSA 4J8DA 2UY1B 4YNDA 4JW1A 3G2TA 2J4DA 3FH8A 3ZW3A 3J5QB 4LERA 3CIAA 2HE0A 2P2CP 4ACLA 1E7UA 4GPKA 1O5MA 3NOGD 3PE3A 3DRAA 2RFMA 4ILGA 1H0AA 5AJLA 3APFA 2V0PA 2JV0A 2EIJE 1K1AA 4L9PA 3LJNA 4APFA 3EHRA 4U0UA 2WXLA 4HVBA 3UX4A 1QQEA 2EIKE 3KSQA 1N0RA 1N0QA 2IJGX 4A1GA 1FVFA 3FTWA 3R9MA 3JUIA 4FU3A 3G2WA 2GROB 3HNAA 5CMYA 2LSVA 3ABKE 3HVEA 4A3VA 2MOWA 3APDA 3AU5A 3B13A 3PEVB 2ZIRA 1QZ2A 3DSXA 4A3TA 3RIBA 1OUVA 5KNGA 3ENEA 3ZUVB 2AVPA 3RO2A 3FUIA 1DNPA 4U0SA 5EYLA 4XKBA 5KBAA 1OWPA 2IONA 5KJKA 4F1PA 5T3RA 3F9XA 1SZAA 3QOUA 3FTUA 2RG8A 5FZRA 3AG4E 2DIWA 3JCKC 2GRLA 4WNGA 4M3OA 3VTYA 1UJJA 2XS8A 3FFLA 4RG6A 4UWKA 5JINA 1HFAA 4J0UA 3FU5A 5TEGA 4JDSA 2J4BA 2VSOE 2XRZA 1RW2A 4FLBA 1RZ4A 4DLOA 2CHXA 4U8YD 2VYIA 5ENQD 2V8SE 3L54A 3ZYKA 2QPWA 2X38A 3UT7A 2Y3AA 3HXCA 1N6AA 3B7RL 4TUUA 3CK7A 3Q78A 3URZA 4WNFA 2XRYA 3HDXA 1TNZA 3CVPA 4EPZA 1TJFA 1BI8B 2R5SA 4AXHA 3L9TA 3QARA 1JCRA 4XX5A 3Q7FA 3VLDA 2ZISA 3D9MA 3D9NA 2IF4A 2PQNA 2XCCA 4ZHBA 4A1SA 3Q7AA 4PUCA 2LSUA 4G11A 3ASGA 3CVNA 4O30A 4YNPA 1IHGA 1HU3A 1KPSB 3D9LA 5TH7A 2DWZA 4LDGA 2ZU6B 4AM9A 1B89A 3PZ1A 4K5CA 3UKRG 4FC8A 4HS2A 1N3JA 1Z3XA 2X6HA 5BV0A 4HNAD 4JD2G 2VSNA 5JMND 4J83A 3DSVA 2OEVA 3IEGA 5H7PA 3OS5A 2YHEA 2RD0A 2DYSE 4OYSA 4HOTA 4U96D 2L0IA 3GZSA 4G2VA 3RQ4A 3S7DA 2ONDA 1V55E 4I6GA 2LAIA 2FBNA 2PZIA 4E85A 2DZNA 3RKVA 1H2UA 3MZLB 4LNUD 2WXGA 3CHPA 2QYUA 5BV1A 5EN5D 3RSEG 4NQ0A 3LVRE 1DCQA 3TWVA 4U7EB 4JEUA 3QB2A 2XPZA 4CDMA 1IXVA 3FUKA 3DPYA 2IQCA 2L6BA 3LPZA 5FQ7A 4NIKA 4QEPA 2OCCE 4GPMA 2Y69E 5ARFA 4JHJA 4DX5D 3I5PA 4HLLA 2HM8A 3EDTB 3HYMB 4JC8A 2C0MA 4CCAA 1NA0A 5DBKA 2KZTA 2GW1A 4LEUA 3DXKG 5CRUA 2BF0X 4I9CA 4W9RA 1MT6A 2LXMA 4C9BB 1YCSB 1X5BA 3PZ3A 3DEPA 5BW8C 5CMWA 3SQVA 2R17C 2PM7A 3U3WA 3NB2A 1H6KA 5JHAA 4GZCA 4U8VD 4V3IA 1ZBPA 3CBOA 2QC9A 4ILHB 3CVLA 3FUDA 3UQ3A 2KCLA 4FJZA 1G3NB 4AIFA 3JQ1A 1YMPA 3QWPA 4YDWA 4E6HA 3D9PA 1H3IA 4EQFA 5AJDA 1SW6A 4BUPA 3TXMA 4EBAG 4HORA 4Z68A 1W3BA 3IHXA 4H12A 3CHSA 4AVXA 3TWUA 4I2WA 2EIME 3B7BA 5C2YA 1Z5SC 4BT9A 4I1AA 3ZNGA 4RLYA 3UM1A 3BUAA 3AS5A 3LJ3A 3UI2A 1MX2A 3RRMB 2NXPA 1EYHA 4DX6D 2WQ6A 2IY0C 2WXOA 3CV0A 3CVVA 1TNUA 3FUEA 5F6LA 3CHQA 3ESLA 4OAUC 4BTBA 1MX6A 4B93B 2F8YA 3SGHA 1BPOA 1AWCB 4N3AA 3SFXA 3SNXA 4KYOB 2I6HA 3PEUB 4F6RD 1LD8A 4HBDA 3Q47B 4L7TA 2MRIA 3LY8A 1TNYA 2J9QA 3BQOA 3OXLA 1N52A 5G05J 1E96B 3V79K 3E30A 2X6FA 3FUJA 3FP3A 1SQMA 5JHBA 3D9OA 1Z6TA 3UT4A 4M7CA 4BETA 2LUHA 2WQHA 5ENPD 2WXIA 2EILE 3U9WA 3HIZA 3I4RB 3RJVA 4ILIA 2I1JA 2VGXB 3CQGB 2XEVA 5BNWA 3M59A 3PVLA 2Y0BG 3E33A 2O8JA 5G04J 4GAAA 5JJ6A 3CR3A 3V2XA 2IOLA 4PH4B 1WG0A 2XZDG 1TN7A 1OWLA 5BXUA 3OOIA 4J6IA 3FU0A 3KS2A 5KNHD 1S64A 4I6EA 3U66A 2IFUA 3OPEA 3AS8A 5ENTD 4CRWA 2UWJG 4KZ0A 2WXMA 3LXUX 4HOQA 3QJZA 3SBSA 5DIZA 4NVQA 2VGEA 3ZYLA 5KJMA 3I3NA 3UXGA 4CGVA 2LNIA 2H6GA 3MKQA 3DPDA 2BQZA 4RSYA 5LOZA 2W5YA 2YQ8A 4PDXA 4PS3A 4KBQA 2WXQA 2NC9A 5HQ8A 2XPYA 2FO1E 3ULYA 1FPPA 3CBPA 1OCZE 5FTPA 1P5QA 4WNEA 3T8MA 1A5EA 3UM3A 2P9IG 1ELWA 5HI7A 1K3ZD 3MV2B 3O48A 3JQ0A 5M72A 3F9ZA 1HO8A 3S2AA 4DI4A 4I9EA 5CBNA 3ZHEB 2WXKA 5EKQD 4JHKA 3HXEA 3ISMC 1O1TA 3FHEA 4DPRA 3MKRA 4YNMA 2V4LA 3ASHA 3QNKA 4G26A 3AS4A 1N95A 3PS6A 3CQCB 1N4RA 3CSTA 5JJTA 5B1BE 4U95D 1N54A 4U0ZA 3Q4AB 1KT0A 4IJ8A 3I4GA 3SWCA 5B3SE 4BERA 2VTBB 4LUNU 2BEDA 3FUMA 3BEEA 4GZ3A 1UG3A 3T8KA 2ZXWE 1WY6A 5J90A 4YPUA 4DX1A 1SVXA 3L82A 4JL0A 2HYZA 1PC2A 5KJLA 5T4YA 3TXNA 5FJYA 5F6KC 2XENA 3Q9UC 5EX0A 4Q96A 5A7DB 1OY3D 3B95A 2E2EA 3DSTA 4JLGA 3PNLB 1E7VA 3CK8A 4G24A 4GZ6A 3SZ7A 4WWNA 2J07A 3NF1A 5ITZF 4OAVB 1U2VG 2M63A 3M54A 4J7FA 2IOSA 2PNNA 4UWFA 4I51A 3CSFA 3ONLA 4GZDA 5AQ7A 3Q5MA 3EU9A 3ESKA 4FULA 3VLEA 3T9KA 1UN8A 3RAUA 3M5AA 2WMOA 4NURA 4TV3A 4LCTA 3AG2E 3T5XA 1QNFA 4EBAA 4J7WA 1D8DA 2E0IA 4WAFA 3RRNB 4MLPA 3SFZA 4JA9A 5LCWJ 4RZ0A 4B89A 5BPPA 3FTZA 5TTFA 4GA2A 3IHYA 1N11A 2A4ZA 4GTMA 3QAQA 2LAHA 2C2LA 1OCCE 4JZYA 1H2VC 2BTDA 4J8FA 2FF4A 2P58C 3RK6A 1PEGA 2X6KA 3QC1A 2P9NG 3PH0C 3TWQA 4C0EA 3C98A 5IY5E 3EIQC 5T8IA 1YYHA 4RVBA 2V5FA 2R59A 4YDEA 5AN8A 5LX8A 1INZA 4WWPA 3GW4A 4ACKA 5FWQA 4LNBA 4CT0A 5KJNA 3CVXA 5FT9A 3TWTA 4AOFA 4MKTA 5AIJA 2NYJA 5LP0A 1E8WA 2F37A 4KMOA 1XGWA 4JA7A 4O1OA 3DEOA 3HXFA 5CBOA 4DLQA 2QY7A 2VGXA 1UW4B 4ANWA 3M53A 3EJNA 2F0YA 3TWXA 4BT8A 2XGSA 4C0MA 1H6PA 4HRNA 3FH7A 1E90A 3CHRA 3FUHA 4WNDA 3C3QA 4GTRA 2X6IA 3M58A 4QFVA 5EX3A 4GMLA 2KCVA 3ZIMA 3JUEA 1OWOA 3FU3A 3OXGA 2WXFA 4YDOA 4KT6B 3ABME 3GYZA 2YNQA 4J8YA 3UIOC 4OVUA 1VDYA 3PNTB 2FI7A 5T0MA 3CVUA 4QQIA 2IGQA 2P9UG 4LNGA 4BEPA 3CBMA 2VSYA 2C0LA 2KC7A 3TG4A 4ATGA 5CEDB 5C1DA 5T0KA 2P9KG 1N9AA 4O6FA 4C1QA 3O4ZA 5A23A 3HHMA 3RRUA 2FEZA 4UI9K 3BG1B 2G46A 2R05A 4F3VA 3IKOB 2P9LG 1OCOE 2I1KA 3EHMA 1Y8MA 3KMTA 1IYGA 3ZHEA 3K5KA 5J08A 3HRAA 4N2QA 4YDYA 5G2NA 3C72A 3Q15A 2XCBA 2Q7FA 4TXRA 4HRMB 2KM4A 4UWGA 3LVQE 4N3BA 1LD7A 2XEHA 1ELRA 4UUCA 4L2LA 4I17A 2J09A 4QEOA 5CECB 4IRUA 2XZTG 2RFAA 3K9IA 5CEAA 4QENA 4I43A 2VTBA 5CRVA 3ASNE 2KBXA 3ZPJA 2WXHA 5CHEE 4URKA 4U04A 4J7IA 2UY1A 3KEZA 1MZCA 1NZNA 4ZFHA 3SO8A 3LY7A 2Y4UA 1FCHA 4FA6A 4R7LA 4XI9A 5G05C 3L08A 2X3MA 3LKUA 3R9AB 2KXPC 4BSXA 4RG9A 3LDZA 4AV7A 4E47A 4IYPA 3L22A 4IJDA
chains in the Genus database with same CATH topology
4A1GA 1FVFA 3FTWA 1Y6IA 3CKCA 3JUIA 4FU3A 3UUXA 3MKQB 3G2WA 3TAXA 4CGVA 3HVEB 2LNIA 3HNAA 5CMYA 2XHEA 3ML8A 3MKQA 1ZKKA 3DPDA 2LSVA 5FQ6A 2KCKA 3HVEA 2BQZA 4RSYA 5LOZA 2W5YA 2YQ8A 4PDXA 4A3VA 2RFIA 2MOWA 4PS3A 4APOA 5G04C 1MQSA 3APDA 3AU5A 4KBQA 2WXQA 3MGBA 3B13A 2NC9A 3PEVB 5HQ8A 2XPYA 5LSXA 1QZ2A 3TG5A 4A3TA 1WM5A 3CBPA 3TL5A 3RIBA 3L17A 5FTPA 1OUVA 1P5QA 4WNEA 3T8MA 3ENEA 5FQ4A 1ELWA 4TRQA 5HI7A 2AVPA 3RO2A 2FO7A 3FUIA 1DNPA 4U0SA 3MV2B 3O48A 3DB5A 3JQ0A 4XKBA 5M72A 3F9ZA 1OWPA 4BX9A 1HO8A 2IONA 2J49A 3CVQA 1LF8A 3ML9A 5KJKA 4ME2A 3MYVA 5E76A 5T3RA 3S2AA 3F9XA 4DI4A 4MS6A 1SZAA 4I9EA 4AY6A 3Q49B 3QOUA 4JHRA 3FTUA 5E75A 2WXKA 3ZHEB 2RG8A 5FZRA 4DK5A 2DIWA 4KVOA 3JCKC 2GRLA 4WNGA 5EKQD 4AJWA 4UWLA 4JHKA 3ULQA 3CHMA 4JPSA 4M3OA 3VTYA 2I2OA 3EIJA 3LEWA 2FULA 1UJJA 1NP7A 3PREA 1TJCA 2IU1A 3FHEA 4DPRA 3MKRA 3FFLA 4RG6A 2V4LA 4UWKA 4YNMA 5JINA 5AENA 3ASHA 3D9IA 3QNKA 3AS4A 1HFAA 4G26A 3F9WA 4J0UA 3S7JA 3L6AA 3PS6A 3FU5A 3CQCB 4HFGA 5JIYA 5TEGA 4JDSA 3CSTA 3D9KA 1HG5A 2HO1A 2VSOE 2J4BA 3CK9A 4GCOA 4FLBA 5JJTA 2XRZA 5JHNA 2LO6A 4DLOA 2QFCA 2CHXA 1N54A 4U0ZA 2VYIA 3Q4AB 1KT0A 3FPDA 3VLFA 4IJ8A 3I4GA 3M56A 3SWCA 2V8SE 3L54A 1HS6A 3ZYKA 2OOEA 2VTBB 4LUNU 2QPWA 2X38A 3FUMA 3BEEA 3ASFA 4GZ3A 3UT7A 1UG3A 2Y3AA 1N6CA 3ZN3A 4NRHB 4Y6WA 1JUQA 4UWHA 1N6AA 2OVFA 3B7RL 3FUFA 4GA0A 4TUUA 1WY6A 4IULA 5J90A 2YINA 4YPUA 3RJWA 4YVQC 5JJ7A 4JL0A 4CDNA 3CK7A 4I2ZA 2HYZA 3KMAA 1PC2A 3ZXSA 5KJLA 3PZDA 5T4YA 3TXNA 3URZA 5FJYA 5F6KC 4HOUA 2DBAA 4WNFA 2XRYA 5EX0A 4Q96A 4PS8A 1ELKA 3HDXA 5A7DB 4YPEA 3ZRHA 3CVPA 3WXXA 4UQXA 4EPZA 1TJFA 2R5SA 2E2EA 4AXHA 4JLGA 2GRMA 3PNLB 1E7VA 3QARA 4G23A 4GYYA 3CK8A 1TEZA 4XX5A 4G24A 4GZ6A 4L1BA 3SZ7A 5CCMA 3VLDA 3ZIMA 4WWNA 2J07A 2PL2A 4UQZA 2AXZA 3D9MA 4L2YA 5ARGA 3D9NA 2IF4A 4BFRA 2PQNA 3NF1A 2XCCA 1EDUA 1YA0A 2L6JA 4BY6A 3S8PA 2M63A 4PS7A 3M54A 4J7FA 4A1SA 2IOSA 2LSUA 3IV0A 4G11A 4J8SA 4PUCA 4FADA 3ASGA 4UWFA 3T5VA 1MVXA 4I51A 3CSFA 3FEYA 3MA5A 3ONLA 3CVNA 4FHKA 4GZDA 4F53A 3OTNA 4O30A 4N2SA 4YNPA 3Q5MA 4XI0A 4FULA 1IHGA 3ESKA 3VLEA 3N71A 1HU3A 3L16A 3D9LA 1O9SA 5TH7A 3CVYA 1UN8A 4LDGA 3M5AA 2AXVA 2ZU6B 4N5CA 4L23A 2WMOA 3M57A 3P1UA 4OVVA 4I1MA 4AM9A 3G2SA 3LCAA 1H2TC 3MEKA 4JEHA 1B89A 1OWMA 3QDNA 3VV0A 4MRUA 4NURA 3ZFWA 4CEMA 1E8YA 2W5ZA 4H7XA 4FC8A 4TV3A 4HS2A 1XQHA 4YPAA 2L0TB 4LCTA 3S7BA 4U07A 1PY1A 4D10C 1Z3XA 4HOSA 1N3JA 2I9CA 2X6HA 5BV0A 2WXNA 2VSNA 2AW6A 4AY5A 2WB2A 3T5XA 4J83A 4EZJA 3IEGA 1QNFA 3LS8A 4EBAA 2ILRA 4GU5A 2YHEA 2RD0A 3SHFA 3OS5A 4HOTA 4OYSA 4N3CA 3S7FA 3NQPA 2E0IA 4WAFA 1XNFA 3RRNB 2CG3A 4MLPA 4KXKB 3SFZA 2L0IA 3GZSA 4JA9A 4G2VA 5LCWJ 2F69A 4U8HA 3RQ4A 4RZ0A 3G2UA 4N39A 3S7DA 4B89A 5BPPA 3FTZA 2ONDA 5TTFA 4GA2A 4XE0A 4I6GA 3TJPA 2J08A 1GW6A 2LAIA 1UJKA 3IHYA 4CDRA 1E8ZA 4DJAA 2A4ZA 2FBNA 2PZIA 4NACA 2R3AA 4E85A 3QAQA 2LAHA 3MCXA 2C2LA 4K03A 3D3MA 1MVHA 3EP0A 2A5UA 2X6JA 1HE8A 1KLXA 3RKVA 5T5GA 3KMJA 4JZYA 1H2VC 2BTDA 4J8FA 5D0QD 5F5EA 1H2UA 3MZLB 1JWFA 5FZSA 2WXGA 4QENA 4MI0A 3CHPA 2FF4A 2P58C 4FJYA 5AYWD 5BV1A 3KAEA 3RK6A 3MO2A 4KZCA 4NQ0A 3FTSA 3LVRE 1PEGA 2X6KA 3QC1A 4HXIA 4GA1A 3PH0C 4AP2A 4BWRA 4C0EA 3C98A 4JEUA 2YHCA 2Y4TA 4FHJA 3FDHA 2XPZA 3QB2A 4XZ4A 3SI5A 3FUKA 4CDMA 3EIQC 5T8IA 3FU6A 2IQCA 4CT4A 5A6CA 4GCNA 5ANRA 1JPLA 3FY4A 3L22A 3LPZA 4GZ5A 4RVBA 5FQ7A 5G55A 4Z4PA 4QEPA 2V5FA 2R59A 3AU4A 4Q69A 5LX8A 4G25A 5ARFA 4HLEA 1INZA 4Q94A 3ZGQA 3MO0A 4JHJA 2WPVA 3FH5A 3I5PA 3GW4A 3NZSA 4WWPA 2HM8A 3EDTB 4ACKA 3HYMB 4JC8A 2C0MA 4GYOA 3ZVVA 5FWQA 3R7RA 4CCAA 1NA0A 5DBKA 2KZTA 2NSZA 2GW1A 4LEUA 4GMJA 2CG2A 5LCWC 5KJNA 1S0PA 4CT0A 3CVXA 1KT1A 2BF0X 4I9CA 4W9RA 1MT6A 2OVBA 5FT9A 2CFUA 4ANUA 4AOFA 4MKTA 3SF4A 4C9BB 5AIJA 2XQ0A 1X5BA 5LP0A 1E8WA 4KMOA 5EDSA 5BW8C 5CMWA 1XGWA 3UPVA 4FMUA 4F7AA 2R17C 2PM7A 3FTXA 4JA7A 3U3WA 3U4TA 4J8EA 2WXJA 3ONKA 4J8OA 4DLQA 3JYSA 1JWGA 1PAQA 2QY7A 2VGXA 3B7UX 1H6KA 1UW4B 1ZU2A 3PUKA 4ANWA 5JHAA 4GZCA 4B0ZA 3M53A 3EJNA 2CHZA 1IQRA 4V3IA 1ZBPA 5D0OD 4BT8A 4EECA 2XGSA 1NA3A 4C0MA 4E6HA 4FP7A 3FTVA 3CBOA 3FH7A 2PQRA 1E90A 3CHRA 3FUHA 4ILHB 3CVLA 4UI9J 4WNDA 3VTXA 5KCMA 3FUDA 4P29A 3UQ3A 4B8AA 3CVWA 1EPUA 2PM6A 3SD5A 2KCLA 3CKBA 5BT1A 4FJZA 4AIFA 4BX8A 2X6IA 3M58A 4QFVA 3JQ1A 3SBTB 5EX3A 3QWPA 4GMLA 1HX8A 2KCVA 3D9PA 3KD7A 3UMVA 4ABNA 3PRZA 1OWOA 2CHWA 3FU3A 4AEZC 4EQFA 5AJDA 2VQ2A 3PDNA 3BO5A 4KVMA 2VSXE 1HF8A 4BUPA 1FVHA 3OXGA 2WXFA 2GGFA 3TXMA 2HR2A 1EF1C 3PUJA 4EBAG 4U63A 1H19A 3R7QA 3EHNA 4B8CB 4KT6B 2AXUA 4FLHA 5F59A 1WAO1 2L9BA 3NZUA 4HORA 2OV8A 3GYZA 2YNQA 3RAYA 5EG2A 3B7TA 1W3BA 4H7YA 3IHXA 4H12A 3P2BA 3CHSA 2CFZA 4AVXA 4JXTA 3BG0B 4OVUA 1MHQA 2XGMA 4I2WA 1ML9A 4WUYA 1VDYA 5C2YA 4ANVA 3CEQA 3LY9A 3PNTB 2FI7A 4BT9A 4ANXA 5T0MA 4I1AA 3CVUA 2IGQA 3SW9A 2WVIA 4A55A 1UN9A 4EZKA 3CBMA 3AS5A 1DVPA 3F9YA 2VSYA 2C0LA 2KC7A 2MHKA 3LJ3A 3TG4A 3GZ2A 3QKYA 4ATGA 3RRMB 4MI5A 4UQYA 2NXPA 5C1DA 3CGHA 1EYHA 5T0KA 1HH8A 1HG2A 2VJ8A 4LRZA 5ENNA 2WQ6A 2WXOA 3CVVA 3CV0A 4UI9C 5BUZA 1HXIA 4O6FA 4C1QA 3MX3A 3CHOA 4GYWA 1A17A 3FUEA 3O4ZA 5F6LA 3CHQA 3ESLA 5JJ0A 4BTBA 5FQ8A 5A23A 3M55A 3SGHA 1BPOA 3FUNA 2KATA 3HHMA 3RRUA 5LSZA 4N3AA 4CGWA 2FEZA 4WWOA 4XIFA 3SNXA 1E8XA 4UI9K 3E4BA 3BG1B 4K0RA 4KYOB 2I6HA 3PEUB 4F3VA 4B94A 2G46A 3MO5A 3IKOB 3EHMA 2I1KA 3QWVA 4F1SA 5FZQA 1Y8MA 1U3DA 2WQ7A 3KMTA 5AYFA 4JVSA 3RU0A 1IYGA 3Q47B 3QK0A 4L7TA 3ZHEA 5J08A 4N2QA 3K5KA 2MRIA 3LY8A 2J9QA 5G2NA 3Q15A 2XCBA 2Q7FA 3GZ1A 3FEXA 2KM4A 3OXLA 3RO3A 3APCA 1N52A 3FULA 5G05J 1Z3YA 1L5JA 3ZEFA 4UWGA 2DCPA 4YVOA 5ANLA 2KZTB 1E96B 3LVQE 3TGOA 4N3BA 2X6FA 3FUJA 3FP3A 1SQMA 1ELRA 2JLBA 4I1OB 4IN3B 3ZYMA 5JHBA 4L2LA 3D9OA 4BTAA 1HZ4A 3FTYA 4I17A 1Z6TA 2WXRA 3U64A 2J09A 3UT4A 2AWIA 2XGOA 3ASDA 2WM9A 4QEOA 2XPIA 3OAWA 2JEKA 2WQHA 4IRUA 3OXFA 3UT8A 2VGYA 2BUGA 5LFAA 4GB9A 3ZYQA 1IQUA 2WXIA 3U9WA 3HIZA 3I4RB 3K9IA 3RJVA 3MJWA 1OWNA 4I43A 4ILIA 2VTBA 2I1JA 3B7SA 4AU7A 4Y6CA 2VGXB 3CQGB 2XEVA 4XKCA 5BNWA 1SZ9A 3DBSA 4NJ5A 3M59A 4J8DA 3ZPJA 3PVLA 2UY1B 2WXHA 4YNDA 2O8JA 4JW1A 3IHVA 3G2TA 5CHEE 2J4DA 5G04J 3FH8A 4GAAA 2WXPA 3ZW3A 5JJ6A 3CR3A 4U04A 3QWWA 4URKA 2UY1A 4J7IA 4LERA 3CIAA 2IOLA 4ACLA 3VUZA 4PH4B 1E7UA 3KEZA 1MUFA 4G1TA 3MV3B 4GPKA 1NZNA 1OWLA 3D9JA 3OOIA 4J6IA 3LY7A 3PE3A 2Y4UA 3FU0A 3KS2A 1H0AA 4ILGA 5CCLA 1FCHA 1U3CA 5AJLA 4FA6A 3APFA 4EZLA 4I6EA 2V0PA 4R7LA 3U66A 2JV0A 4XI9A 2IFUA 2WMNA 5G05C 3L08A 2EQXA 2X3MA 3OPEA 3AS8A 3LKUA 3G2VA 3R9AB 3CLJA 4APFA 4CRWA 2UWJG 3PE4A 4KZ0A 2WXMA 3LXUX 4HOQA 3QJZA 4U0UA 3SBSA 3L13A 2WXLA 3FWVA 5DIZA 3LYAA 3UX4A 4BSXA 4HVBA 1QQEA 4I6JA 3DALA 4NVQA 4RG9A 3LDZA 4AV7A 4DI3A 1H3IA 5CPRB 4E47A 4IYPA 3ZYLA 5KJMA 3IBEA 3I3NA 2IJGX 4IJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CKC A;  3UUX A;  4CGV A;  3TAX A;  2LNI A;  3HNA A;  1ZKK A;  2LSV A;  2KCK A;  2BQZ A;  2W5Y A;  2YQ8 A;  2RFI A;  4APO A;  5G04 C;  4KBQ A;  5LSX A;  2NC9 A;  5HQ8 A;  1QZ2 A;  3TG5 A;  1WM5 A;  3CBP A;  3RIB A;  5FTP A;  1OUV A;  1P5Q A;  4WNE A;  1ELW A;  5HI7 A;  2AVP A;  3RO2 A;  2FO7 A;  4U0S A;  3MV2 B;  3O48 A;  3DB5 A;  5M72 A;  3F9Z A;  3CVQ A;  5KJK A;  4ME2 A;  3F9X A;  4I9E A;  4AY6 A;  3Q49 B;  3QOU A;  4JHR A;  3ZHE B;  5FZR A;  4WNG A;  5EKQ D;  3ULQ A;  3VTY A;  1TJC A;  3MKR A;  3FFL A;  4RG6 A;  4YNM A;  5JIN A;  3ASH A;  4G26 A;  3AS4 A;  3F9W A;  4J0U A;  3S7J A;  5JIY A;  5TEG A;  4JDS A;  5JJT A;  2HO1 A;  4GCO A;  3CK9 A;  2QFC A;  4U0Z A;  2VYI A;  3Q4A B;  1KT0 A;  3FPD A;  4IJ8 A;  3M56 A;  3SWC A;  2OOE A;  2QPW A;  4GZ3 A;  3BEE A;  3ASF A;  1N6C A;  3ZN3 A;  4NRH B;  4Y6W A;  1N6A A;  4GA0 A;  4YPU A;  3RJW A;  4YVQ C;  5JJ7 A;  4JL0 A;  3KMA A;  3CK7 A;  4I2Z A;  2HYZ A;  1PC2 A;  5KJL A;  3URZ A;  5FJY A;  5F6K C;  4HOU A;  2DBA A;  4WNF A;  5EX0 A;  4YPE A;  5A7D B;  3CVP A;  3WXX A;  4UQX A;  2R5S A;  2E2E A;  4JLG A;  4GYY A;  4G23 A;  3CK8 A;  5CCM A;  4G24 A;  4GZ6 A;  3SZ7 A;  2PL2 A;  4UQZ A;  5ARG A;  2IF4 A;  2PQN A;  3NF1 A;  2XCC A;  1YA0 A;  2L6J A;  3S8P A;  3M54 A;  4J7F A;  4A1S A;  2LSU A;  3ASG A;  4I51 A;  1MVX A;  3MA5 A;  3CVN A;  4O30 A;  4N2S A;  4YNP A;  3Q5M A;  4XI0 A;  1IHG A;  3ESK A;  3N71 A;  1O9S A;  5TH7 A;  4LDG A;  3M5A A;  4N5C A;  3M57 A;  4AM9 A;  3LCA A;  3MEK A;  1B89 A;  3QDN A;  3VV0 A;  3ZFW A;  4YPA A;  2W5Z A;  4H7X A;  1XQH A;  3S7B A;  4U07 A;  1N3J A;  4HOS A;  2VSN A;  4AY5 A;  4J83 A;  3IEG A;  3OS5 A;  4HOT A;  4N3C A;  3S7F A;  1XNF A;  4KXK B;  4JA9 A;  5LCW J;  4G2V A;  2F69 A;  3RQ4 A;  4RZ0 A;  4N39 A;  3S7D A;  2OND A;  5TTF A;  4GA2 A;  4CDR A;  2FBN A;  2PZI A;  2R3A A;  2C2L A;  3EP0 A;  1MVH A;  1KLX A;  3RKV A;  5T5G A;  3KMJ A;  4J8F A;  5D0Q D;  5F5E A;  5FZS A;  4MI0 A;  5AYW D;  2FF4 A;  2P58 C;  3KAE A;  3MO2 A;  4NQ0 A;  1PEG A;  4GA1 A;  4BWR A;  2YHC A;  2Y4T A;  5A6C A;  5JHN A;  4GCN A;  4GZ5 A;  3LPZ A;  4QEP A;  4Z4P A;  2V5F A;  4G25 A;  5ARF A;  3ZGQ A;  3MO0 A;  2WPV A;  3GW4 A;  3EDT B;  3HYM B;  2C0M A;  4GYO A;  1NA0 A;  5DBK A;  2GW1 A;  4LEU A;  5LCW C;  5KJN A;  1KT1 A;  4I9C A;  4W9R A;  1MT6 A;  5FT9 A;  3SF4 A;  5BW8 C;  3UPV A;  4FMU A;  4JA7 A;  3U3W A;  3U4T A;  4J8E A;  4J8O A;  3JYS A;  2VGX A;  1ZU2 A;  3M53 A;  1ZBP A;  5D0O D;  4BT8 A;  2XGS A;  1NA3 A;  3CBO A;  2PQR A;  3CVL A;  4UI9 J;  4WND A;  3VTX A;  3UQ3 A;  2KCL A;  3CKB A;  5BT1 A;  4AIF A;  3M58 A;  5EX3 A;  3QWP A;  2KCV A;  4ABN A;  1H3I A;  3KD7 A;  4EQF A;  3BO5 A;  2VQ2 A;  3PDN A;  4BUP A;  3OXG A;  2HR2 A;  5F59 A;  1WAO 1;  4HOR A;  3GYZ A;  3RAY A;  5EG2 A;  4H7Y A;  1W3B A;  3IHX A;  4H12 A;  1ML9 A;  2XGM A;  4I2W A;  4WUY A;  3CEQ A;  3LY9 A;  2FI7 A;  4BT9 A;  5T0M A;  4I1A A;  2IGQ A;  3SW9 A;  3CBM A;  3AS5 A;  3F9Y A;  2VSY A;  2C0L A;  2KC7 A;  2MHK A;  3TG4 A;  3GZ2 A;  3QKY A;  4MI5 A;  4UQY A;  5C1D A;  5T0K A;  1HH8 A;  3CV0 A;  4UI9 C;  1HXI A;  4O6F A;  4C1Q A;  4GYW A;  1A17 A;  5F6L A;  5JJ0 A;  4BTB A;  3M55 A;  2KAT A;  5LSZ A;  4N3A A;  4CGW A;  2FEZ A;  4XIF A;  4UI9 K;  3E4B A;  4KYO B;  2I6H A;  2G46 A;  4F3V A;  4B94 A;  3MO5 A;  3QWV A;  5FZQ A;  1Y8M A;  5AYF A;  3KMT A;  3RU0 A;  1IYG A;  3Q47 B;  3ZHE A;  3K5K A;  4N2Q A;  3LY8 A;  2J9Q A;  3Q15 A;  2XCB A;  2Q7F A;  3GZ1 A;  3OXL A;  3RO3 A;  5G05 J;  4YVO A;  1E96 B;  3TGO A;  4N3B A;  3FP3 A;  1ELR A;  2JLB A;  4IN3 B;  4BTA A;  1HZ4 A;  4I17 A;  2XGO A;  3ASD A;  4QEO A;  2XPI A;  2WQH A;  3OXF A;  2VGY A;  2BUG A;  3K9I A;  3RJV A;  4QEN A;  4AU7 A;  4Y6C A;  2VGX B;  2XEV A;  5BNW A;  4NJ5 A;  3M59 A;  4J8D A;  3ZPJ A;  2UY1 B;  4YND A;  2O8J A;  5CHE E;  5G04 J;  5JJ6 A;  4U04 A;  4J7I A;  3QWW A;  2UY1 A;  3VUZ A;  1MUF A;  4G1T A;  3MV3 B;  4GPK A;  1NZN A;  3OOI A;  3LY7 A;  3PE3 A;  2Y4U A;  3KS2 A;  5CCL A;  1FCH A;  2JV0 A;  4XI9 A;  2IFU A;  5G05 C;  3OPE A;  3AS8 A;  3LKU A;  3R9A B;  2UWJ G;  3PE4 A;  4HOQ A;  4U0U A;  3FWV A;  5DIZ A;  3LYA A;  3DAL A;  4NVQ A;  1QQE A;  4RG9 A;  5CPR B;  4E47 A;  5KJM A;  4IJD A; 
#chains in the Genus database with same CATH topology
 1Y6I A;  3UUX A;  3HVE B;  1ZKK A;  5FQ6 A;  1D9S A;  4DX2 A;  5D2M C;  2V5Q C;  3EU5 A;  5G04 C;  1MQS A;  1H6O A;  2XEE A;  1WM5 A;  5EIL A;  3L17 A;  3DB5 A;  1S70 B;  3V31 A;  4BX9 A;  1LF8 A;  3ML9 A;  4MS6 A;  5E75 A;  4UWL A;  4CYM D;  3ULQ A;  3CHM A;  4JPS A;  2I2O A;  3EIJ A;  2IO3 C;  1NP7 A;  1TJC A;  2IU1 A;  1N4Q A;  3D9I A;  3L6A A;  4HFG A;  5JIY A;  2ZGD A;  3HG0 D;  1HG5 A;  2HO1 A;  4GCO A;  2LO6 A;  5D66 A;  3FPD A;  1BU9 A;  1BD8 A;  1JUQ A;  4UWH A;  2OVF A;  4IUL A;  2YIN A;  5JJ7 A;  2P9S G;  3KMA A;  4XEI G;  3SY2 A;  3F6Q A;  2DBA A;  4PS8 A;  3WXX A;  4UQX A;  4GYY A;  4G23 A;  5CCM A;  4UQZ A;  1OT8 A;  1EDU A;  1YA0 A;  4BY6 A;  4DUI A;  4GTP A;  4FAD A;  2V4H C;  3J5P A;  4F53 A;  3OTN A;  3UM0 A;  3N71 A;  3L16 A;  2ZGG A;  3P1U A;  4OVV A;  4I1M A;  3G2S A;  1H2T C;  1OWM A;  3QDN A;  3VV0 A;  3UIN C;  4LG6 A;  4YPA A;  2W5Z A;  4H7X A;  3S7B A;  4D10 C;  4HOS A;  4MBG A;  4C48 B;  2WXN A;  4AY5 A;  4GU5 A;  3SHF A;  3S7F A;  3NQP A;  2CG3 A;  5HS0 A;  4K5A B;  4JB8 P;  5EIB E;  3WG7 E;  4N39 A;  4XE0 A;  3TJP A;  4GTQ A;  3UM2 A;  2J08 A;  1GW6 A;  1UJK A;  4CDR A;  1E8Z A;  2R3A A;  4NAC A;  4K03 A;  2GRQ B;  3D3M A;  1MVH A;  2X6J A;  1KLX A;  5T5G A;  3KMJ A;  5D0Q D;  5F5E A;  5HKP A;  5FZS A;  2QYJ A;  3MO2 A;  3FTS A;  2H6H A;  1IKN D;  4AP2 A;  1QYM A;  5EID A;  2Y4T A;  4FHJ A;  3FDH A;  4XZ4 A;  1Q2Z A;  2B0O E;  4G8L A;  5JHN A;  4GCN A;  5ANR A;  3FY4 A;  4GZ5 A;  4Z4P A;  1O1R A;  3ASO E;  5KWD A;  4G25 A;  2BKK B;  4Q94 A;  1DC2 A;  3ZGQ A;  3FH5 A;  1UOH A;  2R03 A;  4GTT A;  4GMJ A;  5LCW C;  3JXJ A;  1KT1 A;  4BSZ B;  1K8K G;  2OVB A;  4ANU A;  3SF4 A;  2XQ0 A;  2DZO A;  1TN6 A;  3UPV A;  4F7A A;  1KZO A;  5ENO D;  3ONK A;  4TXQ A;  3JYS A;  1PAQ A;  3B7U X;  1BLX B;  4B0Z A;  4EEC A;  5D0O D;  1NA3 A;  4FP7 A;  3FTV A;  2PQR A;  3C5R A;  1X81 A;  4UI9 J;  3VTX A;  1ZB1 A;  5KCM A;  4P29 A;  3CVW A;  1EPU A;  5AQA A;  3X2Q E;  4BX8 A;  3AG1 E;  3SBT B;  1HX8 A;  3UMV A;  3PDN A;  2GGF A;  2HR2 A;  1EF1 C;  3PUJ A;  5BXO A;  4U63 A;  3R7Q A;  4B8C B;  2AXU A;  5F59 A;  1WAO 1;  2OV8 A;  3RAY A;  3AJI A;  3B7T A;  3HXB A;  3PZ4 A;  4GTV A;  1N4S A;  4WUY A;  1NI1 A;  4ANV A;  3SW9 A;  2WVI A;  1UN9 A;  1DVP A;  2MHK A;  3NOC D;  3QKY A;  4UQY A;  3CGH A;  4LRZ A;  3ZU7 B;  5BUZ A;  1HXI A;  3MX3 A;  3CHO A;  4GYW A;  5JJ0 A;  5FQ8 A;  2P9P G;  3M55 A;  1O1S A;  5FIO A;  3FUN A;  2KAT A;  5LSZ A;  4CGW A;  3EUV A;  4XIF A;  1E8X A;  2J8S D;  3MO5 A;  4F1S A;  5FZQ A;  3ZKJ A;  2WQ7 A;  5AYF A;  3RU0 A;  3QK0 A;  2GRR B;  1SA5 A;  1NFI E;  3GZ1 A;  3RO3 A;  3APC A;  3FUL A;  1Z3Y A;  2DCP A;  4CZ2 D;  3TGO A;  4I1O B;  4IN3 B;  3ZYM A;  3FTY A;  1TR4 A;  2WXR A;  3U64 A;  2XGO A;  3ASD A;  4GTS A;  2VGY A;  5LFA A;  3ZYQ A;  1IQU A;  3BU8 A;  4DX7 D;  3MJW A;  4HI9 A;  4AU7 A;  3B7S A;  4XKC A;  1SZ9 A;  4TUM A;  4NJ5 A;  4EHM A;  3IHV A;  2WXP A;  1OXJ A;  3QWW A;  2ETA A;  1D8E A;  5CER B;  3VUZ A;  1MUF A;  4G1T A;  3MV3 B;  3D9J A;  1LTX A;  5CCL A;  1U3C A;  2ETC A;  4EZL A;  2OEW A;  1WDY A;  2WMN A;  2EQX A;  2H6F A;  3G2V A;  3CLJ A;  3V30 A;  3PE4 A;  1JCQ A;  3L13 A;  3FWV A;  3DAL A;  3LYA A;  2EIN E;  4I6J A;  3KSL A;  4DI3 A;  5CPR B;  3IBE A;  4GMR A;  3PZ2 A;  1TN8 A;  2GRP B;  3CKC A;  3DSW A;  3DXM G;  3MKQ B;  3TAX A;  4K5B A;  1AP7 A;  2XHE A;  3ML8 A;  3AG3 E;  2KCK A;  2QZA A;  2RFI A;  4APO A;  3MGB A;  5LSX A;  3TG5 A;  3TL5 A;  1SA4 A;  5FQ4 A;  3Q9N C;  2DYR E;  4TRQ A;  2FO7 A;  1JCS A;  2J49 A;  3CVQ A;  5AQ9 A;  4ME2 A;  3MYV A;  5E76 A;  4AY6 A;  3Q49 B;  4JHR A;  4DK5 A;  4KVO A;  3TWR A;  4AJW A;  1FT1 A;  1MX4 A;  3LEW A;  2FUL A;  3PRE A;  4LSZ E;  1KZP A;  3AAA C;  5AEN A;  3F9W A;  3S7J A;  3D9K A;  3CK9 A;  2QFC A;  3VLF A;  3M56 A;  5AAO A;  5JA4 D;  1HS6 A;  2OOE A;  3ASF A;  3JXI A;  1N6C A;  2JAB A;  3ZN3 A;  4NRH B;  4Y6W A;  3FUF A;  4GA0 A;  3RJW A;  4YVQ C;  3DSS A;  4CDN A;  4I2Z A;  5FIN A;  1IHB A;  3ZXS A;  2B6C A;  3PZD A;  2IO2 C;  4HOU A;  4YPE A;  1ELK A;  1OCR E;  3E37 A;  3ZRH A;  2R02 A;  2ETB A;  2GRM A;  1TEZ A;  4L1B A;  2PL2 A;  2AXZ A;  4L2Y A;  5ARG A;  4BFR A;  2L6J A;  3S8P A;  4PS7 A;  1MJ0 A;  3IV0 A;  4J8S A;  3UKU G;  3T5V A;  1MVX A;  3FEY A;  3MA5 A;  4FHK A;  4N2S A;  4XI0 A;  1O9S A;  3CVY A;  2AXV A;  4N5C A;  4L23 A;  3M57 A;  3LCA A;  3MEK A;  3V2O A;  4JEH A;  1NL4 A;  4MRU A;  3ZFW A;  4CEM A;  1V54 E;  3TWW A;  1E8Y A;  4O1P A;  1XQH A;  2L0T B;  4U07 A;  1PY1 A;  2I9C A;  2LXL A;  2AW6 A;  2WB2 A;  4EZJ A;  2AJA A;  3LS8 A;  2ILR A;  4RQI A;  4N3C A;  1XNF A;  4X8Q A;  4KXK B;  1K1B A;  4U8H A;  2F69 A;  3G2U A;  4DJA A;  3ZXP A;  2MYO A;  1FT2 A;  3MCX A;  3EP0 A;  3ULE G;  2A5U A;  1HE8 A;  5AAR A;  3HXD A;  5AQB A;  1JWF A;  4MI0 A;  4FJY A;  5AYW D;  3KAE A;  3SFY A;  3NBN B;  4DRX E;  4KZC A;  3UTM A;  4HXI A;  4GA1 A;  4BWR A;  3ABL E;  3EHQ A;  4HI8 A;  2YHC A;  3SI5 A;  4CT4 A;  3FU6 A;  5A6C A;  4A63 B;  1JPL A;  5G55 A;  3AU4 A;  3E32 A;  1N94 A;  4Q69 A;  4HQD A;  4TXP A;  4HLE A;  3MO0 A;  2WPV A;  3TWS A;  3NZS A;  1TYQ G;  3Q73 A;  4GYO A;  3ZVV A;  3R7R A;  3W9G A;  2NSZ A;  5ENR D;  2CG2 A;  1S0P A;  4HB5 A;  5EYP F;  3C3R A;  2CFU A;  3W9F A;  4GTO A;  5EDS A;  4FMU A;  3FTX A;  3U4T A;  4J8E A;  2H6I A;  2WXJ A;  2R2L A;  4J8O A;  4O60 A;  1JWG A;  1ZU2 A;  3PUK A;  1BI7 B;  2CHZ A;  1IQR A;  3Q79 A;  4B8A A;  3UIP C;  2PM6 A;  3SD5 A;  2GRN B;  3CKB A;  5BT1 A;  3IXE A;  4ABN A;  3KD7 A;  4N5Q A;  3PRZ A;  2CHW A;  4AEZ C;  3BO5 A;  2VQ2 A;  4KVM A;  2VSX E;  1HF8 A;  1FVH A;  1TNO A;  1H19 A;  5ENS D;  3EHN A;  4FLH A;  2L9B A;  3NZU A;  5EG2 A;  4H7Y A;  3P2B A;  2CFZ A;  4JXT A;  4ATZ D;  3BG0 B;  1ML9 A;  1MHQ A;  2XGM A;  1QBQ A;  5HRY A;  3D9H A;  3CEQ A;  3LY9 A;  4ANX A;  2F8X K;  4A55 A;  4EZK A;  2BKG A;  3F9Y A;  3GZ2 A;  4MI5 A;  1HH8 A;  1HG2 A;  2VJ8 A;  5ENN A;  4UI9 C;  1A17 A;  4WWO A;  3DSU A;  3E4B A;  4K0R A;  4B94 A;  3QWV A;  3DWL G;  2DVW A;  2Y1L E;  1U3D A;  4JVS A;  4BES A;  1N4P A;  2XS1 A;  3FEX A;  3E34 A;  2A5E A;  3Q75 A;  1TNB A;  1L5J A;  3ZEF A;  4YVO A;  5ANL A;  3KEA A;  1DCE A;  1S63 A;  2KZT B;  2IEJ A;  2JLB A;  1MYO A;  4BTA A;  1HZ4 A;  2AWI A;  3C3O A;  2WM9 A;  4G8K A;  3NAW A;  2XPI A;  3OAW A;  2JEK A;  3UT8 A;  3OXF A;  2BUG A;  4GB9 A;  4HRL A;  5B1A E;  2RKK A;  1OWN A;  4Y6C A;  3DBS A;  4J8D A;  2UY1 B;  4YND A;  4JW1 A;  3G2T A;  2J4D A;  3FH8 A;  3ZW3 A;  3J5Q B;  4LER A;  3CIA A;  2HE0 A;  2P2C P;  4ACL A;  1E7U A;  4GPK A;  1O5M A;  3NOG D;  3PE3 A;  3DRA A;  2RFM A;  4ILG A;  1H0A A;  5AJL A;  3APF A;  2V0P A;  2JV0 A;  2EIJ E;  1K1A A;  4L9P A;  3LJN A;  4APF A;  3EHR A;  4U0U A;  2WXL A;  4HVB A;  3UX4 A;  1QQE A;  2EIK E;  3KSQ A;  1N0R A;  1N0Q A;  2IJG X;  4A1G A;  1FVF A;  3FTW A;  3R9M A;  3JUI A;  4FU3 A;  3G2W A;  2GRO B;  3HNA A;  5CMY A;  2LSV A;  3ABK E;  3HVE A;  4A3V A;  2MOW A;  3APD A;  3AU5 A;  3B13 A;  3PEV B;  2ZIR A;  1QZ2 A;  3DSX A;  4A3T A;  3RIB A;  1OUV A;  5KNG A;  3ENE A;  3ZUV B;  2AVP A;  3RO2 A;  3FUI A;  1DNP A;  4U0S A;  5EYL A;  4XKB A;  5KBA A;  1OWP A;  2ION A;  5KJK A;  4F1P A;  5T3R A;  3F9X A;  1SZA A;  3QOU A;  3FTU A;  2RG8 A;  5FZR A;  3AG4 E;  2DIW A;  3JCK C;  2GRL A;  4WNG A;  4M3O A;  3VTY A;  1UJJ A;  2XS8 A;  3FFL A;  4RG6 A;  4UWK A;  5JIN A;  1HFA A;  4J0U A;  3FU5 A;  5TEG A;  4JDS A;  2J4B A;  2VSO E;  2XRZ A;  1RW2 A;  4FLB A;  1RZ4 A;  4DLO A;  2CHX A;  4U8Y D;  2VYI A;  5ENQ D;  2V8S E;  3L54 A;  3ZYK A;  2QPW A;  2X38 A;  3UT7 A;  2Y3A A;  3HXC A;  1N6A A;  3B7R L;  4TUU A;  3CK7 A;  3Q78 A;  3URZ A;  4WNF A;  2XRY A;  3HDX A;  1TNZ A;  3CVP A;  4EPZ A;  1TJF A;  1BI8 B;  2R5S A;  4AXH A;  3L9T A;  3QAR A;  1JCR A;  4XX5 A;  3Q7F A;  3VLD A;  2ZIS A;  3D9M A;  3D9N A;  2IF4 A;  2PQN A;  2XCC A;  4ZHB A;  4A1S A;  3Q7A A;  4PUC A;  2LSU A;  4G11 A;  3ASG A;  3CVN A;  4O30 A;  4YNP A;  1IHG A;  1HU3 A;  1KPS B;  3D9L A;  5TH7 A;  2DWZ A;  4LDG A;  2ZU6 B;  4AM9 A;  1B89 A;  3PZ1 A;  4K5C A;  3UKR G;  4FC8 A;  4HS2 A;  1N3J A;  1Z3X A;  2X6H A;  5BV0 A;  4HNA D;  4JD2 G;  2VSN A;  5JMN D;  4J83 A;  3DSV A;  2OEV A;  3IEG A;  5H7P A;  3OS5 A;  2YHE A;  2RD0 A;  2DYS E;  4OYS A;  4HOT A;  4U96 D;  2L0I A;  3GZS A;  4G2V A;  3RQ4 A;  3S7D A;  2OND A;  1V55 E;  4I6G A;  2LAI A;  2FBN A;  2PZI A;  4E85 A;  2DZN A;  3RKV A;  1H2U A;  3MZL B;  4LNU D;  2WXG A;  3CHP A;  2QYU A;  5BV1 A;  5EN5 D;  3RSE G;  4NQ0 A;  3LVR E;  1DCQ A;  3TWV A;  4U7E B;  4JEU A;  3QB2 A;  2XPZ A;  4CDM A;  1IXV A;  3FUK A;  3DPY A;  2IQC A;  2L6B A;  3LPZ A;  5FQ7 A;  4NIK A;  4QEP A;  2OCC E;  4GPM A;  2Y69 E;  5ARF A;  4JHJ A;  4DX5 D;  3I5P A;  4HLL A;  2HM8 A;  3EDT B;  3HYM B;  4JC8 A;  2C0M A;  4CCA A;  1NA0 A;  5DBK A;  2KZT A;  2GW1 A;  4LEU A;  3DXK G;  5CRU A;  2BF0 X;  4I9C A;  4W9R A;  1MT6 A;  2LXM A;  4C9B B;  1YCS B;  1X5B A;  3PZ3 A;  3DEP A;  5BW8 C;  5CMW A;  3SQV A;  2R17 C;  2PM7 A;  3U3W A;  3NB2 A;  1H6K A;  5JHA A;  4GZC A;  4U8V D;  4V3I A;  1ZBP A;  3CBO A;  2QC9 A;  4ILH B;  3CVL A;  3FUD A;  3UQ3 A;  2KCL A;  4FJZ A;  1G3N B;  4AIF A;  3JQ1 A;  1YMP A;  3QWP A;  4YDW A;  4E6H A;  3D9P A;  1H3I A;  4EQF A;  5AJD A;  1SW6 A;  4BUP A;  3TXM A;  4EBA G;  4HOR A;  4Z68 A;  1W3B A;  3IHX A;  4H12 A;  3CHS A;  4AVX A;  3TWU A;  4I2W A;  2EIM E;  3B7B A;  5C2Y A;  1Z5S C;  4BT9 A;  4I1A A;  3ZNG A;  4RLY A;  3UM1 A;  3BUA A;  3AS5 A;  3LJ3 A;  3UI2 A;  1MX2 A;  3RRM B;  2NXP A;  1EYH A;  4DX6 D;  2WQ6 A;  2IY0 C;  2WXO A;  3CV0 A;  3CVV A;  1TNU A;  3FUE A;  5F6L A;  3CHQ A;  3ESL A;  4OAU C;  4BTB A;  1MX6 A;  4B93 B;  2F8Y A;  3SGH A;  1BPO A;  1AWC B;  4N3A A;  3SFX A;  3SNX A;  4KYO B;  2I6H A;  3PEU B;  4F6R D;  1LD8 A;  4HBD A;  3Q47 B;  4L7T A;  2MRI A;  3LY8 A;  1TNY A;  2J9Q A;  3BQO A;  3OXL A;  1N52 A;  5G05 J;  1E96 B;  3V79 K;  3E30 A;  2X6F A;  3FUJ A;  3FP3 A;  1SQM A;  5JHB A;  3D9O A;  1Z6T A;  3UT4 A;  4M7C A;  4BET A;  2LUH A;  2WQH A;  5ENP D;  2WXI A;  2EIL E;  3U9W A;  3HIZ A;  3I4R B;  3RJV A;  4ILI A;  2I1J A;  2VGX B;  3CQG B;  2XEV A;  5BNW A;  3M59 A;  3PVL A;  2Y0B G;  3E33 A;  2O8J A;  5G04 J;  4GAA A;  5JJ6 A;  3CR3 A;  3V2X A;  2IOL A;  4PH4 B;  1WG0 A;  2XZD G;  1TN7 A;  1OWL A;  5BXU A;  3OOI A;  4J6I A;  3FU0 A;  3KS2 A;  5KNH D;  1S64 A;  4I6E A;  3U66 A;  2IFU A;  3OPE A;  3AS8 A;  5ENT D;  4CRW A;  2UWJ G;  4KZ0 A;  2WXM A;  3LXU X;  4HOQ A;  3QJZ A;  3SBS A;  5DIZ A;  4NVQ A;  2VGE A;  3ZYL A;  5KJM A;  3I3N A;  3UXG A;  4CGV A;  2LNI A;  2H6G A;  3MKQ A;  3DPD A;  2BQZ A;  4RSY A;  5LOZ A;  2W5Y A;  2YQ8 A;  4PDX A;  4PS3 A;  4KBQ A;  2WXQ A;  2NC9 A;  5HQ8 A;  2XPY A;  2FO1 E;  3ULY A;  1FPP A;  3CBP A;  1OCZ E;  5FTP A;  1P5Q A;  4WNE A;  3T8M A;  1A5E A;  3UM3 A;  2P9I G;  1ELW A;  5HI7 A;  1K3Z D;  3MV2 B;  3O48 A;  3JQ0 A;  5M72 A;  3F9Z A;  1HO8 A;  3S2A A;  4DI4 A;  4I9E A;  5CBN A;  3ZHE B;  2WXK A;  5EKQ D;  4JHK A;  3HXE A;  3ISM C;  1O1T A;  3FHE A;  4DPR A;  3MKR A;  4YNM A;  2V4L A;  3ASH A;  3QNK A;  4G26 A;  3AS4 A;  1N95 A;  3PS6 A;  3CQC B;  1N4R A;  3CST A;  5JJT A;  5B1B E;  4U95 D;  1N54 A;  4U0Z A;  3Q4A B;  1KT0 A;  4IJ8 A;  3I4G A;  3SWC A;  5B3S E;  4BER A;  2VTB B;  4LUN U;  2BED A;  3FUM A;  3BEE A;  4GZ3 A;  1UG3 A;  3T8K A;  2ZXW E;  1WY6 A;  5J90 A;  4YPU A;  4DX1 A;  1SVX A;  3L82 A;  4JL0 A;  2HYZ A;  1PC2 A;  5KJL A;  5T4Y A;  3TXN A;  5FJY A;  5F6K C;  2XEN A;  3Q9U C;  5EX0 A;  4Q96 A;  5A7D B;  1OY3 D;  3B95 A;  2E2E A;  3DST A;  4JLG A;  3PNL B;  1E7V A;  3CK8 A;  4G24 A;  4GZ6 A;  3SZ7 A;  4WWN A;  2J07 A;  3NF1 A;  5ITZ F;  4OAV B;  1U2V G;  2M63 A;  3M54 A;  4J7F A;  2IOS A;  2PNN A;  4UWF A;  4I51 A;  3CSF A;  3ONL A;  4GZD A;  5AQ7 A;  3Q5M A;  3EU9 A;  3ESK A;  4FUL A;  3VLE A;  3T9K A;  1UN8 A;  3RAU A;  3M5A A;  2WMO A;  4NUR A;  4TV3 A;  4LCT A;  3AG2 E;  3T5X A;  1QNF A;  4EBA A;  4J7W A;  1D8D A;  2E0I A;  4WAF A;  3RRN B;  4MLP A;  3SFZ A;  4JA9 A;  5LCW J;  4RZ0 A;  4B89 A;  5BPP A;  3FTZ A;  5TTF A;  4GA2 A;  3IHY A;  1N11 A;  2A4Z A;  4GTM A;  3QAQ A;  2LAH A;  2C2L A;  1OCC E;  4JZY A;  1H2V C;  2BTD A;  4J8F A;  2FF4 A;  2P58 C;  3RK6 A;  1PEG A;  2X6K A;  3QC1 A;  2P9N G;  3PH0 C;  3TWQ A;  4C0E A;  3C98 A;  5IY5 E;  3EIQ C;  5T8I A;  1YYH A;  4RVB A;  2V5F A;  2R59 A;  4YDE A;  5AN8 A;  5LX8 A;  1INZ A;  4WWP A;  3GW4 A;  4ACK A;  5FWQ A;  4LNB A;  4CT0 A;  5KJN A;  3CVX A;  5FT9 A;  3TWT A;  4AOF A;  4MKT A;  5AIJ A;  2NYJ A;  5LP0 A;  1E8W A;  2F37 A;  4KMO A;  1XGW A;  4JA7 A;  4O1O A;  3DEO A;  3HXF A;  5CBO A;  4DLQ A;  2QY7 A;  2VGX A;  1UW4 B;  4ANW A;  3M53 A;  3EJN A;  2F0Y A;  3TWX A;  4BT8 A;  2XGS A;  4C0M A;  1H6P A;  4HRN A;  3FH7 A;  1E90 A;  3CHR A;  3FUH A;  4WND A;  3C3Q A;  4GTR A;  2X6I A;  3M58 A;  4QFV A;  5EX3 A;  4GML A;  2KCV A;  3ZIM A;  3JUE A;  1OWO A;  3FU3 A;  3OXG A;  2WXF A;  4YDO A;  4KT6 B;  3ABM E;  3GYZ A;  2YNQ A;  4J8Y A;  3UIO C;  4OVU A;  1VDY A;  3PNT B;  2FI7 A;  5T0M A;  3CVU A;  4QQI A;  2IGQ A;  2P9U G;  4LNG A;  4BEP A;  3CBM A;  2VSY A;  2C0L A;  2KC7 A;  3TG4 A;  4ATG A;  5CED B;  5C1D A;  5T0K A;  2P9K G;  1N9A A;  4O6F A;  4C1Q A;  3O4Z A;  5A23 A;  3HHM A;  3RRU A;  2FEZ A;  4UI9 K;  3BG1 B;  2G46 A;  2R05 A;  4F3V A;  3IKO B;  2P9L G;  1OCO E;  2I1K A;  3EHM A;  1Y8M A;  3KMT A;  1IYG A;  3ZHE A;  3K5K A;  5J08 A;  3HRA A;  4N2Q A;  4YDY A;  5G2N A;  3C72 A;  3Q15 A;  2XCB A;  2Q7F A;  4TXR A;  4HRM B;  2KM4 A;  4UWG A;  3LVQ E;  4N3B A;  1LD7 A;  2XEH A;  1ELR A;  4UUC A;  4L2L A;  4I17 A;  2J09 A;  4QEO A;  5CEC B;  4IRU A;  2XZT G;  2RFA A;  3K9I A;  5CEA A;  4QEN A;  4I43 A;  2VTB A;  5CRV A;  3ASN E;  2KBX A;  3ZPJ A;  2WXH A;  5CHE E;  4URK A;  4U04 A;  4J7I A;  2UY1 A;  3KEZ A;  1MZC A;  1NZN A;  4ZFH A;  3SO8 A;  3LY7 A;  2Y4U A;  1FCH A;  4FA6 A;  4R7L A;  4XI9 A;  5G05 C;  3L08 A;  2X3M A;  3LKU A;  3R9A B;  2KXP C;  4BSX A;  4RG9 A;  3LDZ A;  4AV7 A;  4E47 A;  4IYP A;  3L22 A;  4IJD A; 
#chains in the Genus database with same CATH homology
 4A1G A;  1FVF A;  3FTW A;  1Y6I A;  3CKC A;  3JUI A;  4FU3 A;  3UUX A;  3MKQ B;  3G2W A;  3TAX A;  4CGV A;  3HVE B;  2LNI A;  3HNA A;  5CMY A;  2XHE A;  3ML8 A;  3MKQ A;  1ZKK A;  3DPD A;  2LSV A;  5FQ6 A;  2KCK A;  3HVE A;  2BQZ A;  4RSY A;  5LOZ A;  2W5Y A;  2YQ8 A;  4PDX A;  4A3V A;  2RFI A;  2MOW A;  4PS3 A;  4APO A;  5G04 C;  1MQS A;  3APD A;  3AU5 A;  4KBQ A;  2WXQ A;  3MGB A;  3B13 A;  2NC9 A;  3PEV B;  5HQ8 A;  2XPY A;  5LSX A;  1QZ2 A;  3TG5 A;  4A3T A;  1WM5 A;  3CBP A;  3TL5 A;  3RIB A;  3L17 A;  5FTP A;  1OUV A;  1P5Q A;  4WNE A;  3T8M A;  3ENE A;  5FQ4 A;  1ELW A;  4TRQ A;  5HI7 A;  2AVP A;  3RO2 A;  2FO7 A;  3FUI A;  1DNP A;  4U0S A;  3MV2 B;  3O48 A;  3DB5 A;  3JQ0 A;  4XKB A;  5M72 A;  3F9Z A;  1OWP A;  4BX9 A;  1HO8 A;  2ION A;  2J49 A;  3CVQ A;  1LF8 A;  3ML9 A;  5KJK A;  4ME2 A;  3MYV A;  5E76 A;  5T3R A;  3S2A A;  3F9X A;  4DI4 A;  4MS6 A;  1SZA A;  4I9E A;  4AY6 A;  3Q49 B;  3QOU A;  4JHR A;  3FTU A;  5E75 A;  2WXK A;  3ZHE B;  2RG8 A;  5FZR A;  4DK5 A;  2DIW A;  4KVO A;  3JCK C;  2GRL A;  4WNG A;  5EKQ D;  4AJW A;  4UWL A;  4JHK A;  3ULQ A;  3CHM A;  4JPS A;  4M3O A;  3VTY A;  2I2O A;  3EIJ A;  3LEW A;  2FUL A;  1UJJ A;  1NP7 A;  3PRE A;  1TJC A;  2IU1 A;  3FHE A;  4DPR A;  3MKR A;  3FFL A;  4RG6 A;  2V4L A;  4UWK A;  4YNM A;  5JIN A;  5AEN A;  3ASH A;  3D9I A;  3QNK A;  3AS4 A;  1HFA A;  4G26 A;  3F9W A;  4J0U A;  3S7J A;  3L6A A;  3PS6 A;  3FU5 A;  3CQC B;  4HFG A;  5JIY A;  5TEG A;  4JDS A;  3CST A;  3D9K A;  1HG5 A;  2HO1 A;  2VSO E;  2J4B A;  3CK9 A;  4GCO A;  4FLB A;  5JJT A;  2XRZ A;  5JHN A;  2LO6 A;  4DLO A;  2QFC A;  2CHX A;  1N54 A;  4U0Z A;  2VYI A;  3Q4A B;  1KT0 A;  3FPD A;  3VLF A;  4IJ8 A;  3I4G A;  3M56 A;  3SWC A;  2V8S E;  3L54 A;  1HS6 A;  3ZYK A;  2OOE A;  2VTB B;  4LUN U;  2QPW A;  2X38 A;  3FUM A;  3BEE A;  3ASF A;  4GZ3 A;  3UT7 A;  1UG3 A;  2Y3A A;  1N6C A;  3ZN3 A;  4NRH B;  4Y6W A;  1JUQ A;  4UWH A;  1N6A A;  2OVF A;  3B7R L;  3FUF A;  4GA0 A;  4TUU A;  1WY6 A;  4IUL A;  5J90 A;  2YIN A;  4YPU A;  3RJW A;  4YVQ C;  5JJ7 A;  4JL0 A;  4CDN A;  3CK7 A;  4I2Z A;  2HYZ A;  3KMA A;  1PC2 A;  3ZXS A;  5KJL A;  3PZD A;  5T4Y A;  3TXN A;  3URZ A;  5FJY A;  5F6K C;  4HOU A;  2DBA A;  4WNF A;  2XRY A;  5EX0 A;  4Q96 A;  4PS8 A;  1ELK A;  3HDX A;  5A7D B;  4YPE A;  3ZRH A;  3CVP A;  3WXX A;  4UQX A;  4EPZ A;  1TJF A;  2R5S A;  2E2E A;  4AXH A;  4JLG A;  2GRM A;  3PNL B;  1E7V A;  3QAR A;  4G23 A;  4GYY A;  3CK8 A;  1TEZ A;  4XX5 A;  4G24 A;  4GZ6 A;  4L1B A;  3SZ7 A;  5CCM A;  3VLD A;  3ZIM A;  4WWN A;  2J07 A;  2PL2 A;  4UQZ A;  2AXZ A;  3D9M A;  4L2Y A;  5ARG A;  3D9N A;  2IF4 A;  4BFR A;  2PQN A;  3NF1 A;  2XCC A;  1EDU A;  1YA0 A;  2L6J A;  4BY6 A;  3S8P A;  2M63 A;  4PS7 A;  3M54 A;  4J7F A;  4A1S A;  2IOS A;  2LSU A;  3IV0 A;  4G11 A;  4J8S A;  4PUC A;  4FAD A;  3ASG A;  4UWF A;  3T5V A;  1MVX A;  4I51 A;  3CSF A;  3FEY A;  3MA5 A;  3ONL A;  3CVN A;  4FHK A;  4GZD A;  4F53 A;  3OTN A;  4O30 A;  4N2S A;  4YNP A;  3Q5M A;  4XI0 A;  4FUL A;  1IHG A;  3ESK A;  3VLE A;  3N71 A;  1HU3 A;  3L16 A;  3D9L A;  1O9S A;  5TH7 A;  3CVY A;  1UN8 A;  4LDG A;  3M5A A;  2AXV A;  2ZU6 B;  4N5C A;  4L23 A;  2WMO A;  3M57 A;  3P1U A;  4OVV A;  4I1M A;  4AM9 A;  3G2S A;  3LCA A;  1H2T C;  3MEK A;  4JEH A;  1B89 A;  1OWM A;  3QDN A;  3VV0 A;  4MRU A;  4NUR A;  3ZFW A;  4CEM A;  1E8Y A;  2W5Z A;  4H7X A;  4FC8 A;  4TV3 A;  4HS2 A;  1XQH A;  4YPA A;  2L0T B;  4LCT A;  3S7B A;  4U07 A;  1PY1 A;  4D10 C;  1Z3X A;  4HOS A;  1N3J A;  2I9C A;  2X6H A;  5BV0 A;  2WXN A;  2VSN A;  2AW6 A;  4AY5 A;  2WB2 A;  3T5X A;  4J83 A;  4EZJ A;  3IEG A;  1QNF A;  3LS8 A;  4EBA A;  2ILR A;  4GU5 A;  2YHE A;  2RD0 A;  3SHF A;  3OS5 A;  4HOT A;  4OYS A;  4N3C A;  3S7F A;  3NQP A;  2E0I A;  4WAF A;  1XNF A;  3RRN B;  2CG3 A;  4MLP A;  4KXK B;  3SFZ A;  2L0I A;  3GZS A;  4JA9 A;  4G2V A;  5LCW J;  2F69 A;  4U8H A;  3RQ4 A;  4RZ0 A;  3G2U A;  4N39 A;  3S7D A;  4B89 A;  5BPP A;  3FTZ A;  2OND A;  5TTF A;  4GA2 A;  4XE0 A;  4I6G A;  3TJP A;  2J08 A;  1GW6 A;  2LAI A;  1UJK A;  3IHY A;  4CDR A;  1E8Z A;  4DJA A;  2A4Z A;  2FBN A;  2PZI A;  4NAC A;  2R3A A;  4E85 A;  3QAQ A;  2LAH A;  3MCX A;  2C2L A;  4K03 A;  3D3M A;  1MVH A;  3EP0 A;  2A5U A;  2X6J A;  1HE8 A;  1KLX A;  3RKV A;  5T5G A;  3KMJ A;  4JZY A;  1H2V C;  2BTD A;  4J8F A;  5D0Q D;  5F5E A;  1H2U A;  3MZL B;  1JWF A;  5FZS A;  2WXG A;  4QEN A;  4MI0 A;  3CHP A;  2FF4 A;  2P58 C;  4FJY A;  5AYW D;  5BV1 A;  3KAE A;  3RK6 A;  3MO2 A;  4KZC A;  4NQ0 A;  3FTS A;  3LVR E;  1PEG A;  2X6K A;  3QC1 A;  4HXI A;  4GA1 A;  3PH0 C;  4AP2 A;  4BWR A;  4C0E A;  3C98 A;  4JEU A;  2YHC A;  2Y4T A;  4FHJ A;  3FDH A;  2XPZ A;  3QB2 A;  4XZ4 A;  3SI5 A;  3FUK A;  4CDM A;  3EIQ C;  5T8I A;  3FU6 A;  2IQC A;  4CT4 A;  5A6C A;  4GCN A;  5ANR A;  1JPL A;  3FY4 A;  3L22 A;  3LPZ A;  4GZ5 A;  4RVB A;  5FQ7 A;  5G55 A;  4Z4P A;  4QEP A;  2V5F A;  2R59 A;  3AU4 A;  4Q69 A;  5LX8 A;  4G25 A;  5ARF A;  4HLE A;  1INZ A;  4Q94 A;  3ZGQ A;  3MO0 A;  4JHJ A;  2WPV A;  3FH5 A;  3I5P A;  3GW4 A;  3NZS A;  4WWP A;  2HM8 A;  3EDT B;  4ACK A;  3HYM B;  4JC8 A;  2C0M A;  4GYO A;  3ZVV A;  5FWQ A;  3R7R A;  4CCA A;  1NA0 A;  5DBK A;  2KZT A;  2NSZ A;  2GW1 A;  4LEU A;  4GMJ A;  2CG2 A;  5LCW C;  5KJN A;  1S0P A;  4CT0 A;  3CVX A;  1KT1 A;  2BF0 X;  4I9C A;  4W9R A;  1MT6 A;  2OVB A;  5FT9 A;  2CFU A;  4ANU A;  4AOF A;  4MKT A;  3SF4 A;  4C9B B;  5AIJ A;  2XQ0 A;  1X5B A;  5LP0 A;  1E8W A;  4KMO A;  5EDS A;  5BW8 C;  5CMW A;  1XGW A;  3UPV A;  4FMU A;  4F7A A;  2R17 C;  2PM7 A;  3FTX A;  4JA7 A;  3U3W A;  3U4T A;  4J8E A;  2WXJ A;  3ONK A;  4J8O A;  4DLQ A;  3JYS A;  1JWG A;  1PAQ A;  2QY7 A;  2VGX A;  3B7U X;  1H6K A;  1UW4 B;  1ZU2 A;  3PUK A;  4ANW A;  5JHA A;  4GZC A;  4B0Z A;  3M53 A;  3EJN A;  2CHZ A;  1IQR A;  4V3I A;  1ZBP A;  5D0O D;  4BT8 A;  4EEC A;  2XGS A;  1NA3 A;  4C0M A;  4E6H A;  4FP7 A;  3FTV A;  3CBO A;  3FH7 A;  2PQR A;  1E90 A;  3CHR A;  3FUH A;  4ILH B;  3CVL A;  4UI9 J;  4WND A;  3VTX A;  5KCM A;  3FUD A;  4P29 A;  3UQ3 A;  4B8A A;  3CVW A;  1EPU A;  2PM6 A;  3SD5 A;  2KCL A;  3CKB A;  5BT1 A;  4FJZ A;  4AIF A;  4BX8 A;  2X6I A;  3M58 A;  4QFV A;  3JQ1 A;  3SBT B;  5EX3 A;  3QWP A;  4GML A;  1HX8 A;  2KCV A;  3D9P A;  3KD7 A;  3UMV A;  4ABN A;  3PRZ A;  1OWO A;  2CHW A;  3FU3 A;  4AEZ C;  4EQF A;  5AJD A;  2VQ2 A;  3PDN A;  3BO5 A;  4KVM A;  2VSX E;  1HF8 A;  4BUP A;  1FVH A;  3OXG A;  2WXF A;  2GGF A;  3TXM A;  2HR2 A;  1EF1 C;  3PUJ A;  4EBA G;  4U63 A;  1H19 A;  3R7Q A;  3EHN A;  4B8C B;  4KT6 B;  2AXU A;  4FLH A;  5F59 A;  1WAO 1;  2L9B A;  3NZU A;  4HOR A;  2OV8 A;  3GYZ A;  2YNQ A;  3RAY A;  5EG2 A;  3B7T A;  1W3B A;  4H7Y A;  3IHX A;  4H12 A;  3P2B A;  3CHS A;  2CFZ A;  4AVX A;  4JXT A;  3BG0 B;  4OVU A;  1MHQ A;  2XGM A;  4I2W A;  1ML9 A;  4WUY A;  1VDY A;  5C2Y A;  4ANV A;  3CEQ A;  3LY9 A;  3PNT B;  2FI7 A;  4BT9 A;  4ANX A;  5T0M A;  4I1A A;  3CVU A;  2IGQ A;  3SW9 A;  2WVI A;  4A55 A;  1UN9 A;  4EZK A;  3CBM A;  3AS5 A;  1DVP A;  3F9Y A;  2VSY A;  2C0L A;  2KC7 A;  2MHK A;  3LJ3 A;  3TG4 A;  3GZ2 A;  3QKY A;  4ATG A;  3RRM B;  4MI5 A;  4UQY A;  2NXP A;  5C1D A;  3CGH A;  1EYH A;  5T0K A;  1HH8 A;  1HG2 A;  2VJ8 A;  4LRZ A;  5ENN A;  2WQ6 A;  2WXO A;  3CVV A;  3CV0 A;  4UI9 C;  5BUZ A;  1HXI A;  4O6F A;  4C1Q A;  3MX3 A;  3CHO A;  4GYW A;  1A17 A;  3FUE A;  3O4Z A;  5F6L A;  3CHQ A;  3ESL A;  5JJ0 A;  4BTB A;  5FQ8 A;  5A23 A;  3M55 A;  3SGH A;  1BPO A;  3FUN A;  2KAT A;  3HHM A;  3RRU A;  5LSZ A;  4N3A A;  4CGW A;  2FEZ A;  4WWO A;  4XIF A;  3SNX A;  1E8X A;  4UI9 K;  3E4B A;  3BG1 B;  4K0R A;  4KYO B;  2I6H A;  3PEU B;  4F3V A;  4B94 A;  2G46 A;  3MO5 A;  3IKO B;  3EHM A;  2I1K A;  3QWV A;  4F1S A;  5FZQ A;  1Y8M A;  1U3D A;  2WQ7 A;  3KMT A;  5AYF A;  4JVS A;  3RU0 A;  1IYG A;  3Q47 B;  3QK0 A;  4L7T A;  3ZHE A;  5J08 A;  4N2Q A;  3K5K A;  2MRI A;  3LY8 A;  2J9Q A;  5G2N A;  3Q15 A;  2XCB A;  2Q7F A;  3GZ1 A;  3FEX A;  2KM4 A;  3OXL A;  3RO3 A;  3APC A;  1N52 A;  3FUL A;  5G05 J;  1Z3Y A;  1L5J A;  3ZEF A;  4UWG A;  2DCP A;  4YVO A;  5ANL A;  2KZT B;  1E96 B;  3LVQ E;  3TGO A;  4N3B A;  2X6F A;  3FUJ A;  3FP3 A;  1SQM A;  1ELR A;  2JLB A;  4I1O B;  4IN3 B;  3ZYM A;  5JHB A;  4L2L A;  3D9O A;  4BTA A;  1HZ4 A;  3FTY A;  4I17 A;  1Z6T A;  2WXR A;  3U64 A;  2J09 A;  3UT4 A;  2AWI A;  2XGO A;  3ASD A;  2WM9 A;  4QEO A;  2XPI A;  3OAW A;  2JEK A;  2WQH A;  4IRU A;  3OXF A;  3UT8 A;  2VGY A;  2BUG A;  5LFA A;  4GB9 A;  3ZYQ A;  1IQU A;  2WXI A;  3U9W A;  3HIZ A;  3I4R B;  3K9I A;  3RJV A;  3MJW A;  1OWN A;  4I43 A;  4ILI A;  2VTB A;  2I1J A;  3B7S A;  4AU7 A;  4Y6C A;  2VGX B;  3CQG B;  2XEV A;  4XKC A;  5BNW A;  1SZ9 A;  3DBS A;  4NJ5 A;  3M59 A;  4J8D A;  3ZPJ A;  3PVL A;  2UY1 B;  2WXH A;  4YND A;  2O8J A;  4JW1 A;  3IHV A;  3G2T A;  5CHE E;  2J4D A;  5G04 J;  3FH8 A;  4GAA A;  2WXP A;  3ZW3 A;  5JJ6 A;  3CR3 A;  4U04 A;  3QWW A;  4URK A;  2UY1 A;  4J7I A;  4LER A;  3CIA A;  2IOL A;  4ACL A;  3VUZ A;  4PH4 B;  1E7U A;  3KEZ A;  1MUF A;  4G1T A;  3MV3 B;  4GPK A;  1NZN A;  1OWL A;  3D9J A;  3OOI A;  4J6I A;  3LY7 A;  3PE3 A;  2Y4U A;  3FU0 A;  3KS2 A;  1H0A A;  4ILG A;  5CCL A;  1FCH A;  1U3C A;  5AJL A;  4FA6 A;  3APF A;  4EZL A;  4I6E A;  2V0P A;  4R7L A;  3U66 A;  2JV0 A;  4XI9 A;  2IFU A;  2WMN A;  5G05 C;  3L08 A;  2EQX A;  2X3M A;  3OPE A;  3AS8 A;  3LKU A;  3G2V A;  3R9A B;  3CLJ A;  4APF A;  4CRW A;  2UWJ G;  3PE4 A;  4KZ0 A;  2WXM A;  3LXU X;  4HOQ A;  3QJZ A;  4U0U A;  3SBS A;  3L13 A;  2WXL A;  3FWV A;  5DIZ A;  3LYA A;  3UX4 A;  4BSX A;  4HVB A;  1QQE A;  4I6J A;  3DAL A;  4NVQ A;  4RG9 A;  3LDZ A;  4AV7 A;  4DI3 A;  1H3I A;  5CPR B;  4E47 A;  4IYP A;  3ZYL A;  5KJM A;  3IBE A;  3I3N A;  2IJG X;  4IJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...