5KJLA

Smyd2 in complex with az378
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
428
structure length
428
Chain Sequence
b'LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-lysine methyltransferase SMYD2
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 141
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjlA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjlA01
2XPIA 4IJDA 4YNDA 3LPZA 3CK7A 4GYWA 4GA0A 4GZ3A 2KCLA 2VGXB 4UQXA 3SWCA 2PQNA 3Q47B 3U3WA 4IJ8A 2LSVA 2XCCA 4JL0A 4GYOA 4N2QA 5FTPA 5CCLA 1ELWA 5G04J 5JJ7A 3QOUA 2Y4UA 4F3VA 3OS5A 4GYYA 5AYWD 3OOIA 1H3IA 5LCWC 3ZHEA 3HNAA 5KJNA 3SF4A 1ELRA 4J7FA 2PL2A 3N71A 5C1DA 5JHNA 1ZU2A 2QPWA 3LY8A 3CK9A 2KCVA 3TG5A 3KMAA 2UY1A 1E96B 4O6FA 3OPEA 4GCNA 2F69A 4NVQA 5F6KC 3KAEA 4AY5A 3OXGA 4WUYA 1B89A 3CKBA 4H12A 1MT6A 3ZGQA 2C2LA 2W5ZA 4C1QA 2HYZA 4I9EA 3OXFA 2JLBA 5FJYA 3FFLA 5A7DB 3GZ2A 4U0SA 4G24A 3RJVA 3CBMA 2BQZA 2FI7A 3M54A 4H7YA 4QEOA 1NA0A 2IFUA 4CGVA 4IN3B 3EDTB 2G46A 4E47A 3RU0A 2W5YA 3QKYA 3F9ZA 3CV0A 3AS5A 5G04C 4GA2A 4QEPA 5ARGA 5LSXA 3PE3A 2XCBA 2C0MA 3VUZA 5F5EA 3PE4A 2XGSA 2XEVA 4JHRA 4UI9J 3Q5MA 4XI0A 4FMUA 1N6AA 5FZQA 3KS2A 3K5KA 3QWVA 2FBNA 5A6CA 5FT9A 3S7BA 1PEGA 2J9QA 3MKRA 5KJKA 4YNMA 5TEGA 1IYGA 5EX3A 2KATA 2QFCA 1ZBPA 4LDGA 3ZHEB 5BT1A 3TGOA 4ABNA 2NC9A 3CKCA 3CVNA 4BTAA 3FWVA 5CCMA 5EKQD 4AM9A 2YQ8A 1N6CA 3WXXA 1YA0A 3HYMB 2UY1B 2Q7FA 4GA1A 5D0OD 1KT1A 2VQ2A 4YPUA 1A17A 4HOSA 1OUVA 4JA7A 2RFIA 4BUPA 4G23A 4U0UA 4G1TA 3PDNA 1KT0A 1MVHA 1NA3A 4I2WA 4KBQA 4WNDA 4GPKA 1IHGA 3OXLA 4GZ6A 1HZ4A 4KXKB 3Q4AB 4BTBA 3ASDA 4GZ5A 1W3BA 4JA9A 5JIYA 2IF4A 3FPDA 2MHKA 3FP3A 4CDRA 1HH8A 3CEQA 3ZN3A 4YPEA 5CHEE 2WQHA 5T0KA 4XI9A 2VGYA 1WAO1 3M55A 1XNFA 4BT8A 5HI7A 2FEZA 3ASHA 3MV2B 4U0ZA 4NQ0A 3RKVA 2AVPA 4MI5A 2LNIA 5FZRA 3QWWA 4N3BA 2KC7A 5EG2A 4HORA 1PC2A 4Y6WA 1QZ2A 2IGQA 3CBOA 5JINA 4N5CA 4NJ5A 4JLGA 3AS4A 3R9AB 1KLXA 2BUGA 3KD7A 4I9CA 1P5QA 3MO2A 2VYIA 3DALA 4RZ0A 3ULQA 4YNPA 3K9IA 3KMTA 2PZIA 5FZSA 5JJTA 3LY7A 4G26A 4EQFA 4O30A 4I2ZA 3ZFWA 2GW1A 5KJMA 1O9SA 3TAXA 4LEUA 3URZA 4WNFA 5ARFA 4J8OA 5BW8C 4ME2A 2WPVA 4J8FA 4G2VA 5HQ8A 3F9WA 5M72A 3ZPJA 3UQ3A 4HOQA 3ESKA 3IEGA 3RO3A 1FCHA 4N3AA 3GW4A 4WNGA 1Y8MA 4YVQC 4JDSA 2HR2A 3AS8A 4YPAA 3RJWA 2UWJG 3S7JA 4B94A 1ZKKA 3MO5A 5KJLA 3CVPA 5T0MA 3M59A 3QDNA 2P58C 3RO2A 5TTFA 5DIZA 5F6LA 2L6JA 4UI9K 5JJ0A 4AIFA 4APOA 4QENA 4N3CA 3ASGA 2VSNA 3M58A 4UI9C 1NZNA 4Z4PA 4UQZA 3S8PA 4I51A 2VSYA 3CK8A 1WM5A 4RG9A 3VTXA 2JV0A 1MVXA 3MO0A 5AYFA 4YVOA 4U07A 5D0QD 3NF1A 3JYSA 3LCAA 4J8DA 4J7IA 4CGWA 3BO5A 1XQHA 2E2EA 3DB5A 4HOUA 3M56A 2XGOA 5G05J 3LKUA 4KYOB 4HOTA 4WNEA 5JJ6A 3CVQA 3M5AA 2YHCA 4UQYA 4GCOA 4W9RA 5TH7A 3MEKA 1QQEA 3CBPA 3RAYA 3VV0A 3Q15A 4AU7A 2R3AA 3RQ4A 3E4BA 3LYAA 2DBAA 3ASFA 3MA5A 5EX0A 4H7XA 4AY6A 5DBKA 2HO1A 2ONDA 3S7DA 2VGXA 3F9XA 4BWRA 2C0LA 1HXIA 2Y4TA 4NRHB 3IHXA 5F59A 2O8JA 5LSZA 4G25A 4J83A 1ML9A 3LY9A 2OOEA 2R5SA 3EP0A 4J0UA 3O48A 3CVLA 3M53A 1MUFA 3S7FA 4N2SA 2KCKA 3QWPA 5CPRB 4I1AA 4XIFA 3UPVA 3Q49B 4J8EA 5G05C 2V5FA 3UUXA 3VTYA 3TG4A 3U4TA 4Y6CA 3RIBA 5LCWJ 3GYZA 2I6HA 1TJCA 4BT9A 3MV3B 2FF4A 3SZ7A 4N39A 1N3JA 2FO7A 3KMJA 2XGMA 2LSUA 5T5GA 4MI0A 5BNWA 4I17A 3SW9A 3F9YA 4U04A 3BEEA 3GZ1A 2PQRA 4A1SA 4RG6A 3M57A
chains in the Genus database with same CATH superfamily
3ULEG 5BV0A 1H6KA 3QARA 3EJNA 4YNDA 1K3ZD 2XZDG 2F0YA 2OV8A 3HVEA 2LXLA 3HXFA 4FHKA 4FC8A 5J08A 3U3WA 4O1OA 2XCCA 4FP7A 4JL0A 5CCLA 3C5RA 3EHQA 2YHEA 5FWQA 3AAAC 2Y4UA 4JVSA 3OOIA 1H3IA 3JXIA 4ACKA 2LAIA 3ZHEA 4TUMA 1K1BA 1ELRA 2EINE 3N71A 4YDWA 4J8YA 4TXRA 3FDHA 2QPWA 2ETCA 4I43A 1K1AA 3LVRE 3OPEA 4GCNA 5F6KC 3KAEA 4DI4A 5JA4D 4GTPA 3CKBA 4H12A 1YYHA 5BXOA 3HXCA 4UUCA 3OXFA 2JLBA 2BQZA 2FI7A 2BEDA 3EHNA 4LSZE 2WQ6A 1TR4A 1JWGA 1S63A 3BQOA 5LFAA 2X6FA 3CV0A 2WVIA 2IO3C 3HVEB 4GA2A 5C2YA 5ENRD 2C0MA 5A23A 1PAQA 2CG2A 4XI0A 4FMUA 3TWQA 4DLQA 4KVMA 3FTVA 3P2BA 2QZAA 3SGHA 3EIQC 2XPZA 3ZVVA 2P9PG 3AJIA 3LXUX 3MKRA 4L2YA 5EX3A 2KATA 3BU8A 2QFCA 3ZHEB 5BT1A 2KZTA 4GPMA 4JD2G 3FU5A 3Q9UC 2XRZA 4L7TA 4A63B 2VTBA 5D0OD 1H19A 1PY1A 4FA6A 1SZ9A 3DWLG 3T5VA 3VLDA 4CDNA 2BKGA 4G1TA 2H6GA 3ZXSA 4O60A 4WNDA 1N95A 3I4GA 3T5XA 1HZ4A 4KXKB 3ASDA 4ANVA 3FPDA 2MHKA 1EYHA 4G8KA 2F8XK 5CHEE 3HXBA 1WAO1 3M55A 1N52A 4FADA 4U0ZA 4NQ0A 3RKVA 4MI5A 3FUEA 5FZRA 1HS6A 3CHQA 4WWPA 2KC7A 1H6PA 5AQAA 2KZTB 3CQGB 3BG0B 4Y6WA 5EIDA 2IGQA 2AXUA 2VTBB 1TNZA 4UWFA 2XRYA 3F6QA 3R9AB 1P5QA 1OY3D 2P9IG 1SA5A 3MO2A 3TL5A 1Q2ZA 3LEWA 2KBXA 4RZ0A 2LO6A 1H6OA 2I2OA 5FIOA 3D9LA 1BPOA 5ANLA 3SY2A 3ZIMA 3KSLA 2CHZA 5J90A 4LEUA 3QNKA 1KZPA 2WPVA 3RK6A 4HLEA 4J8FA 2QY7A 3C3OA 3PZ3A 2ILRA 2Y1LE 3AG1E 3EIJA 4FLHA 4FJYA 3IEGA 3RO3A 3ABLE 4BY6A 2IU1A 2YINA 1UW4B 3UX4A 3R9MA 1ZKKA 1WG0A 1N4PA 5AARA 2P58C 3W9GA 2BF0X 4IULA 2WXQA 5F6LA 2L6JA 1Z3YA 1L5JA 1SA4A 5JJ0A 4QENA 1S0PA 3M58A 5AIJA 4UI9C 3KSQA 3JCKC 3TXMA 5KNGA 1WM5A 4RG9A 4AEZC 4MKTA 5AYFA 1LTXA 4PS8A 3L17A 4U07A 2WXOA 2WXMA 1U2VG 3JYSA 1D8DA 3LCAA 4DX7D 1E7VA 1BD8A 3DSUA 5ENOD 3QB2A 3S2AA 1IXVA 1HX8A 1SVXA 3D9IA 4K5BA 4TXQA 2R05A 1OCRE 5G05J 4KYOB 2RKKA 3CVQA 3M5AA 2XS1A 3SNXA 4UQYA 1OXJA 1OWOA 3IV0A 3Q15A 4AU7A 2R3AA 3QC1A 1TNBA 3LYAA 5CERB 4XKCA 4EBAG 4GU5A 2L9BA 4H7XA 2AWIA 2ONDA 3S7DA 2VGXA 2L0TB 2RFAA 1HE8A 1O1SA 2EQXA 2H6HA 4NRHB 2OEVA 3CGHA 4K0RA 2R5SA 3TWTA 1SQMA 3SI5A 1MUFA 2WXJA 2KCKA 1DC2A 3FULA 3QWPA 3UINC 5CPRB 3NQPA 3EHMA 4EZJA 4C0EA 4I6EA 1TEZA 4J8EA 5G05C 2VGEA 2WB2A 1TJCA 2DVWA 4KZ0A 4BT9A 3LJ3A 3MV3B 3T8MA 4CZ2D 2Y0BG 3IBEA 2FO7A 3KMJA 2A5UA 4GTTA 3TWVA 3B7UX 3RAUA 5T5GA 4WWNA 2GRPB 4MI0A 4O1PA 4U04A 2BKKB 2P9NG 2R03A 2YNQA 4MRUA 1WY6A 4HB5A 2P9KG 3LPZA 3UKUG 3SBTB 4GZ3A 2KCLA 4GB9A 2VGXB 4C0MA 2WQ7A 3SWCA 4I1OB 1HFAA 2VSXE 4IJ8A 4J7WA 2LSVA 4PDXA 4V3IA 1OWPA 3FUNA 5G04J 3TWXA 3QOUA 1D8EA 3OS5A 5JHBA 3ZW3A 2R59A 2B6CA 3SF4A 3UT8A 4J7FA 4Q69A 4E6HA 1TNUA 3CK9A 2ZXWE 3TG5A 3KMAA 4L23A 2LUHA 1FT1A 1E96B 3AG2E 4O6FA 3PRZA 4KT6B 3ENEA 4NVQA 3B95A 4A3VA 3CR3A 4YDYA 3B7RL 2V4HC 1MT6A 2GRNB 3BG1B 5B3SE 2W5ZA 4I9EA 4MS6A 5A7DB 3GZ2A 4U0SA 4G24A 2PM7A 3DSSA 3HHMA 2H6FA 2ZU6B 5CBOA 5JHAA 4APFA 3EDTB 2A5EA 2G46A 5D66A 1UJKA 4E47A 3F9ZA 5G04C 4KMOA 4DX1A 4HXIA 1Z3XA 3AU5A 5CRUA 4AJWA 2XGSA 2XEVA 4DJAA 5FZQA 4ZHBA 1N6AA 4U8VD 1TNOA 3QWVA 3FHEA 3FTSA 3TWSA 1HO8A 1U3DA 3ONLA 5AAOA 2RG8A 4A1GA 3CVYA 4DUIA 2NC9A 3CKCA 3CVNA 2VSOE 4D10C 3FWVA 1H2UA 1N6CA 3JQ0A 2XPYA 4GA1A 1KT1A 2GGFA 4CEMA 3KEAA 3IXEA 2VQ2A 4YPUA 1A17A 4XX5A 2DYRE 1OUVA 4RSYA 3DEOA 1YMPA 4JA7A 2RFIA 1S70B 3E32A 1NL4A 3ESLA 1MVHA 2CHWA 2XQ0A 1NA3A 3Q79A 2AJAA 4LUNU 3HRAA 4GPKA 3OXLA 3OTNA 4BTBA 4JA9A 1MYOA 4RQIA 4GMRA 3FP3A 3FU6A 1HH8A 1UJJA 2IJGX 3FUFA 5HS0A 2M63A 2WQHA 3L82A 2VGYA 4PH4B 5EIBE 1XNFA 4BT8A 3E30A 3T8KA 3PUKA 5ENSD 1E8XA 3MV2B 2LNIA 1N54A 1E8YA 3D9MA 4F6RD 1X81A 1O1RA 4HORA 4ANWA 3FUDA 2L6BA 1HG5A 2R02A 5AQ7A 5JINA 2ZIRA 1N94A 4NJ5A 2DZOA 5EDSA 1TYQG 4HI8A 4CYMD 5FQ4A 1JPLA 2GRLA 4C48B 2XZTG 2DIWA 3T9KA 2PZIA 5FZSA 3LY7A 3EU5A 4G26A 1N11A 4HRMB 3DSXA 3U9WA 3NOCD 5KJMA 4ANUA 4LRZA 3NBNB 1JCSA 2I1JA 3MZLB 3URZA 5ARFA 1TN6A 4J8OA 4B93B 2B0OE 2IOLA 3ZYMA 5KCMA 5CMWA 3EHRA 4ACLA 3F9WA 4YDEA 3IKOB 4HOQA 1QBQA 1MQSA 3HIZA 4JW1A 3GW4A 4YVQC 2DZNA 4AXHA 2P2CP 3APFA 2HE0A 3UM2A 3ML8A 2UWJG 3Q7FA 3CVPA 3APDA 4EPZA 4KZCA 3QDNA 5TTFA 3W9FA 1OWLA 4UI9K 4IRUA 3SBSA 4APOA 5E76A 2VSNA 4IYPA 4ATGA 3DPDA 4BSXA 3C98A 2PM6A 2AW6A 1U3CA 3VTXA 2JV0A 1MVXA 1O5MA 4HRLA 1KPSB 2RFMA 5LOZA 1BI8B 2X38A 1EDUA 3P1UA 3PVLA 3FH5A 4PUCA 1D9SA 1FT2A 2FULA 5CEDB 3RRNB 3DB5A 5KNHD 1OCOE 2XGOA 3L16A 4N5QA 3SHFA 4OAUC 3CSFA 2V5QC 3ZRHA 3RAYA 2OEWA 3VV0A 3E4BA 5G55A 1SZAA 3B7TA 2V4LA 4ATZD 2KM4A 4YDOA 3PS6A 2DBAA 5CRVA 3FUIA 4ILIA 2CFZA 4ILGA 4GMLA 3FTWA 3ZYKA 3F9XA 4J8SA 2C0LA 1DCEA 3UTMA 2WXLA 3Q9NC 3KEZA 3IHXA 2X6HA 5FQ7A 3V31A 2O8JA 3BUAA 4G25A 2BTDA 3V30A 3EP0A 4C9BB 3CVLA 3S7FA 4N2SA 3Q78A 4I1AA 1TN7A 3D9NA 4CT0A 3ABKE 3TG4A 3FU0A 5LCWJ 3G2UA 4A55A 1X5BA 2FF4A 3SZ7A 1NI1A 5ENTD 4N39A 4HFGA 1N3JA 4GZCA 4XEIG 2WXIA 3UM3A 3EU9A 5HKPA 4UWHA 4I17A 3SW9A 3D9HA 1FPPA 4A1SA 3ZNGA 2XPIA 3TWUA 4IJDA 4K03A 4GYWA 3PZ2A 2XENA 2PQNA 1EF1C 3UKRG 2VJ8A 2J09A 4LNUD 4M7CA 2J4BA 3VLFA 4F3VA 5AYWD 2ZGGA 5LCWC 4R7LA 5KJNA 4CRWA 1E7UA 5JHNA 2J07A 4AVXA 3LDZA 1ZU2A 4JHKA 3LY8A 3UM0A 2KCVA 3FH7A 4LERA 1VDYA 3CHPA 3MCXA 4LG6A 2F69A 1H2VC 4AY5A 4HI9A 5B1AE 4WUYA 4GAAA 4TUUA 4JHJA 5JMND 4FULA 2HYZA 5FJYA 1N0RA 3B7BA 3M54A 4H7YA 2IFUA 4CGVA 4IN3B 1OCZE 4Q96A 3PREA 3RU0A 1XGWA 4UWLA 1TJFA 4QEPA 5ARGA 4QQIA 4BETA 3PE3A 5HRYA 2XCBA 5LSXA 5F5EA 3PE4A 4U96D 3Q5MA 3CVVA 1N9AA 3KS2A 4LCTA 3L9TA 3L08A 2FBNA 5A6CA 3IHYA 5FT9A 3ZEFA 2GROB 5IY5E 2CFUA 3ZXPA 2J9QA 1IQRA 5KJKA 4M3OA 3G2WA 4LDGA 3I5PA 3TGOA 3SO8A 1AWCB 4ABNA 2I1KA 3U64A 2NXPA 1FVFA 4AM9A 4B8AA 3HYMB 2AXZA 3GZSA 4AV7A 4GTSA 4OYSA 4BUPA 1SW6A 4I2WA 1UOHA 2OCCE 3ZKJA 1IHGA 4GZ6A 4CDMA 4EBAA 4GZ5A 3D3MA 1W3BA 2MRIA 5JIYA 3OAWA 1NP7A 3ULYA 1HG2A 5BV1A 1OWMA 3FUMA 4GTRA 2ZGDA 4K5AB 4XKBA 1Y6IA 1JUQA 3HDXA 4JB8P 5HI7A 2V8SE 3LVQE 5BXUA 3ASNE 3ASHA 1TN8A 3CVXA 1N4RA 4CT4A 2AVPA 2WXPA 3I4RB 3X2QE 1OWNA 4EZLA 4N3BA 2P9LG 1E8ZA 2ETBA 2IOSA 3L13A 5EG2A 2WXGA 3SFYA 4DPRA 5ENNA 2LXMA 4U63A 1PC2A 3FH8A 3O4ZA 1QZ2A 3NOGD 1KLXA 3SFXA 3KD7A 2Y69E 3Q73A 2VYIA 3DALA 2J8SD 2GRQB 4HS2A 1GW6A 2CG3A 4YNPA 4PS7A 5EILA 5JJTA 3ONKA 4JEHA 2ETAA 4O30A 1OT8A 4I2ZA 3ZFWA 5ITZF 2GW1A 3CHRA 5H7PA 2AXVA 4DK5A 1O9SA 2R2LA 1QNFA 2CHXA 4NACA 1LD8A 4ME2A 3UIPC 5M72A 3UQ3A 2QYUA 4UWKA 1ELKA 1FCHA 1O1TA 4HRNA 4WNGA 1Y8MA 2E0IA 1DCQA 4WAFA 3AS8A 3S7JA 3MO5A 5T0MA 1N4QA 1YCSB 1KZOA 5DIZA 4HQDA 4E85A 4JC8A 3FUHA 3PZ1A 3ASGA 5CECB 5KBAA 2WXHA 3AU4A 1NZNA 3S8PA 2FO1E 2JABA 3RRMB 3MO0A 5AENA 2L0IA 4YVOA 5D0QD 3NF1A 3SFZA 3D9JA 4FJZA 4OVUA 2XEHA 3B7SA 3TXNA 1IHBA 3AG4E 4U8HA 4CGWA 3BO5A 4JEUA 1XQHA 3CVUA 4WWOA 3DSWA 3JUIA 5CMYA 1Z5SC 3LKUA 3PZ4A 3B13A 2YHCA 4HVBA 4W9RA 4DI3A 5TH7A 2J49A 3D9PA 3MEKA 3CBPA 4GTQA 1TNYA 2P9UG 3RQ4A 3DBSA 2QYJA 3ASFA 3MA5A 2WXKA 5D2MC 3LJNA 5CBNA 4FLBA 4GMJA 4GTMA 5KWDA 5AN8A 4AY6A 5DBKA 5AQBA 3DSTA 1H2TC 1MX2A 3RSEG 2Y4TA 2X6JA 5G2NA 3DSVA 4L9PA 5BUZA 5LSZA 5T4YA 4J83A 1ML9A 4BX8A 3O48A 4URKA 3ASOE 2F8YA 1RZ4A 3I3NA 4TRQA 4B0ZA 4XIFA 3EUVA 4ANXA 3C3RA 4U7EB 2V5FA 3MYVA 5CEAA 3U4TA 5FQ8A 2I6HA 4NIKA 4LNGA 3CSTA 3ZU7B 3UT4A 3Q7AA 3NZUA 1N4SA 2XGMA 3CHOA 4HNAD 2NSZA 2XHEA 3BEEA 3QJZA 3E33A 2PQRA 3M57A 2XS8A 3CVWA 4TXPA 5EYPF 1ZB1A 2IY0C 3CK7A 3HXDA 4GA0A 3PUJA 4UQXA 3CLJA 3ISMC 2EIJE 3Q47B 4OAVB 3PEVB 2IEJA 4GYOA 4N2QA 5FTPA 1E90A 3G2TA 1ELWA 2WMOA 2R17C 3NB2A 2EIKE 3L6AA 5JJ7A 4AP2A 4CCAA 4GYYA 4EHMA 3D9KA 3Q75A 5AJDA 3PNLB 5ENQD 3HNAA 5FQ6A 3PNTB 1A5EA 4QFVA 3DEPA 2PL2A 5C1DA 4ILHB 2PNNA 3DXMG 2UY1A 4BEPA 1HU3A 3R7RA 3OXGA 1HF8A 2I9CA 3C3QA 1B89A 3ZGQA 2C2LA 5LX8A 4C1QA 3FFLA 3CBMA 3RJVA 3DRAA 4QEOA 4PS3A 1NA0A 2X6KA 3IHVA 4F7AA 2WXRA 3FUKA 2X3MA 3FU3A 1IKND 4MLPA 2W5YA 3QKYA 1UN9A 3AS5A 1INZA 4X8QA 1JCRA 4J6IA 3VUZA 2GRMA 4JHRA 4UI9J 2P9SG 4LNBA 3K5KA 3TWWA 3UM1A 4DX6D 3S7BA 1S64A 1PEGA 3UT7A 3RRUA 4YNMA 5TEGA 1IYGA 3PEUB 4XZ4A 4NURA 1ZBPA 5T3RA 4GTVA 4EZKA 3WG7E 4JPSA 3FEYA 1V54E 4P29A 5B1BE 3ML9A 4BTAA 5CCMA 4HLLA 5EKQD 4EECA 4FHJA 3R7QA 2YQ8A 3WXXA 1YA0A 1DNPA 2UY1B 2Q7FA 3D9OA 4BESA 1WDYA 1MJ0A 4HOSA 2EILE 2ZISA 4G23A 4U0UA 2KXPC 2OVFA 3PDNA 1KT0A 4L1BA 3FTZA 4KBQA 2DYSE 1BI7B 5AJLA 3Q4AB 3QAQA 5T8IA 2IF4A 1MX4A 4CDRA 5FINA 1JCQA 3CEQA 4BERA 3ZN3A 3HXEA 4YPEA 2EIME 2WXNA 3FTYA 3AG3E 5T0KA 2NYJA 4XI9A 4BX9A 1BU9A 3V79K 2FEZA 3JQ1A 3JUEA 3NAWA 4RLYA 3FTUA 3FEXA 5LP0A 3G2SA 3QWWA 2XEEA 2A4ZA 4L2LA 3UI2A 1H0AA 2IO2C 1LD7A 3CBOA 2WM9A 4F1PA 4N5CA 4JLGA 3AS4A 4GTOA 2BUGA 3CIAA 2DCPA 4I9CA 3V2OA 1UN8A 2LAHA 4F53A 2GRRB 4RVBA 3CQCB 5ENPD 3ULQA 1DVPA 1JWFA 5AQ9A 4TV3A 1FVHA 4I1MA 3FTXA 3K9IA 3KMTA 3APCA 1NFIE 4EQFA 3UIOC 4MBGA 2QC9A 3TAXA 4WNFA 5BW8C 3L22A 2RD0A 4G2VA 5HQ8A 1RW2A 2JEKA 3SQVA 3ZPJA 3UMVA 1K8KG 2MOWA 3ESKA 4I6GA 3MKQA 4N3AA 3SD5A 4K5CA 3PZDA 4ZFHA 4JDSA 2HR2A 3L54A 4U8YD 5E75A 4YPAA 2J08A 3RJWA 4I6JA 4B94A 3VLEA 4JXTA 5KJLA 2F37A 3M59A 3RO2A 5EYLA 1Z6TA 2H6IA 5ANRA 4AIFA 4FU3A 3J5QB 4N3CA 1MHQA 3MJWA 4DX5D 3ZYQA 4Z4PA 4UQZA 3CHSA 4I51A 2IONA 4BSZB 2Y3AA 2VSYA 3CK8A 3G2VA 3FY4A 4GZDA 1AP7A 3LS8A 2MYOA 4KVOA 3ABME 2DWZA 3J5PA 4J8DA 4J7IA 3ZUVB 4U95D 3DPYA 2E2EA 3DXKG 4DRXE 4HOUA 3M56A 4UWGA 2J4DA 4HOTA 3E34A 4WNEA 5BPPA 1QYMA 5JJ6A 4GCOA 1QQEA 3CHMA 3MKQB 4B8CB 2WMNA 4G11A 4DLOA 4BFRA 5EX0A 3MGBA 4AOFA 5EN5D 4Z68A 2HO1A 1MZCA 4BWRA 3QK0A 1OCCE 3U66A 1HXIA 4XE0A 3HG0D 5F59A 4Q94A 3UXGA 1G3NB 1N0QA 1EPUA 3TWRA 4F1SA 3LY9A 2OOEA 4OVVA 3E37A 4J0UA 3MX3A 3M53A 4B89A 1E8WA 2HM8A 2IQCA 2X6IA 3ZYLA 3UPVA 3Q49B 4A3TA 3V2XA 2WXFA 1BLXB 1UG3A 4DX2A 3UUXA 3VTYA 4Y6CA 3RIBA 3GYZA 2OVBA 1MX6A 4G8LA 3FUJA 3PH0C 3NZSA 2LSUA 4HBDA 1LF8A 2V0PA 5BNWA 3F9YA 1IQUA 3C72A 3GZ1A 3JXJA 4RG6A 1V55E 4JZYA 3TJPA
chains in the Genus database with same CATH topology
5BV0A 1H6KA 2XPIA 2YNQA 4MRUA 1WY6A 3QARA 4IJDA 3EJNA 4K03A 4YNDA 3LPZA 3CK7A 4GYWA 3SBTB 4GA0A 2OV8A 3HVEA 4GZ3A 2KCLA 4GB9A 3PUJA 4FHKA 2VGXB 4FC8A 4C0MA 4UQXA 3CLJA 2WQ7A 3SWCA 4I1OB 2PQNA 5J08A 1HFAA 2VSXE 3Q47B 1EF1C 3U3WA 2LSVA 4IJ8A 2XCCA 4FP7A 4PDXA 4V3IA 3PEVB 4JL0A 1OWPA 4GYOA 2VJ8A 4N2QA 5FTPA 5CCLA 2J09A 1E90A 2YHEA 3G2TA 3FUNA 5FWQA 1ELWA 2WMOA 2R17C 5G04J 3L6AA 5JJ7A 3QOUA 2J4BA 2Y4UA 3VLFA 4JVSA 4AP2A 4CCAA 4F3VA 3OS5A 4GYYA 5AYWD 5JHBA 3OOIA 1H3IA 3ZW3A 3D9KA 4ACKA 5LCWC 5AJDA 3PNLB 2R59A 2LAIA 4R7LA 3ZHEA 5KJNA 3HNAA 5FQ6A 3PNTB 3SF4A 4CRWA 3UT8A 4QFVA 1ELRA 4Q69A 4J7FA 2PL2A 3N71A 1E7UA 5C1DA 4E6HA 5JHNA 2J07A 4AVXA 3LDZA 4ILHB 3FDHA 1ZU2A 2QPWA 4JHKA 3LY8A 3CK9A 2KCVA 3FH7A 4LERA 3TG5A 3KMAA 4L23A 2UY1A 1VDYA 4I43A 3CHPA 3LVRE 1E96B 1HU3A 4O6FA 3MCXA 3PRZA 4KT6B 4GCNA 2F69A 3OPEA 3R7RA 3ENEA 4NVQA 5F6KC 3KAEA 1H2VC 4A3VA 4AY5A 3OXGA 1HF8A 3CR3A 4WUYA 3B7RL 4GAAA 4DI4A 2I9CA 1B89A 3CKBA 4H12A 1MT6A 4TUUA 3BG1B 3ZGQA 4JHJA 2C2LA 5LX8A 2W5ZA 4C1QA 4FULA 2HYZA 4I9EA 3OXFA 2JLBA 4MS6A 5FJYA 3FFLA 5A7DB 3GZ2A 4U0SA 4G24A 2PM7A 3RJVA 2BQZA 3CBMA 2FI7A 3M54A 4H7YA 4QEOA 3HHMA 3EHNA 2WQ6A 2ZU6B 4PS3A 1NA0A 1JWGA 2IFUA 2X6KA 3IHVA 4IN3B 4F7AA 4CGVA 5JHAA 4APFA 3EDTB 2WXRA 3FUKA 2X3MA 2G46A 4Q96A 3FU3A 1UJKA 4E47A 3PREA 4MLPA 3RU0A 2W5YA 3QKYA 5LFAA 2X6FA 1XGWA 3CV0A 3F9ZA 2WVIA 1UN9A 3AS5A 4UWLA 4KMOA 5G04C 1TJFA 3HVEB 4GA2A 5ARGA 5C2YA 1INZA 3PE3A 5LSXA 2XCBA 4HXIA 2C0MA 4J6IA 1Z3XA 1PAQA 5A23A 5F5EA 2GRMA 3VUZA 3PE4A 3AU5A 4AJWA 2XGSA 2XEVA 2CG2A 4JHRA 3Q5MA 4UI9J 4XI0A 4FMUA 4DJAA 5FZQA 3CVVA 3KS2A 1N6AA 3K5KA 4LCTA 4KVMA 4DLQA 3FTVA 3L08A 3QWVA 2FBNA 3P2BA 3FHEA 5A6CA 3SGHA 3IHYA 3EIQC 5FT9A 3ZEFA 2XPZA 3S7BA 3FTSA 1PEGA 3ZVVA 2CFUA 3UT7A 3LXUX 2J9QA 3MKRA 1IQRA 3RRUA 5KJKA 1HO8A 1U3DA 4YNMA 5TEGA 4L2YA 1IYGA 3PEUB 4XZ4A 4M3OA 5EX3A 4NURA 2KATA 3G2WA 2QFCA 3ONLA 1ZBPA 4LDGA 5T3RA 2RG8A 4EZKA 3ZHEB 5BT1A 3I5PA 4A1GA 3TGOA 3CVYA 4JPSA 4ABNA 2NC9A 3FEYA 2I1KA 3U64A 2KZTA 2NXPA 1FVFA 4P29A 3CKCA 3CVNA 3ML9A 2VSOE 4BTAA 3FWVA 4D10C 5CCMA 5EKQD 1H2UA 4EECA 4FHJA 3FU5A 4AM9A 2XRZA 4L7TA 3R7QA 2YQ8A 3JQ0A 4B8AA 3WXXA 1YA0A 1DNPA 2XPYA 3HYMB 2VTBA 1N6CA 2UY1B 2AXZA 2Q7FA 4GA1A 1KT1A 1H19A 1PY1A 2GGFA 3D9OA 5D0OD 4CEMA 1SZ9A 4FA6A 3T5VA 3GZSA 4AV7A 2VQ2A 3VLDA 4YPUA 1A17A 4XX5A 4HOSA 1OUVA 4RSYA 4JA7A 2RFIA 4OYSA 4BUPA 4CDNA 4G23A 4U0UA 4G1TA 2OVFA 3PDNA 1KT0A 3ESLA 3ZXSA 2CHWA 1MVHA 4L1BA 2XQ0A 1NA3A 4I2WA 3FTZA 4KBQA 4LUNU 4WNDA 4GPKA 1IHGA 3OXLA 4GZ6A 5AJLA 4CDMA 3I4GA 3OTNA 3T5XA 1HZ4A 4KXKB 4EBAA 3Q4AB 4BTBA 3ASDA 4GZ5A 3D3MA 1W3BA 3QAQA 4JA9A 5T8IA 4ANVA 2MRIA 5JIYA 2IF4A 3FPDA 3OAWA 2MHKA 1NP7A 3FP3A 3FU6A 4CDRA 1HH8A 1HG2A 1EYHA 5BV1A 3CEQA 1OWMA 3ZN3A 1UJJA 4YPEA 2IJGX 3FUFA 2M63A 3FUMA 4XKBA 2WXNA 3FTYA 2WQHA 5CHEE 5T0KA 1Y6IA 4XI9A 2VGYA 4BX9A 1JUQA 1WAO1 3HDXA 3M55A 4PH4B 1XNFA 4BT8A 5HI7A 2V8SE 2FEZA 3LVQE 3PUKA 3JQ1A 3ASHA 1N52A 4FADA 1E8XA 3MV2B 3CVXA 4U0ZA 4NQ0A 3RKVA 4CT4A 2AVPA 4MI5A 2LNIA 2WXPA 3FUEA 5FZRA 1HS6A 1N54A 3FTUA 3I4RB 3FEXA 3CHQA 5LP0A 1OWNA 1E8YA 3G2SA 4WWPA 4EZLA 3QWWA 4N3BA 3D9MA 2KC7A 1E8ZA 2IOSA 2A4ZA 3L13A 4L2LA 5EG2A 2WXGA 1H0AA 2KZTB 4DPRA 3CQGB 3BG0B 5ENNA 4HORA 4U63A 4ANWA 1PC2A 3FH8A 3O4ZA 3FUDA 4Y6WA 1QZ2A 2IGQA 3CBOA 1HG5A 2WM9A 5JINA 2AXUA 4N5CA 2VTBB 4NJ5A 4JLGA 3AS4A 4UWFA 2XRYA 5EDSA 1KLXA 2BUGA 3CIAA 3R9AB 2DCPA 3KD7A 4I9CA 1P5QA 3MO2A 3TL5A 4QEPA 1UN8A 2LAHA 2VYIA 4F53A 5FQ4A 3DALA 1JPLA 3LEWA 2GRLA 4HS2A 4RZ0A 1GW6A 2LO6A 3CQCB 4RVBA 1DVPA 3ULQA 2I2OA 1JWFA 2CG3A 4TV3A 1FVHA 2DIWA 4I1MA 4YNPA 3FTXA 3K9IA 3KMTA 2PZIA 4PS7A 5FZSA 5JJTA 3LY7A 3D9LA 4G26A 3ONKA 4JEHA 3APCA 4EQFA 4O30A 1BPOA 5ANLA 4I2ZA 3U9WA 3ZFWA 3ZIMA 2GW1A 5KJMA 3CHRA 2AXVA 4ANUA 4LRZA 4DK5A 2I1JA 3MZLB 1O9SA 2CHZA 5J90A 3TAXA 4LEUA 3URZA 1QNFA 4WNFA 5ARFA 4J8OA 2CHXA 4NACA 3QNKA 5BW8C 3L22A 4ME2A 2WPVA 4HLEA 3RK6A 2RD0A 4J8FA 2IOLA 2QY7A 4G2VA 3ZYMA 5HQ8A 5KCMA 2ILRA 5CMWA 3F9WA 2JEKA 4ACLA 5M72A 3ZPJA 3UQ3A 3UMVA 3IKOB 4HOQA 2MOWA 1MQSA 3EIJA 3ESKA 4FLHA 4FJYA 4UWKA 3IEGA 4I6GA 1ELKA 3MKQA 3HIZA 1FCHA 4JW1A 3RO3A 4N3AA 3SD5A 3GW4A 4BY6A 2IU1A 3PZDA 4WNGA 1Y8MA 4YVQC 2YINA 2E0IA 4AXHA 4JDSA 1UW4B 3APFA 2HR2A 3L54A 4WAFA 3UX4A 3AS8A 5E75A 3ML8A 4YPAA 2J08A 2UWJG 4I6JA 3S7JA 4B94A 1ZKKA 3VLEA 4JXTA 5KJLA 3MO5A 3CVPA 3APDA 4EPZA 4KZCA 5T0MA 3M59A 3QDNA 2P58C 3RO2A 2BF0X 5TTFA 1Z6TA 4IULA 5DIZA 2WXQA 5F6LA 2L6JA 1OWLA 1Z3YA 4UI9K 5ANRA 1L5JA 4IRUA 4E85A 3SBSA 5JJ0A 4AIFA 4APOA 4FU3A 4QENA 5E76A 4JC8A 3FUHA 4N3CA 3ASGA 1S0PA 2VSNA 5AIJA 1MHQA 3M58A 4IYPA 2WXHA 3AU4A 4UI9C 4ATGA 3DPDA 3MJWA 1NZNA 3ZYQA 4Z4PA 4UQZA 3CHSA 4BSXA 3S8PA 3C98A 4I51A 3JCKC 3TXMA 2IONA 2PM6A 2AW6A 1U3CA 2VSYA 2Y3AA 3CK8A 3G2VA 1WM5A 3FY4A 4RG9A 3VTXA 3RRMB 4AEZC 2JV0A 1MVXA 4MKTA 3MO0A 5AYFA 5AENA 4PS8A 2L0IA 3L17A 4YVOA 4U07A 4GZDA 5D0QD 3NF1A 2WXOA 2WXMA 3LS8A 4KVOA 5LOZA 2X38A 3SFZA 3D9JA 4FJZA 4OVUA 1EDUA 3JYSA 3B7SA 3LCAA 3P1UA 3TXNA 3PVLA 3FH5A 1E7VA 4J8DA 4PUCA 4J7IA 4U8HA 2FULA 4CGWA 3BO5A 4JEUA 1XQHA 3RRNB 3QB2A 3CVUA 3S2AA 2E2EA 4WWOA 1HX8A 3JUIA 3DB5A 3D9IA 4HOUA 3M56A 5CMYA 2XGOA 4UWGA 2J4DA 3L16A 3SHFA 5G05J 3LKUA 4KYOB 4HOTA 4WNEA 5BPPA 5JJ6A 3B13A 3CVQA 3M5AA 2YHCA 4HVBA 3CSFA 3SNXA 4UQYA 4GCOA 4W9RA 4DI3A 5TH7A 1OWOA 2J49A 3D9PA 3MEKA 1QQEA 3ZRHA 3CBPA 3CHMA 3IV0A 3MKQB 3RAYA 3Q15A 3VV0A 4B8CB 4AU7A 2R3AA 3RQ4A 3E4BA 5G55A 3DBSA 1SZAA 3QC1A 2WMNA 3B7TA 2V4LA 3LYAA 4G11A 2KM4A 4DLOA 4XKCA 3PS6A 2DBAA 3ASFA 4EBAG 4GU5A 4BFRA 3MA5A 2L9BA 2WXKA 5EX0A 4H7XA 3MGBA 4AOFA 4FLBA 3FUIA 4GMJA 4ILIA 2AWIA 4AY6A 2CFZA 5DBKA 4ILGA 4GMLA 1H2TC 2HO1A 2ONDA 3FTWA 3S7DA 3ZYKA 2VGXA 2L0TB 3F9XA 4BWRA 4J8SA 2C0LA 1HE8A 2EQXA 3QK0A 3U66A 1HXIA 2WXLA 2Y4TA 4NRHB 3KEZA 4XE0A 2X6JA 3IHXA 5F59A 3CGHA 2X6HA 4Q94A 5G2NA 3RJWA 5FQ7A 2O8JA 1EPUA 5BUZA 5LSZA 4G25A 4K0RA 5T4YA 4J83A 1ML9A 4F1SA 2BTDA 3LY9A 2OOEA 2R5SA 4OVVA 3EP0A 4J0UA 4BX8A 1SQMA 3MX3A 4C9BB 3SI5A 3O48A 3CVLA 4URKA 3M53A 1MUFA 3S7FA 2WXJA 4N2SA 2KCKA 3FULA 3QWPA 3I3NA 5CPRB 4B89A 4I1AA 4TRQA 1E8WA 2HM8A 2IQCA 2X6IA 3EHMA 3NQPA 4XIFA 3ZYLA 4B0ZA 4ANXA 3UPVA 4EZJA 3Q49B 4C0EA 4I6EA 1TEZA 4A3TA 2WXFA 4J8EA 5G05C 3D9NA 4CT0A 2V5FA 1UG3A 3UUXA 3VTYA 3MYVA 3TG4A 3FU0A 3U4TA 4Y6CA 3RIBA 5LCWJ 3GYZA 5FQ8A 2OVBA 3G2UA 2WB2A 2I6HA 1TJCA 4KZ0A 4A55A 3CSTA 1X5BA 4BT9A 3LJ3A 3MV3B 3T8MA 3UT4A 2FF4A 3SZ7A 3FUJA 3NZUA 3PH0C 4HFGA 4N39A 3IBEA 1N3JA 2FO7A 3KMJA 2A5UA 2XGMA 4GZCA 3NZSA 2LSUA 3CHOA 2WXIA 3B7UX 2NSZA 5T5GA 4WWNA 1LF8A 4UWHA 4MI0A 2V0PA 5BNWA 4I17A 3SW9A 3F9YA 2XHEA 1IQUA 4U04A 3BEEA 3QJZA 3GZ1A 2PQRA 4A1SA 4RG6A 3M57A 3CVWA 4JZYA 3TJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPI A;  4IJD A;  4YND A;  3LPZ A;  3CK7 A;  4GYW A;  4GA0 A;  4GZ3 A;  2KCL A;  2VGX B;  4UQX A;  3SWC A;  2PQN A;  3Q47 B;  3U3W A;  4IJ8 A;  2LSV A;  2XCC A;  4JL0 A;  4GYO A;  4N2Q A;  5FTP A;  5CCL A;  1ELW A;  5G04 J;  5JJ7 A;  3QOU A;  2Y4U A;  4F3V A;  3OS5 A;  4GYY A;  5AYW D;  3OOI A;  1H3I A;  5LCW C;  3ZHE A;  3HNA A;  5KJN A;  3SF4 A;  1ELR A;  4J7F A;  2PL2 A;  3N71 A;  5C1D A;  5JHN A;  1ZU2 A;  2QPW A;  3LY8 A;  3CK9 A;  2KCV A;  3TG5 A;  3KMA A;  2UY1 A;  1E96 B;  4O6F A;  3OPE A;  4GCN A;  2F69 A;  4NVQ A;  5F6K C;  3KAE A;  4AY5 A;  3OXG A;  4WUY A;  1B89 A;  3CKB A;  4H12 A;  1MT6 A;  3ZGQ A;  2C2L A;  2W5Z A;  4C1Q A;  2HYZ A;  4I9E A;  3OXF A;  2JLB A;  5FJY A;  3FFL A;  5A7D B;  3GZ2 A;  4U0S A;  4G24 A;  3RJV A;  3CBM A;  2BQZ A;  2FI7 A;  3M54 A;  4H7Y A;  4QEO A;  1NA0 A;  2IFU A;  4CGV A;  4IN3 B;  3EDT B;  2G46 A;  4E47 A;  3RU0 A;  2W5Y A;  3QKY A;  3F9Z A;  3CV0 A;  3AS5 A;  5G04 C;  4GA2 A;  4QEP A;  5ARG A;  5LSX A;  3PE3 A;  2XCB A;  2C0M A;  3VUZ A;  5F5E A;  3PE4 A;  2XGS A;  2XEV A;  4JHR A;  4UI9 J;  3Q5M A;  4XI0 A;  4FMU A;  1N6A A;  5FZQ A;  3KS2 A;  3K5K A;  3QWV A;  2FBN A;  5A6C A;  5FT9 A;  3S7B A;  1PEG A;  2J9Q A;  3MKR A;  5KJK A;  4YNM A;  5TEG A;  1IYG A;  5EX3 A;  2KAT A;  2QFC A;  1ZBP A;  4LDG A;  3ZHE B;  5BT1 A;  3TGO A;  4ABN A;  2NC9 A;  3CKC A;  3CVN A;  4BTA A;  3FWV A;  5CCM A;  5EKQ D;  4AM9 A;  2YQ8 A;  1N6C A;  3WXX A;  1YA0 A;  3HYM B;  2UY1 B;  2Q7F A;  4GA1 A;  5D0O D;  1KT1 A;  2VQ2 A;  4YPU A;  1A17 A;  4HOS A;  1OUV A;  4JA7 A;  2RFI A;  4BUP A;  4G23 A;  4U0U A;  4G1T A;  3PDN A;  1KT0 A;  1MVH A;  1NA3 A;  4I2W A;  4KBQ A;  4WND A;  4GPK A;  1IHG A;  3OXL A;  4GZ6 A;  1HZ4 A;  4KXK B;  3Q4A B;  4BTB A;  3ASD A;  4GZ5 A;  1W3B A;  4JA9 A;  5JIY A;  2IF4 A;  3FPD A;  2MHK A;  3FP3 A;  4CDR A;  1HH8 A;  3CEQ A;  3ZN3 A;  4YPE A;  5CHE E;  2WQH A;  5T0K A;  4XI9 A;  2VGY A;  1WAO 1;  3M55 A;  1XNF A;  4BT8 A;  5HI7 A;  2FEZ A;  3ASH A;  3MV2 B;  4U0Z A;  4NQ0 A;  3RKV A;  2AVP A;  4MI5 A;  2LNI A;  5FZR A;  3QWW A;  4N3B A;  2KC7 A;  5EG2 A;  4HOR A;  1PC2 A;  4Y6W A;  1QZ2 A;  2IGQ A;  3CBO A;  5JIN A;  4N5C A;  4NJ5 A;  4JLG A;  3AS4 A;  3R9A B;  1KLX A;  2BUG A;  3KD7 A;  4I9C A;  1P5Q A;  3MO2 A;  2VYI A;  3DAL A;  4RZ0 A;  3ULQ A;  4YNP A;  3K9I A;  3KMT A;  2PZI A;  5FZS A;  5JJT A;  3LY7 A;  4G26 A;  4EQF A;  4O30 A;  4I2Z A;  3ZFW A;  2GW1 A;  5KJM A;  1O9S A;  3TAX A;  4LEU A;  3URZ A;  4WNF A;  5ARF A;  4J8O A;  5BW8 C;  4ME2 A;  2WPV A;  4J8F A;  4G2V A;  5HQ8 A;  3F9W A;  5M72 A;  3ZPJ A;  3UQ3 A;  4HOQ A;  3ESK A;  3IEG A;  3RO3 A;  1FCH A;  4N3A A;  3GW4 A;  4WNG A;  1Y8M A;  4YVQ C;  4JDS A;  2HR2 A;  3AS8 A;  4YPA A;  3RJW A;  2UWJ G;  3S7J A;  4B94 A;  1ZKK A;  3MO5 A;  5KJL A;  3CVP A;  5T0M A;  3M59 A;  3QDN A;  2P58 C;  3RO2 A;  5TTF A;  5DIZ A;  5F6L A;  2L6J A;  4UI9 K;  5JJ0 A;  4AIF A;  4APO A;  4QEN A;  4N3C A;  3ASG A;  2VSN A;  3M58 A;  4UI9 C;  1NZN A;  4Z4P A;  4UQZ A;  3S8P A;  4I51 A;  2VSY A;  3CK8 A;  1WM5 A;  4RG9 A;  3VTX A;  2JV0 A;  1MVX A;  3MO0 A;  5AYF A;  4YVO A;  4U07 A;  5D0Q D;  3NF1 A;  3JYS A;  3LCA A;  4J8D A;  4J7I A;  4CGW A;  3BO5 A;  1XQH A;  2E2E A;  3DB5 A;  4HOU A;  3M56 A;  2XGO A;  5G05 J;  3LKU A;  4KYO B;  4HOT A;  4WNE A;  5JJ6 A;  3CVQ A;  3M5A A;  2YHC A;  4UQY A;  4GCO A;  4W9R A;  5TH7 A;  3MEK A;  1QQE A;  3CBP A;  3RAY A;  3VV0 A;  3Q15 A;  4AU7 A;  2R3A A;  3RQ4 A;  3E4B A;  3LYA A;  2DBA A;  3ASF A;  3MA5 A;  5EX0 A;  4H7X A;  4AY6 A;  5DBK A;  2HO1 A;  2OND A;  3S7D A;  2VGX A;  3F9X A;  4BWR A;  2C0L A;  1HXI A;  2Y4T A;  4NRH B;  3IHX A;  5F59 A;  2O8J A;  5LSZ A;  4G25 A;  4J83 A;  1ML9 A;  3LY9 A;  2OOE A;  2R5S A;  3EP0 A;  4J0U A;  3O48 A;  3CVL A;  3M53 A;  1MUF A;  3S7F A;  4N2S A;  2KCK A;  3QWP A;  5CPR B;  4I1A A;  4XIF A;  3UPV A;  3Q49 B;  4J8E A;  5G05 C;  2V5F A;  3UUX A;  3VTY A;  3TG4 A;  3U4T A;  4Y6C A;  3RIB A;  5LCW J;  3GYZ A;  2I6H A;  1TJC A;  4BT9 A;  3MV3 B;  2FF4 A;  3SZ7 A;  4N39 A;  1N3J A;  2FO7 A;  3KMJ A;  2XGM A;  2LSU A;  5T5G A;  4MI0 A;  5BNW A;  4I17 A;  3SW9 A;  3F9Y A;  4U04 A;  3BEE A;  3GZ1 A;  2PQR A;  4A1S A;  4RG6 A;  3M57 A; 
#chains in the Genus database with same CATH topology
 3ULE G;  5BV0 A;  1H6K A;  3QAR A;  3EJN A;  4YND A;  1K3Z D;  2XZD G;  2F0Y A;  2OV8 A;  3HVE A;  2LXL A;  3HXF A;  4FHK A;  4FC8 A;  5J08 A;  3U3W A;  4O1O A;  2XCC A;  4FP7 A;  4JL0 A;  5CCL A;  3C5R A;  3EHQ A;  2YHE A;  5FWQ A;  3AAA C;  2Y4U A;  4JVS A;  3OOI A;  1H3I A;  3JXI A;  4ACK A;  2LAI A;  3ZHE A;  4TUM A;  1K1B A;  1ELR A;  2EIN E;  3N71 A;  4YDW A;  4J8Y A;  4TXR A;  3FDH A;  2QPW A;  2ETC A;  4I43 A;  1K1A A;  3LVR E;  3OPE A;  4GCN A;  5F6K C;  3KAE A;  4DI4 A;  5JA4 D;  4GTP A;  3CKB A;  4H12 A;  1YYH A;  5BXO A;  3HXC A;  4UUC A;  3OXF A;  2JLB A;  2BQZ A;  2FI7 A;  2BED A;  3EHN A;  4LSZ E;  2WQ6 A;  1TR4 A;  1JWG A;  1S63 A;  3BQO A;  5LFA A;  2X6F A;  3CV0 A;  2WVI A;  2IO3 C;  3HVE B;  4GA2 A;  5C2Y A;  5ENR D;  2C0M A;  5A23 A;  1PAQ A;  2CG2 A;  4XI0 A;  4FMU A;  3TWQ A;  4DLQ A;  4KVM A;  3FTV A;  3P2B A;  2QZA A;  3SGH A;  3EIQ C;  2XPZ A;  3ZVV A;  2P9P G;  3AJI A;  3LXU X;  3MKR A;  4L2Y A;  5EX3 A;  2KAT A;  3BU8 A;  2QFC A;  3ZHE B;  5BT1 A;  2KZT A;  4GPM A;  4JD2 G;  3FU5 A;  3Q9U C;  2XRZ A;  4L7T A;  4A63 B;  2VTB A;  5D0O D;  1H19 A;  1PY1 A;  4FA6 A;  1SZ9 A;  3DWL G;  3T5V A;  3VLD A;  4CDN A;  2BKG A;  4G1T A;  2H6G A;  3ZXS A;  4O60 A;  4WND A;  1N95 A;  3I4G A;  3T5X A;  1HZ4 A;  4KXK B;  3ASD A;  4ANV A;  3FPD A;  2MHK A;  1EYH A;  4G8K A;  2F8X K;  5CHE E;  3HXB A;  1WAO 1;  3M55 A;  1N52 A;  4FAD A;  4U0Z A;  4NQ0 A;  3RKV A;  4MI5 A;  3FUE A;  5FZR A;  1HS6 A;  3CHQ A;  4WWP A;  2KC7 A;  1H6P A;  5AQA A;  2KZT B;  3CQG B;  3BG0 B;  4Y6W A;  5EID A;  2IGQ A;  2AXU A;  2VTB B;  1TNZ A;  4UWF A;  2XRY A;  3F6Q A;  3R9A B;  1P5Q A;  1OY3 D;  2P9I G;  1SA5 A;  3MO2 A;  3TL5 A;  1Q2Z A;  3LEW A;  2KBX A;  4RZ0 A;  2LO6 A;  1H6O A;  2I2O A;  5FIO A;  3D9L A;  1BPO A;  5ANL A;  3SY2 A;  3ZIM A;  3KSL A;  2CHZ A;  5J90 A;  4LEU A;  3QNK A;  1KZP A;  2WPV A;  3RK6 A;  4HLE A;  4J8F A;  2QY7 A;  3C3O A;  3PZ3 A;  2ILR A;  2Y1L E;  3AG1 E;  3EIJ A;  4FLH A;  4FJY A;  3IEG A;  3RO3 A;  3ABL E;  4BY6 A;  2IU1 A;  2YIN A;  1UW4 B;  3UX4 A;  3R9M A;  1ZKK A;  1WG0 A;  1N4P A;  5AAR A;  2P58 C;  3W9G A;  2BF0 X;  4IUL A;  2WXQ A;  5F6L A;  2L6J A;  1Z3Y A;  1L5J A;  1SA4 A;  5JJ0 A;  4QEN A;  1S0P A;  3M58 A;  5AIJ A;  4UI9 C;  3KSQ A;  3JCK C;  3TXM A;  5KNG A;  1WM5 A;  4RG9 A;  4AEZ C;  4MKT A;  5AYF A;  1LTX A;  4PS8 A;  3L17 A;  4U07 A;  2WXO A;  2WXM A;  1U2V G;  3JYS A;  1D8D A;  3LCA A;  4DX7 D;  1E7V A;  1BD8 A;  3DSU A;  5ENO D;  3QB2 A;  3S2A A;  1IXV A;  1HX8 A;  1SVX A;  3D9I A;  4K5B A;  4TXQ A;  2R05 A;  1OCR E;  5G05 J;  4KYO B;  2RKK A;  3CVQ A;  3M5A A;  2XS1 A;  3SNX A;  4UQY A;  1OXJ A;  1OWO A;  3IV0 A;  3Q15 A;  4AU7 A;  2R3A A;  3QC1 A;  1TNB A;  3LYA A;  5CER B;  4XKC A;  4EBA G;  4GU5 A;  2L9B A;  4H7X A;  2AWI A;  2OND A;  3S7D A;  2VGX A;  2L0T B;  2RFA A;  1HE8 A;  1O1S A;  2EQX A;  2H6H A;  4NRH B;  2OEV A;  3CGH A;  4K0R A;  2R5S A;  3TWT A;  1SQM A;  3SI5 A;  1MUF A;  2WXJ A;  2KCK A;  1DC2 A;  3FUL A;  3QWP A;  3UIN C;  5CPR B;  3NQP A;  3EHM A;  4EZJ A;  4C0E A;  4I6E A;  1TEZ A;  4J8E A;  5G05 C;  2VGE A;  2WB2 A;  1TJC A;  2DVW A;  4KZ0 A;  4BT9 A;  3LJ3 A;  3MV3 B;  3T8M A;  4CZ2 D;  2Y0B G;  3IBE A;  2FO7 A;  3KMJ A;  2A5U A;  4GTT A;  3TWV A;  3B7U X;  3RAU A;  5T5G A;  4WWN A;  2GRP B;  4MI0 A;  4O1P A;  4U04 A;  2BKK B;  2P9N G;  2R03 A;  2YNQ A;  4MRU A;  1WY6 A;  4HB5 A;  2P9K G;  3LPZ A;  3UKU G;  3SBT B;  4GZ3 A;  2KCL A;  4GB9 A;  2VGX B;  4C0M A;  2WQ7 A;  3SWC A;  4I1O B;  1HFA A;  2VSX E;  4IJ8 A;  4J7W A;  2LSV A;  4PDX A;  4V3I A;  1OWP A;  3FUN A;  5G04 J;  3TWX A;  3QOU A;  1D8E A;  3OS5 A;  5JHB A;  3ZW3 A;  2R59 A;  2B6C A;  3SF4 A;  3UT8 A;  4J7F A;  4Q69 A;  4E6H A;  1TNU A;  3CK9 A;  2ZXW E;  3TG5 A;  3KMA A;  4L23 A;  2LUH A;  1FT1 A;  1E96 B;  3AG2 E;  4O6F A;  3PRZ A;  4KT6 B;  3ENE A;  4NVQ A;  3B95 A;  4A3V A;  3CR3 A;  4YDY A;  3B7R L;  2V4H C;  1MT6 A;  2GRN B;  3BG1 B;  5B3S E;  2W5Z A;  4I9E A;  4MS6 A;  5A7D B;  3GZ2 A;  4U0S A;  4G24 A;  2PM7 A;  3DSS A;  3HHM A;  2H6F A;  2ZU6 B;  5CBO A;  5JHA A;  4APF A;  3EDT B;  2A5E A;  2G46 A;  5D66 A;  1UJK A;  4E47 A;  3F9Z A;  5G04 C;  4KMO A;  4DX1 A;  4HXI A;  1Z3X A;  3AU5 A;  5CRU A;  4AJW A;  2XGS A;  2XEV A;  4DJA A;  5FZQ A;  4ZHB A;  1N6A A;  4U8V D;  1TNO A;  3QWV A;  3FHE A;  3FTS A;  3TWS A;  1HO8 A;  1U3D A;  3ONL A;  5AAO A;  2RG8 A;  4A1G A;  3CVY A;  4DUI A;  2NC9 A;  3CKC A;  3CVN A;  2VSO E;  4D10 C;  3FWV A;  1H2U A;  1N6C A;  3JQ0 A;  2XPY A;  4GA1 A;  1KT1 A;  2GGF A;  4CEM A;  3KEA A;  3IXE A;  2VQ2 A;  4YPU A;  1A17 A;  4XX5 A;  2DYR E;  1OUV A;  4RSY A;  3DEO A;  1YMP A;  4JA7 A;  2RFI A;  1S70 B;  3E32 A;  1NL4 A;  3ESL A;  1MVH A;  2CHW A;  2XQ0 A;  1NA3 A;  3Q79 A;  2AJA A;  4LUN U;  3HRA A;  4GPK A;  3OXL A;  3OTN A;  4BTB A;  4JA9 A;  1MYO A;  4RQI A;  4GMR A;  3FP3 A;  3FU6 A;  1HH8 A;  1UJJ A;  2IJG X;  3FUF A;  5HS0 A;  2M63 A;  2WQH A;  3L82 A;  2VGY A;  4PH4 B;  5EIB E;  1XNF A;  4BT8 A;  3E30 A;  3T8K A;  3PUK A;  5ENS D;  1E8X A;  3MV2 B;  2LNI A;  1N54 A;  1E8Y A;  3D9M A;  4F6R D;  1X81 A;  1O1R A;  4HOR A;  4ANW A;  3FUD A;  2L6B A;  1HG5 A;  2R02 A;  5AQ7 A;  5JIN A;  2ZIR A;  1N94 A;  4NJ5 A;  2DZO A;  5EDS A;  1TYQ G;  4HI8 A;  4CYM D;  5FQ4 A;  1JPL A;  2GRL A;  4C48 B;  2XZT G;  2DIW A;  3T9K A;  2PZI A;  5FZS A;  3LY7 A;  3EU5 A;  4G26 A;  1N11 A;  4HRM B;  3DSX A;  3U9W A;  3NOC D;  5KJM A;  4ANU A;  4LRZ A;  3NBN B;  1JCS A;  2I1J A;  3MZL B;  3URZ A;  5ARF A;  1TN6 A;  4J8O A;  4B93 B;  2B0O E;  2IOL A;  3ZYM A;  5KCM A;  5CMW A;  3EHR A;  4ACL A;  3F9W A;  4YDE A;  3IKO B;  4HOQ A;  1QBQ A;  1MQS A;  3HIZ A;  4JW1 A;  3GW4 A;  4YVQ C;  2DZN A;  4AXH A;  2P2C P;  3APF A;  2HE0 A;  3UM2 A;  3ML8 A;  2UWJ G;  3Q7F A;  3CVP A;  3APD A;  4EPZ A;  4KZC A;  3QDN A;  5TTF A;  3W9F A;  1OWL A;  4UI9 K;  4IRU A;  3SBS A;  4APO A;  5E76 A;  2VSN A;  4IYP A;  4ATG A;  3DPD A;  4BSX A;  3C98 A;  2PM6 A;  2AW6 A;  1U3C A;  3VTX A;  2JV0 A;  1MVX A;  1O5M A;  4HRL A;  1KPS B;  2RFM A;  5LOZ A;  1BI8 B;  2X38 A;  1EDU A;  3P1U A;  3PVL A;  3FH5 A;  4PUC A;  1D9S A;  1FT2 A;  2FUL A;  5CED B;  3RRN B;  3DB5 A;  5KNH D;  1OCO E;  2XGO A;  3L16 A;  4N5Q A;  3SHF A;  4OAU C;  3CSF A;  2V5Q C;  3ZRH A;  3RAY A;  2OEW A;  3VV0 A;  3E4B A;  5G55 A;  1SZA A;  3B7T A;  2V4L A;  4ATZ D;  2KM4 A;  4YDO A;  3PS6 A;  2DBA A;  5CRV A;  3FUI A;  4ILI A;  2CFZ A;  4ILG A;  4GML A;  3FTW A;  3ZYK A;  3F9X A;  4J8S A;  2C0L A;  1DCE A;  3UTM A;  2WXL A;  3Q9N C;  3KEZ A;  3IHX A;  2X6H A;  5FQ7 A;  3V31 A;  2O8J A;  3BUA A;  4G25 A;  2BTD A;  3V30 A;  3EP0 A;  4C9B B;  3CVL A;  3S7F A;  4N2S A;  3Q78 A;  4I1A A;  1TN7 A;  3D9N A;  4CT0 A;  3ABK E;  3TG4 A;  3FU0 A;  5LCW J;  3G2U A;  4A55 A;  1X5B A;  2FF4 A;  3SZ7 A;  1NI1 A;  5ENT D;  4N39 A;  4HFG A;  1N3J A;  4GZC A;  4XEI G;  2WXI A;  3UM3 A;  3EU9 A;  5HKP A;  4UWH A;  4I17 A;  3SW9 A;  3D9H A;  1FPP A;  4A1S A;  3ZNG A;  2XPI A;  3TWU A;  4IJD A;  4K03 A;  4GYW A;  3PZ2 A;  2XEN A;  2PQN A;  1EF1 C;  3UKR G;  2VJ8 A;  2J09 A;  4LNU D;  4M7C A;  2J4B A;  3VLF A;  4F3V A;  5AYW D;  2ZGG A;  5LCW C;  4R7L A;  5KJN A;  4CRW A;  1E7U A;  5JHN A;  2J07 A;  4AVX A;  3LDZ A;  1ZU2 A;  4JHK A;  3LY8 A;  3UM0 A;  2KCV A;  3FH7 A;  4LER A;  1VDY A;  3CHP A;  3MCX A;  4LG6 A;  2F69 A;  1H2V C;  4AY5 A;  4HI9 A;  5B1A E;  4WUY A;  4GAA A;  4TUU A;  4JHJ A;  5JMN D;  4FUL A;  2HYZ A;  5FJY A;  1N0R A;  3B7B A;  3M54 A;  4H7Y A;  2IFU A;  4CGV A;  4IN3 B;  1OCZ E;  4Q96 A;  3PRE A;  3RU0 A;  1XGW A;  4UWL A;  1TJF A;  4QEP A;  5ARG A;  4QQI A;  4BET A;  3PE3 A;  5HRY A;  2XCB A;  5LSX A;  5F5E A;  3PE4 A;  4U96 D;  3Q5M A;  3CVV A;  1N9A A;  3KS2 A;  4LCT A;  3L9T A;  3L08 A;  2FBN A;  5A6C A;  3IHY A;  5FT9 A;  3ZEF A;  2GRO B;  5IY5 E;  2CFU A;  3ZXP A;  2J9Q A;  1IQR A;  5KJK A;  4M3O A;  3G2W A;  4LDG A;  3I5P A;  3TGO A;  3SO8 A;  1AWC B;  4ABN A;  2I1K A;  3U64 A;  2NXP A;  1FVF A;  4AM9 A;  4B8A A;  3HYM B;  2AXZ A;  3GZS A;  4AV7 A;  4GTS A;  4OYS A;  4BUP A;  1SW6 A;  4I2W A;  1UOH A;  2OCC E;  3ZKJ A;  1IHG A;  4GZ6 A;  4CDM A;  4EBA A;  4GZ5 A;  3D3M A;  1W3B A;  2MRI A;  5JIY A;  3OAW A;  1NP7 A;  3ULY A;  1HG2 A;  5BV1 A;  1OWM A;  3FUM A;  4GTR A;  2ZGD A;  4K5A B;  4XKB A;  1Y6I A;  1JUQ A;  3HDX A;  4JB8 P;  5HI7 A;  2V8S E;  3LVQ E;  5BXU A;  3ASN E;  3ASH A;  1TN8 A;  3CVX A;  1N4R A;  4CT4 A;  2AVP A;  2WXP A;  3I4R B;  3X2Q E;  1OWN A;  4EZL A;  4N3B A;  2P9L G;  1E8Z A;  2ETB A;  2IOS A;  3L13 A;  5EG2 A;  2WXG A;  3SFY A;  4DPR A;  5ENN A;  2LXM A;  4U63 A;  1PC2 A;  3FH8 A;  3O4Z A;  1QZ2 A;  3NOG D;  1KLX A;  3SFX A;  3KD7 A;  2Y69 E;  3Q73 A;  2VYI A;  3DAL A;  2J8S D;  2GRQ B;  4HS2 A;  1GW6 A;  2CG3 A;  4YNP A;  4PS7 A;  5EIL A;  5JJT A;  3ONK A;  4JEH A;  2ETA A;  4O30 A;  1OT8 A;  4I2Z A;  3ZFW A;  5ITZ F;  2GW1 A;  3CHR A;  5H7P A;  2AXV A;  4DK5 A;  1O9S A;  2R2L A;  1QNF A;  2CHX A;  4NAC A;  1LD8 A;  4ME2 A;  3UIP C;  5M72 A;  3UQ3 A;  2QYU A;  4UWK A;  1ELK A;  1FCH A;  1O1T A;  4HRN A;  4WNG A;  1Y8M A;  2E0I A;  1DCQ A;  4WAF A;  3AS8 A;  3S7J A;  3MO5 A;  5T0M A;  1N4Q A;  1YCS B;  1KZO A;  5DIZ A;  4HQD A;  4E85 A;  4JC8 A;  3FUH A;  3PZ1 A;  3ASG A;  5CEC B;  5KBA A;  2WXH A;  3AU4 A;  1NZN A;  3S8P A;  2FO1 E;  2JAB A;  3RRM B;  3MO0 A;  5AEN A;  2L0I A;  4YVO A;  5D0Q D;  3NF1 A;  3SFZ A;  3D9J A;  4FJZ A;  4OVU A;  2XEH A;  3B7S A;  3TXN A;  1IHB A;  3AG4 E;  4U8H A;  4CGW A;  3BO5 A;  4JEU A;  1XQH A;  3CVU A;  4WWO A;  3DSW A;  3JUI A;  5CMY A;  1Z5S C;  3LKU A;  3PZ4 A;  3B13 A;  2YHC A;  4HVB A;  4W9R A;  4DI3 A;  5TH7 A;  2J49 A;  3D9P A;  3MEK A;  3CBP A;  4GTQ A;  1TNY A;  2P9U G;  3RQ4 A;  3DBS A;  2QYJ A;  3ASF A;  3MA5 A;  2WXK A;  5D2M C;  3LJN A;  5CBN A;  4FLB A;  4GMJ A;  4GTM A;  5KWD A;  5AN8 A;  4AY6 A;  5DBK A;  5AQB A;  3DST A;  1H2T C;  1MX2 A;  3RSE G;  2Y4T A;  2X6J A;  5G2N A;  3DSV A;  4L9P A;  5BUZ A;  5LSZ A;  5T4Y A;  4J83 A;  1ML9 A;  4BX8 A;  3O48 A;  4URK A;  3ASO E;  2F8Y A;  1RZ4 A;  3I3N A;  4TRQ A;  4B0Z A;  4XIF A;  3EUV A;  4ANX A;  3C3R A;  4U7E B;  2V5F A;  3MYV A;  5CEA A;  3U4T A;  5FQ8 A;  2I6H A;  4NIK A;  4LNG A;  3CST A;  3ZU7 B;  3UT4 A;  3Q7A A;  3NZU A;  1N4S A;  2XGM A;  3CHO A;  4HNA D;  2NSZ A;  2XHE A;  3BEE A;  3QJZ A;  3E33 A;  2PQR A;  3M57 A;  2XS8 A;  3CVW A;  4TXP A;  5EYP F;  1ZB1 A;  2IY0 C;  3CK7 A;  3HXD A;  4GA0 A;  3PUJ A;  4UQX A;  3CLJ A;  3ISM C;  2EIJ E;  3Q47 B;  4OAV B;  3PEV B;  2IEJ A;  4GYO A;  4N2Q A;  5FTP A;  1E90 A;  3G2T A;  1ELW A;  2WMO A;  2R17 C;  3NB2 A;  2EIK E;  3L6A A;  5JJ7 A;  4AP2 A;  4CCA A;  4GYY A;  4EHM A;  3D9K A;  3Q75 A;  5AJD A;  3PNL B;  5ENQ D;  3HNA A;  5FQ6 A;  3PNT B;  1A5E A;  4QFV A;  3DEP A;  2PL2 A;  5C1D A;  4ILH B;  2PNN A;  3DXM G;  2UY1 A;  4BEP A;  1HU3 A;  3R7R A;  3OXG A;  1HF8 A;  2I9C A;  3C3Q A;  1B89 A;  3ZGQ A;  2C2L A;  5LX8 A;  4C1Q A;  3FFL A;  3CBM A;  3RJV A;  3DRA A;  4QEO A;  4PS3 A;  1NA0 A;  2X6K A;  3IHV A;  4F7A A;  2WXR A;  3FUK A;  2X3M A;  3FU3 A;  1IKN D;  4MLP A;  2W5Y A;  3QKY A;  1UN9 A;  3AS5 A;  1INZ A;  4X8Q A;  1JCR A;  4J6I A;  3VUZ A;  2GRM A;  4JHR A;  4UI9 J;  2P9S G;  4LNB A;  3K5K A;  3TWW A;  3UM1 A;  4DX6 D;  3S7B A;  1S64 A;  1PEG A;  3UT7 A;  3RRU A;  4YNM A;  5TEG A;  1IYG A;  3PEU B;  4XZ4 A;  4NUR A;  1ZBP A;  5T3R A;  4GTV A;  4EZK A;  3WG7 E;  4JPS A;  3FEY A;  1V54 E;  4P29 A;  5B1B E;  3ML9 A;  4BTA A;  5CCM A;  4HLL A;  5EKQ D;  4EEC A;  4FHJ A;  3R7Q A;  2YQ8 A;  3WXX A;  1YA0 A;  1DNP A;  2UY1 B;  2Q7F A;  3D9O A;  4BES A;  1WDY A;  1MJ0 A;  4HOS A;  2EIL E;  2ZIS A;  4G23 A;  4U0U A;  2KXP C;  2OVF A;  3PDN A;  1KT0 A;  4L1B A;  3FTZ A;  4KBQ A;  2DYS E;  1BI7 B;  5AJL A;  3Q4A B;  3QAQ A;  5T8I A;  2IF4 A;  1MX4 A;  4CDR A;  5FIN A;  1JCQ A;  3CEQ A;  4BER A;  3ZN3 A;  3HXE A;  4YPE A;  2EIM E;  2WXN A;  3FTY A;  3AG3 E;  5T0K A;  2NYJ A;  4XI9 A;  4BX9 A;  1BU9 A;  3V79 K;  2FEZ A;  3JQ1 A;  3JUE A;  3NAW A;  4RLY A;  3FTU A;  3FEX A;  5LP0 A;  3G2S A;  3QWW A;  2XEE A;  2A4Z A;  4L2L A;  3UI2 A;  1H0A A;  2IO2 C;  1LD7 A;  3CBO A;  2WM9 A;  4F1P A;  4N5C A;  4JLG A;  3AS4 A;  4GTO A;  2BUG A;  3CIA A;  2DCP A;  4I9C A;  3V2O A;  1UN8 A;  2LAH A;  4F53 A;  2GRR B;  4RVB A;  3CQC B;  5ENP D;  3ULQ A;  1DVP A;  1JWF A;  5AQ9 A;  4TV3 A;  1FVH A;  4I1M A;  3FTX A;  3K9I A;  3KMT A;  3APC A;  1NFI E;  4EQF A;  3UIO C;  4MBG A;  2QC9 A;  3TAX A;  4WNF A;  5BW8 C;  3L22 A;  2RD0 A;  4G2V A;  5HQ8 A;  1RW2 A;  2JEK A;  3SQV A;  3ZPJ A;  3UMV A;  1K8K G;  2MOW A;  3ESK A;  4I6G A;  3MKQ A;  4N3A A;  3SD5 A;  4K5C A;  3PZD A;  4ZFH A;  4JDS A;  2HR2 A;  3L54 A;  4U8Y D;  5E75 A;  4YPA A;  2J08 A;  3RJW A;  4I6J A;  4B94 A;  3VLE A;  4JXT A;  5KJL A;  2F37 A;  3M59 A;  3RO2 A;  5EYL A;  1Z6T A;  2H6I A;  5ANR A;  4AIF A;  4FU3 A;  3J5Q B;  4N3C A;  1MHQ A;  3MJW A;  4DX5 D;  3ZYQ A;  4Z4P A;  4UQZ A;  3CHS A;  4I51 A;  2ION A;  4BSZ B;  2Y3A A;  2VSY A;  3CK8 A;  3G2V A;  3FY4 A;  4GZD A;  1AP7 A;  3LS8 A;  2MYO A;  4KVO A;  3ABM E;  2DWZ A;  3J5P A;  4J8D A;  4J7I A;  3ZUV B;  4U95 D;  3DPY A;  2E2E A;  3DXK G;  4DRX E;  4HOU A;  3M56 A;  4UWG A;  2J4D A;  4HOT A;  3E34 A;  4WNE A;  5BPP A;  1QYM A;  5JJ6 A;  4GCO A;  1QQE A;  3CHM A;  3MKQ B;  4B8C B;  2WMN A;  4G11 A;  4DLO A;  4BFR A;  5EX0 A;  3MGB A;  4AOF A;  5EN5 D;  4Z68 A;  2HO1 A;  1MZC A;  4BWR A;  3QK0 A;  1OCC E;  3U66 A;  1HXI A;  4XE0 A;  3HG0 D;  5F59 A;  4Q94 A;  3UXG A;  1G3N B;  1N0Q A;  1EPU A;  3TWR A;  4F1S A;  3LY9 A;  2OOE A;  4OVV A;  3E37 A;  4J0U A;  3MX3 A;  3M53 A;  4B89 A;  1E8W A;  2HM8 A;  2IQC A;  2X6I A;  3ZYL A;  3UPV A;  3Q49 B;  4A3T A;  3V2X A;  2WXF A;  1BLX B;  1UG3 A;  4DX2 A;  3UUX A;  3VTY A;  4Y6C A;  3RIB A;  3GYZ A;  2OVB A;  1MX6 A;  4G8L A;  3FUJ A;  3PH0 C;  3NZS A;  2LSU A;  4HBD A;  1LF8 A;  2V0P A;  5BNW A;  3F9Y A;  1IQU A;  3C72 A;  3GZ1 A;  3JXJ A;  4RG6 A;  1V55 E;  4JZY A;  3TJP A; 
#chains in the Genus database with same CATH homology
 5BV0 A;  1H6K A;  2XPI A;  2YNQ A;  4MRU A;  1WY6 A;  3QAR A;  4IJD A;  3EJN A;  4K03 A;  4YND A;  3LPZ A;  3CK7 A;  4GYW A;  3SBT B;  4GA0 A;  2OV8 A;  3HVE A;  4GZ3 A;  2KCL A;  4GB9 A;  3PUJ A;  4FHK A;  2VGX B;  4FC8 A;  4C0M A;  4UQX A;  3CLJ A;  2WQ7 A;  3SWC A;  4I1O B;  2PQN A;  5J08 A;  1HFA A;  2VSX E;  3Q47 B;  1EF1 C;  3U3W A;  2LSV A;  4IJ8 A;  2XCC A;  4FP7 A;  4PDX A;  4V3I A;  3PEV B;  4JL0 A;  1OWP A;  4GYO A;  2VJ8 A;  4N2Q A;  5FTP A;  5CCL A;  2J09 A;  1E90 A;  2YHE A;  3G2T A;  3FUN A;  5FWQ A;  1ELW A;  2WMO A;  2R17 C;  5G04 J;  3L6A A;  5JJ7 A;  3QOU A;  2J4B A;  2Y4U A;  3VLF A;  4JVS A;  4AP2 A;  4CCA A;  4F3V A;  3OS5 A;  4GYY A;  5AYW D;  5JHB A;  3OOI A;  1H3I A;  3ZW3 A;  3D9K A;  4ACK A;  5LCW C;  5AJD A;  3PNL B;  2R59 A;  2LAI A;  4R7L A;  3ZHE A;  5KJN A;  3HNA A;  5FQ6 A;  3PNT B;  3SF4 A;  4CRW A;  3UT8 A;  4QFV A;  1ELR A;  4Q69 A;  4J7F A;  2PL2 A;  3N71 A;  1E7U A;  5C1D A;  4E6H A;  5JHN A;  2J07 A;  4AVX A;  3LDZ A;  4ILH B;  3FDH A;  1ZU2 A;  2QPW A;  4JHK A;  3LY8 A;  3CK9 A;  2KCV A;  3FH7 A;  4LER A;  3TG5 A;  3KMA A;  4L23 A;  2UY1 A;  1VDY A;  4I43 A;  3CHP A;  3LVR E;  1E96 B;  1HU3 A;  4O6F A;  3MCX A;  3PRZ A;  4KT6 B;  4GCN A;  2F69 A;  3OPE A;  3R7R A;  3ENE A;  4NVQ A;  5F6K C;  3KAE A;  1H2V C;  4A3V A;  4AY5 A;  3OXG A;  1HF8 A;  3CR3 A;  4WUY A;  3B7R L;  4GAA A;  4DI4 A;  2I9C A;  1B89 A;  3CKB A;  4H12 A;  1MT6 A;  4TUU A;  3BG1 B;  3ZGQ A;  4JHJ A;  2C2L A;  5LX8 A;  2W5Z A;  4C1Q A;  4FUL A;  2HYZ A;  4I9E A;  3OXF A;  2JLB A;  4MS6 A;  5FJY A;  3FFL A;  5A7D B;  3GZ2 A;  4U0S A;  4G24 A;  2PM7 A;  3RJV A;  2BQZ A;  3CBM A;  2FI7 A;  3M54 A;  4H7Y A;  4QEO A;  3HHM A;  3EHN A;  2WQ6 A;  2ZU6 B;  4PS3 A;  1NA0 A;  1JWG A;  2IFU A;  2X6K A;  3IHV A;  4IN3 B;  4F7A A;  4CGV A;  5JHA A;  4APF A;  3EDT B;  2WXR A;  3FUK A;  2X3M A;  2G46 A;  4Q96 A;  3FU3 A;  1UJK A;  4E47 A;  3PRE A;  4MLP A;  3RU0 A;  2W5Y A;  3QKY A;  5LFA A;  2X6F A;  1XGW A;  3CV0 A;  3F9Z A;  2WVI A;  1UN9 A;  3AS5 A;  4UWL A;  4KMO A;  5G04 C;  1TJF A;  3HVE B;  4GA2 A;  5ARG A;  5C2Y A;  1INZ A;  3PE3 A;  5LSX A;  2XCB A;  4HXI A;  2C0M A;  4J6I A;  1Z3X A;  1PAQ A;  5A23 A;  5F5E A;  2GRM A;  3VUZ A;  3PE4 A;  3AU5 A;  4AJW A;  2XGS A;  2XEV A;  2CG2 A;  4JHR A;  3Q5M A;  4UI9 J;  4XI0 A;  4FMU A;  4DJA A;  5FZQ A;  3CVV A;  3KS2 A;  1N6A A;  3K5K A;  4LCT A;  4KVM A;  4DLQ A;  3FTV A;  3L08 A;  3QWV A;  2FBN A;  3P2B A;  3FHE A;  5A6C A;  3SGH A;  3IHY A;  3EIQ C;  5FT9 A;  3ZEF A;  2XPZ A;  3S7B A;  3FTS A;  1PEG A;  3ZVV A;  2CFU A;  3UT7 A;  3LXU X;  2J9Q A;  3MKR A;  1IQR A;  3RRU A;  5KJK A;  1HO8 A;  1U3D A;  4YNM A;  5TEG A;  4L2Y A;  1IYG A;  3PEU B;  4XZ4 A;  4M3O A;  5EX3 A;  4NUR A;  2KAT A;  3G2W A;  2QFC A;  3ONL A;  1ZBP A;  4LDG A;  5T3R A;  2RG8 A;  4EZK A;  3ZHE B;  5BT1 A;  3I5P A;  4A1G A;  3TGO A;  3CVY A;  4JPS A;  4ABN A;  2NC9 A;  3FEY A;  2I1K A;  3U64 A;  2KZT A;  2NXP A;  1FVF A;  4P29 A;  3CKC A;  3CVN A;  3ML9 A;  2VSO E;  4BTA A;  3FWV A;  4D10 C;  5CCM A;  5EKQ D;  1H2U A;  4EEC A;  4FHJ A;  3FU5 A;  4AM9 A;  2XRZ A;  4L7T A;  3R7Q A;  2YQ8 A;  3JQ0 A;  4B8A A;  3WXX A;  1YA0 A;  1DNP A;  2XPY A;  3HYM B;  2VTB A;  1N6C A;  2UY1 B;  2AXZ A;  2Q7F A;  4GA1 A;  1KT1 A;  1H19 A;  1PY1 A;  2GGF A;  3D9O A;  5D0O D;  4CEM A;  1SZ9 A;  4FA6 A;  3T5V A;  3GZS A;  4AV7 A;  2VQ2 A;  3VLD A;  4YPU A;  1A17 A;  4XX5 A;  4HOS A;  1OUV A;  4RSY A;  4JA7 A;  2RFI A;  4OYS A;  4BUP A;  4CDN A;  4G23 A;  4U0U A;  4G1T A;  2OVF A;  3PDN A;  1KT0 A;  3ESL A;  3ZXS A;  2CHW A;  1MVH A;  4L1B A;  2XQ0 A;  1NA3 A;  4I2W A;  3FTZ A;  4KBQ A;  4LUN U;  4WND A;  4GPK A;  1IHG A;  3OXL A;  4GZ6 A;  5AJL A;  4CDM A;  3I4G A;  3OTN A;  3T5X A;  1HZ4 A;  4KXK B;  4EBA A;  3Q4A B;  4BTB A;  3ASD A;  4GZ5 A;  3D3M A;  1W3B A;  3QAQ A;  4JA9 A;  5T8I A;  4ANV A;  2MRI A;  5JIY A;  2IF4 A;  3FPD A;  3OAW A;  2MHK A;  1NP7 A;  3FP3 A;  3FU6 A;  4CDR A;  1HH8 A;  1HG2 A;  1EYH A;  5BV1 A;  3CEQ A;  1OWM A;  3ZN3 A;  1UJJ A;  4YPE A;  2IJG X;  3FUF A;  2M63 A;  3FUM A;  4XKB A;  2WXN A;  3FTY A;  2WQH A;  5CHE E;  5T0K A;  1Y6I A;  4XI9 A;  2VGY A;  4BX9 A;  1JUQ A;  1WAO 1;  3HDX A;  3M55 A;  4PH4 B;  1XNF A;  4BT8 A;  5HI7 A;  2V8S E;  2FEZ A;  3LVQ E;  3PUK A;  3JQ1 A;  3ASH A;  1N52 A;  4FAD A;  1E8X A;  3MV2 B;  3CVX A;  4U0Z A;  4NQ0 A;  3RKV A;  4CT4 A;  2AVP A;  4MI5 A;  2LNI A;  2WXP A;  3FUE A;  5FZR A;  1HS6 A;  1N54 A;  3FTU A;  3I4R B;  3FEX A;  3CHQ A;  5LP0 A;  1OWN A;  1E8Y A;  3G2S A;  4WWP A;  4EZL A;  3QWW A;  4N3B A;  3D9M A;  2KC7 A;  1E8Z A;  2IOS A;  2A4Z A;  3L13 A;  4L2L A;  5EG2 A;  2WXG A;  1H0A A;  2KZT B;  4DPR A;  3CQG B;  3BG0 B;  5ENN A;  4HOR A;  4U63 A;  4ANW A;  1PC2 A;  3FH8 A;  3O4Z A;  3FUD A;  4Y6W A;  1QZ2 A;  2IGQ A;  3CBO A;  1HG5 A;  2WM9 A;  5JIN A;  2AXU A;  4N5C A;  2VTB B;  4NJ5 A;  4JLG A;  3AS4 A;  4UWF A;  2XRY A;  5EDS A;  1KLX A;  2BUG A;  3CIA A;  3R9A B;  2DCP A;  3KD7 A;  4I9C A;  1P5Q A;  3MO2 A;  3TL5 A;  4QEP A;  1UN8 A;  2LAH A;  2VYI A;  4F53 A;  5FQ4 A;  3DAL A;  1JPL A;  3LEW A;  2GRL A;  4HS2 A;  4RZ0 A;  1GW6 A;  2LO6 A;  3CQC B;  4RVB A;  1DVP A;  3ULQ A;  2I2O A;  1JWF A;  2CG3 A;  4TV3 A;  1FVH A;  2DIW A;  4I1M A;  4YNP A;  3FTX A;  3K9I A;  3KMT A;  2PZI A;  4PS7 A;  5FZS A;  5JJT A;  3LY7 A;  3D9L A;  4G26 A;  3ONK A;  4JEH A;  3APC A;  4EQF A;  4O30 A;  1BPO A;  5ANL A;  4I2Z A;  3U9W A;  3ZFW A;  3ZIM A;  2GW1 A;  5KJM A;  3CHR A;  2AXV A;  4ANU A;  4LRZ A;  4DK5 A;  2I1J A;  3MZL B;  1O9S A;  2CHZ A;  5J90 A;  3TAX A;  4LEU A;  3URZ A;  1QNF A;  4WNF A;  5ARF A;  4J8O A;  2CHX A;  4NAC A;  3QNK A;  5BW8 C;  3L22 A;  4ME2 A;  2WPV A;  4HLE A;  3RK6 A;  2RD0 A;  4J8F A;  2IOL A;  2QY7 A;  4G2V A;  3ZYM A;  5HQ8 A;  5KCM A;  2ILR A;  5CMW A;  3F9W A;  2JEK A;  4ACL A;  5M72 A;  3ZPJ A;  3UQ3 A;  3UMV A;  3IKO B;  4HOQ A;  2MOW A;  1MQS A;  3EIJ A;  3ESK A;  4FLH A;  4FJY A;  4UWK A;  3IEG A;  4I6G A;  1ELK A;  3MKQ A;  3HIZ A;  1FCH A;  4JW1 A;  3RO3 A;  4N3A A;  3SD5 A;  3GW4 A;  4BY6 A;  2IU1 A;  3PZD A;  4WNG A;  1Y8M A;  4YVQ C;  2YIN A;  2E0I A;  4AXH A;  4JDS A;  1UW4 B;  3APF A;  2HR2 A;  3L54 A;  4WAF A;  3UX4 A;  3AS8 A;  5E75 A;  3ML8 A;  4YPA A;  2J08 A;  2UWJ G;  4I6J A;  3S7J A;  4B94 A;  1ZKK A;  3VLE A;  4JXT A;  5KJL A;  3MO5 A;  3CVP A;  3APD A;  4EPZ A;  4KZC A;  5T0M A;  3M59 A;  3QDN A;  2P58 C;  3RO2 A;  2BF0 X;  5TTF A;  1Z6T A;  4IUL A;  5DIZ A;  2WXQ A;  5F6L A;  2L6J A;  1OWL A;  1Z3Y A;  4UI9 K;  5ANR A;  1L5J A;  4IRU A;  4E85 A;  3SBS A;  5JJ0 A;  4AIF A;  4APO A;  4FU3 A;  4QEN A;  5E76 A;  4JC8 A;  3FUH A;  4N3C A;  3ASG A;  1S0P A;  2VSN A;  5AIJ A;  1MHQ A;  3M58 A;  4IYP A;  2WXH A;  3AU4 A;  4UI9 C;  4ATG A;  3DPD A;  3MJW A;  1NZN A;  3ZYQ A;  4Z4P A;  4UQZ A;  3CHS A;  4BSX A;  3S8P A;  3C98 A;  4I51 A;  3JCK C;  3TXM A;  2ION A;  2PM6 A;  2AW6 A;  1U3C A;  2VSY A;  2Y3A A;  3CK8 A;  3G2V A;  1WM5 A;  3FY4 A;  4RG9 A;  3VTX A;  3RRM B;  4AEZ C;  2JV0 A;  1MVX A;  4MKT A;  3MO0 A;  5AYF A;  5AEN A;  4PS8 A;  2L0I A;  3L17 A;  4YVO A;  4U07 A;  4GZD A;  5D0Q D;  3NF1 A;  2WXO A;  2WXM A;  3LS8 A;  4KVO A;  5LOZ A;  2X38 A;  3SFZ A;  3D9J A;  4FJZ A;  4OVU A;  1EDU A;  3JYS A;  3B7S A;  3LCA A;  3P1U A;  3TXN A;  3PVL A;  3FH5 A;  1E7V A;  4J8D A;  4PUC A;  4J7I A;  4U8H A;  2FUL A;  4CGW A;  3BO5 A;  4JEU A;  1XQH A;  3RRN B;  3QB2 A;  3CVU A;  3S2A A;  2E2E A;  4WWO A;  1HX8 A;  3JUI A;  3DB5 A;  3D9I A;  4HOU A;  3M56 A;  5CMY A;  2XGO A;  4UWG A;  2J4D A;  3L16 A;  3SHF A;  5G05 J;  3LKU A;  4KYO B;  4HOT A;  4WNE A;  5BPP A;  5JJ6 A;  3B13 A;  3CVQ A;  3M5A A;  2YHC A;  4HVB A;  3CSF A;  3SNX A;  4UQY A;  4GCO A;  4W9R A;  4DI3 A;  5TH7 A;  1OWO A;  2J49 A;  3D9P A;  3MEK A;  1QQE A;  3ZRH A;  3CBP A;  3CHM A;  3IV0 A;  3MKQ B;  3RAY A;  3Q15 A;  3VV0 A;  4B8C B;  4AU7 A;  2R3A A;  3RQ4 A;  3E4B A;  5G55 A;  3DBS A;  1SZA A;  3QC1 A;  2WMN A;  3B7T A;  2V4L A;  3LYA A;  4G11 A;  2KM4 A;  4DLO A;  4XKC A;  3PS6 A;  2DBA A;  3ASF A;  4EBA G;  4GU5 A;  4BFR A;  3MA5 A;  2L9B A;  2WXK A;  5EX0 A;  4H7X A;  3MGB A;  4AOF A;  4FLB A;  3FUI A;  4GMJ A;  4ILI A;  2AWI A;  4AY6 A;  2CFZ A;  5DBK A;  4ILG A;  4GML A;  1H2T C;  2HO1 A;  2OND A;  3FTW A;  3S7D A;  3ZYK A;  2VGX A;  2L0T B;  3F9X A;  4BWR A;  4J8S A;  2C0L A;  1HE8 A;  2EQX A;  3QK0 A;  3U66 A;  1HXI A;  2WXL A;  2Y4T A;  4NRH B;  3KEZ A;  4XE0 A;  2X6J A;  3IHX A;  5F59 A;  3CGH A;  2X6H A;  4Q94 A;  5G2N A;  3RJW A;  5FQ7 A;  2O8J A;  1EPU A;  5BUZ A;  5LSZ A;  4G25 A;  4K0R A;  5T4Y A;  4J83 A;  1ML9 A;  4F1S A;  2BTD A;  3LY9 A;  2OOE A;  2R5S A;  4OVV A;  3EP0 A;  4J0U A;  4BX8 A;  1SQM A;  3MX3 A;  4C9B B;  3SI5 A;  3O48 A;  3CVL A;  4URK A;  3M53 A;  1MUF A;  3S7F A;  2WXJ A;  4N2S A;  2KCK A;  3FUL A;  3QWP A;  3I3N A;  5CPR B;  4B89 A;  4I1A A;  4TRQ A;  1E8W A;  2HM8 A;  2IQC A;  2X6I A;  3EHM A;  3NQP A;  4XIF A;  3ZYL A;  4B0Z A;  4ANX A;  3UPV A;  4EZJ A;  3Q49 B;  4C0E A;  4I6E A;  1TEZ A;  4A3T A;  2WXF A;  4J8E A;  5G05 C;  3D9N A;  4CT0 A;  2V5F A;  1UG3 A;  3UUX A;  3VTY A;  3MYV A;  3TG4 A;  3FU0 A;  3U4T A;  4Y6C A;  3RIB A;  5LCW J;  3GYZ A;  5FQ8 A;  2OVB A;  3G2U A;  2WB2 A;  2I6H A;  1TJC A;  4KZ0 A;  4A55 A;  3CST A;  1X5B A;  4BT9 A;  3LJ3 A;  3MV3 B;  3T8M A;  3UT4 A;  2FF4 A;  3SZ7 A;  3FUJ A;  3NZU A;  3PH0 C;  4HFG A;  4N39 A;  3IBE A;  1N3J A;  2FO7 A;  3KMJ A;  2A5U A;  2XGM A;  4GZC A;  3NZS A;  2LSU A;  3CHO A;  2WXI A;  3B7U X;  2NSZ A;  5T5G A;  4WWN A;  1LF8 A;  4UWH A;  4MI0 A;  2V0P A;  5BNW A;  4I17 A;  3SW9 A;  3F9Y A;  2XHE A;  1IQU A;  4U04 A;  3BEE A;  3QJZ A;  3GZ1 A;  2PQR A;  4A1S A;  4RG6 A;  3M57 A;  3CVW A;  4JZY A;  3TJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...