5KJLA

Smyd2 in complex with az378
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
428
structure length
428
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
molecule keywords N-lysine methyltransferase SMYD2
molecule tags Transferase/transferase inhibitor
source organism Homo sapiens
total genus 141
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjlA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjlA01
3SF4A 3RIBA 3KMJA 3QWVA 2RFIA 4HORA 3MKRA 2KCKA 4WNFA 5F6KC 5AYFA 4UQZA 2JV0A 5FZSA 3M57A 4J83A 3CVNA 4I2ZA 2Y4UA 4CGWA 2BUGA 3ASGA 1IYGA 3F9YA 4IN3B 3F9ZA 3RQ4A 2PQRA 4I2WA 3OXLA 4J7FA 3BEEA 4BTBA 2UY1B 2KATA 4I9EA 3KMTA 4KXKB 3UPVA 3Q15A 5A6CA 4I51A 5JJTA 4JLGA 3M55A 4Y6CA 2LNIA 3GW4A 1KLXA 4YVOA 3SW9A 1ZKKA 2XCCA 5EG2A 4AY6A 1B89A 1HH8A 4WNDA 5BNWA 2DBAA 5JJ7A 3IEGA 2C2LA 3M56A 1MUFA 3HNAA 5ARGA 4O30A 3ZGQA 4E47A 3MO2A 3ASFA 3E4BA 3UQ3A 3LY8A 3EDTB 5FT9A 4YPAA 5FZRA 3SZ7A 4B94A 4G23A 2HO1A 1PEGA 4MI0A 2XGSA 4EQFA 3M5AA 5F5EA 4G25A 3LY7A 2YQ8A 4UI9J 4APOA 5LSXA 5D0QD 3CKCA 3VUZA 2C0MA 5LCWC 3S7BA 5AYWD 3TAXA 2MHKA 4FMUA 4BWRA 1ELRA 2Y4TA 1Y8MA 1N6CA 2XGOA 4H12A 2V5FA 1YA0A 5LSZA 2AVPA 4H7YA 1MVHA 1TJCA 2J9QA 2FO7A 4GZ3A 4J7IA 2XGMA 3OS5A 4JL0A 5KJNA 5G04J 3MO0A 4J8EA 2R3AA 1XNFA 3DB5A 4GA1A 2UY1A 5HQ8A 2PZIA 4G24A 5F59A 2VGYA 2XCBA 4G2VA 3RAYA 3VTXA 3MV2B 1OUVA 3QKYA 1ZBPA 4N3CA 3CVPA 1KT1A 5EKQD 2HYZA 1KT0A 1IHGA 3RJWA 4BTAA 4N5CA 3AS8A 1N6AA 3CVQA 3M58A 3CK9A 1FCHA 3K5KA 2VSYA 4AIFA 2FF4A 4WNGA 4HOUA 3LPZA 4GZ5A 2VYIA 4GCNA 3K9IA 4N3AA 1ML9A 3FFLA 4AY5A 2VSNA 2IF4A 2GW1A 4LEUA 4LDGA 4ABNA 3CBOA 3ASHA 5G05C 4JA9A 3BO5A 3PDNA 3GYZA 5C1DA 3U3WA 3F9XA 3RKVA 4UI9K 1NA3A 3MO5A 1ZU2A 3QOUA 4JHRA 3CBPA 3ZFWA 3CVLA 3WXXA 4NQ0A 2QPWA 5TH7A 2VGXA 3S8PA 3VV0A 1N3JA 3EP0A 1P5QA 5KJKA 3QDNA 4YPUA 3URZA 3GZ1A 2QFCA 4RZ0A 4NJ5A 2FEZA 4Z4PA 5T5GA 3AS4A 3LYAA 3ZHEA 4C1QA 5BW8C 2FI7A 4U04A 3QWPA 3CBMA 4N3BA 4MI5A 5FJYA 4AU7A 2OOEA 5EX0A 2PQNA 3Q4AB 4GYYA 1H3IA 1W3BA 4KYOB 4F3VA 4XIFA 3Q5MA 4UQYA 4IJDA 2UWJG 5JIYA 4NVQA 1WM5A 1HXIA 2F69A 5FZQA 3CEQA 4HOTA 4W9RA 5DBKA 2R5SA 1WAO1 3KS2A 1NA0A 3HYMB 1QZ2A 3FP3A 4U0ZA 5TEGA 2BQZA 3CK7A 4N39A 4U07A 3DALA 2G46A 1HZ4A 4J0UA 4QEPA 4QENA 5CPRB 4N2QA 2ONDA 5JJ6A 4XI0A 3O48A 4ME2A 4GPKA 3PE4A 2PL2A 3RJVA 3KMAA 5LCWJ 2W5YA 4BUPA 4HOQA 3PE3A 5TTFA 3ASDA 3OPEA 2YHCA 2Q7FA 2JLBA 3OXGA 3GZ2A 3CK8A 4GYOA 4NRHB 4QEOA 4JA7A 2FBNA 4GA2A 3OXFA 3AS5A 3S7DA 4I17A 3QWWA 5M72A 4O6FA 2HR2A 5D0OD 3TG4A 3M59A 4YVQC 3TGOA 2O8JA 3UUXA 3MA5A 4AM9A 3SWCA 2WQHA 2XEVA 1A17A 4WNEA 5A7DB 2XPIA 3S7FA 2I6HA 5JHNA 3U4TA 3FPDA 5CHEE 2E2EA 3ESKA 3Q47B 2IGQA 3N71A 5F6LA 4UI9C 4G26A 4A1SA 3ZPJA 3TG5A 5KJLA 2VQ2A 4RG9A 4UQXA 3MEKA 3IHXA 4GA0A 4J8OA 4J8DA 2LSUA 4HOSA 2W5ZA 4WUYA 5G05J 4JDSA 1MT6A 5FTPA 4GYWA 5JINA 4KBQA 3OOIA 4GCOA 1O9SA 4U0UA 5G04C 1NZNA 3F9WA 3M54A 2LSVA 1MVXA 3ZN3A 3Q49B 1QQEA 3R9AB 3LKUA 5DIZA 3RO3A 3KD7A 4IJ8A 3KAEA 2KCLA 5CCMA 4H7XA 5CCLA 4G1TA 4N2SA 3VTYA 5JJ0A 4YNDA 3M53A 5ARFA 4U0SA 4YNPA 4BT8A 3FWVA 2VGXB 1ELWA 3JYSA 1PC2A 5T0MA 5HI7A 5T0KA 2KCVA 3RU0A 3S7JA 2C0LA 5KJMA 4YNMA 4RG6A 3RO2A 3ULQA 2L6JA 2KC7A 4BT9A 1E96B 3NF1A 5EX3A 3CKBA 2NC9A 4YPEA 2P58C 4J8FA 2WPVA 4I1AA 2IFUA 3MV3B 3ZHEB 4CGVA 4Y6WA 5BT1A 4CDRA 4GZ6A 3LCAA 4I9CA 3CV0A 1XQHA 3LY9A 4XI9A
chains in the Genus database with same CATH superfamily
2ZGGA 4F1PA 5CERB 3UT7A 4O1PA 4I2ZA 2Y4UA 4CGWA 2BUGA 1N4PA 1L5JA 2WXIA 3L6AA 2J4BA 1NL4A 4GZDA 5EYLA 3SNXA 1BLXB 4LERA 4I2WA 3C3QA 3S2AA 4KXKB 1OWNA 2RFMA 2P9NG 3Q15A 4XE0A 3HRAA 4Y6CA 2LNIA 4HI9A 3RRUA 3ZXPA 3Q75A 3SW9A 1ZKKA 2XCCA 3DSWA 3CHMA 1IKND 1BI7B 1OCZE 5BNWA 1DVPA 2LAHA 3UM2A 3HXBA 2IONA 3FUMA 1MUFA 3MO2A 2FULA 3ASFA 3B7SA 2KBXA 4WWPA 3APDA 3FUHA 3FUJA 3DSUA 2ZISA 3AU4A 4DJAA 2ZIRA 3EDTB 5FT9A 4YPAA 1Q2ZA 3TWWA 2XGSA 2R02A 5F5EA 3B7UX 4G25A 3ZIMA 2YQ8A 2IQCA 5D0QD 2C0MA 3S7BA 5AYWD 1N6CA 1H0AA 1Y8MA 4DRXE 1YA0A 3E37A 4A3VA 4GTPA 4BESA 2F8XK 3PH0C 4B0ZA 4B8CB 3C3OA 1KZOA 3J5QB 5C2YA 5G04J 4JC8A 2R3AA 4NIKA 4HI8A 2ZU6B 5CRUA 3CGHA 3ISMC 1OXJA 5HQ8A 3UT4A 4KZ0A 3CIAA 4L1BA 2IU1A 3KSLA 4JB8P 1WG0A 5B3SE 3R7QA 5EKQD 3ML8A 2HYZA 1AP7A 3UMVA 2R05A 4XKBA 1N4SA 3LDZA 4L9PA 4Q94A 2VSYA 4JHJA 1ELKA 2A4ZA 4WNGA 4HOUA 4HB5A 3K9IA 1ML9A 3FFLA 3BG0B 2R03A 3BU8A 4LEUA 5AJLA 1TNYA 3UINC 4ABNA 3PZ1A 3Q79A 3BO5A 3PDNA 3FTUA 1IXVA 5C1DA 3DWLG 3F9XA 4HRLA 1E90A 2X6FA 1N9AA 5EDSA 3CHRA 3U64A 1BPOA 3LJ3A 2ETAA 3SBTB 3UX4A 3FUEA 4EZKA 3S8PA 2AJAA 2ETCA 1P5QA 3DBSA 5LX8A 2XPZA 4TRQA 1TEZA 1N11A 3QDNA 1E8ZA 4F1SA 2FEZA 3AS4A 3ZHEA 5JHBA 4U04A 2VSXE 4HRNA 4JPSA 1OWPA 5FJYA 1N94A 2OOEA 2VTBA 2I2OA 3FY4A 3SFZA 1H3IA 3JXIA 4IJDA 2LAIA 1D8DA 1RW2A 2NXPA 5CMWA 1U3CA 3EHQA 3V31A 5TEGA 4CEMA 2DIWA 4XZ4A 5AIJA 4QEPA 5LOZA 4N2QA 1OWMA 4PS8A 3ZYLA 3UXGA 3I3NA 4V3IA 3TWRA 1INZA 2PL2A 2PNNA 3RJVA 3KMAA 2W5YA 2PM7A 3QJZA 3TWTA 4BX8A 3PE3A 3ASDA 4AP2A 3VLFA 2WVIA 1JWGA 3CK8A 2EQXA 3CLJA 4ANXA 3VLDA 3D9MA 3MX3A 2QY7A 3FULA 3AS5A 5M72A 4I6JA 1E7VA 3G2VA 4O6FA 5D0OD 3ABLE 3TGOA 4AM9A 3SWCA 4U7EB 3CQGB 1TNOA 3FU5A 5EN5D 1E8WA 1A17A 1O5MA 3FUNA 4WAFA 5A7DB 2XPIA 1IQUA 4PS7A 1N4QA 2EIJE 3FPDA 5CHEE 1HS6A 4QQIA 3D9HA 4CT0A 2I9CA 4GAAA 1U3DA 4EHMA 5LFAA 4G26A 3C72A 3TG5A 3UI2A 4RG9A 2IEJA 1N52A 4U8VD 4DLQA 2I1JA 1UOHA 2LXLA 3E33A 2WXFA 2A5EA 2W5ZA 3ULEG 2WXPA 1MT6A 5JHAA 2LO6A 1K1AA 2HE0A 3OOIA 1MYOA 4GCOA 3DPDA 1ZB1A 4U8HA 3V2XA 1MVXA 4JHKA 3ZN3A 4NACA 3R9AB 2NYJA 5DIZA 5FINA 3AG1E 3KAEA 5ENTD 2P9UG 5CCLA 5A23A 3M53A 1H6OA 1DC2A 3PZ3A 1ELWA 5T0MA 2VJ8A 1H6PA 3SFYA 5HRYA 4OAVB 4O1OA 2M63A 2OVBA 1SW6A 3AG3E 3RO2A 5BV1A 4L23A 4BT9A 4CCAA 1E96B 5CEDB 4YPEA 4UWKA 4FLHA 2WPVA 4UUCA 1N0RA 2DVWA 2X3MA 4DI4A 4Y6WA 5BT1A 4GZ6A 4GB9A 4I6EA 4AEZC 3RAUA 1XQHA 2J08A 2J4DA 4GU5A 1TNZA 2V4HC 4B89A 4D10C 3KMJA 3CVVA 2RFIA 2OVFA 2KCKA 3P2BA 1OWLA 5F6KC 5AYFA 4UQZA 3EHNA 4Q69A 3M57A 2QYUA 2Y1LE 4IN3B 3T5VA 2R59A 3RQ4A 2PQRA 3NOGD 3FTWA 1G3NB 3L13A 3OXLA 3D9NA 3LVRE 1K8KG 4TUUA 5J90A 1MX4A 5A6CA 5JJTA 3M55A 2X38A 2F8YA 3GW4A 4KVOA 5EG2A 4AY6A 4WNDA 3FH7A 3KSQA 2KZTB 3NZSA 3T9KA 3ZNGA 1H2UA 5ARGA 4RLYA 4E6HA 3ZGQA 4GMJA 3MCXA 4CDNA 3CVWA 1LTXA 3AG4E 3RK6A 3SO8A 3LY8A 4B94A 3L82A 4MI0A 2DZNA 3B13A 4APOA 3SI5A 2WM9A 2P9PG 3IHYA 5LCWC 4QFVA 2MHKA 3TAXA 4PS3A 2Y4TA 3F6QA 3DEPA 2AWIA 2XGOA 2V5FA 3HHMA 4U95D 3LVQE 3RRMB 2LXMA 2AW6A 1TJCA 2J9QA 4GZ3A 3CSFA 4AXHA 3X2QE 4J7IA 5KJNA 3G2WA 2GROB 5CRVA 1JCSA 5AENA 1JCRA 3I4RB 2PZIA 3B95A 5F59A 1FVFA 3RAYA 3HXFA 3MV2B 3DSXA 4KVMA 1KT1A 1UG3A 4BTAA 3NZUA 3SHFA 2XEEA 3AS8A 3CK9A 3Q7FA 1FCHA 4AIFA 1X81A 3LPZA 4GZ5A 2VYIA 5BXUA 5EILA 2ZGDA 2E0IA 2VSNA 2LUHA 3L08A 2L6BA 3E32A 4JA9A 5KBAA 4BY6A 3GYZA 3GZSA 4G8KA 3U3WA 4UI9K 2WXKA 3QOUA 4JXTA 4BERA 5JA4D 3BQOA 3NQPA 1TN7A 5AJDA 4A3TA 3PZ2A 2QPWA 2VGXA 4FULA 3ZYKA 4DX7D 3MKQB 5EIBE 3VV0A 1HF8A 3JXJA 4HXIA 5IY5E 3EIJA 4GPMA 4YDYA 4NJ5A 5CEAA 4U63A 4M7CA 3G2UA 4ANUA 4CRWA 3PZ4A 5BW8C 2FI7A 1AWCB 3PEVB 3QWPA 5JMND 1OY3D 5EX0A 1BI8B 1H2VC 2PQNA 3Q4AB 2MRIA 1TNUA 2DCPA 1TYQG 3UTMA 2XZDG 4F3VA 5BPPA 4UQYA 4BEPA 2UWJG 3SFXA 3SGHA 4NVQA 2B0OE 3FH8A 1KPSB 4YDOA 4JEUA 4HOTA 5DBKA 2R5SA 3HYMB 2WB2A 3QNKA 2BQZA 2YINA 2WXRA 2RKKA 3ABME 5CMYA 1HZ4A 4GTRA 2P9LG 5JJ6A 4XI0A 1S63A 3TXNA 4EBAA 2F37A 4GZCA 4PUCA 2XS1A 4BUPA 1XGWA 2MOWA 2V8SE 3L22A 4PDXA 1UN8A 3O4ZA 3D9LA 4AJWA 2JLBA 2XRYA 5HKPA 4JA7A 3AG2E 4BETA 4DK5A 4A55A 2YHEA 5KNHD 5KCMA 4I17A 3QWWA 4HLLA 3CR3A 4LG6A 3E34A 4AV7A 3DXKG 2IOSA 2WQHA 3R9MA 3ZW3A 3S7FA 3D9IA 5JHNA 2DYSE 4J8YA 3FTYA 2GRMA 1IHBA 3ESKA 3DSVA 2JABA 2AXUA 2XQ0A 3QC1A 3D9PA 5ENOD 4A1SA 3ZPJA 3APFA 4A63B 3IHXA 2BKKB 4J8OA 3D3MA 2LSUA 3CHPA 3ZYMA 4DI3A 4HOSA 3PUKA 5G05J 3PRZA 3E30A 5JINA 3W9FA 5D2MC 4K5BA 4KBQA 5G04C 3F9WA 3M54A 3FU3A 2PM6A 3T8KA 5FQ8A 3RO3A 4DPRA 4HVBA 3I5PA 2KCLA 5CCMA 4H7XA 4K0RA 4C0MA 2DZOA 3EIQC 4GTQA 4N2SA 3VTYA 5JJ0A 2H6GA 4BT8A 5KNGA 3L16A 3FWVA 4FA6A 4FJYA 2A5UA 1MQSA 4UWFA 3JYSA 4OYSA 1SZ9A 3KEZA 5T0KA 5KJMA 3HG0D 2WXQA 3T5XA 4RG6A 1H19A 4FHKA 3ULQA 2KC7A 4G8LA 1S70B 3NF1A 3FUIA 5EX3A 3Q9NC 1UJKA 3IKOB 3TWSA 4A1GA 2WXOA 3MV3B 3TWUA 3ZHEB 3MZLB 1HX8A 3CV0A 1HO8A 2VTBB 2EIME 4WWOA 3SF4A 1SA5A 1DCEA 3ZKJA 1U2VG 4HORA 3JCKC 4WNFA 2NSZA 4HLEA 5FZSA 2JV0A 4J83A 3CVNA 2OV8A 3DXMG 1YMPA 4BSZB 3ZYQA 5ITZF 3RRNB 5CECB 3FU0A 3BEEA 4BTBA 2UY1B 4I9EA 3FH5A 2WXMA 3PNLB 3UPVA 1MX2A 1DNPA 2BF0X 4JLGA 3BUAA 5ENSD 4IYPA 1SQMA 1B89A 5H7PA 3UM1A 4OAUC 1HH8A 3EUVA 3L54A 5JJ7A 3IEGA 2AXVA 4F53A 3M56A 3TXMA 3HNAA 4O30A 2DWZA 4K03A 3EU5A 2WXHA 4E85A 4OVUA 4C48B 4ZFHA 4Q96A 1K3ZD 4AVXA 3SZ7A 2HO1A 3M5AA 4UWLA 1N54A 2H6FA 2CHWA 2CHZA 3CQCB 1JWFA 4HFGA 1KZPA 3LY7A 3UT8A 4APFA 3V30A 5FIOA 2J07A 4UI9J 5LSXA 3CHOA 4K5AB 1BU9A 4FMUA 2Y69E 1ELRA 4BWRA 1K1BA 2J49A 3UM3A 1TN6A 1E8YA 4H7YA 1MVHA 4ILHB 4HNAD 2V5QC 4RQIA 3C5RA 3SBSA 2P9KG 3OS5A 4I6GA 5CBOA 2QYJA 4J8EA 3Q78A 3MGBA 3TL5A 5T8IA 4JVSA 5KWDA 4B8AA 1XNFA 4XEIG 2X6IA 4FP7A 2VGEA 5AN8A 4URKA 1E8XA 4G24A 3DSSA 4IULA 2VGYA 2XCBA 4G2VA 2CFZA 3VTXA 3QKYA 2EIKE 4HQDA 5ENPD 3CHQA 3CVPA 2GRPB 1Z5SC 1QBQA 2KZTA 4KT6B 1KT0A 1IHGA 2V0PA 3PNTB 4N5CA 4U8YD 3CVQA 4EECA 2DYRE 4GCNA 5BUZA 2VSOE 4AY5A 2BTDA 3ABKE 3JQ0A 5LP0A 2IF4A 4CYMD 2GW1A 3FTXA 5ANRA 4LDGA 2WQ7A 3PS6A 3WG7E 4B93B 1FT1A 2XS8A 1EPUA 4J7WA 3RKVA 1NA3A 3ZUVB 1ZU2A 4X8QA 2XENA 1UW4B 4JHRA 3CVLA 3WXXA 4NQ0A 5TH7A 1SZAA 4L2LA 1N3JA 3EP0A 1UJJA 4LNUD 4YPUA 1GW6A 1EF1C 3JUEA 1A5EA 4Z4PA 1WDYA 4J8SA 2R17C 2X6JA 5T5GA 1HG2A 3DPYA 2B6CA 1H6KA 1Y6IA 4ACLA 1MZCA 1W3BA 3Q5MA 3DEOA 3NOCD 3PUJA 4JW1A 4LUNU 5JIYA 1WM5A 3CVUA 3EHRA 1HXIA 2F69A 3FTSA 5FZQA 3CEQA 4GMLA 3L17A 4W9RA 4FHJA 1WAO1 1N4RA 1NA0A 4BSXA 1QZ2A 3FP3A 4U0ZA 3CK7A 4FADA 4U07A 3DALA 1H2TC 3KEAA 2G46A 3V79K 2WMOA 4J0UA 2GGFA 1PY1A 3OTNA 5CPRB 2IO3C 3JUIA 1HG5A 4ME2A 3HVEB 4GPKA 1Z3YA 4K5CA 5TTFA 1HU3A 1LD7A 2Q7FA 4EZJA 3OXGA 3GZ2A 1TR4A 1VDYA 3TJPA 5ENQD 5EIDA 2JEKA 2FBNA 1SVXA 4MRUA 2L0IA 4GA2A 4EBAG 3OXFA 1V54E 2J8SD 5FWQA 3UKUG 3HXEA 3U66A 3M59A 4N5QA 4ANVA 3UUXA 3MA5A 5AARA 3NBNB 4M3OA 3NB2A 4YDEA 4WNEA 3Q73A 4J6IA 4LCTA 4TXQA 4L7TA 4WWNA 2AXZA 2E2EA 1QYMA 4I43A 2P9IG 3Q47B 3IBEA 3FEYA 5F6LA 3EJNA 4LSZE 1MHQA 1Z6TA 4UQXA 1EYHA 3LEWA 1OCCE 3QK0A 2ETBA 4MS6A 1YCSB 4AOFA 1DCQA 1O1SA 5FQ4A 4JDSA 5FTPA 5B1AE 1NFIE 4GTVA 1O9SA 4U0UA 1NZNA 3Q7AA 3Q49B 1QQEA 3CVXA 4F6RD 4RSYA 1V55E 3LKUA 3ZU7B 2GRRB 2I1KA 3C98A 4LRZA 4L2YA 5ENRD 4HS2A 4GTSA 2OCCE 4YNDA 4U0SA 4PH4B 2VGXB 5HI7A 2KCVA 5ENNA 3D9KA 2EINE 5FQ7A 2L6JA 2NC9A 2P58C 5G2NA 4HBDA 5E76A 1JCQA 2IFUA 5BV0A 1WY6A 4CGVA 4ACKA 4CDRA 5AQAA 4P29A 1TJFA 2XZTG 1BD8A 1D9SA 1UN9A 4DX5D 3LY9A 2BKGA 3ML9A 4XI9A 3RIBA 3ASNE 3QWVA 3B7RL 4MBGA 1TNBA 3MKRA 2YNQA 2H6IA 4GTTA 3HXDA 4I1MA 2QC9A 3ASGA 3ULYA 1IYGA 2KM4A 3F9YA 1E7UA 3F9ZA 1OCOE 2X6KA 4J7FA 2KATA 3KMTA 1JUQA 3L9TA 1NI1A 1HFAA 4I51A 3JQ1A 1KLXA 4YVOA 2Y0BG 1PAQA 2DBAA 3HIZA 4EPZA 2WXLA 4KZCA 2C2LA 1OCRE 4U96D 4E47A 2RFAA 3PZDA 3E4BA 2QZAA 3UQ3A 3Q9UC 5FZRA 3UKRG 4G23A 1PEGA 4EQFA 5E75A 1FT2A 2HM8A 4TUMA 1Z3XA 3IHVA 3CKCA 3ZRHA 3VUZA 3FUDA 3QARA 3ONKA 2R2LA 3ZVVA 1OT8A 4H12A 4ILGA 2KXPC 4LNGA 1S64A 5LSZA 5AAOA 2L9BA 2AVPA 1NP7A 3FEXA 3CSTA 4BFRA 4XKCA 4BX9A 3PREA 2GRNB 4FU3A 2IO2C 2FO7A 2XGMA 4JL0A 3NAWA 2BEDA 1FVHA 3I4GA 3MO0A 3W9GA 4G11A 3AU5A 2EILE 3DB5A 2IOLA 4GA1A 2UY1A 3ASOE 3SY2A 3PVLA 1OUVA 1ZBPA 4N3CA 4YDWA 4JEHA 3ESLA 5ANLA 3RJWA 3OAWA 1N6AA 3M58A 5J08A 3K5KA 1TN8A 2FF4A 3C3RA 2WMNA 3FUKA 4N3AA 3EU9A 2MYOA 4UWHA 3J5PA 1D8EA 3CBOA 3ASHA 5G05C 4DX1A 1MX6A 3B7BA 3D9JA 5D66A 4ANWA 3MO5A 4IRUA 3CBPA 3ZFWA 1N0QA 2ZXWE 3DSTA 1IQRA 4OVVA 3TWQA 2ILRA 3EHMA 3RSEG 4CT4A 5KJKA 4TXPA 3AAAC 3IXEA 3URZA 3GZ1A 2QFCA 3R7RA 4RZ0A 4FC8A 4ILIA 5BXOA 3LYAA 5AQBA 4C1QA 4FLBA 3CBMA 4XX5A 4N3BA 4MI5A 4AU7A 4ATZD 3DRAA 4I1OB 4GYYA 3G2TA 3FTZA 4R7LA 2IJGX 4JZYA 2RD0A 4KYOB 1N95A 4XIFA 4ATGA 2WXGA 2RG8A 1O1RA 2V4LA 3LXUX 3QB2A 2IY0C 4JD2G 3G2SA 2CG3A 2H6HA 1RZ4A 3KS2A 3CVYA 2P9SG 4N39A 3FTVA 3FHEA 4GTMA 5G55A 3IV0A 4QENA 2ONDA 3LS8A 3O48A 4NURA 2OEVA 3PE4A 2CFUA 5LCWJ 4RVBA 4HOQA 3OPEA 2YHCA 2J09A 2OEWA 4CZ2D 1LD8A 2L0TB 4GYOA 2WQ6A 4NRHB 3ZXSA 4QEOA 1SA4A 1JPLA 2FO1E 3T8MA 5FQ6A 3ZEFA 3S7DA 2HR2A 3TG4A 4YVQC 2O8JA 3LJNA 4Z68A 4UWGA 4MKTA 3UIOC 4C9BB 3TWXA 1S0PA 4GTOA 2XEVA 5AQ9A 2CG2A 1MJ0A 3FU6A 1FPPA 3MJWA 2I6HA 3U4TA 5HS0A 3U9WA 4O60A 3MYVA 5EYPF 2XRZA 2IGQA 2X6HA 3N71A 1LF8A 3APCA 3HXCA 4UI9C 3BG1B 5T3RA 4GMRA 2GRLA 3P1UA 5KJLA 2VQ2A 4TV3A 3MEKA 2XHEA 4GA0A 3TWVA 4KMOA 4DX6D 4J8DA 3HDXA 2P2CP 3UIPC 5B1BE 4WUYA 4ZHBA 1OWOA 4GYWA 2XPYA 1O1TA 3ENEA 4MLPA 3VLEA 2XEHA 2LSVA 3HVEA 2WXNA 5T4YA 2GRQB 3V2OA 4FJZA 3KD7A 4IJ8A 3UM0A 2WXJA 1HE8A 4G1TA 3SD5A 4DX2A 4TXRA 3SQVA 1QNFA 4F7AA 5ARFA 1YYHA 4YNPA 3ONLA 1PC2A 4C0EA 2F0YA 3RU0A 3S7JA 2C0LA 4CDMA 3QAQA 3D9OA 5CBNA 4YNMA 2Y3AA 5AQ7A 3CKBA 3FUFA 4J8FA 4EZLA 4I1AA 4LNBA 3FDHA 4DUIA 1EDUA 3CHSA 3LCAA 3B7TA 4I9CA 4DLOA 3AJIA 1X5BA 4HRMB 3MKQA 3PEUB 2CHXA
chains in the Genus database with same CATH topology
3SF4A 3RIBA 4B89A 4D10C 3KMJA 3CVVA 3QWVA 3B7RL 2RFIA 2OVFA 3UT7A 4HORA 3MKRA 2KCKA 2YNQA 3JCKC 3P2BA 4WNFA 1OWLA 5F6KC 5AYFA 2NSZA 4UQZA 4HLEA 5FZSA 2JV0A 3EHNA 4Q69A 3M57A 4I1MA 4J83A 3CVNA 2OV8A 4I2ZA 2Y4UA 4CGWA 2BUGA 3ASGA 1IYGA 1L5JA 2WXIA 3L6AA 2KM4A 2J4BA 3F9YA 4IN3B 3T5VA 3ZYQA 1E7UA 4GZDA 3F9ZA 3SNXA 2R59A 3RQ4A 2PQRA 3FTWA 3RRNB 3FU0A 3L13A 4LERA 2X6KA 3OXLA 4I2WA 3D9NA 3BEEA 4J7FA 3LVRE 4BTBA 4TUUA 2UY1B 3S2AA 2KATA 4I9EA 5J90A 3FH5A 3KMTA 4KXKB 1JUQA 1OWNA 2WXMA 3PNLB 3UPVA 3Q15A 5A6CA 1HFAA 1DNPA 2BF0X 4XE0A 5JJTA 3M55A 4I51A 4JLGA 4Y6CA 2LNIA 2X38A 3JQ1A 3RRUA 3GW4A 1KLXA 4IYPA 4KVOA 4YVOA 1SQMA 3SW9A 1ZKKA 2XCCA 3CHMA 5EG2A 4AY6A 1B89A 1PAQA 1HH8A 4WNDA 3FH7A 5BNWA 2KZTB 1DVPA 3L54A 2LAHA 2DBAA 3NZSA 5JJ7A 3IEGA 3HIZA 4EPZA 2WXLA 2IONA 4KZCA 2AXVA 4F53A 2C2LA 3FUMA 3TXMA 1H2UA 1MUFA 5ARGA 3HNAA 4E6HA 3M56A 4O30A 3ZGQA 4GMJA 4E47A 3MO2A 2FULA 4K03A 3ASFA 3B7SA 3MCXA 2WXHA 3E4BA 3PZDA 3UQ3A 4CDNA 4WWPA 4E85A 3CVWA 3APDA 4OVUA 3FUHA 3RK6A 3FUJA 3LY8A 4Q96A 4DJAA 3AU4A 3EDTB 5FT9A 4AVXA 4YPAA 5FZRA 3SZ7A 4B94A 4G23A 2HO1A 1PEGA 4MI0A 2XGSA 4EQFA 3M5AA 4UWLA 5F5EA 1N54A 3B13A 3B7UX 4G25A 5E75A 5BV0A 2HM8A 2CHWA 2CHZA 3CQCB 1JWFA 4HFGA 3LY7A 1Z3XA 3IHVA 3UT8A 4APFA 3ZIMA 2J07A 2YQ8A 4UI9J 3SI5A 2IQCA 2WM9A 3CKCA 5D0QD 4APOA 5LSXA 3ZRHA 3VUZA 2C0MA 3CHOA 3FUDA 3IHYA 3QARA 5LCWC 3S7BA 3ONKA 5AYWD 4QFVA 2MHKA 3TAXA 3ZVVA 4FMUA 4PS3A 4BWRA 1ELRA 2Y4TA 1H0AA 1Y8MA 1N6CA 2J49A 2AWIA 2XGOA 4H12A 4ILGA 2V5FA 1YA0A 5LSZA 3HHMA 3LVQE 2L9BA 2AVPA 3RRMB 1NP7A 1E8YA 3FEXA 4H7YA 4A3VA 1MVHA 3CSTA 4ILHB 4BFRA 2AW6A 1TJCA 4XKCA 4BX9A 3PREA 3PH0C 4FU3A 4B0ZA 4B8CB 2J9QA 2FO7A 4GZ3A 3SBSA 3CSFA 2XGMA 4AXHA 4JL0A 3OS5A 4J7IA 5C2YA 5KJNA 1FVHA 3I4GA 4I6GA 4JC8A 5G04J 3MO0A 4J8EA 3G2WA 2R3AA 3MGBA 3TL5A 4G11A 3AU5A 4JVSA 5T8IA 4B8AA 1XNFA 3DB5A 2X6IA 2IOLA 2ZU6B 3CGHA 4GA1A 4FP7A 2UY1A 5AENA 5HQ8A 3I4RB 1E8XA 2PZIA 4G24A 3UT4A 4URKA 4IULA 5F59A 2VGYA 2XCBA 1FVFA 4G2VA 3CIAA 4KZ0A 3RAYA 2CFZA 4L1BA 2IU1A 3PVLA 3VTXA 3MV2B 4KVMA 1OUVA 3QKYA 1ZBPA 4N3CA 4JEHA 3CHQA 3CVPA 3ESLA 1KT1A 3R7QA 5EKQD 5ANLA 3ML8A 2HYZA 2KZTA 4KT6B 1KT0A 1UG3A 1IHGA 3RJWA 4BTAA 3UMVA 2V0PA 3OAWA 3NZUA 3PNTB 4N5CA 3SHFA 3AS8A 4XKBA 3LDZA 1N6AA 3CVQA 3M58A 5J08A 3CK9A 1FCHA 4Q94A 3K5KA 2VSYA 4AIFA 4EECA 2FF4A 4JHJA 1ELKA 2A4ZA 4WNGA 4HOUA 2WMNA 3LPZA 4GZ5A 2VYIA 4GCNA 5BUZA 3K9IA 3FUKA 4N3AA 2VSOE 3FFLA 1ML9A 3BG0B 4AY5A 2E0IA 2BTDA 2VSNA 3JQ0A 5LP0A 2IF4A 2GW1A 3FTXA 5ANRA 4LEUA 5AJLA 4LDGA 3L08A 4UWHA 4ABNA 2WQ7A 3CBOA 3ASHA 5G05C 3PS6A 4JA9A 3BO5A 3PDNA 4BY6A 3FTUA 3GYZA 3GZSA 5C1DA 3U3WA 1EPUA 3F9XA 3D9JA 3RKVA 4UI9K 1NA3A 2WXKA 4ANWA 3MO5A 1ZU2A 1E90A 3QOUA 4JXTA 1UW4B 4JHRA 2X6FA 4IRUA 3NQPA 5EDSA 3CBPA 3CHRA 3CVLA 5AJDA 3U64A 1BPOA 3LJ3A 3ZFWA 3WXXA 4NQ0A 4A3TA 3SBTB 3UX4A 2QPWA 5TH7A 2VGXA 4FULA 3ZYKA 1IQRA 3FUEA 4OVVA 4EZKA 1SZAA 2ILRA 3MKQB 3S8PA 3EHMA 4L2LA 3VV0A 1N3JA 3EP0A 4CT4A 1UJJA 1P5QA 1HF8A 3DBSA 4HXIA 2XPZA 4TRQA 5KJKA 5LX8A 1TEZA 3EIJA 1E8ZA 3QDNA 4F1SA 4YPUA 1GW6A 3URZA 1EF1C 3GZ1A 2QFCA 3R7RA 4NJ5A 4RZ0A 2FEZA 4U63A 4Z4PA 4FC8A 3G2UA 4J8SA 2R17C 2X6JA 4ILIA 4ANUA 4CRWA 5T5GA 3AS4A 3LYAA 3ZHEA 5JHBA 4C1QA 5BW8C 2FI7A 3PEVB 4U04A 3QWPA 4FLBA 2VSXE 4XX5A 4JPSA 3CBMA 4N3BA 4MI5A 1OWPA 5FJYA 4AU7A 1HG2A 2OOEA 5EX0A 2VTBA 1H2VC 2I2OA 2PQNA 3FY4A 3Q4AB 1H6KA 4I1OB 4GYYA 2MRIA 3SFZA 3G2TA 1Y6IA 3FTZA 4R7LA 2IJGX 4JZYA 4ACLA 2DCPA 1W3BA 2RD0A 1H3IA 4KYOB 4F3VA 4XIFA 4ATGA 2WXGA 5BPPA 3Q5MA 2RG8A 4UQYA 2V4LA 2LAIA 3PUJA 3LXUX 3QB2A 4JW1A 4IJDA 2UWJG 4LUNU 3SGHA 5JIYA 4NVQA 1WM5A 3FH8A 3CVUA 3G2SA 2CG3A 1HXIA 2F69A 3FTSA 5FZQA 2NXPA 4JEUA 3CEQA 4GMLA 3L17A 5CMWA 4W9RA 4HOTA 5DBKA 2R5SA 4FHJA 1WAO1 3KS2A 1NA0A 3HYMB 4BSXA 1U3CA 1QZ2A 3FP3A 3QNKA 4U0ZA 2WB2A 3CVYA 5TEGA 2BQZA 3CK7A 4CEMA 4FADA 4N39A 3FTVA 2DIWA 3FHEA 4U07A 3DALA 2YINA 2WXRA 1H2TC 4XZ4A 2G46A 5CMYA 2WMOA 1HZ4A 4J0UA 5AIJA 5G55A 4QEPA 2GGFA 1PY1A 3IV0A 3OTNA 5CPRB 4QENA 5LOZA 4N2QA 1OWMA 2ONDA 5JJ6A 4XI0A 3TXNA 4PS8A 4EBAA 3ZYLA 4GZCA 4PUCA 3LS8A 3JUIA 1HG5A 3O48A 3I3NA 4ME2A 4NURA 4V3IA 3HVEB 4GPKA 1INZA 3PE4A 2PL2A 2CFUA 3RJVA 3KMAA 5LCWJ 2W5YA 4RVBA 4BUPA 1Z3YA 1XGWA 2PM7A 3QJZA 4HOQA 4BX8A 2MOWA 2V8SE 3L22A 3PE3A 4PDXA 5TTFA 1HU3A 3ASDA 4AP2A 1UN8A 3VLFA 3O4ZA 3D9LA 3OPEA 4AJWA 2WVIA 2YHCA 2J09A 1JWGA 2Q7FA 4EZJA 2JLBA 3OXGA 2L0TB 2XRYA 3GZ2A 1VDYA 3CK8A 3TJPA 4GYOA 2EQXA 3CLJA 2WQ6A 4NRHB 2JEKA 3ZXSA 4ANXA 4QEOA 4JA7A 3VLDA 1JPLA 3D9MA 2FBNA 3MX3A 4DK5A 2QY7A 2YHEA 4MRUA 4A55A 3T8MA 2L0IA 4GA2A 3FULA 3OXFA 4EBAG 5FQ6A 3AS5A 3ZEFA 5KCMA 4I17A 3QWWA 3S7DA 4I6JA 5FWQA 5M72A 1E7VA 3U66A 3G2VA 4O6FA 3CR3A 2HR2A 5D0OD 3TG4A 3M59A 4YVQC 4AV7A 3TGOA 2O8JA 4ANVA 3UUXA 3MA5A 4MKTA 4UWGA 4AM9A 2IOSA 3SWCA 3CQGB 4C9BB 3FU5A 2WQHA 4M3OA 1S0PA 1E8WA 2XEVA 1A17A 3FUNA 4WAFA 4WNEA 4J6IA 4LCTA 2CG2A 5A7DB 2XPIA 3S7FA 3FU6A 3ZW3A 3MJWA 1IQUA 2I6HA 3D9IA 5JHNA 4PS7A 3U4TA 4L7TA 4WWNA 3U9WA 3FTYA 3MYVA 5CHEE 1HS6A 2AXZA 2E2EA 4CT0A 2GRMA 3FPDA 3ESKA 2I9CA 4I43A 3Q47B 4GAAA 2XRZA 2X6HA 3IBEA 2IGQA 3N71A 3FEYA 1LF8A 2AXUA 2XQ0A 3APCA 1U3DA 3D9PA 3QC1A 5F6LA 4UI9C 5LFAA 3BG1B 3EJNA 5T3RA 4G26A 2GRLA 4A1SA 3ZPJA 1MHQA 3TG5A 3P1UA 5KJLA 3APFA 1Z6TA 2VQ2A 4RG9A 4UQXA 4TV3A 1EYHA 3LEWA 1N52A 3MEKA 3IHXA 2XHEA 4GA0A 4J8OA 4KMOA 3QK0A 4J8DA 3D3MA 2LSUA 2I1JA 3CHPA 3HDXA 3ZYMA 4DI3A 2WXFA 4DLQA 4HOSA 4MS6A 2W5ZA 4AOFA 4WUYA 3PUKA 2WXPA 5G05J 5FQ4A 4JDSA 1MT6A 1OWOA 3PRZA 5FTPA 5JHAA 2LO6A 4GYWA 5JINA 4KBQA 2XPYA 5T0KA 3OOIA 4GCOA 1O9SA 4U0UA 5G04C 1NZNA 3F9WA 3DPDA 3ENEA 4MLPA 3VLEA 3M54A 2LSVA 3HVEA 4U8HA 2WXNA 5T4YA 3FU3A 1MVXA 2PM6A 4JHKA 3Q49B 5FQ8A 3ZN3A 4NACA 1QQEA 3CVXA 4RSYA 3R9AB 3LKUA 5DIZA 3RO3A 4DPRA 4FJZA 3KD7A 2I1KA 3C98A 4LRZA 4L2YA 4IJ8A 4HVBA 3I5PA 3KAEA 2WXJA 2KCLA 5CCMA 4H7XA 4K0RA 1HE8A 5CCLA 4HS2A 4G1TA 4C0MA 3SD5A 5A23A 3EIQC 4N2SA 3VTYA 5JJ0A 4YNDA 3M53A 1QNFA 4F7AA 5ARFA 4U0SA 4YNPA 4BT8A 4PH4B 3L16A 3FWVA 2VGXB 4FJYA 3ONLA 4FA6A 2A5UA 1MQSA 4UWFA 1ELWA 3JYSA 1PC2A 5T0MA 5HI7A 2VJ8A 4OYSA 4C0EA 1SZ9A 2KCVA 3KEZA 3RU0A 2C0LA 5ENNA 3S7JA 4CDMA 5KJMA 3QAQA 2M63A 3D9KA 2OVBA 2WXQA 3T5XA 3D9OA 5FQ7A 4YNMA 4RG6A 1H19A 4FHKA 3RO2A 3ULQA 2L6JA 2Y3AA 2KC7A 5BV1A 4L23A 4BT9A 4CCAA 1E96B 3NF1A 3CKBA 2NC9A 3FUIA 5EX3A 4YPEA 2P58C 3FUFA 4J8FA 5G2NA 4UWKA 4FLHA 4EZLA 2WPVA 4I1AA 1UJKA 3IKOB 2X3MA 4DI4A 5E76A 2IFUA 2WXOA 1WY6A 3MV3B 3ZHEB 4Y6WA 4A1GA 4ACKA 3FDHA 4GZ6A 4CDRA 5BT1A 4CGVA 1EDUA 3CHSA 3LCAA 3MZLB 4GB9A 3B7TA 1TJFA 1HX8A 4I9CA 4I6EA 4P29A 4AEZC 3CV0A 4DLOA 1HO8A 1XQHA 1X5BA 1UN9A 2J08A 2J4DA 3LY9A 3MKQA 2VTBB 4GU5A 3PEUB 2CHXA 4WWOA 3ML9A 4XI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SF4 A;  3RIB A;  3KMJ A;  3QWV A;  2RFI A;  4HOR A;  3MKR A;  2KCK A;  4WNF A;  5F6K C;  5AYF A;  4UQZ A;  2JV0 A;  5FZS A;  3M57 A;  4J83 A;  3CVN A;  4I2Z A;  2Y4U A;  4CGW A;  2BUG A;  3ASG A;  1IYG A;  3F9Y A;  4IN3 B;  3F9Z A;  3RQ4 A;  2PQR A;  4I2W A;  3OXL A;  4J7F A;  3BEE A;  4BTB A;  2UY1 B;  2KAT A;  4I9E A;  3KMT A;  4KXK B;  3UPV A;  3Q15 A;  5A6C A;  4I51 A;  5JJT A;  4JLG A;  3M55 A;  4Y6C A;  2LNI A;  3GW4 A;  1KLX A;  4YVO A;  3SW9 A;  1ZKK A;  2XCC A;  5EG2 A;  4AY6 A;  1B89 A;  1HH8 A;  4WND A;  5BNW A;  2DBA A;  5JJ7 A;  3IEG A;  2C2L A;  3M56 A;  1MUF A;  3HNA A;  5ARG A;  4O30 A;  3ZGQ A;  4E47 A;  3MO2 A;  3ASF A;  3E4B A;  3UQ3 A;  3LY8 A;  3EDT B;  5FT9 A;  4YPA A;  5FZR A;  3SZ7 A;  4B94 A;  4G23 A;  2HO1 A;  1PEG A;  4MI0 A;  2XGS A;  4EQF A;  3M5A A;  5F5E A;  4G25 A;  3LY7 A;  2YQ8 A;  4UI9 J;  4APO A;  5LSX A;  5D0Q D;  3CKC A;  3VUZ A;  2C0M A;  5LCW C;  3S7B A;  5AYW D;  3TAX A;  2MHK A;  4FMU A;  4BWR A;  1ELR A;  2Y4T A;  1Y8M A;  1N6C A;  2XGO A;  4H12 A;  2V5F A;  1YA0 A;  5LSZ A;  2AVP A;  4H7Y A;  1MVH A;  1TJC A;  2J9Q A;  2FO7 A;  4GZ3 A;  4J7I A;  2XGM A;  3OS5 A;  4JL0 A;  5KJN A;  5G04 J;  3MO0 A;  4J8E A;  2R3A A;  1XNF A;  3DB5 A;  4GA1 A;  2UY1 A;  5HQ8 A;  2PZI A;  4G24 A;  5F59 A;  2VGY A;  2XCB A;  4G2V A;  3RAY A;  3VTX A;  3MV2 B;  1OUV A;  3QKY A;  1ZBP A;  4N3C A;  3CVP A;  1KT1 A;  5EKQ D;  2HYZ A;  1KT0 A;  1IHG A;  3RJW A;  4BTA A;  4N5C A;  3AS8 A;  1N6A A;  3CVQ A;  3M58 A;  3CK9 A;  1FCH A;  3K5K A;  2VSY A;  4AIF A;  2FF4 A;  4WNG A;  4HOU A;  3LPZ A;  4GZ5 A;  2VYI A;  4GCN A;  3K9I A;  4N3A A;  1ML9 A;  3FFL A;  4AY5 A;  2VSN A;  2IF4 A;  2GW1 A;  4LEU A;  4LDG A;  4ABN A;  3CBO A;  3ASH A;  5G05 C;  4JA9 A;  3BO5 A;  3PDN A;  3GYZ A;  5C1D A;  3U3W A;  3F9X A;  3RKV A;  4UI9 K;  1NA3 A;  3MO5 A;  1ZU2 A;  3QOU A;  4JHR A;  3CBP A;  3ZFW A;  3CVL A;  3WXX A;  4NQ0 A;  2QPW A;  5TH7 A;  2VGX A;  3S8P A;  3VV0 A;  1N3J A;  3EP0 A;  1P5Q A;  5KJK A;  3QDN A;  4YPU A;  3URZ A;  3GZ1 A;  2QFC A;  4RZ0 A;  4NJ5 A;  2FEZ A;  4Z4P A;  5T5G A;  3AS4 A;  3LYA A;  3ZHE A;  4C1Q A;  5BW8 C;  2FI7 A;  4U04 A;  3QWP A;  3CBM A;  4N3B A;  4MI5 A;  5FJY A;  4AU7 A;  2OOE A;  5EX0 A;  2PQN A;  3Q4A B;  4GYY A;  1H3I A;  1W3B A;  4KYO B;  4F3V A;  4XIF A;  3Q5M A;  4UQY A;  4IJD A;  2UWJ G;  5JIY A;  4NVQ A;  1WM5 A;  1HXI A;  2F69 A;  5FZQ A;  3CEQ A;  4HOT A;  4W9R A;  5DBK A;  2R5S A;  1WAO 1;  3KS2 A;  1NA0 A;  3HYM B;  1QZ2 A;  3FP3 A;  4U0Z A;  5TEG A;  2BQZ A;  3CK7 A;  4N39 A;  4U07 A;  3DAL A;  2G46 A;  1HZ4 A;  4J0U A;  4QEP A;  4QEN A;  5CPR B;  4N2Q A;  2OND A;  5JJ6 A;  4XI0 A;  3O48 A;  4ME2 A;  4GPK A;  3PE4 A;  2PL2 A;  3RJV A;  3KMA A;  5LCW J;  2W5Y A;  4BUP A;  4HOQ A;  3PE3 A;  5TTF A;  3ASD A;  3OPE A;  2YHC A;  2Q7F A;  2JLB A;  3OXG A;  3GZ2 A;  3CK8 A;  4GYO A;  4NRH B;  4QEO A;  4JA7 A;  2FBN A;  4GA2 A;  3OXF A;  3AS5 A;  3S7D A;  4I17 A;  3QWW A;  5M72 A;  4O6F A;  2HR2 A;  5D0O D;  3TG4 A;  3M59 A;  4YVQ C;  3TGO A;  2O8J A;  3UUX A;  3MA5 A;  4AM9 A;  3SWC A;  2WQH A;  2XEV A;  1A17 A;  4WNE A;  5A7D B;  2XPI A;  3S7F A;  2I6H A;  5JHN A;  3U4T A;  3FPD A;  5CHE E;  2E2E A;  3ESK A;  3Q47 B;  2IGQ A;  3N71 A;  5F6L A;  4UI9 C;  4G26 A;  4A1S A;  3ZPJ A;  3TG5 A;  5KJL A;  2VQ2 A;  4RG9 A;  4UQX A;  3MEK A;  3IHX A;  4GA0 A;  4J8O A;  4J8D A;  2LSU A;  4HOS A;  2W5Z A;  4WUY A;  5G05 J;  4JDS A;  1MT6 A;  5FTP A;  4GYW A;  5JIN A;  4KBQ A;  3OOI A;  4GCO A;  1O9S A;  4U0U A;  5G04 C;  1NZN A;  3F9W A;  3M54 A;  2LSV A;  1MVX A;  3ZN3 A;  3Q49 B;  1QQE A;  3R9A B;  3LKU A;  5DIZ A;  3RO3 A;  3KD7 A;  4IJ8 A;  3KAE A;  2KCL A;  5CCM A;  4H7X A;  5CCL A;  4G1T A;  4N2S A;  3VTY A;  5JJ0 A;  4YND A;  3M53 A;  5ARF A;  4U0S A;  4YNP A;  4BT8 A;  3FWV A;  2VGX B;  1ELW A;  3JYS A;  1PC2 A;  5T0M A;  5HI7 A;  5T0K A;  2KCV A;  3RU0 A;  3S7J A;  2C0L A;  5KJM A;  4YNM A;  4RG6 A;  3RO2 A;  3ULQ A;  2L6J A;  2KC7 A;  4BT9 A;  1E96 B;  3NF1 A;  5EX3 A;  3CKB A;  2NC9 A;  4YPE A;  2P58 C;  4J8F A;  2WPV A;  4I1A A;  2IFU A;  3MV3 B;  3ZHE B;  4CGV A;  4Y6W A;  5BT1 A;  4CDR A;  4GZ6 A;  3LCA A;  4I9C A;  3CV0 A;  1XQH A;  3LY9 A;  4XI9 A; 
#chains in the Genus database with same CATH topology
 2ZGG A;  4F1P A;  5CER B;  3UT7 A;  4O1P A;  4I2Z A;  2Y4U A;  4CGW A;  2BUG A;  1N4P A;  1L5J A;  2WXI A;  3L6A A;  2J4B A;  1NL4 A;  4GZD A;  5EYL A;  3SNX A;  1BLX B;  4LER A;  4I2W A;  3C3Q A;  3S2A A;  4KXK B;  1OWN A;  2RFM A;  2P9N G;  3Q15 A;  4XE0 A;  3HRA A;  4Y6C A;  2LNI A;  4HI9 A;  3RRU A;  3ZXP A;  3Q75 A;  3SW9 A;  1ZKK A;  2XCC A;  3DSW A;  3CHM A;  1IKN D;  1BI7 B;  1OCZ E;  5BNW A;  1DVP A;  2LAH A;  3UM2 A;  3HXB A;  2ION A;  3FUM A;  1MUF A;  3MO2 A;  2FUL A;  3ASF A;  3B7S A;  2KBX A;  4WWP A;  3APD A;  3FUH A;  3FUJ A;  3DSU A;  2ZIS A;  3AU4 A;  4DJA A;  2ZIR A;  3EDT B;  5FT9 A;  4YPA A;  1Q2Z A;  3TWW A;  2XGS A;  2R02 A;  5F5E A;  3B7U X;  4G25 A;  3ZIM A;  2YQ8 A;  2IQC A;  5D0Q D;  2C0M A;  3S7B A;  5AYW D;  1N6C A;  1H0A A;  1Y8M A;  4DRX E;  1YA0 A;  3E37 A;  4A3V A;  4GTP A;  4BES A;  2F8X K;  3PH0 C;  4B0Z A;  4B8C B;  3C3O A;  1KZO A;  3J5Q B;  5C2Y A;  5G04 J;  4JC8 A;  2R3A A;  4NIK A;  4HI8 A;  2ZU6 B;  5CRU A;  3CGH A;  3ISM C;  1OXJ A;  5HQ8 A;  3UT4 A;  4KZ0 A;  3CIA A;  4L1B A;  2IU1 A;  3KSL A;  4JB8 P;  1WG0 A;  5B3S E;  3R7Q A;  5EKQ D;  3ML8 A;  2HYZ A;  1AP7 A;  3UMV A;  2R05 A;  4XKB A;  1N4S A;  3LDZ A;  4L9P A;  4Q94 A;  2VSY A;  4JHJ A;  1ELK A;  2A4Z A;  4WNG A;  4HOU A;  4HB5 A;  3K9I A;  1ML9 A;  3FFL A;  3BG0 B;  2R03 A;  3BU8 A;  4LEU A;  5AJL A;  1TNY A;  3UIN C;  4ABN A;  3PZ1 A;  3Q79 A;  3BO5 A;  3PDN A;  3FTU A;  1IXV A;  5C1D A;  3DWL G;  3F9X A;  4HRL A;  1E90 A;  2X6F A;  1N9A A;  5EDS A;  3CHR A;  3U64 A;  1BPO A;  3LJ3 A;  2ETA A;  3SBT B;  3UX4 A;  3FUE A;  4EZK A;  3S8P A;  2AJA A;  2ETC A;  1P5Q A;  3DBS A;  5LX8 A;  2XPZ A;  4TRQ A;  1TEZ A;  1N11 A;  3QDN A;  1E8Z A;  4F1S A;  2FEZ A;  3AS4 A;  3ZHE A;  5JHB A;  4U04 A;  2VSX E;  4HRN A;  4JPS A;  1OWP A;  5FJY A;  1N94 A;  2OOE A;  2VTB A;  2I2O A;  3FY4 A;  3SFZ A;  1H3I A;  3JXI A;  4IJD A;  2LAI A;  1D8D A;  1RW2 A;  2NXP A;  5CMW A;  1U3C A;  3EHQ A;  3V31 A;  5TEG A;  4CEM A;  2DIW A;  4XZ4 A;  5AIJ A;  4QEP A;  5LOZ A;  4N2Q A;  1OWM A;  4PS8 A;  3ZYL A;  3UXG A;  3I3N A;  4V3I A;  3TWR A;  1INZ A;  2PL2 A;  2PNN A;  3RJV A;  3KMA A;  2W5Y A;  2PM7 A;  3QJZ A;  3TWT A;  4BX8 A;  3PE3 A;  3ASD A;  4AP2 A;  3VLF A;  2WVI A;  1JWG A;  3CK8 A;  2EQX A;  3CLJ A;  4ANX A;  3VLD A;  3D9M A;  3MX3 A;  2QY7 A;  3FUL A;  3AS5 A;  5M72 A;  4I6J A;  1E7V A;  3G2V A;  4O6F A;  5D0O D;  3ABL E;  3TGO A;  4AM9 A;  3SWC A;  4U7E B;  3CQG B;  1TNO A;  3FU5 A;  5EN5 D;  1E8W A;  1A17 A;  1O5M A;  3FUN A;  4WAF A;  5A7D B;  2XPI A;  1IQU A;  4PS7 A;  1N4Q A;  2EIJ E;  3FPD A;  5CHE E;  1HS6 A;  4QQI A;  3D9H A;  4CT0 A;  2I9C A;  4GAA A;  1U3D A;  4EHM A;  5LFA A;  4G26 A;  3C72 A;  3TG5 A;  3UI2 A;  4RG9 A;  2IEJ A;  1N52 A;  4U8V D;  4DLQ A;  2I1J A;  1UOH A;  2LXL A;  3E33 A;  2WXF A;  2A5E A;  2W5Z A;  3ULE G;  2WXP A;  1MT6 A;  5JHA A;  2LO6 A;  1K1A A;  2HE0 A;  3OOI A;  1MYO A;  4GCO A;  3DPD A;  1ZB1 A;  4U8H A;  3V2X A;  1MVX A;  4JHK A;  3ZN3 A;  4NAC A;  3R9A B;  2NYJ A;  5DIZ A;  5FIN A;  3AG1 E;  3KAE A;  5ENT D;  2P9U G;  5CCL A;  5A23 A;  3M53 A;  1H6O A;  1DC2 A;  3PZ3 A;  1ELW A;  5T0M A;  2VJ8 A;  1H6P A;  3SFY A;  5HRY A;  4OAV B;  4O1O A;  2M63 A;  2OVB A;  1SW6 A;  3AG3 E;  3RO2 A;  5BV1 A;  4L23 A;  4BT9 A;  4CCA A;  1E96 B;  5CED B;  4YPE A;  4UWK A;  4FLH A;  2WPV A;  4UUC A;  1N0R A;  2DVW A;  2X3M A;  4DI4 A;  4Y6W A;  5BT1 A;  4GZ6 A;  4GB9 A;  4I6E A;  4AEZ C;  3RAU A;  1XQH A;  2J08 A;  2J4D A;  4GU5 A;  1TNZ A;  2V4H C;  4B89 A;  4D10 C;  3KMJ A;  3CVV A;  2RFI A;  2OVF A;  2KCK A;  3P2B A;  1OWL A;  5F6K C;  5AYF A;  4UQZ A;  3EHN A;  4Q69 A;  3M57 A;  2QYU A;  2Y1L E;  4IN3 B;  3T5V A;  2R59 A;  3RQ4 A;  2PQR A;  3NOG D;  3FTW A;  1G3N B;  3L13 A;  3OXL A;  3D9N A;  3LVR E;  1K8K G;  4TUU A;  5J90 A;  1MX4 A;  5A6C A;  5JJT A;  3M55 A;  2X38 A;  2F8Y A;  3GW4 A;  4KVO A;  5EG2 A;  4AY6 A;  4WND A;  3FH7 A;  3KSQ A;  2KZT B;  3NZS A;  3T9K A;  3ZNG A;  1H2U A;  5ARG A;  4RLY A;  4E6H A;  3ZGQ A;  4GMJ A;  3MCX A;  4CDN A;  3CVW A;  1LTX A;  3AG4 E;  3RK6 A;  3SO8 A;  3LY8 A;  4B94 A;  3L82 A;  4MI0 A;  2DZN A;  3B13 A;  4APO A;  3SI5 A;  2WM9 A;  2P9P G;  3IHY A;  5LCW C;  4QFV A;  2MHK A;  3TAX A;  4PS3 A;  2Y4T A;  3F6Q A;  3DEP A;  2AWI A;  2XGO A;  2V5F A;  3HHM A;  4U95 D;  3LVQ E;  3RRM B;  2LXM A;  2AW6 A;  1TJC A;  2J9Q A;  4GZ3 A;  3CSF A;  4AXH A;  3X2Q E;  4J7I A;  5KJN A;  3G2W A;  2GRO B;  5CRV A;  1JCS A;  5AEN A;  1JCR A;  3I4R B;  2PZI A;  3B95 A;  5F59 A;  1FVF A;  3RAY A;  3HXF A;  3MV2 B;  3DSX A;  4KVM A;  1KT1 A;  1UG3 A;  4BTA A;  3NZU A;  3SHF A;  2XEE A;  3AS8 A;  3CK9 A;  3Q7F A;  1FCH A;  4AIF A;  1X81 A;  3LPZ A;  4GZ5 A;  2VYI A;  5BXU A;  5EIL A;  2ZGD A;  2E0I A;  2VSN A;  2LUH A;  3L08 A;  2L6B A;  3E32 A;  4JA9 A;  5KBA A;  4BY6 A;  3GYZ A;  3GZS A;  4G8K A;  3U3W A;  4UI9 K;  2WXK A;  3QOU A;  4JXT A;  4BER A;  5JA4 D;  3BQO A;  3NQP A;  1TN7 A;  5AJD A;  4A3T A;  3PZ2 A;  2QPW A;  2VGX A;  4FUL A;  3ZYK A;  4DX7 D;  3MKQ B;  5EIB E;  3VV0 A;  1HF8 A;  3JXJ A;  4HXI A;  5IY5 E;  3EIJ A;  4GPM A;  4YDY A;  4NJ5 A;  5CEA A;  4U63 A;  4M7C A;  3G2U A;  4ANU A;  4CRW A;  3PZ4 A;  5BW8 C;  2FI7 A;  1AWC B;  3PEV B;  3QWP A;  5JMN D;  1OY3 D;  5EX0 A;  1BI8 B;  1H2V C;  2PQN A;  3Q4A B;  2MRI A;  1TNU A;  2DCP A;  1TYQ G;  3UTM A;  2XZD G;  4F3V A;  5BPP A;  4UQY A;  4BEP A;  2UWJ G;  3SFX A;  3SGH A;  4NVQ A;  2B0O E;  3FH8 A;  1KPS B;  4YDO A;  4JEU A;  4HOT A;  5DBK A;  2R5S A;  3HYM B;  2WB2 A;  3QNK A;  2BQZ A;  2YIN A;  2WXR A;  2RKK A;  3ABM E;  5CMY A;  1HZ4 A;  4GTR A;  2P9L G;  5JJ6 A;  4XI0 A;  1S63 A;  3TXN A;  4EBA A;  2F37 A;  4GZC A;  4PUC A;  2XS1 A;  4BUP A;  1XGW A;  2MOW A;  2V8S E;  3L22 A;  4PDX A;  1UN8 A;  3O4Z A;  3D9L A;  4AJW A;  2JLB A;  2XRY A;  5HKP A;  4JA7 A;  3AG2 E;  4BET A;  4DK5 A;  4A55 A;  2YHE A;  5KNH D;  5KCM A;  4I17 A;  3QWW A;  4HLL A;  3CR3 A;  4LG6 A;  3E34 A;  4AV7 A;  3DXK G;  2IOS A;  2WQH A;  3R9M A;  3ZW3 A;  3S7F A;  3D9I A;  5JHN A;  2DYS E;  4J8Y A;  3FTY A;  2GRM A;  1IHB A;  3ESK A;  3DSV A;  2JAB A;  2AXU A;  2XQ0 A;  3QC1 A;  3D9P A;  5ENO D;  4A1S A;  3ZPJ A;  3APF A;  4A63 B;  3IHX A;  2BKK B;  4J8O A;  3D3M A;  2LSU A;  3CHP A;  3ZYM A;  4DI3 A;  4HOS A;  3PUK A;  5G05 J;  3PRZ A;  3E30 A;  5JIN A;  3W9F A;  5D2M C;  4K5B A;  4KBQ A;  5G04 C;  3F9W A;  3M54 A;  3FU3 A;  2PM6 A;  3T8K A;  5FQ8 A;  3RO3 A;  4DPR A;  4HVB A;  3I5P A;  2KCL A;  5CCM A;  4H7X A;  4K0R A;  4C0M A;  2DZO A;  3EIQ C;  4GTQ A;  4N2S A;  3VTY A;  5JJ0 A;  2H6G A;  4BT8 A;  5KNG A;  3L16 A;  3FWV A;  4FA6 A;  4FJY A;  2A5U A;  1MQS A;  4UWF A;  3JYS A;  4OYS A;  1SZ9 A;  3KEZ A;  5T0K A;  5KJM A;  3HG0 D;  2WXQ A;  3T5X A;  4RG6 A;  1H19 A;  4FHK A;  3ULQ A;  2KC7 A;  4G8L A;  1S70 B;  3NF1 A;  3FUI A;  5EX3 A;  3Q9N C;  1UJK A;  3IKO B;  3TWS A;  4A1G A;  2WXO A;  3MV3 B;  3TWU A;  3ZHE B;  3MZL B;  1HX8 A;  3CV0 A;  1HO8 A;  2VTB B;  2EIM E;  4WWO A;  3SF4 A;  1SA5 A;  1DCE A;  3ZKJ A;  1U2V G;  4HOR A;  3JCK C;  4WNF A;  2NSZ A;  4HLE A;  5FZS A;  2JV0 A;  4J83 A;  3CVN A;  2OV8 A;  3DXM G;  1YMP A;  4BSZ B;  3ZYQ A;  5ITZ F;  3RRN B;  5CEC B;  3FU0 A;  3BEE A;  4BTB A;  2UY1 B;  4I9E A;  3FH5 A;  2WXM A;  3PNL B;  3UPV A;  1MX2 A;  1DNP A;  2BF0 X;  4JLG A;  3BUA A;  5ENS D;  4IYP A;  1SQM A;  1B89 A;  5H7P A;  3UM1 A;  4OAU C;  1HH8 A;  3EUV A;  3L54 A;  5JJ7 A;  3IEG A;  2AXV A;  4F53 A;  3M56 A;  3TXM A;  3HNA A;  4O30 A;  2DWZ A;  4K03 A;  3EU5 A;  2WXH A;  4E85 A;  4OVU A;  4C48 B;  4ZFH A;  4Q96 A;  1K3Z D;  4AVX A;  3SZ7 A;  2HO1 A;  3M5A A;  4UWL A;  1N54 A;  2H6F A;  2CHW A;  2CHZ A;  3CQC B;  1JWF A;  4HFG A;  1KZP A;  3LY7 A;  3UT8 A;  4APF A;  3V30 A;  5FIO A;  2J07 A;  4UI9 J;  5LSX A;  3CHO A;  4K5A B;  1BU9 A;  4FMU A;  2Y69 E;  1ELR A;  4BWR A;  1K1B A;  2J49 A;  3UM3 A;  1TN6 A;  1E8Y A;  4H7Y A;  1MVH A;  4ILH B;  4HNA D;  2V5Q C;  4RQI A;  3C5R A;  3SBS A;  2P9K G;  3OS5 A;  4I6G A;  5CBO A;  2QYJ A;  4J8E A;  3Q78 A;  3MGB A;  3TL5 A;  5T8I A;  4JVS A;  5KWD A;  4B8A A;  1XNF A;  4XEI G;  2X6I A;  4FP7 A;  2VGE A;  5AN8 A;  4URK A;  1E8X A;  4G24 A;  3DSS A;  4IUL A;  2VGY A;  2XCB A;  4G2V A;  2CFZ A;  3VTX A;  3QKY A;  2EIK E;  4HQD A;  5ENP D;  3CHQ A;  3CVP A;  2GRP B;  1Z5S C;  1QBQ A;  2KZT A;  4KT6 B;  1KT0 A;  1IHG A;  2V0P A;  3PNT B;  4N5C A;  4U8Y D;  3CVQ A;  4EEC A;  2DYR E;  4GCN A;  5BUZ A;  2VSO E;  4AY5 A;  2BTD A;  3ABK E;  3JQ0 A;  5LP0 A;  2IF4 A;  4CYM D;  2GW1 A;  3FTX A;  5ANR A;  4LDG A;  2WQ7 A;  3PS6 A;  3WG7 E;  4B93 B;  1FT1 A;  2XS8 A;  1EPU A;  4J7W A;  3RKV A;  1NA3 A;  3ZUV B;  1ZU2 A;  4X8Q A;  2XEN A;  1UW4 B;  4JHR A;  3CVL A;  3WXX A;  4NQ0 A;  5TH7 A;  1SZA A;  4L2L A;  1N3J A;  3EP0 A;  1UJJ A;  4LNU D;  4YPU A;  1GW6 A;  1EF1 C;  3JUE A;  1A5E A;  4Z4P A;  1WDY A;  4J8S A;  2R17 C;  2X6J A;  5T5G A;  1HG2 A;  3DPY A;  2B6C A;  1H6K A;  1Y6I A;  4ACL A;  1MZC A;  1W3B A;  3Q5M A;  3DEO A;  3NOC D;  3PUJ A;  4JW1 A;  4LUN U;  5JIY A;  1WM5 A;  3CVU A;  3EHR A;  1HXI A;  2F69 A;  3FTS A;  5FZQ A;  3CEQ A;  4GML A;  3L17 A;  4W9R A;  4FHJ A;  1WAO 1;  1N4R A;  1NA0 A;  4BSX A;  1QZ2 A;  3FP3 A;  4U0Z A;  3CK7 A;  4FAD A;  4U07 A;  3DAL A;  1H2T C;  3KEA A;  2G46 A;  3V79 K;  2WMO A;  4J0U A;  2GGF A;  1PY1 A;  3OTN A;  5CPR B;  2IO3 C;  3JUI A;  1HG5 A;  4ME2 A;  3HVE B;  4GPK A;  1Z3Y A;  4K5C A;  5TTF A;  1HU3 A;  1LD7 A;  2Q7F A;  4EZJ A;  3OXG A;  3GZ2 A;  1TR4 A;  1VDY A;  3TJP A;  5ENQ D;  5EID A;  2JEK A;  2FBN A;  1SVX A;  4MRU A;  2L0I A;  4GA2 A;  4EBA G;  3OXF A;  1V54 E;  2J8S D;  5FWQ A;  3UKU G;  3HXE A;  3U66 A;  3M59 A;  4N5Q A;  4ANV A;  3UUX A;  3MA5 A;  5AAR A;  3NBN B;  4M3O A;  3NB2 A;  4YDE A;  4WNE A;  3Q73 A;  4J6I A;  4LCT A;  4TXQ A;  4L7T A;  4WWN A;  2AXZ A;  2E2E A;  1QYM A;  4I43 A;  2P9I G;  3Q47 B;  3IBE A;  3FEY A;  5F6L A;  3EJN A;  4LSZ E;  1MHQ A;  1Z6T A;  4UQX A;  1EYH A;  3LEW A;  1OCC E;  3QK0 A;  2ETB A;  4MS6 A;  1YCS B;  4AOF A;  1DCQ A;  1O1S A;  5FQ4 A;  4JDS A;  5FTP A;  5B1A E;  1NFI E;  4GTV A;  1O9S A;  4U0U A;  1NZN A;  3Q7A A;  3Q49 B;  1QQE A;  3CVX A;  4F6R D;  4RSY A;  1V55 E;  3LKU A;  3ZU7 B;  2GRR B;  2I1K A;  3C98 A;  4LRZ A;  4L2Y A;  5ENR D;  4HS2 A;  4GTS A;  2OCC E;  4YND A;  4U0S A;  4PH4 B;  2VGX B;  5HI7 A;  2KCV A;  5ENN A;  3D9K A;  2EIN E;  5FQ7 A;  2L6J A;  2NC9 A;  2P58 C;  5G2N A;  4HBD A;  5E76 A;  1JCQ A;  2IFU A;  5BV0 A;  1WY6 A;  4CGV A;  4ACK A;  4CDR A;  5AQA A;  4P29 A;  1TJF A;  2XZT G;  1BD8 A;  1D9S A;  1UN9 A;  4DX5 D;  3LY9 A;  2BKG A;  3ML9 A;  4XI9 A;  3RIB A;  3ASN E;  3QWV A;  3B7R L;  4MBG A;  1TNB A;  3MKR A;  2YNQ A;  2H6I A;  4GTT A;  3HXD A;  4I1M A;  2QC9 A;  3ASG A;  3ULY A;  1IYG A;  2KM4 A;  3F9Y A;  1E7U A;  3F9Z A;  1OCO E;  2X6K A;  4J7F A;  2KAT A;  3KMT A;  1JUQ A;  3L9T A;  1NI1 A;  1HFA A;  4I51 A;  3JQ1 A;  1KLX A;  4YVO A;  2Y0B G;  1PAQ A;  2DBA A;  3HIZ A;  4EPZ A;  2WXL A;  4KZC A;  2C2L A;  1OCR E;  4U96 D;  4E47 A;  2RFA A;  3PZD A;  3E4B A;  2QZA A;  3UQ3 A;  3Q9U C;  5FZR A;  3UKR G;  4G23 A;  1PEG A;  4EQF A;  5E75 A;  1FT2 A;  2HM8 A;  4TUM A;  1Z3X A;  3IHV A;  3CKC A;  3ZRH A;  3VUZ A;  3FUD A;  3QAR A;  3ONK A;  2R2L A;  3ZVV A;  1OT8 A;  4H12 A;  4ILG A;  2KXP C;  4LNG A;  1S64 A;  5LSZ A;  5AAO A;  2L9B A;  2AVP A;  1NP7 A;  3FEX A;  3CST A;  4BFR A;  4XKC A;  4BX9 A;  3PRE A;  2GRN B;  4FU3 A;  2IO2 C;  2FO7 A;  2XGM A;  4JL0 A;  3NAW A;  2BED A;  1FVH A;  3I4G A;  3MO0 A;  3W9G A;  4G11 A;  3AU5 A;  2EIL E;  3DB5 A;  2IOL A;  4GA1 A;  2UY1 A;  3ASO E;  3SY2 A;  3PVL A;  1OUV A;  1ZBP A;  4N3C A;  4YDW A;  4JEH A;  3ESL A;  5ANL A;  3RJW A;  3OAW A;  1N6A A;  3M58 A;  5J08 A;  3K5K A;  1TN8 A;  2FF4 A;  3C3R A;  2WMN A;  3FUK A;  4N3A A;  3EU9 A;  2MYO A;  4UWH A;  3J5P A;  1D8E A;  3CBO A;  3ASH A;  5G05 C;  4DX1 A;  1MX6 A;  3B7B A;  3D9J A;  5D66 A;  4ANW A;  3MO5 A;  4IRU A;  3CBP A;  3ZFW A;  1N0Q A;  2ZXW E;  3DST A;  1IQR A;  4OVV A;  3TWQ A;  2ILR A;  3EHM A;  3RSE G;  4CT4 A;  5KJK A;  4TXP A;  3AAA C;  3IXE A;  3URZ A;  3GZ1 A;  2QFC A;  3R7R A;  4RZ0 A;  4FC8 A;  4ILI A;  5BXO A;  3LYA A;  5AQB A;  4C1Q A;  4FLB A;  3CBM A;  4XX5 A;  4N3B A;  4MI5 A;  4AU7 A;  4ATZ D;  3DRA A;  4I1O B;  4GYY A;  3G2T A;  3FTZ A;  4R7L A;  2IJG X;  4JZY A;  2RD0 A;  4KYO B;  1N95 A;  4XIF A;  4ATG A;  2WXG A;  2RG8 A;  1O1R A;  2V4L A;  3LXU X;  3QB2 A;  2IY0 C;  4JD2 G;  3G2S A;  2CG3 A;  2H6H A;  1RZ4 A;  3KS2 A;  3CVY A;  2P9S G;  4N39 A;  3FTV A;  3FHE A;  4GTM A;  5G55 A;  3IV0 A;  4QEN A;  2OND A;  3LS8 A;  3O48 A;  4NUR A;  2OEV A;  3PE4 A;  2CFU A;  5LCW J;  4RVB A;  4HOQ A;  3OPE A;  2YHC A;  2J09 A;  2OEW A;  4CZ2 D;  1LD8 A;  2L0T B;  4GYO A;  2WQ6 A;  4NRH B;  3ZXS A;  4QEO A;  1SA4 A;  1JPL A;  2FO1 E;  3T8M A;  5FQ6 A;  3ZEF A;  3S7D A;  2HR2 A;  3TG4 A;  4YVQ C;  2O8J A;  3LJN A;  4Z68 A;  4UWG A;  4MKT A;  3UIO C;  4C9B B;  3TWX A;  1S0P A;  4GTO A;  2XEV A;  5AQ9 A;  2CG2 A;  1MJ0 A;  3FU6 A;  1FPP A;  3MJW A;  2I6H A;  3U4T A;  5HS0 A;  3U9W A;  4O60 A;  3MYV A;  5EYP F;  2XRZ A;  2IGQ A;  2X6H A;  3N71 A;  1LF8 A;  3APC A;  3HXC A;  4UI9 C;  3BG1 B;  5T3R A;  4GMR A;  2GRL A;  3P1U A;  5KJL A;  2VQ2 A;  4TV3 A;  3MEK A;  2XHE A;  4GA0 A;  3TWV A;  4KMO A;  4DX6 D;  4J8D A;  3HDX A;  2P2C P;  3UIP C;  5B1B E;  4WUY A;  4ZHB A;  1OWO A;  4GYW A;  2XPY A;  1O1T A;  3ENE A;  4MLP A;  3VLE A;  2XEH A;  2LSV A;  3HVE A;  2WXN A;  5T4Y A;  2GRQ B;  3V2O A;  4FJZ A;  3KD7 A;  4IJ8 A;  3UM0 A;  2WXJ A;  1HE8 A;  4G1T A;  3SD5 A;  4DX2 A;  4TXR A;  3SQV A;  1QNF A;  4F7A A;  5ARF A;  1YYH A;  4YNP A;  3ONL A;  1PC2 A;  4C0E A;  2F0Y A;  3RU0 A;  3S7J A;  2C0L A;  4CDM A;  3QAQ A;  3D9O A;  5CBN A;  4YNM A;  2Y3A A;  5AQ7 A;  3CKB A;  3FUF A;  4J8F A;  4EZL A;  4I1A A;  4LNB A;  3FDH A;  4DUI A;  1EDU A;  3CHS A;  3LCA A;  3B7T A;  4I9C A;  4DLO A;  3AJI A;  1X5B A;  4HRM B;  3MKQ A;  3PEU B;  2CHX A; 
#chains in the Genus database with same CATH homology
 3SF4 A;  3RIB A;  4B89 A;  4D10 C;  3KMJ A;  3CVV A;  3QWV A;  3B7R L;  2RFI A;  2OVF A;  3UT7 A;  4HOR A;  3MKR A;  2KCK A;  2YNQ A;  3JCK C;  3P2B A;  4WNF A;  1OWL A;  5F6K C;  5AYF A;  2NSZ A;  4UQZ A;  4HLE A;  5FZS A;  2JV0 A;  3EHN A;  4Q69 A;  3M57 A;  4I1M A;  4J83 A;  3CVN A;  2OV8 A;  4I2Z A;  2Y4U A;  4CGW A;  2BUG A;  3ASG A;  1IYG A;  1L5J A;  2WXI A;  3L6A A;  2KM4 A;  2J4B A;  3F9Y A;  4IN3 B;  3T5V A;  3ZYQ A;  1E7U A;  4GZD A;  3F9Z A;  3SNX A;  2R59 A;  3RQ4 A;  2PQR A;  3FTW A;  3RRN B;  3FU0 A;  3L13 A;  4LER A;  2X6K A;  3OXL A;  4I2W A;  3D9N A;  3BEE A;  4J7F A;  3LVR E;  4BTB A;  4TUU A;  2UY1 B;  3S2A A;  2KAT A;  4I9E A;  5J90 A;  3FH5 A;  3KMT A;  4KXK B;  1JUQ A;  1OWN A;  2WXM A;  3PNL B;  3UPV A;  3Q15 A;  5A6C A;  1HFA A;  1DNP A;  2BF0 X;  4XE0 A;  5JJT A;  3M55 A;  4I51 A;  4JLG A;  4Y6C A;  2LNI A;  2X38 A;  3JQ1 A;  3RRU A;  3GW4 A;  1KLX A;  4IYP A;  4KVO A;  4YVO A;  1SQM A;  3SW9 A;  1ZKK A;  2XCC A;  3CHM A;  5EG2 A;  4AY6 A;  1B89 A;  1PAQ A;  1HH8 A;  4WND A;  3FH7 A;  5BNW A;  2KZT B;  1DVP A;  3L54 A;  2LAH A;  2DBA A;  3NZS A;  5JJ7 A;  3IEG A;  3HIZ A;  4EPZ A;  2WXL A;  2ION A;  4KZC A;  2AXV A;  4F53 A;  2C2L A;  3FUM A;  3TXM A;  1H2U A;  1MUF A;  5ARG A;  3HNA A;  4E6H A;  3M56 A;  4O30 A;  3ZGQ A;  4GMJ A;  4E47 A;  3MO2 A;  2FUL A;  4K03 A;  3ASF A;  3B7S A;  3MCX A;  2WXH A;  3E4B A;  3PZD A;  3UQ3 A;  4CDN A;  4WWP A;  4E85 A;  3CVW A;  3APD A;  4OVU A;  3FUH A;  3RK6 A;  3FUJ A;  3LY8 A;  4Q96 A;  4DJA A;  3AU4 A;  3EDT B;  5FT9 A;  4AVX A;  4YPA A;  5FZR A;  3SZ7 A;  4B94 A;  4G23 A;  2HO1 A;  1PEG A;  4MI0 A;  2XGS A;  4EQF A;  3M5A A;  4UWL A;  5F5E A;  1N54 A;  3B13 A;  3B7U X;  4G25 A;  5E75 A;  5BV0 A;  2HM8 A;  2CHW A;  2CHZ A;  3CQC B;  1JWF A;  4HFG A;  3LY7 A;  1Z3X A;  3IHV A;  3UT8 A;  4APF A;  3ZIM A;  2J07 A;  2YQ8 A;  4UI9 J;  3SI5 A;  2IQC A;  2WM9 A;  3CKC A;  5D0Q D;  4APO A;  5LSX A;  3ZRH A;  3VUZ A;  2C0M A;  3CHO A;  3FUD A;  3IHY A;  3QAR A;  5LCW C;  3S7B A;  3ONK A;  5AYW D;  4QFV A;  2MHK A;  3TAX A;  3ZVV A;  4FMU A;  4PS3 A;  4BWR A;  1ELR A;  2Y4T A;  1H0A A;  1Y8M A;  1N6C A;  2J49 A;  2AWI A;  2XGO A;  4H12 A;  4ILG A;  2V5F A;  1YA0 A;  5LSZ A;  3HHM A;  3LVQ E;  2L9B A;  2AVP A;  3RRM B;  1NP7 A;  1E8Y A;  3FEX A;  4H7Y A;  4A3V A;  1MVH A;  3CST A;  4ILH B;  4BFR A;  2AW6 A;  1TJC A;  4XKC A;  4BX9 A;  3PRE A;  3PH0 C;  4FU3 A;  4B0Z A;  4B8C B;  2J9Q A;  2FO7 A;  4GZ3 A;  3SBS A;  3CSF A;  2XGM A;  4AXH A;  4JL0 A;  3OS5 A;  4J7I A;  5C2Y A;  5KJN A;  1FVH A;  3I4G A;  4I6G A;  4JC8 A;  5G04 J;  3MO0 A;  4J8E A;  3G2W A;  2R3A A;  3MGB A;  3TL5 A;  4G11 A;  3AU5 A;  4JVS A;  5T8I A;  4B8A A;  1XNF A;  3DB5 A;  2X6I A;  2IOL A;  2ZU6 B;  3CGH A;  4GA1 A;  4FP7 A;  2UY1 A;  5AEN A;  5HQ8 A;  3I4R B;  1E8X A;  2PZI A;  4G24 A;  3UT4 A;  4URK A;  4IUL A;  5F59 A;  2VGY A;  2XCB A;  1FVF A;  4G2V A;  3CIA A;  4KZ0 A;  3RAY A;  2CFZ A;  4L1B A;  2IU1 A;  3PVL A;  3VTX A;  3MV2 B;  4KVM A;  1OUV A;  3QKY A;  1ZBP A;  4N3C A;  4JEH A;  3CHQ A;  3CVP A;  3ESL A;  1KT1 A;  3R7Q A;  5EKQ D;  5ANL A;  3ML8 A;  2HYZ A;  2KZT A;  4KT6 B;  1KT0 A;  1UG3 A;  1IHG A;  3RJW A;  4BTA A;  3UMV A;  2V0P A;  3OAW A;  3NZU A;  3PNT B;  4N5C A;  3SHF A;  3AS8 A;  4XKB A;  3LDZ A;  1N6A A;  3CVQ A;  3M58 A;  5J08 A;  3CK9 A;  1FCH A;  4Q94 A;  3K5K A;  2VSY A;  4AIF A;  4EEC A;  2FF4 A;  4JHJ A;  1ELK A;  2A4Z A;  4WNG A;  4HOU A;  2WMN A;  3LPZ A;  4GZ5 A;  2VYI A;  4GCN A;  5BUZ A;  3K9I A;  3FUK A;  4N3A A;  2VSO E;  3FFL A;  1ML9 A;  3BG0 B;  4AY5 A;  2E0I A;  2BTD A;  2VSN A;  3JQ0 A;  5LP0 A;  2IF4 A;  2GW1 A;  3FTX A;  5ANR A;  4LEU A;  5AJL A;  4LDG A;  3L08 A;  4UWH A;  4ABN A;  2WQ7 A;  3CBO A;  3ASH A;  5G05 C;  3PS6 A;  4JA9 A;  3BO5 A;  3PDN A;  4BY6 A;  3FTU A;  3GYZ A;  3GZS A;  5C1D A;  3U3W A;  1EPU A;  3F9X A;  3D9J A;  3RKV A;  4UI9 K;  1NA3 A;  2WXK A;  4ANW A;  3MO5 A;  1ZU2 A;  1E90 A;  3QOU A;  4JXT A;  1UW4 B;  4JHR A;  2X6F A;  4IRU A;  3NQP A;  5EDS A;  3CBP A;  3CHR A;  3CVL A;  5AJD A;  3U64 A;  1BPO A;  3LJ3 A;  3ZFW A;  3WXX A;  4NQ0 A;  4A3T A;  3SBT B;  3UX4 A;  2QPW A;  5TH7 A;  2VGX A;  4FUL A;  3ZYK A;  1IQR A;  3FUE A;  4OVV A;  4EZK A;  1SZA A;  2ILR A;  3MKQ B;  3S8P A;  3EHM A;  4L2L A;  3VV0 A;  1N3J A;  3EP0 A;  4CT4 A;  1UJJ A;  1P5Q A;  1HF8 A;  3DBS A;  4HXI A;  2XPZ A;  4TRQ A;  5KJK A;  5LX8 A;  1TEZ A;  3EIJ A;  1E8Z A;  3QDN A;  4F1S A;  4YPU A;  1GW6 A;  3URZ A;  1EF1 C;  3GZ1 A;  2QFC A;  3R7R A;  4NJ5 A;  4RZ0 A;  2FEZ A;  4U63 A;  4Z4P A;  4FC8 A;  3G2U A;  4J8S A;  2R17 C;  2X6J A;  4ILI A;  4ANU A;  4CRW A;  5T5G A;  3AS4 A;  3LYA A;  3ZHE A;  5JHB A;  4C1Q A;  5BW8 C;  2FI7 A;  3PEV B;  4U04 A;  3QWP A;  4FLB A;  2VSX E;  4XX5 A;  4JPS A;  3CBM A;  4N3B A;  4MI5 A;  1OWP A;  5FJY A;  4AU7 A;  1HG2 A;  2OOE A;  5EX0 A;  2VTB A;  1H2V C;  2I2O A;  2PQN A;  3FY4 A;  3Q4A B;  1H6K A;  4I1O B;  4GYY A;  2MRI A;  3SFZ A;  3G2T A;  1Y6I A;  3FTZ A;  4R7L A;  2IJG X;  4JZY A;  4ACL A;  2DCP A;  1W3B A;  2RD0 A;  1H3I A;  4KYO B;  4F3V A;  4XIF A;  4ATG A;  2WXG A;  5BPP A;  3Q5M A;  2RG8 A;  4UQY A;  2V4L A;  2LAI A;  3PUJ A;  3LXU X;  3QB2 A;  4JW1 A;  4IJD A;  2UWJ G;  4LUN U;  3SGH A;  5JIY A;  4NVQ A;  1WM5 A;  3FH8 A;  3CVU A;  3G2S A;  2CG3 A;  1HXI A;  2F69 A;  3FTS A;  5FZQ A;  2NXP A;  4JEU A;  3CEQ A;  4GML A;  3L17 A;  5CMW A;  4W9R A;  4HOT A;  5DBK A;  2R5S A;  4FHJ A;  1WAO 1;  3KS2 A;  1NA0 A;  3HYM B;  4BSX A;  1U3C A;  1QZ2 A;  3FP3 A;  3QNK A;  4U0Z A;  2WB2 A;  3CVY A;  5TEG A;  2BQZ A;  3CK7 A;  4CEM A;  4FAD A;  4N39 A;  3FTV A;  2DIW A;  3FHE A;  4U07 A;  3DAL A;  2YIN A;  2WXR A;  1H2T C;  4XZ4 A;  2G46 A;  5CMY A;  2WMO A;  1HZ4 A;  4J0U A;  5AIJ A;  5G55 A;  4QEP A;  2GGF A;  1PY1 A;  3IV0 A;  3OTN A;  5CPR B;  4QEN A;  5LOZ A;  4N2Q A;  1OWM A;  2OND A;  5JJ6 A;  4XI0 A;  3TXN A;  4PS8 A;  4EBA A;  3ZYL A;  4GZC A;  4PUC A;  3LS8 A;  3JUI A;  1HG5 A;  3O48 A;  3I3N A;  4ME2 A;  4NUR A;  4V3I A;  3HVE B;  4GPK A;  1INZ A;  3PE4 A;  2PL2 A;  2CFU A;  3RJV A;  3KMA A;  5LCW J;  2W5Y A;  4RVB A;  4BUP A;  1Z3Y A;  1XGW A;  2PM7 A;  3QJZ A;  4HOQ A;  4BX8 A;  2MOW A;  2V8S E;  3L22 A;  3PE3 A;  4PDX A;  5TTF A;  1HU3 A;  3ASD A;  4AP2 A;  1UN8 A;  3VLF A;  3O4Z A;  3D9L A;  3OPE A;  4AJW A;  2WVI A;  2YHC A;  2J09 A;  1JWG A;  2Q7F A;  4EZJ A;  2JLB A;  3OXG A;  2L0T B;  2XRY A;  3GZ2 A;  1VDY A;  3CK8 A;  3TJP A;  4GYO A;  2EQX A;  3CLJ A;  2WQ6 A;  4NRH B;  2JEK A;  3ZXS A;  4ANX A;  4QEO A;  4JA7 A;  3VLD A;  1JPL A;  3D9M A;  2FBN A;  3MX3 A;  4DK5 A;  2QY7 A;  2YHE A;  4MRU A;  4A55 A;  3T8M A;  2L0I A;  4GA2 A;  3FUL A;  3OXF A;  4EBA G;  5FQ6 A;  3AS5 A;  3ZEF A;  5KCM A;  4I17 A;  3QWW A;  3S7D A;  4I6J A;  5FWQ A;  5M72 A;  1E7V A;  3U66 A;  3G2V A;  4O6F A;  3CR3 A;  2HR2 A;  5D0O D;  3TG4 A;  3M59 A;  4YVQ C;  4AV7 A;  3TGO A;  2O8J A;  4ANV A;  3UUX A;  3MA5 A;  4MKT A;  4UWG A;  4AM9 A;  2IOS A;  3SWC A;  3CQG B;  4C9B B;  3FU5 A;  2WQH A;  4M3O A;  1S0P A;  1E8W A;  2XEV A;  1A17 A;  3FUN A;  4WAF A;  4WNE A;  4J6I A;  4LCT A;  2CG2 A;  5A7D B;  2XPI A;  3S7F A;  3FU6 A;  3ZW3 A;  3MJW A;  1IQU A;  2I6H A;  3D9I A;  5JHN A;  4PS7 A;  3U4T A;  4L7T A;  4WWN A;  3U9W A;  3FTY A;  3MYV A;  5CHE E;  1HS6 A;  2AXZ A;  2E2E A;  4CT0 A;  2GRM A;  3FPD A;  3ESK A;  2I9C A;  4I43 A;  3Q47 B;  4GAA A;  2XRZ A;  2X6H A;  3IBE A;  2IGQ A;  3N71 A;  3FEY A;  1LF8 A;  2AXU A;  2XQ0 A;  3APC A;  1U3D A;  3D9P A;  3QC1 A;  5F6L A;  4UI9 C;  5LFA A;  3BG1 B;  3EJN A;  5T3R A;  4G26 A;  2GRL A;  4A1S A;  3ZPJ A;  1MHQ A;  3TG5 A;  3P1U A;  5KJL A;  3APF A;  1Z6T A;  2VQ2 A;  4RG9 A;  4UQX A;  4TV3 A;  1EYH A;  3LEW A;  1N52 A;  3MEK A;  3IHX A;  2XHE A;  4GA0 A;  4J8O A;  4KMO A;  3QK0 A;  4J8D A;  3D3M A;  2LSU A;  2I1J A;  3CHP A;  3HDX A;  3ZYM A;  4DI3 A;  2WXF A;  4DLQ A;  4HOS A;  4MS6 A;  2W5Z A;  4AOF A;  4WUY A;  3PUK A;  2WXP A;  5G05 J;  5FQ4 A;  4JDS A;  1MT6 A;  1OWO A;  3PRZ A;  5FTP A;  5JHA A;  2LO6 A;  4GYW A;  5JIN A;  4KBQ A;  2XPY A;  5T0K A;  3OOI A;  4GCO A;  1O9S A;  4U0U A;  5G04 C;  1NZN A;  3F9W A;  3DPD A;  3ENE A;  4MLP A;  3VLE A;  3M54 A;  2LSV A;  3HVE A;  4U8H A;  2WXN A;  5T4Y A;  3FU3 A;  1MVX A;  2PM6 A;  4JHK A;  3Q49 B;  5FQ8 A;  3ZN3 A;  4NAC A;  1QQE A;  3CVX A;  4RSY A;  3R9A B;  3LKU A;  5DIZ A;  3RO3 A;  4DPR A;  4FJZ A;  3KD7 A;  2I1K A;  3C98 A;  4LRZ A;  4L2Y A;  4IJ8 A;  4HVB A;  3I5P A;  3KAE A;  2WXJ A;  2KCL A;  5CCM A;  4H7X A;  4K0R A;  1HE8 A;  5CCL A;  4HS2 A;  4G1T A;  4C0M A;  3SD5 A;  5A23 A;  3EIQ C;  4N2S A;  3VTY A;  5JJ0 A;  4YND A;  3M53 A;  1QNF A;  4F7A A;  5ARF A;  4U0S A;  4YNP A;  4BT8 A;  4PH4 B;  3L16 A;  3FWV A;  2VGX B;  4FJY A;  3ONL A;  4FA6 A;  2A5U A;  1MQS A;  4UWF A;  1ELW A;  3JYS A;  1PC2 A;  5T0M A;  5HI7 A;  2VJ8 A;  4OYS A;  4C0E A;  1SZ9 A;  2KCV A;  3KEZ A;  3RU0 A;  2C0L A;  5ENN A;  3S7J A;  4CDM A;  5KJM A;  3QAQ A;  2M63 A;  3D9K A;  2OVB A;  2WXQ A;  3T5X A;  3D9O A;  5FQ7 A;  4YNM A;  4RG6 A;  1H19 A;  4FHK A;  3RO2 A;  3ULQ A;  2L6J A;  2Y3A A;  2KC7 A;  5BV1 A;  4L23 A;  4BT9 A;  4CCA A;  1E96 B;  3NF1 A;  3CKB A;  2NC9 A;  3FUI A;  5EX3 A;  4YPE A;  2P58 C;  3FUF A;  4J8F A;  5G2N A;  4UWK A;  4FLH A;  4EZL A;  2WPV A;  4I1A A;  1UJK A;  3IKO B;  2X3M A;  4DI4 A;  5E76 A;  2IFU A;  2WXO A;  1WY6 A;  3MV3 B;  3ZHE B;  4Y6W A;  4A1G A;  4ACK A;  3FDH A;  4GZ6 A;  4CDR A;  5BT1 A;  4CGV A;  1EDU A;  3CHS A;  3LCA A;  3MZL B;  4GB9 A;  3B7T A;  1TJF A;  1HX8 A;  4I9C A;  4I6E A;  4P29 A;  4AEZ C;  3CV0 A;  4DLO A;  1HO8 A;  1XQH A;  1X5B A;  1UN9 A;  2J08 A;  2J4D A;  3LY9 A;  3MKQ A;  2VTB B;  4GU5 A;  3PEU B;  2CHX A;  4WWO A;  3ML9 A;  4XI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...