5KJLA

Smyd2 in complex with az378
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
428
structure length
428
Chain Sequence
LGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLEFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, and Biological Activity of Substrate Competitive SMYD2 Inhibitors.
pubmed rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords N-lysine methyltransferase SMYD2
total genus 141
structure length 428
sequence length 428
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF01753 zf-MYND MYND finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5kjlA03
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 5kjlA01
4XI9A 3IEGA 5C1DA 2PQNA 4WNFA 4U07A 4IN3B 5CHEE 4GYYA 1QQEA 4U0UA 3RIBA 4MI5A 3E4BA 4G1TA 2F69A 3PE4A 3QDNA 1A17A 4AY6A 4YPEA 2VSYA 3CVLA 1KLXA 5KJKA 3MO5A 3AS8A 3FFLA 1NA3A 3MO0A 1PC2A 4J8OA 5TH7A 2XPIA 4N3BA 2HR2A 4C1QA 4XI0A 2C0LA 3OPEA 1ELWA 4XIFA 3UUXA 3RQ4A 4I17A 4UQXA 4MI0A 3VTYA 5F6LA 2AVPA 2LSVA 3OXFA 2YHCA 3K5KA 5JHNA 3SWCA 5LSXA 4J8EA 3KMJA 4H12A 1IHGA 3LY9A 2HYZA 2FEZA 4G25A 5T0MA 2KC7A 2XCCA 4U0ZA 3UPVA 1KT0A 5AYFA 3RAYA 4UQYA 3S8PA 3CV0A 2Q7FA 2XGSA 5JINA 4I9CA 3CKBA 2C2LA 4NRHB 4HOTA 4N3CA 4O30A 3M5AA 5JJ0A 1YA0A 3AS4A 3MA5A 3ASGA 4YVOA 2KCKA 2RFIA 3Q5MA 3VTXA 3FWVA 2WQHA 1B89A 5DBKA 5HQ8A 3CBOA 4GYWA 4J8DA 4J7IA 1ML9A 3Q49B 4Z4PA 4KYOB 3KMTA 5A6CA 2L6JA 4JDSA 2NC9A 4GYOA 1ELRA 4YNDA 3FPDA 3MV3B 4AY5A 3OOIA 1E96B 4HOSA 3LCAA 4UQZA 2W5ZA 3S7FA 4HOUA 1HH8A 3F9ZA 4BWRA 2PL2A 4YPUA 2I6HA 3BEEA 1NZNA 4BT8A 4WNGA 3QWPA 4BT9A 3R9AB 5KJLA 5G05J 5FTPA 3EDTB 1XNFA 1OUVA 1TJCA 4I1AA 3S7JA 2JLBA 3BO5A 2E2EA 5A7DB 2Y4UA 5G05C 1MVXA 3PDNA 5EKQD 3U4TA 3HNAA 4JA9A 2LNIA 1N6CA 2C0MA 3LKUA 4Y6CA 3F9YA 1WM5A 2YQ8A 1FCHA 4J83A 5EG2A 3ZHEB 4H7XA 1ZU2A 3MKRA 1MUFA 4ME2A 4JHRA 5KJNA 3LY8A 5TEGA 4YPAA 2KCLA 3SF4A 4GA0A 5JJ6A 3WXXA 2UY1A 5JJTA 3MV2B 3M57A 5F59A 1MVHA 4GZ3A 1KT1A 3GYZA 4CGVA 5T5GA 3Q15A 2KATA 5FJYA 1IYGA 4KXKB 3KAEA 4N3AA 5AYWD 2JV0A 1N6AA 2R3AA 2BUGA 2IGQA 3CVNA 2VQ2A 3Q47B 3VUZA 5G04C 5LSZA 2FF4A 2GW1A 4N5CA 3FP3A 4AIFA 3HYMB 3KS2A 3CKCA 4E47A 3QOUA 4JA7A 2MHKA 2UY1B 1HXIA 3M56A 4G26A 2OOEA 4ABNA 2UWJG 4W9RA 3N71A 4APOA 3CEQA 3AS5A 4YVQC 4A1SA 3MEKA 1Y8MA 4FMUA 2V5FA 5ARFA 1XQHA 3SW9A 3GZ1A 4UI9J 3M55A 2PZIA 2Y4TA 4WNEA 4QEOA 3ZN3A 3CBMA 3F9XA 2QPWA 3NF1A 1HZ4A 4UI9K 3ULQA 1N3JA 3M53A 3OXLA 4BTBA 3F9WA 4RG6A 3ZPJA 4NJ5A 2J9QA 4J8FA 5LCWJ 4CGWA 4H7YA 4IJDA 4HOQA 4LDGA 2R5SA 4QENA 4G24A 2FI7A 4RG9A 2XGOA 5F5EA 3QWWA 2QFCA 3TG4A 1PEGA 2XCBA 3CBPA 4HORA 1O9SA 4U04A 5T0KA 3KMAA 5CPRB 4G2VA 2PQRA 2XGMA 4I2ZA 3EP0A 4F3VA 2FBNA 5JJ7A 3CVPA 1QZ2A 5D0OD 4JLGA 4JL0A 4EQFA 5JIYA 4LEUA 4I2WA 4GCNA 2DBAA 1MT6A 1W3BA 2IFUA 5EX0A 3GW4A 3LYAA 4BTAA 3S7BA 2P58C 1P5QA 3ZFWA 2VYIA 3CK7A 3QWVA 4N2QA 5EX3A 3OXGA 3DB5A 2O8JA 3ZGQA 5M72A 3M54A 3JYSA 1WAO1 4GPKA 4YNMA 3PE3A 5CCMA 3ZHEA 2BQZA 4U0SA 3CVQA 2XEVA 5F6KC 5KJMA 4GA2A 3OS5A 3VV0A 2LSUA 4GA1A 3URZA 5FZSA 5ARGA 4NVQA 1ZBPA 4B94A 5FT9A 3U3WA 3ASFA 3LPZA 1H3IA 5CCLA 4Y6WA 3UQ3A 3RKVA 4N2SA 4QEPA 3CK8A 5BT1A 3O48A 1NA0A 4J0UA 3RJVA 3ASDA 3IHXA 3Q4AB 5D0QD 2FO7A 4NQ0A 3SZ7A 3TG5A 3ESKA 4GCOA 4RZ0A 3GZ2A 4GZ6A 4AU7A 4I51A 3RO3A 4G23A 5HI7A 4IJ8A 3K9IA 4UI9C 4YNPA 3ASHA 4AM9A 4WUYA 4I9EA 4N39A 5FZQA 2HO1A 1ZKKA 3RJWA 3DALA 5BW8C 3TAXA 3M59A 5BNWA 2KCVA 2ONDA 5FZRA 3CK9A 3LY7A 3M58A 2VGXA 4O6FA 3KD7A 5DIZA 4CDRA 2IF4A 4BUPA 5G04J 3MO2A 3RU0A 3TGOA 3QKYA 4KBQA 2VGYA 3S7DA 3RO2A 4J7FA 4WNDA 4GZ5A 5TTFA 2W5YA 2WPVA 2VGXB 2VSNA 5LCWC 2G46A
chains in the Genus database with same CATH superfamily
4ANVA 4M3OA 5ENTD 3PRZA 3QJZA 4U07A 2V5QC 2EQXA 1UJJA 3RIBA 1BI8B 2R03A 3C3RA 4MI5A 2F69A 4OVVA 3ONLA 3HXFA 3EHMA 4XX5A 4EBAA 2RKKA 4PS7A 3RK6A 4G11A 3NBNB 1NI1A 4FP7A 3ASOE 1MHQA 4J8OA 3DWLG 3FUFA 2XPIA 4N3BA 1FT2A 1H6KA 3LXUX 2C0LA 4AV7A 5CECB 3OPEA 3RQ4A 3UUXA 4I17A 4UQXA 1OCRE 3IHYA 5AQAA 5BXOA 5JMND 4AJWA 3U66A 5F6LA 5JHNA 3ZYMA 4FLBA 3AG4E 4ZHBA 1KT0A 4I6JA 4GU5A 4CT0A 3S8PA 2Q7FA 3ZYQA 5JINA 3CKBA 3PZ1A 2R2LA 3MA5A 5AQ9A 4BX8A 3ASGA 5CRUA 4UWLA 5EIBE 2KCKA 3T5VA 4CDNA 3G2UA 3FWVA 2WQHA 3CBOA 3UKRG 3FTUA 4J7IA 3J5QB 2R17C 4KYOB 4XE0A 3UTMA 2IOSA 5ENSD 3FH5A 2WB2A 4TV3A 4E85A 4L23A 4XKCA 3LCAA 4LNBA 3C98A 2EIME 3L6AA 2YINA 2W5ZA 3S7FA 2V0PA 4HOUA 3F9ZA 4BWRA 3B7BA 1NL4A 1AP7A 3BEEA 4BT8A 3J5PA 2P9LG 1G3NB 5KJLA 3NQPA 4JB8P 4GAAA 5FTPA 4DPRA 3EDTB 3DXKG 5BXUA 4WWPA 2JLBA 2AXVA 3BO5A 3JUEA 3AG2E 4XKBA 1WM5A 2YQ8A 4J83A 3EHNA 4O60A 4DX5D 5CEDB 3MKRA 3HXEA 3GZSA 1HX8A 4K0RA 3ABKE 1H2VC 4GA0A 3ZIMA 5JJ6A 2UY1A 1E7VA 3MV2B 3ONKA 3M57A 1MVHA 3GYZA 4CGVA 3HHMA 3UIPC 5FJYA 3BU8A 4KXKB 4XZ4A 2JV0A 3CHRA 1N6AA 2BUGA 2R3AA 2IGQA 3RAUA 3QARA 2EIKE 2ETBA 3B7TA 2GW1A 2BEDA 2GRQB 1TN7A 3IHVA 3QOUA 3AAAC 4JA7A 4WWOA 3I5PA 4HVBA 1N11A 4BSXA 4FJYA 4ABNA 3I4RB 2KZTB 2LUHA 4BFRA 3E34A 1MJ0A 4A1SA 3MEKA 3U9WA 2DYRE 2WXHA 3ABLE 2V5FA 4K5CA 4DLQA 3HVEA 3PZ3A 3GZ1A 1N4RA 4FU3A 4GB9A 2Y4TA 3CBMA 3F9XA 1IHBA 2Y1LE 4BETA 1OCOE 2IJGX 3PEVB 1HG5A 5E75A 4RG6A 4ILHB 2XENA 4H7YA 2IOLA 4G24A 3CVUA 4RG9A 3PEUB 2XGOA 5F5EA 3CBPA 3C72A 1TEZA 1O9SA 4U04A 5T0KA 2PQRA 3EP0A 3PNTB 4NIKA 4F3VA 5JJ7A 3CVVA 5D0OD 2WVIA 4U8YD 4HRLA 4EQFA 3Q7AA 4LEUA 4HXIA 4TRQA 4GCNA 1UJKA 2GGFA 3NB2A 3PZ2A 3LYAA 1N4PA 4APFA 2P58C 3RRUA 1OWLA 2Y0BG 3ZFWA 4HBDA 4UUCA 2VYIA 3DB5A 3OXGA 2O8JA 5FINA 3FUMA 4LCTA 3FTYA 3Q9NC 4GPKA 2WQ7A 2NSZA 3DSUA 2L6BA 4GA2A 5LFAA 3PNLB 4GA1A 2L0TB 3T8KA 5AJDA 1EF1C 1HFAA 4B94A 3U3WA 3ASFA 4K03A 2LXMA 1WY6A 1H3IA 5JHAA 2A4ZA 4QEPA 4UWKA 4A3TA 1NA0A 1DVPA 3RJVA 5B1BE 3E32A 3Q4AB 5FQ6A 4DX6D 1K3ZD 4NQ0A 3AG3E 3ESKA 4YDOA 5D2MC 4I51A 1S0PA 2CG3A 4IJ8A 3K9IA 4AM9A 4I9EA 3ZKJA 3DEPA 2HO1A 1ZKKA 1H19A 2V4HC 5BW8C 1N0RA 2GRRB 2XQ0A 4I1OB 3TWVA 5FQ4A 2VGXA 1UN8A 3KD7A 3QAQA 5FQ8A 5G04J 3NZSA 5H7PA 4HQDA 3TJPA 3L54A 4WNDA 3L82A 2R05A 3PREA 4BEPA 2W5YA 1GW6A 2HM8A 1H0AA 2WPVA 1JCQA 2VGXB 3NOGD 4TXQA 1IQUA 3UM3A 2OV8A 4GPMA 5AJLA 4ILIA 5CHEE 4GYYA 4U0UA 2XEEA 5BV0A 1A17A 4AY6A 4IYPA 4YPEA 2VSYA 2DZNA 4M7CA 4ANUA 2PM6A 3ISMC 4GTQA 3WG7E 1NA3A 1PC2A 2VSXE 3Q9UC 2Y69E 5TH7A 5CERB 1ZB1A 3Q75A 1ELWA 4XIFA 3MYVA 4PS3A 4MI0A 3VTYA 5CMWA 2WXRA 1H2TC 3OXFA 3K5KA 4J8EA 4BSZB 3ZUVB 4H12A 5J90A 2HYZA 2FEZA 4G25A 5T0MA 3FU6A 2ZU6B 3V2OA 3BQOA 3L16A 5AYFA 1TNZA 3SD5A 3ZXSA 3CV0A 2XGSA 1DCQA 5J08A 3T8MA 4ACLA 5ENPD 3ZEFA 4HOTA 4N3CA 4O30A 3M5AA 5JJ0A 2ETCA 5AARA 2NXPA 3TWQA 4RSYA 3EU9A 3Q5MA 3VTXA 4Q69A 3LEWA 4L7TA 3C3OA 5HQ8A 3Q49B 4EBAG 2J08A 5A6CA 3G2TA 4JDSA 1OCZE 4GYOA 3FPDA 1U2VG 3MV3B 4AY5A 4GMJA 5ENQD 3OOIA 2ZXWE 5BUZA 4E6HA 4UQZA 1SVXA 3EIQC 2QY7A 3NAWA 4EZLA 1NZNA 4KMOA 3QWPA 2WQ6A 3R9AB 1L5JA 2I1KA 3EHQA 3UI2A 4FADA 1XNFA 4B8CB 2ZGDA 4YDYA 5A7DB 5EYLA 5ENOD 1MVXA 2AXUA 1RW2A 3Q7FA 2J8SD 4JA9A 2LNIA 3UMVA 2C0MA 4U8VD 1TN6A 2WXLA 3HG0D 1FCHA 1WDYA 3APFA 3DSXA 3MJWA 5T3RA 5CEAA 4ME2A 4R7LA 2GRNB 4JHKA 1MQSA 5LX8A 3WXXA 2YHEA 4O1OA 3G2SA 3CR3A 2X38A 3PZDA 1E8YA 1U3CA 3JQ1A 3D9OA 5T5GA 2IO2C 3Q79A 2DWZA 1N9AA 5AYWD 4HNAD 4UWFA 3VUZA 3Q47B 2FF4A 2IQCA 2BKKB 4FC8A 4K5AB 3HYMB 4HB5A 3CKCA 2RD0A 2MHKA 4MRUA 2UY1B 1HXIA 4CRWA 3E30A 3HRAA 3MKQB 3EU5A 3N71A 4OVUA 3IV0A 3LVRE 4APOA 4GTPA 3SI5A 3D9LA 3AJIA 1OT8A 4JD2G 4LERA 3SW9A 4NURA 2RFAA 1FVHA 2PZIA 1H2UA 1WG0A 2R02A 1HZ4A 3NF1A 4UI9K 3ULQA 1X81A 3OXLA 3F9WA 4CT4A 2OCCE 3ZPJA 4X8QA 4CGWA 2XS8A 3DXMG 2CHWA 3APCA 4LDGA 4L2YA 4PDXA 3EHRA 3ZU7B 3KMAA 2RFMA 4ATGA 3RRMB 2EILE 2XGMA 2MYOA 2VTBA 3TWXA 3TWSA 1QZ2A 1A5EA 3LVQE 4CEMA 4AEZC 4JLGA 5JIYA 2P9PG 3D9KA 4I2WA 2XRZA 1FPPA 3FU3A 3AG1E 5EX0A 4FA6A 1MX6A 3VLEA 3GW4A 4HFGA 1UW4B 5EDSA 3UX4A 1YYHA 3LS8A 3ULYA 4WAFA 4N2QA 2VTBB 3ZGQA 5M72A 5ENRD 2QYJA 5D66A 3FHEA 3L22A 2B0OE 4YNMA 3Q78A 3FU0A 1MZCA 3PE3A 5CCMA 3ZHEA 2XEHA 3FTVA 3CVQA 4U7EB 3OS5A 3VV0A 4GTVA 5LP0A 4BERA 3URZA 4DX7D 3F6QA 1ZBPA 4L9PA 5FT9A 2WMNA 2F8XK 3LPZA 3FTZA 2RG8A 3HVEB 5CCLA 4Y6WA 3D9JA 2KXPC 4P29A 3UM0A 2P9SG 3B7SA 4KVOA 1BI7B 3APDA 2QYUA 4ATZD 2L0IA 3SZ7A 3KEAA 4HI8A 1OWPA 3FULA 3PUKA 4AU7A 1Z5SC 4L1BA 4G23A 2CFZA 4YNPA 4AVXA 2DVWA 3FH8A 5FZQA 1BPOA 2ONDA 1DC2A 5FZRA 5ITZF 4FULA 5FWQA 2ZIRA 3CSFA 3LY7A 4B0ZA 2HE0A 4O6FA 4U63A 3CVXA 1YMPA 3TWRA 4KBQA 5HKPA 3S7DA 2GRPB 4GZ5A 5EIDA 2I1JA 3CHQA 4EZKA 1IXVA 2BKGA 1Z3XA 1EDUA 3DSSA 1BU9A 4TXRA 5B1AE 4B93B 5LCWC 4WNFA 4F7AA 1TR4A 4IN3B 2X6IA 3DSWA 3E4BA 1LTXA 3PE4A 1TJFA 4BY6A 3QDNA 3CVLA 3JQ0A 1KLXA 2X3MA 1AWCB 3MO5A 2MRIA 4GZDA 2WXNA 3L13A 5A23A 1OWNA 3X2QE 2P9IG 3CHMA 3QNKA 2HR2A 4AXHA 1N4QA 5CMYA 4XI0A 3FTSA 4C0EA 4PH4B 3CHPA 3ZXPA 2GRLA 4WWNA 1EPUA 3JXIA 5LSXA 3V31A 4A63B 1D8DA 2WXFA 3DEOA 1IHGA 1HU3A 1JCSA 4U0ZA 3UPVA 2GROB 2H6GA 4UQYA 1INZA 3SO8A 2F37A 4ZFHA 2C2LA 1KPSB 3EUVA 4NRHB 3UM2A 3C3QA 3AS4A 1DCEA 4GTOA 4PS8A 2XRYA 4YVOA 1E8XA 3EJNA 2RFIA 1FT1A 1S64A 4AOFA 1B89A 5DBKA 4GYWA 3AU4A 2L6JA 4J8SA 3R7RA 1N54A 4YNDA 2PM7A 4A1GA 3ML9A 3FUKA 3SFYA 1SZAA 1E96B 3CQGB 4HOSA 3IXEA 2BTDA 2IU1A 1HH8A 2MOWA 4YPUA 2I6HA 3C5RA 4WNGA 5AIJA 3CHSA 3ESLA 1N52A 3IKOB 4TUUA 1TNYA 3TWUA 3RSEG 2AXZA 4OYSA 1TJCA 3OAWA 2J09A 2H6FA 2OVFA 3LDZA 1UN9A 4NACA 1Z3YA 3UT4A 5G05C 2VGEA 4HLLA 5KBAA 3HNAA 2F8YA 5FQ7A 5E76A 1S70B 3F9YA 1ZU2A 4MBGA 4HI9A 4JC8A 1MUFA 4JHRA 2YNQA 3HXDA 3NOCD 4GZCA 4YPAA 4KZ0A 1OWMA 4GTSA 2IONA 3FUDA 5JJTA 3DSVA 2ETAA 5F59A 3LJ3A 2H6IA 1KT1A 1OY3D 3Q15A 3T5XA 4MKTA 1PAQA 5AQBA 3VLFA 2CHZA 3FH7A 2VQ2A 5BV1A 5LSZA 4RVBA 3FTXA 4CDMA 4JHJA 2IY0C 3I4GA 4N5CA 1N95A 3TL5A 3CVWA 5LOZA 3V30A 4G8LA 3ZVVA 3FUIA 4F6RD 3FUHA 3D9MA 5CBOA 2UWJG 5KWDA 5G55A 5AENA 3S2AA 2M63A 3ML8A 1SQMA 1LD7A 2WXIA 3D9NA 2JABA 1Y8MA 4RQIA 4FMUA 3PZ4A 1TNUA 1E7UA 3G2WA 1O1RA 4DUIA 4GTTA 3HXBA 5ARFA 3W9GA 4DI3A 1IQRA 2R59A 3M55A 3O4ZA 3EIJA 4GTMA 1HE8A 3I3NA 4WNEA 1FVFA 4FLHA 4QEOA 3ZN3A 4PUCA 2QPWA 3HIZA 4DJAA 2AWIA 4HRMB 4HRNA 3CLJA 2V4LA 3CHOA 2J9QA 4HLEA 5HS0A 4G8KA 4HOQA 4QENA 4LSZE 3TXNA 2QFCA 2DCPA 1PEGA 2LXLA 2LAIA 5JA4D 1O1SA 2A5UA 1MX2A 2DZOA 5CPRB 2FULA 4G2VA 1E90A 3FTWA 3UT8A 4I2ZA 2WXQA 3UT7A 1K1BA 2FBNA 3G2VA 3SNXA 3BG1B 2H6HA 1D9SA 1K8KG 4MS6A 4ANXA 1UG3A 1W3BA 2IFUA 3FUNA 3FY4A 3SQVA 4BTAA 4OAVB 1P5QA 1HS6A 2OEVA 2CG2A 3CK7A 4GTRA 2CHXA 4FJZA 3MCXA 3JYSA 4U96D 3DSTA 2BQZA 4U0SA 4L2LA 4NVQA 5FZSA 3D9HA 2XHEA 2X6FA 5KNGA 3UXGA 4FHKA 1JWFA 4I1MA 3RKVA 3UQ3A 3HXCA 1X5BA 3LJNA 3CK8A 3O48A 5KNHD 4QFVA 4J0UA 4EECA 3QK0A 3ASDA 4MLPA 4KZCA 3IHXA 3V2XA 5D0QD 1SA5A 3B7RL 5T4YA 4RZ0A 3OTNA 4GZ6A 4JEUA 2WM9A 3ZYKA 4QQIA 2PNNA 2OVBA 3UIOC 2KZTA 2AW6A 3DBSA 4J8YA 1OXJA 3TAXA 3RRNB 2KCVA 4O1PA 3M58A 1LD8A 1VDYA 4CDRA 4BX9A 4DLOA 2X6HA 1JWGA 2DYSE 3MO2A 3TGOA 3QKYA 1JUQA 2VGYA 3FEYA 3RO2A 3T9KA 4J7FA 3KSLA 1Q2ZA 5KCMA 1PY1A 1N0QA 3DRAA 4XI9A 3IEGA 5C1DA 4DX1A 1OWOA 1QBQA 2PQNA 3TXMA 1K1AA 1QQEA 1DNPA 3E33A 4G1TA 5BPPA 2QZAA 3PVLA 5KJKA 1BD8A 3UKUG 3AS8A 3CVYA 3FFLA 4DI4A 2F0YA 3MO0A 2E0IA 1E8ZA 4C1QA 1U3DA 5AN8A 3FU5A 3KSQA 4DK5A 3HDXA 5JHBA 2AVPA 3SY2A 2LSVA 2X6KA 2YHCA 3D9IA 3SWCA 3FEXA 4LNGA 1V55E 3KMJA 2ZISA 3LY9A 4U8HA 2KC7A 3B95A 2XCCA 3RAYA 1KZOA 4JPSA 4UWHA 3DPDA 4C48B 4B89A 4I9CA 2WXOA 4F1PA 3VLDA 2FO1E 1HO8A 1JPLA 3FUJA 1YA0A 5EILA 2KM4A 4FHJA 4U95D 1MYOA 5ENNA 2ZGGA 1UOHA 4URKA 1TN8A 3BUAA 1TNOA 4J8DA 1ML9A 4GMRA 4Z4PA 3KMTA 2IO3C 2NC9A 1ELRA 3E37A 4C9BB 2CFUA 3ZYLA 2J07A 2KBXA 4LRZA 4IULA 3B7UX 4OAUC 1O5MA 1IKND 5ANRA 5IY5E 3D9PA 3L9TA 3QC1A 2PL2A 4LG6A 4UWGA 4BT9A 2WXKA 4IRUA 5G05J 4CCAA 2V8SE 4EHMA 1SW6A 4K5BA 1OUVA 4EZJA 4D10C 4N5QA 4I1AA 3S7JA 2WXJA 2E2EA 4DRXE 1H6PA 2Y4UA 2EINE 4I43A 3PDNA 3PUJA 5EKQD 1Z6TA 3BG0B 3U4TA 1N6CA 4RLYA 3LKUA 4Y6CA 3FUEA 5EN5D 5EG2A 3ZHEB 4H7XA 1Y6IA 2P2CP 1NP7A 3R9MA 5KJNA 3MGBA 3LY8A 4TUMA 5TEGA 2KCLA 3SF4A 3SFXA 4EPZA 4A55A 1MX4A 4LUNU 4JVSA 5EYPF 3KEZA 4GZ3A 5AQ7A 2J4DA 5C2YA 1HF8A 2EIJE 1JCRA 3B13A 2KATA 1IYGA 3KAEA 3ULEG 4N3AA 5B3SE 3JXJA 2XPYA 2LAHA 3CVNA 5AAOA 4B8AA 5FIOA 4ILGA 5G04C 2AJAA 2VJ8A 2DIWA 4LNUD 3FP3A 4AIFA 3U64A 3W9FA 1NFIE 3KS2A 1O1TA 4E47A 3JCKC 1QNFA 4TXPA 5CRVA 4ANWA 3L17A 3Q73A 3M56A 2WXGA 4G26A 1TNBA 2OOEA 4W9RA 4YDEA 4Q94A 3CQCB 4XEIG 2XZDG 3AS5A 3CEQA 4YVQC 1N94A 2I2OA 1BLXB 1XGWA 1XQHA 4JEHA 5G2NA 4UI9J 3CSTA 3UM1A 3FDHA 3TWWA 1N3JA 3M53A 4BTBA 1H6OA 4NJ5A 4J8FA 5LCWJ 3SFZA 4IJDA 4CYMD 2XS1A 2R5SA 4HS2A 2FI7A 3QWWA 2P9NG 3TG4A 3QB2A 2XCBA 3ABME 4HORA 4I6GA 1YCSB 1TYQG 1SA4A 3ASNE 1KZPA 2A5EA 4V3IA 4JZYA 5HRYA 2Y3AA 2J49A 3CVPA 5ANLA 3D3MA 3V79K 3SBSA 3PS6A 2L9BA 1SZ9A 4JL0A 5T8IA 1HG2A 3P2BA 4Z68A 2DBAA 3ZW3A 4JXTA 1MT6A 3TWTA 1LF8A 4ACKA 3S7BA 4A3VA 3R7QA 2X6JA 2XPZA 3DPYA 3P1UA 3QWVA 3MX3A 4KT6B 5EX3A 1E8WA 3SHFA 4KVMA 3M54A 3AU5A 1WAO1 3L08A 4C0MA 4JW1A 2XEVA 1ELKA 5F6KC 2QC9A 5KJMA 4YDWA 2GRMA 2LSUA 2WXPA 5ARGA 2WXMA 3JUIA 2XZTG 1RZ4A 5CBNA 4N2SA 2JEKA 3ZRHA 5BT1A 4J7WA 2NYJA 2LO6A 3MZLB 2FO7A 3TG5A 4GCOA 3GZ2A 1EYHA 3RO3A 3NZUA 2OEWA 2J4BA 5HI7A 1N4SA 4UI9C 1S63A 2P9UG 4AP2A 3ASHA 4CZ2D 3CIAA 4WUYA 3UINC 3SBTB 4N39A 3RJWA 2VSOE 3DALA 2IEJA 3M59A 5BNWA 1D8EA 3CK9A 1OCCE 3SGHA 3MKQA 5DIZA 4DX2A 4F1SA 2IF4A 4BUPA 2I9CA 3RU0A 4GMLA 3CGHA 4F53A 2WMOA 4J6IA 5TTFA 3ENEA 4Q96A 3PH0C 2ILRA 2B6CA 4BESA 3ZNGA 2P9KG 1QYMA 2BF0X 2VSNA 2G46A 3IBEA 1V54E 4I6EA
chains in the Genus database with same CATH topology
4ANVA 4XI9A 3IEGA 5C1DA 4M3OA 5AJLA 1OWOA 4ILIA 2PQNA 4WNFA 4F7AA 3PRZA 3QJZA 4IN3B 4U07A 4GYYA 1QQEA 5CHEE 1DNPA 2EQXA 1UJJA 2X6IA 4U0UA 3RIBA 5BV0A 3E4BA 4G1TA 2F69A 4MI5A 3PE4A 1TJFA 5BPPA 4OVVA 4BY6A 3QDNA 3ONLA 1A17A 3EHMA 4AY6A 4IYPA 4XX5A 4YPEA 2VSYA 3CVLA 3PVLA 4EBAA 3JQ0A 1KLXA 2X3MA 5KJKA 4ANUA 4PS7A 2PM6A 3MO5A 3AS8A 3CVYA 3RK6A 4G11A 2MRIA 4GZDA 2WXNA 3FFLA 4DI4A 1NA3A 3L13A 4FP7A 3MO0A 1MHQA 1PC2A 2E0IA 4J8OA 5A23A 1E8ZA 1OWNA 2VSXE 3FUFA 5TH7A 2XPIA 3CHMA 4N3BA 3QNKA 2HR2A 4AXHA 4C1QA 5CMYA 4XI0A 1H6KA 3LXUX 2C0LA 4AV7A 3FTSA 1U3DA 3OPEA 1ELWA 4C0EA 3FU5A 4PH4B 4XIFA 3UUXA 3RQ4A 4I17A 3MYVA 4UQXA 3IHYA 4PS3A 4DK5A 4MI0A 3CHPA 2GRLA 3HDXA 4WWNA 3VTYA 5CMWA 4AJWA 3U66A 5JHBA 2AVPA 1EPUA 1H2TC 2WXRA 5F6LA 2LSVA 2X6KA 3OXFA 2YHCA 3D9IA 3K5KA 5JHNA 3FEXA 5LSXA 3SWCA 4J8EA 3ZYMA 3KMJA 2WXFA 4H12A 1IHGA 3LY9A 2HYZA 1HU3A 2FEZA 4FLBA 4G25A 4U8HA 2KC7A 5J90A 5T0MA 2XCCA 3FU6A 2ZU6B 4U0ZA 3UPVA 1KT0A 3L16A 4I6JA 5AYFA 4GU5A 3RAYA 4CT0A 4UQYA 3SD5A 1INZA 3S8PA 4JPSA 3CV0A 3ZXSA 2Q7FA 2XGSA 4UWHA 3DPDA 4B89A 3ZYQA 5JINA 4I9CA 3CKBA 5J08A 2WXOA 3VLDA 2C2LA 3T8MA 4ACLA 4NRHB 1HO8A 1JPLA 3ZEFA 4HOTA 3FUJA 4N3CA 4O30A 3M5AA 5JJ0A 1YA0A 3AS4A 3MA5A 4BX8A 3ASGA 4PS8A 4UWLA 2KM4A 2NXPA 2XRYA 4FHJA 4YVOA 1E8XA 2KCKA 5ENNA 3T5VA 4CDNA 4URKA 3EJNA 3M54A 4RSYA 2RFIA 3Q5MA 3VTXA 4Q69A 4AOFA 3G2UA 3FWVA 2WQHA 3LEWA 4L7TA 1B89A 5DBKA 5HQ8A 3CBOA 3FTUA 4GYWA 4J8DA 4J7IA 1ML9A 2R17C 3Q49B 4EBAG 4Z4PA 4KYOB 3KMTA 3AU4A 4XE0A 2J08A 2L6JA 5A6CA 2IOSA 3G2TA 4JDSA 4J8SA 2NC9A 3FH5A 4GYOA 3R7RA 2WB2A 4TV3A 1ELRA 1N54A 4YNDA 3FPDA 2PM7A 3MV3B 4A1GA 4AY5A 3ML9A 4GMJA 2CFUA 4C9BB 4E85A 3OOIA 3FUKA 4L23A 4XKCA 3ZYLA 1SZAA 1E96B 2J07A 3CQGB 3LCAA 4HOSA 5BUZA 4E6HA 4UQZA 3C98A 2BTDA 4LRZA 3L6AA 2YINA 2W5ZA 4IULA 3B7UX 2IU1A 3EIQC 3S7FA 2QY7A 5ANRA 2V0PA 4HOUA 1HH8A 3D9PA 4EZLA 3QC1A 3F9ZA 4BWRA 2MOWA 2PL2A 4YPUA 2I6HA 3BEEA 1NZNA 4KMOA 4BT8A 4WNGA 4UWGA 3QWPA 2WQ6A 5AIJA 3CHSA 2WXKA 3ESLA 3R9AB 1N52A 4BT9A 5KJLA 4IRUA 1L5JA 3IKOB 2I1KA 3NQPA 4TUUA 5G05J 4CCAA 4GAAA 2V8SE 5FTPA 4DPRA 2AXZA 3EDTB 4FADA 1XNFA 4B8CB 1OUVA 4OYSA 1TJCA 4EZJA 3OAWA 4D10C 4WWPA 2J09A 4I1AA 2OVFA 3S7JA 2JLBA 2AXVA 2E2EA 2WXJA 3LDZA 1UN9A 4NACA 3BO5A 5A7DB 2Y4UA 1Z3YA 3UT4A 5G05C 4I43A 1MVXA 3PDNA 3PUJA 2AXUA 5EKQD 1Z6TA 3BG0B 3U4TA 3HNAA 4JA9A 2LNIA 1N6CA 3UMVA 2C0MA 3LKUA 4Y6CA 5FQ7A 5E76A 3F9YA 2WXLA 4XKBA 1WM5A 2YQ8A 1FCHA 4J83A 3FUEA 5EG2A 3APFA 3ZHEB 4H7XA 3EHNA 1ZU2A 1Y6IA 3MJWA 3MKRA 4JC8A 5T3RA 1MUFA 3GZSA 1NP7A 4ME2A 4JHRA 2YNQA 1HX8A 5KJNA 4K0RA 4GZCA 4R7LA 3MGBA 3LY8A 5TEGA 4YPAA 4KZ0A 2KCLA 3SF4A 1OWMA 4JHKA 1H2VC 4EPZA 4GA0A 1MQSA 2IONA 3ZIMA 4A55A 5JJ6A 3WXXA 3FUDA 5LX8A 2UY1A 2YHEA 4LUNU 1E7VA 3MV2B 3ONKA 5JJTA 3M57A 3G2SA 3CR3A 4JVSA 2X38A 5F59A 3LJ3A 3PZDA 3KEZA 1U3CA 1E8YA 4GZ3A 2J4DA 1MVHA 1KT1A 3JQ1A 3D9OA 5C2YA 3GYZA 1HF8A 4CGVA 3HHMA 5T5GA 3Q15A 3B13A 3T5XA 2KATA 5FJYA 1IYGA 4KXKB 3KAEA 4MKTA 4N3AA 5AYWD 1PAQA 4XZ4A 2JV0A 3CHRA 3VLFA 2BUGA 1N6AA 2R3AA 2CHZA 2XPYA 2LAHA 4UWFA 2IGQA 3CVNA 3FH7A 4B8AA 2VQ2A 3Q47B 4ILGA 3QARA 5G04C 3VUZA 5BV1A 5LSZA 4RVBA 3FTXA 2VJ8A 2FF4A 2IQCA 3B7TA 2DIWA 2GW1A 4CDMA 4JHJA 3I4GA 4FC8A 4N5CA 3TL5A 3FP3A 4AIFA 3HYMB 3U64A 3CVWA 5LOZA 3KS2A 3CKCA 3ZVVA 3IHVA 3QOUA 4E47A 3JCKC 1QNFA 4JA7A 4WWOA 2RD0A 3FUIA 2MHKA 3I5PA 4MRUA 2UY1B 3FUHA 4HVBA 1HXIA 4CRWA 4ANWA 4BSXA 3L17A 4FJYA 3M56A 2WXGA 3D9MA 4G26A 3MKQB 2OOEA 4ABNA 3I4RB 2UWJG 4W9RA 4Q94A 3N71A 2KZTB 4OVUA 3CQCB 3IV0A 4BFRA 3LVRE 5G55A 4APOA 3S2AA 3CEQA 2M63A 3AS5A 1SQMA 3ML8A 4YVQC 5AENA 4A1SA 3MEKA 2WXIA 2I2OA 3D9NA 3SI5A 1Y8MA 3D9LA 2WXHA 3U9WA 4FMUA 2V5FA 1E7UA 3G2WA 4LERA 1XGWA 4DLQA 3HVEA 5ARFA 1XQHA 3SW9A 4NURA 4JEHA 3GZ1A 5G2NA 4DI3A 1FVHA 4UI9J 1IQRA 2R59A 3CSTA 3O4ZA 3M55A 3EIJA 4FU3A 2PZIA 1HE8A 3I3NA 1H2UA 2Y4TA 4GB9A 1FVFA 4WNEA 4FLHA 4QEOA 3ZN3A 4PUCA 3CBMA 3F9XA 3FDHA 2QPWA 3HIZA 4DJAA 3NF1A 1HZ4A 4UI9K 2IJGX 3PEVB 3ULQA 1N3JA 1HG5A 2AWIA 3M53A 3OXLA 4BTBA 5E75A 3F9WA 4RG6A 4CT4A 3CLJA 2V4LA 3CHOA 4ILHB 3ZPJA 4NJ5A 2J9QA 4J8FA 5LCWJ 3SFZA 4CGWA 4HLEA 4N2QA 4H7YA 2CHWA 4HOQA 4IJDA 3APCA 4LDGA 2R5SA 4QENA 2IOLA 4G24A 2FI7A 4HS2A 4L2YA 4RG9A 3CVUA 3PEUB 3TXNA 2XGOA 5F5EA 3QWWA 2QFCA 4PDXA 2DCPA 3TG4A 1PEGA 2LAIA 3QB2A 2XCBA 2A5UA 3CBPA 4HORA 1TEZA 1O9SA 4I6GA 4U04A 5T0KA 3KMAA 4ATGA 5CPRB 2FULA 4G2VA 1E90A 3RRMB 3FTWA 2PQRA 2XGMA 3UT8A 4I2ZA 2WXQA 3EP0A 3PNTB 2VTBA 3UT7A 4F3VA 4V3IA 4JZYA 2FBNA 3G2VA 2Y3AA 5JJ7A 3CVVA 2J49A 3CVPA 5ANLA 3D3MA 1QZ2A 5D0OD 2WVIA 3LVQE 3SBSA 3SNXA 4CEMA 4AEZC 3BG1B 3PS6A 2L9BA 1SZ9A 4JLGA 4JL0A 5T8IA 1HG2A 4EQFA 5JIYA 4LEUA 4HXIA 4MS6A 3P2BA 3D9KA 4I2WA 4TRQA 4GCNA 2XRZA 3FU3A 4ANXA 2DBAA 1UJKA 2GGFA 1UG3A 3ZW3A 4JXTA 1MT6A 1W3BA 2IFUA 3FUNA 5EX0A 4FA6A 3VLEA 3GW4A 3FY4A 3LYAA 4HFGA 4BTAA 1LF8A 4APFA 1UW4B 4ACKA 5EDSA 3S7BA 3UX4A 2P58C 4A3VA 1P5QA 3RRUA 1HS6A 3R7QA 2X6JA 1OWLA 3LS8A 2XPZA 2CG2A 3ZFWA 3P1UA 2VYIA 3CK7A 3QWVA 4WAFA 3MX3A 4KT6B 5EX3A 1E8WA 2CHXA 3OXGA 4FJZA 4KVMA 3SHFA 3MCXA 3ZGQA 5M72A 2VTBB 2O8JA 3AU5A 3FUMA 1WAO1 3JYSA 4LCTA 3FHEA 3L22A 3FTYA 3L08A 4GPKA 4YNMA 3FU0A 3PE3A 5CCMA 3ZHEA 4C0MA 2WQ7A 2NSZA 3FTVA 3CVQA 2XEVA 4JW1A 4L2LA 4U0SA 1ELKA 5F6KC 5KJMA 4GA2A 3OS5A 5LFAA 2GRMA 3PNLB 2LSUA 4GA1A 2L0TB 3VV0A 5AJDA 5LP0A 3URZA 2WXPA 1EF1C 5ARGA 5FZSA 4NVQA 1ZBPA 2XHEA 1HFAA 2WXMA 2X6FA 4B94A 5FT9A 3U3WA 2WMNA 3JUIA 3ASFA 4K03A 3LPZA 3FTZA 1WY6A 2RG8A 3HVEB 1H3IA 4FHKA 1JWFA 5CCLA 5JHAA 4Y6WA 2A4ZA 4I1MA 3RKVA 3UQ3A 3D9JA 4N2SA 2JEKA 4QEPA 4P29A 4UWKA 1X5BA 4A3TA 3CK8A 3ZRHA 5BT1A 3O48A 4QFVA 1NA0A 4J0UA 4EECA 1DVPA 3QK0A 3ASDA 4MLPA 3RJVA 2LO6A 3B7SA 4KVOA 4KZCA 3MZLB 3APDA 3Q4AB 5FQ6A 3IHXA 5D0QD 2FO7A 2L0IA 2BQZA 3B7RL 5T4YA 4NQ0A 3SZ7A 3TG5A 1OWPA 3ESKA 4GCOA 4RZ0A 3FULA 3GZ2A 3OTNA 1EYHA 3PUKA 4GZ6A 4JEUA 2WM9A 3RO3A 4I51A 4AU7A 3NZUA 3ZYKA 2J4BA 1S0PA 4L1BA 4G23A 2CG3A 5HI7A 3K9IA 4IJ8A 4UI9C 2CFZA 4AP2A 4YNPA 2OVBA 3ASHA 3CIAA 4WUYA 4AM9A 2KZTA 4I9EA 3SBTB 2AW6A 3DBSA 4AVXA 4N39A 3FH8A 2HO1A 5FZQA 1ZKKA 1H19A 3RJWA 2VSOE 3DALA 1BPOA 5BW8C 3TAXA 3M59A 3RRNB 5BNWA 2KCVA 2ONDA 5FZRA 3TXMA 3CK9A 4FULA 5FWQA 2XQ0A 3SGHA 3CSFA 3LY7A 4I1OB 3M58A 5FQ4A 2VGXA 4B0ZA 3MKQA 4O6FA 1UN8A 1VDYA 3KD7A 3QAQA 5FQ8A 5DIZA 4CDRA 4U63A 4BX9A 4DLOA 2IF4A 4F1SA 4BUPA 2X6HA 5G04J 1JWGA 3CVXA 2I9CA 3RU0A 3MO2A 3TGOA 3QKYA 4KBQA 1JUQA 4GMLA 2VGYA 3CGHA 4F53A 2WMOA 3FEYA 3S7DA 3NZSA 3RO2A 3TJPA 3DB5A 4J6IA 3L54A 4J7FA 4WNDA 4GZ5A 5TTFA 2I1JA 3ENEA 3PREA 3CHQA 4Q96A 3PH0C 2ILRA 4EZKA 2W5YA 1GW6A 2HM8A 1H0AA 2WPVA 2VGXB 5KCMA 1Z3XA 1EDUA 2BF0X 2VSNA 5LCWC 2G46A 3IBEA 1IQUA 4I6EA 1PY1A 2OV8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XI9 A;  3IEG A;  5C1D A;  2PQN A;  4WNF A;  4U07 A;  4IN3 B;  5CHE E;  4GYY A;  1QQE A;  4U0U A;  3RIB A;  4MI5 A;  3E4B A;  4G1T A;  2F69 A;  3PE4 A;  3QDN A;  1A17 A;  4AY6 A;  4YPE A;  2VSY A;  3CVL A;  1KLX A;  5KJK A;  3MO5 A;  3AS8 A;  3FFL A;  1NA3 A;  3MO0 A;  1PC2 A;  4J8O A;  5TH7 A;  2XPI A;  4N3B A;  2HR2 A;  4C1Q A;  4XI0 A;  2C0L A;  3OPE A;  1ELW A;  4XIF A;  3UUX A;  3RQ4 A;  4I17 A;  4UQX A;  4MI0 A;  3VTY A;  5F6L A;  2AVP A;  2LSV A;  3OXF A;  2YHC A;  3K5K A;  5JHN A;  3SWC A;  5LSX A;  4J8E A;  3KMJ A;  4H12 A;  1IHG A;  3LY9 A;  2HYZ A;  2FEZ A;  4G25 A;  5T0M A;  2KC7 A;  2XCC A;  4U0Z A;  3UPV A;  1KT0 A;  5AYF A;  3RAY A;  4UQY A;  3S8P A;  3CV0 A;  2Q7F A;  2XGS A;  5JIN A;  4I9C A;  3CKB A;  2C2L A;  4NRH B;  4HOT A;  4N3C A;  4O30 A;  3M5A A;  5JJ0 A;  1YA0 A;  3AS4 A;  3MA5 A;  3ASG A;  4YVO A;  2KCK A;  2RFI A;  3Q5M A;  3VTX A;  3FWV A;  2WQH A;  1B89 A;  5DBK A;  5HQ8 A;  3CBO A;  4GYW A;  4J8D A;  4J7I A;  1ML9 A;  3Q49 B;  4Z4P A;  4KYO B;  3KMT A;  5A6C A;  2L6J A;  4JDS A;  2NC9 A;  4GYO A;  1ELR A;  4YND A;  3FPD A;  3MV3 B;  4AY5 A;  3OOI A;  1E96 B;  4HOS A;  3LCA A;  4UQZ A;  2W5Z A;  3S7F A;  4HOU A;  1HH8 A;  3F9Z A;  4BWR A;  2PL2 A;  4YPU A;  2I6H A;  3BEE A;  1NZN A;  4BT8 A;  4WNG A;  3QWP A;  4BT9 A;  3R9A B;  5KJL A;  5G05 J;  5FTP A;  3EDT B;  1XNF A;  1OUV A;  1TJC A;  4I1A A;  3S7J A;  2JLB A;  3BO5 A;  2E2E A;  5A7D B;  2Y4U A;  5G05 C;  1MVX A;  3PDN A;  5EKQ D;  3U4T A;  3HNA A;  4JA9 A;  2LNI A;  1N6C A;  2C0M A;  3LKU A;  4Y6C A;  3F9Y A;  1WM5 A;  2YQ8 A;  1FCH A;  4J83 A;  5EG2 A;  3ZHE B;  4H7X A;  1ZU2 A;  3MKR A;  1MUF A;  4ME2 A;  4JHR A;  5KJN A;  3LY8 A;  5TEG A;  4YPA A;  2KCL A;  3SF4 A;  4GA0 A;  5JJ6 A;  3WXX A;  2UY1 A;  5JJT A;  3MV2 B;  3M57 A;  5F59 A;  1MVH A;  4GZ3 A;  1KT1 A;  3GYZ A;  4CGV A;  5T5G A;  3Q15 A;  2KAT A;  5FJY A;  1IYG A;  4KXK B;  3KAE A;  4N3A A;  5AYW D;  2JV0 A;  1N6A A;  2R3A A;  2BUG A;  2IGQ A;  3CVN A;  2VQ2 A;  3Q47 B;  3VUZ A;  5G04 C;  5LSZ A;  2FF4 A;  2GW1 A;  4N5C A;  3FP3 A;  4AIF A;  3HYM B;  3KS2 A;  3CKC A;  4E47 A;  3QOU A;  4JA7 A;  2MHK A;  2UY1 B;  1HXI A;  3M56 A;  4G26 A;  2OOE A;  4ABN A;  2UWJ G;  4W9R A;  3N71 A;  4APO A;  3CEQ A;  3AS5 A;  4YVQ C;  4A1S A;  3MEK A;  1Y8M A;  4FMU A;  2V5F A;  5ARF A;  1XQH A;  3SW9 A;  3GZ1 A;  4UI9 J;  3M55 A;  2PZI A;  2Y4T A;  4WNE A;  4QEO A;  3ZN3 A;  3CBM A;  3F9X A;  2QPW A;  3NF1 A;  1HZ4 A;  4UI9 K;  3ULQ A;  1N3J A;  3M53 A;  3OXL A;  4BTB A;  3F9W A;  4RG6 A;  3ZPJ A;  4NJ5 A;  2J9Q A;  4J8F A;  5LCW J;  4CGW A;  4H7Y A;  4IJD A;  4HOQ A;  4LDG A;  2R5S A;  4QEN A;  4G24 A;  2FI7 A;  4RG9 A;  2XGO A;  5F5E A;  3QWW A;  2QFC A;  3TG4 A;  1PEG A;  2XCB A;  3CBP A;  4HOR A;  1O9S A;  4U04 A;  5T0K A;  3KMA A;  5CPR B;  4G2V A;  2PQR A;  2XGM A;  4I2Z A;  3EP0 A;  4F3V A;  2FBN A;  5JJ7 A;  3CVP A;  1QZ2 A;  5D0O D;  4JLG A;  4JL0 A;  4EQF A;  5JIY A;  4LEU A;  4I2W A;  4GCN A;  2DBA A;  1MT6 A;  1W3B A;  2IFU A;  5EX0 A;  3GW4 A;  3LYA A;  4BTA A;  3S7B A;  2P58 C;  1P5Q A;  3ZFW A;  2VYI A;  3CK7 A;  3QWV A;  4N2Q A;  5EX3 A;  3OXG A;  3DB5 A;  2O8J A;  3ZGQ A;  5M72 A;  3M54 A;  3JYS A;  1WAO 1;  4GPK A;  4YNM A;  3PE3 A;  5CCM A;  3ZHE A;  2BQZ A;  4U0S A;  3CVQ A;  2XEV A;  5F6K C;  5KJM A;  4GA2 A;  3OS5 A;  3VV0 A;  2LSU A;  4GA1 A;  3URZ A;  5FZS A;  5ARG A;  4NVQ A;  1ZBP A;  4B94 A;  5FT9 A;  3U3W A;  3ASF A;  3LPZ A;  1H3I A;  5CCL A;  4Y6W A;  3UQ3 A;  3RKV A;  4N2S A;  4QEP A;  3CK8 A;  5BT1 A;  3O48 A;  1NA0 A;  4J0U A;  3RJV A;  3ASD A;  3IHX A;  3Q4A B;  5D0Q D;  2FO7 A;  4NQ0 A;  3SZ7 A;  3TG5 A;  3ESK A;  4GCO A;  4RZ0 A;  3GZ2 A;  4GZ6 A;  4AU7 A;  4I51 A;  3RO3 A;  4G23 A;  5HI7 A;  4IJ8 A;  3K9I A;  4UI9 C;  4YNP A;  3ASH A;  4AM9 A;  4WUY A;  4I9E A;  4N39 A;  5FZQ A;  2HO1 A;  1ZKK A;  3RJW A;  3DAL A;  5BW8 C;  3TAX A;  3M59 A;  5BNW A;  2KCV A;  2OND A;  5FZR A;  3CK9 A;  3LY7 A;  3M58 A;  2VGX A;  4O6F A;  3KD7 A;  5DIZ A;  4CDR A;  2IF4 A;  4BUP A;  5G04 J;  3MO2 A;  3RU0 A;  3TGO A;  3QKY A;  4KBQ A;  2VGY A;  3S7D A;  3RO2 A;  4J7F A;  4WND A;  4GZ5 A;  5TTF A;  2W5Y A;  2WPV A;  2VGX B;  2VSN A;  5LCW C;  2G46 A; 
#chains in the Genus database with same CATH topology
 4ANV A;  4M3O A;  5ENT D;  3PRZ A;  3QJZ A;  4U07 A;  2V5Q C;  2EQX A;  1UJJ A;  3RIB A;  1BI8 B;  2R03 A;  3C3R A;  4MI5 A;  2F69 A;  4OVV A;  3ONL A;  3HXF A;  3EHM A;  4XX5 A;  4EBA A;  2RKK A;  4PS7 A;  3RK6 A;  4G11 A;  3NBN B;  1NI1 A;  4FP7 A;  3ASO E;  1MHQ A;  4J8O A;  3DWL G;  3FUF A;  2XPI A;  4N3B A;  1FT2 A;  1H6K A;  3LXU X;  2C0L A;  4AV7 A;  5CEC B;  3OPE A;  3RQ4 A;  3UUX A;  4I17 A;  4UQX A;  1OCR E;  3IHY A;  5AQA A;  5BXO A;  5JMN D;  4AJW A;  3U66 A;  5F6L A;  5JHN A;  3ZYM A;  4FLB A;  3AG4 E;  4ZHB A;  1KT0 A;  4I6J A;  4GU5 A;  4CT0 A;  3S8P A;  2Q7F A;  3ZYQ A;  5JIN A;  3CKB A;  3PZ1 A;  2R2L A;  3MA5 A;  5AQ9 A;  4BX8 A;  3ASG A;  5CRU A;  4UWL A;  5EIB E;  2KCK A;  3T5V A;  4CDN A;  3G2U A;  3FWV A;  2WQH A;  3CBO A;  3UKR G;  3FTU A;  4J7I A;  3J5Q B;  2R17 C;  4KYO B;  4XE0 A;  3UTM A;  2IOS A;  5ENS D;  3FH5 A;  2WB2 A;  4TV3 A;  4E85 A;  4L23 A;  4XKC A;  3LCA A;  4LNB A;  3C98 A;  2EIM E;  3L6A A;  2YIN A;  2W5Z A;  3S7F A;  2V0P A;  4HOU A;  3F9Z A;  4BWR A;  3B7B A;  1NL4 A;  1AP7 A;  3BEE A;  4BT8 A;  3J5P A;  2P9L G;  1G3N B;  5KJL A;  3NQP A;  4JB8 P;  4GAA A;  5FTP A;  4DPR A;  3EDT B;  3DXK G;  5BXU A;  4WWP A;  2JLB A;  2AXV A;  3BO5 A;  3JUE A;  3AG2 E;  4XKB A;  1WM5 A;  2YQ8 A;  4J83 A;  3EHN A;  4O60 A;  4DX5 D;  5CED B;  3MKR A;  3HXE A;  3GZS A;  1HX8 A;  4K0R A;  3ABK E;  1H2V C;  4GA0 A;  3ZIM A;  5JJ6 A;  2UY1 A;  1E7V A;  3MV2 B;  3ONK A;  3M57 A;  1MVH A;  3GYZ A;  4CGV A;  3HHM A;  3UIP C;  5FJY A;  3BU8 A;  4KXK B;  4XZ4 A;  2JV0 A;  3CHR A;  1N6A A;  2BUG A;  2R3A A;  2IGQ A;  3RAU A;  3QAR A;  2EIK E;  2ETB A;  3B7T A;  2GW1 A;  2BED A;  2GRQ B;  1TN7 A;  3IHV A;  3QOU A;  3AAA C;  4JA7 A;  4WWO A;  3I5P A;  4HVB A;  1N11 A;  4BSX A;  4FJY A;  4ABN A;  3I4R B;  2KZT B;  2LUH A;  4BFR A;  3E34 A;  1MJ0 A;  4A1S A;  3MEK A;  3U9W A;  2DYR E;  2WXH A;  3ABL E;  2V5F A;  4K5C A;  4DLQ A;  3HVE A;  3PZ3 A;  3GZ1 A;  1N4R A;  4FU3 A;  4GB9 A;  2Y4T A;  3CBM A;  3F9X A;  1IHB A;  2Y1L E;  4BET A;  1OCO E;  2IJG X;  3PEV B;  1HG5 A;  5E75 A;  4RG6 A;  4ILH B;  2XEN A;  4H7Y A;  2IOL A;  4G24 A;  3CVU A;  4RG9 A;  3PEU B;  2XGO A;  5F5E A;  3CBP A;  3C72 A;  1TEZ A;  1O9S A;  4U04 A;  5T0K A;  2PQR A;  3EP0 A;  3PNT B;  4NIK A;  4F3V A;  5JJ7 A;  3CVV A;  5D0O D;  2WVI A;  4U8Y D;  4HRL A;  4EQF A;  3Q7A A;  4LEU A;  4HXI A;  4TRQ A;  4GCN A;  1UJK A;  2GGF A;  3NB2 A;  3PZ2 A;  3LYA A;  1N4P A;  4APF A;  2P58 C;  3RRU A;  1OWL A;  2Y0B G;  3ZFW A;  4HBD A;  4UUC A;  2VYI A;  3DB5 A;  3OXG A;  2O8J A;  5FIN A;  3FUM A;  4LCT A;  3FTY A;  3Q9N C;  4GPK A;  2WQ7 A;  2NSZ A;  3DSU A;  2L6B A;  4GA2 A;  5LFA A;  3PNL B;  4GA1 A;  2L0T B;  3T8K A;  5AJD A;  1EF1 C;  1HFA A;  4B94 A;  3U3W A;  3ASF A;  4K03 A;  2LXM A;  1WY6 A;  1H3I A;  5JHA A;  2A4Z A;  4QEP A;  4UWK A;  4A3T A;  1NA0 A;  1DVP A;  3RJV A;  5B1B E;  3E32 A;  3Q4A B;  5FQ6 A;  4DX6 D;  1K3Z D;  4NQ0 A;  3AG3 E;  3ESK A;  4YDO A;  5D2M C;  4I51 A;  1S0P A;  2CG3 A;  4IJ8 A;  3K9I A;  4AM9 A;  4I9E A;  3ZKJ A;  3DEP A;  2HO1 A;  1ZKK A;  1H19 A;  2V4H C;  5BW8 C;  1N0R A;  2GRR B;  2XQ0 A;  4I1O B;  3TWV A;  5FQ4 A;  2VGX A;  1UN8 A;  3KD7 A;  3QAQ A;  5FQ8 A;  5G04 J;  3NZS A;  5H7P A;  4HQD A;  3TJP A;  3L54 A;  4WND A;  3L82 A;  2R05 A;  3PRE A;  4BEP A;  2W5Y A;  1GW6 A;  2HM8 A;  1H0A A;  2WPV A;  1JCQ A;  2VGX B;  3NOG D;  4TXQ A;  1IQU A;  3UM3 A;  2OV8 A;  4GPM A;  5AJL A;  4ILI A;  5CHE E;  4GYY A;  4U0U A;  2XEE A;  5BV0 A;  1A17 A;  4AY6 A;  4IYP A;  4YPE A;  2VSY A;  2DZN A;  4M7C A;  4ANU A;  2PM6 A;  3ISM C;  4GTQ A;  3WG7 E;  1NA3 A;  1PC2 A;  2VSX E;  3Q9U C;  2Y69 E;  5TH7 A;  5CER B;  1ZB1 A;  3Q75 A;  1ELW A;  4XIF A;  3MYV A;  4PS3 A;  4MI0 A;  3VTY A;  5CMW A;  2WXR A;  1H2T C;  3OXF A;  3K5K A;  4J8E A;  4BSZ B;  3ZUV B;  4H12 A;  5J90 A;  2HYZ A;  2FEZ A;  4G25 A;  5T0M A;  3FU6 A;  2ZU6 B;  3V2O A;  3BQO A;  3L16 A;  5AYF A;  1TNZ A;  3SD5 A;  3ZXS A;  3CV0 A;  2XGS A;  1DCQ A;  5J08 A;  3T8M A;  4ACL A;  5ENP D;  3ZEF A;  4HOT A;  4N3C A;  4O30 A;  3M5A A;  5JJ0 A;  2ETC A;  5AAR A;  2NXP A;  3TWQ A;  4RSY A;  3EU9 A;  3Q5M A;  3VTX A;  4Q69 A;  3LEW A;  4L7T A;  3C3O A;  5HQ8 A;  3Q49 B;  4EBA G;  2J08 A;  5A6C A;  3G2T A;  4JDS A;  1OCZ E;  4GYO A;  3FPD A;  1U2V G;  3MV3 B;  4AY5 A;  4GMJ A;  5ENQ D;  3OOI A;  2ZXW E;  5BUZ A;  4E6H A;  4UQZ A;  1SVX A;  3EIQ C;  2QY7 A;  3NAW A;  4EZL A;  1NZN A;  4KMO A;  3QWP A;  2WQ6 A;  3R9A B;  1L5J A;  2I1K A;  3EHQ A;  3UI2 A;  4FAD A;  1XNF A;  4B8C B;  2ZGD A;  4YDY A;  5A7D B;  5EYL A;  5ENO D;  1MVX A;  2AXU A;  1RW2 A;  3Q7F A;  2J8S D;  4JA9 A;  2LNI A;  3UMV A;  2C0M A;  4U8V D;  1TN6 A;  2WXL A;  3HG0 D;  1FCH A;  1WDY A;  3APF A;  3DSX A;  3MJW A;  5T3R A;  5CEA A;  4ME2 A;  4R7L A;  2GRN B;  4JHK A;  1MQS A;  5LX8 A;  3WXX A;  2YHE A;  4O1O A;  3G2S A;  3CR3 A;  2X38 A;  3PZD A;  1E8Y A;  1U3C A;  3JQ1 A;  3D9O A;  5T5G A;  2IO2 C;  3Q79 A;  2DWZ A;  1N9A A;  5AYW D;  4HNA D;  4UWF A;  3VUZ A;  3Q47 B;  2FF4 A;  2IQC A;  2BKK B;  4FC8 A;  4K5A B;  3HYM B;  4HB5 A;  3CKC A;  2RD0 A;  2MHK A;  4MRU A;  2UY1 B;  1HXI A;  4CRW A;  3E30 A;  3HRA A;  3MKQ B;  3EU5 A;  3N71 A;  4OVU A;  3IV0 A;  3LVR E;  4APO A;  4GTP A;  3SI5 A;  3D9L A;  3AJI A;  1OT8 A;  4JD2 G;  4LER A;  3SW9 A;  4NUR A;  2RFA A;  1FVH A;  2PZI A;  1H2U A;  1WG0 A;  2R02 A;  1HZ4 A;  3NF1 A;  4UI9 K;  3ULQ A;  1X81 A;  3OXL A;  3F9W A;  4CT4 A;  2OCC E;  3ZPJ A;  4X8Q A;  4CGW A;  2XS8 A;  3DXM G;  2CHW A;  3APC A;  4LDG A;  4L2Y A;  4PDX A;  3EHR A;  3ZU7 B;  3KMA A;  2RFM A;  4ATG A;  3RRM B;  2EIL E;  2XGM A;  2MYO A;  2VTB A;  3TWX A;  3TWS A;  1QZ2 A;  1A5E A;  3LVQ E;  4CEM A;  4AEZ C;  4JLG A;  5JIY A;  2P9P G;  3D9K A;  4I2W A;  2XRZ A;  1FPP A;  3FU3 A;  3AG1 E;  5EX0 A;  4FA6 A;  1MX6 A;  3VLE A;  3GW4 A;  4HFG A;  1UW4 B;  5EDS A;  3UX4 A;  1YYH A;  3LS8 A;  3ULY A;  4WAF A;  4N2Q A;  2VTB B;  3ZGQ A;  5M72 A;  5ENR D;  2QYJ A;  5D66 A;  3FHE A;  3L22 A;  2B0O E;  4YNM A;  3Q78 A;  3FU0 A;  1MZC A;  3PE3 A;  5CCM A;  3ZHE A;  2XEH A;  3FTV A;  3CVQ A;  4U7E B;  3OS5 A;  3VV0 A;  4GTV A;  5LP0 A;  4BER A;  3URZ A;  4DX7 D;  3F6Q A;  1ZBP A;  4L9P A;  5FT9 A;  2WMN A;  2F8X K;  3LPZ A;  3FTZ A;  2RG8 A;  3HVE B;  5CCL A;  4Y6W A;  3D9J A;  2KXP C;  4P29 A;  3UM0 A;  2P9S G;  3B7S A;  4KVO A;  1BI7 B;  3APD A;  2QYU A;  4ATZ D;  2L0I A;  3SZ7 A;  3KEA A;  4HI8 A;  1OWP A;  3FUL A;  3PUK A;  4AU7 A;  1Z5S C;  4L1B A;  4G23 A;  2CFZ A;  4YNP A;  4AVX A;  2DVW A;  3FH8 A;  5FZQ A;  1BPO A;  2OND A;  1DC2 A;  5FZR A;  5ITZ F;  4FUL A;  5FWQ A;  2ZIR A;  3CSF A;  3LY7 A;  4B0Z A;  2HE0 A;  4O6F A;  4U63 A;  3CVX A;  1YMP A;  3TWR A;  4KBQ A;  5HKP A;  3S7D A;  2GRP B;  4GZ5 A;  5EID A;  2I1J A;  3CHQ A;  4EZK A;  1IXV A;  2BKG A;  1Z3X A;  1EDU A;  3DSS A;  1BU9 A;  4TXR A;  5B1A E;  4B93 B;  5LCW C;  4WNF A;  4F7A A;  1TR4 A;  4IN3 B;  2X6I A;  3DSW A;  3E4B A;  1LTX A;  3PE4 A;  1TJF A;  4BY6 A;  3QDN A;  3CVL A;  3JQ0 A;  1KLX A;  2X3M A;  1AWC B;  3MO5 A;  2MRI A;  4GZD A;  2WXN A;  3L13 A;  5A23 A;  1OWN A;  3X2Q E;  2P9I G;  3CHM A;  3QNK A;  2HR2 A;  4AXH A;  1N4Q A;  5CMY A;  4XI0 A;  3FTS A;  4C0E A;  4PH4 B;  3CHP A;  3ZXP A;  2GRL A;  4WWN A;  1EPU A;  3JXI A;  5LSX A;  3V31 A;  4A63 B;  1D8D A;  2WXF A;  3DEO A;  1IHG A;  1HU3 A;  1JCS A;  4U0Z A;  3UPV A;  2GRO B;  2H6G A;  4UQY A;  1INZ A;  3SO8 A;  2F37 A;  4ZFH A;  2C2L A;  1KPS B;  3EUV A;  4NRH B;  3UM2 A;  3C3Q A;  3AS4 A;  1DCE A;  4GTO A;  4PS8 A;  2XRY A;  4YVO A;  1E8X A;  3EJN A;  2RFI A;  1FT1 A;  1S64 A;  4AOF A;  1B89 A;  5DBK A;  4GYW A;  3AU4 A;  2L6J A;  4J8S A;  3R7R A;  1N54 A;  4YND A;  2PM7 A;  4A1G A;  3ML9 A;  3FUK A;  3SFY A;  1SZA A;  1E96 B;  3CQG B;  4HOS A;  3IXE A;  2BTD A;  2IU1 A;  1HH8 A;  2MOW A;  4YPU A;  2I6H A;  3C5R A;  4WNG A;  5AIJ A;  3CHS A;  3ESL A;  1N52 A;  3IKO B;  4TUU A;  1TNY A;  3TWU A;  3RSE G;  2AXZ A;  4OYS A;  1TJC A;  3OAW A;  2J09 A;  2H6F A;  2OVF A;  3LDZ A;  1UN9 A;  4NAC A;  1Z3Y A;  3UT4 A;  5G05 C;  2VGE A;  4HLL A;  5KBA A;  3HNA A;  2F8Y A;  5FQ7 A;  5E76 A;  1S70 B;  3F9Y A;  1ZU2 A;  4MBG A;  4HI9 A;  4JC8 A;  1MUF A;  4JHR A;  2YNQ A;  3HXD A;  3NOC D;  4GZC A;  4YPA A;  4KZ0 A;  1OWM A;  4GTS A;  2ION A;  3FUD A;  5JJT A;  3DSV A;  2ETA A;  5F59 A;  3LJ3 A;  2H6I A;  1KT1 A;  1OY3 D;  3Q15 A;  3T5X A;  4MKT A;  1PAQ A;  5AQB A;  3VLF A;  2CHZ A;  3FH7 A;  2VQ2 A;  5BV1 A;  5LSZ A;  4RVB A;  3FTX A;  4CDM A;  4JHJ A;  2IY0 C;  3I4G A;  4N5C A;  1N95 A;  3TL5 A;  3CVW A;  5LOZ A;  3V30 A;  4G8L A;  3ZVV A;  3FUI A;  4F6R D;  3FUH A;  3D9M A;  5CBO A;  2UWJ G;  5KWD A;  5G55 A;  5AEN A;  3S2A A;  2M63 A;  3ML8 A;  1SQM A;  1LD7 A;  2WXI A;  3D9N A;  2JAB A;  1Y8M A;  4RQI A;  4FMU A;  3PZ4 A;  1TNU A;  1E7U A;  3G2W A;  1O1R A;  4DUI A;  4GTT A;  3HXB A;  5ARF A;  3W9G A;  4DI3 A;  1IQR A;  2R59 A;  3M55 A;  3O4Z A;  3EIJ A;  4GTM A;  1HE8 A;  3I3N A;  4WNE A;  1FVF A;  4FLH A;  4QEO A;  3ZN3 A;  4PUC A;  2QPW A;  3HIZ A;  4DJA A;  2AWI A;  4HRM B;  4HRN A;  3CLJ A;  2V4L A;  3CHO A;  2J9Q A;  4HLE A;  5HS0 A;  4G8K A;  4HOQ A;  4QEN A;  4LSZ E;  3TXN A;  2QFC A;  2DCP A;  1PEG A;  2LXL A;  2LAI A;  5JA4 D;  1O1S A;  2A5U A;  1MX2 A;  2DZO A;  5CPR B;  2FUL A;  4G2V A;  1E90 A;  3FTW A;  3UT8 A;  4I2Z A;  2WXQ A;  3UT7 A;  1K1B A;  2FBN A;  3G2V A;  3SNX A;  3BG1 B;  2H6H A;  1D9S A;  1K8K G;  4MS6 A;  4ANX A;  1UG3 A;  1W3B A;  2IFU A;  3FUN A;  3FY4 A;  3SQV A;  4BTA A;  4OAV B;  1P5Q A;  1HS6 A;  2OEV A;  2CG2 A;  3CK7 A;  4GTR A;  2CHX A;  4FJZ A;  3MCX A;  3JYS A;  4U96 D;  3DST A;  2BQZ A;  4U0S A;  4L2L A;  4NVQ A;  5FZS A;  3D9H A;  2XHE A;  2X6F A;  5KNG A;  3UXG A;  4FHK A;  1JWF A;  4I1M A;  3RKV A;  3UQ3 A;  3HXC A;  1X5B A;  3LJN A;  3CK8 A;  3O48 A;  5KNH D;  4QFV A;  4J0U A;  4EEC A;  3QK0 A;  3ASD A;  4MLP A;  4KZC A;  3IHX A;  3V2X A;  5D0Q D;  1SA5 A;  3B7R L;  5T4Y A;  4RZ0 A;  3OTN A;  4GZ6 A;  4JEU A;  2WM9 A;  3ZYK A;  4QQI A;  2PNN A;  2OVB A;  3UIO C;  2KZT A;  2AW6 A;  3DBS A;  4J8Y A;  1OXJ A;  3TAX A;  3RRN B;  2KCV A;  4O1P A;  3M58 A;  1LD8 A;  1VDY A;  4CDR A;  4BX9 A;  4DLO A;  2X6H A;  1JWG A;  2DYS E;  3MO2 A;  3TGO A;  3QKY A;  1JUQ A;  2VGY A;  3FEY A;  3RO2 A;  3T9K A;  4J7F A;  3KSL A;  1Q2Z A;  5KCM A;  1PY1 A;  1N0Q A;  3DRA A;  4XI9 A;  3IEG A;  5C1D A;  4DX1 A;  1OWO A;  1QBQ A;  2PQN A;  3TXM A;  1K1A A;  1QQE A;  1DNP A;  3E33 A;  4G1T A;  5BPP A;  2QZA A;  3PVL A;  5KJK A;  1BD8 A;  3UKU G;  3AS8 A;  3CVY A;  3FFL A;  4DI4 A;  2F0Y A;  3MO0 A;  2E0I A;  1E8Z A;  4C1Q A;  1U3D A;  5AN8 A;  3FU5 A;  3KSQ A;  4DK5 A;  3HDX A;  5JHB A;  2AVP A;  3SY2 A;  2LSV A;  2X6K A;  2YHC A;  3D9I A;  3SWC A;  3FEX A;  4LNG A;  1V55 E;  3KMJ A;  2ZIS A;  3LY9 A;  4U8H A;  2KC7 A;  3B95 A;  2XCC A;  3RAY A;  1KZO A;  4JPS A;  4UWH A;  3DPD A;  4C48 B;  4B89 A;  4I9C A;  2WXO A;  4F1P A;  3VLD A;  2FO1 E;  1HO8 A;  1JPL A;  3FUJ A;  1YA0 A;  5EIL A;  2KM4 A;  4FHJ A;  4U95 D;  1MYO A;  5ENN A;  2ZGG A;  1UOH A;  4URK A;  1TN8 A;  3BUA A;  1TNO A;  4J8D A;  1ML9 A;  4GMR A;  4Z4P A;  3KMT A;  2IO3 C;  2NC9 A;  1ELR A;  3E37 A;  4C9B B;  2CFU A;  3ZYL A;  2J07 A;  2KBX A;  4LRZ A;  4IUL A;  3B7U X;  4OAU C;  1O5M A;  1IKN D;  5ANR A;  5IY5 E;  3D9P A;  3L9T A;  3QC1 A;  2PL2 A;  4LG6 A;  4UWG A;  4BT9 A;  2WXK A;  4IRU A;  5G05 J;  4CCA A;  2V8S E;  4EHM A;  1SW6 A;  4K5B A;  1OUV A;  4EZJ A;  4D10 C;  4N5Q A;  4I1A A;  3S7J A;  2WXJ A;  2E2E A;  4DRX E;  1H6P A;  2Y4U A;  2EIN E;  4I43 A;  3PDN A;  3PUJ A;  5EKQ D;  1Z6T A;  3BG0 B;  3U4T A;  1N6C A;  4RLY A;  3LKU A;  4Y6C A;  3FUE A;  5EN5 D;  5EG2 A;  3ZHE B;  4H7X A;  1Y6I A;  2P2C P;  1NP7 A;  3R9M A;  5KJN A;  3MGB A;  3LY8 A;  4TUM A;  5TEG A;  2KCL A;  3SF4 A;  3SFX A;  4EPZ A;  4A55 A;  1MX4 A;  4LUN U;  4JVS A;  5EYP F;  3KEZ A;  4GZ3 A;  5AQ7 A;  2J4D A;  5C2Y A;  1HF8 A;  2EIJ E;  1JCR A;  3B13 A;  2KAT A;  1IYG A;  3KAE A;  3ULE G;  4N3A A;  5B3S E;  3JXJ A;  2XPY A;  2LAH A;  3CVN A;  5AAO A;  4B8A A;  5FIO A;  4ILG A;  5G04 C;  2AJA A;  2VJ8 A;  2DIW A;  4LNU D;  3FP3 A;  4AIF A;  3U64 A;  3W9F A;  1NFI E;  3KS2 A;  1O1T A;  4E47 A;  3JCK C;  1QNF A;  4TXP A;  5CRV A;  4ANW A;  3L17 A;  3Q73 A;  3M56 A;  2WXG A;  4G26 A;  1TNB A;  2OOE A;  4W9R A;  4YDE A;  4Q94 A;  3CQC B;  4XEI G;  2XZD G;  3AS5 A;  3CEQ A;  4YVQ C;  1N94 A;  2I2O A;  1BLX B;  1XGW A;  1XQH A;  4JEH A;  5G2N A;  4UI9 J;  3CST A;  3UM1 A;  3FDH A;  3TWW A;  1N3J A;  3M53 A;  4BTB A;  1H6O A;  4NJ5 A;  4J8F A;  5LCW J;  3SFZ A;  4IJD A;  4CYM D;  2XS1 A;  2R5S A;  4HS2 A;  2FI7 A;  3QWW A;  2P9N G;  3TG4 A;  3QB2 A;  2XCB A;  3ABM E;  4HOR A;  4I6G A;  1YCS B;  1TYQ G;  1SA4 A;  3ASN E;  1KZP A;  2A5E A;  4V3I A;  4JZY A;  5HRY A;  2Y3A A;  2J49 A;  3CVP A;  5ANL A;  3D3M A;  3V79 K;  3SBS A;  3PS6 A;  2L9B A;  1SZ9 A;  4JL0 A;  5T8I A;  1HG2 A;  3P2B A;  4Z68 A;  2DBA A;  3ZW3 A;  4JXT A;  1MT6 A;  3TWT A;  1LF8 A;  4ACK A;  3S7B A;  4A3V A;  3R7Q A;  2X6J A;  2XPZ A;  3DPY A;  3P1U A;  3QWV A;  3MX3 A;  4KT6 B;  5EX3 A;  1E8W A;  3SHF A;  4KVM A;  3M54 A;  3AU5 A;  1WAO 1;  3L08 A;  4C0M A;  4JW1 A;  2XEV A;  1ELK A;  5F6K C;  2QC9 A;  5KJM A;  4YDW A;  2GRM A;  2LSU A;  2WXP A;  5ARG A;  2WXM A;  3JUI A;  2XZT G;  1RZ4 A;  5CBN A;  4N2S A;  2JEK A;  3ZRH A;  5BT1 A;  4J7W A;  2NYJ A;  2LO6 A;  3MZL B;  2FO7 A;  3TG5 A;  4GCO A;  3GZ2 A;  1EYH A;  3RO3 A;  3NZU A;  2OEW A;  2J4B A;  5HI7 A;  1N4S A;  4UI9 C;  1S63 A;  2P9U G;  4AP2 A;  3ASH A;  4CZ2 D;  3CIA A;  4WUY A;  3UIN C;  3SBT B;  4N39 A;  3RJW A;  2VSO E;  3DAL A;  2IEJ A;  3M59 A;  5BNW A;  1D8E A;  3CK9 A;  1OCC E;  3SGH A;  3MKQ A;  5DIZ A;  4DX2 A;  4F1S A;  2IF4 A;  4BUP A;  2I9C A;  3RU0 A;  4GML A;  3CGH A;  4F53 A;  2WMO A;  4J6I A;  5TTF A;  3ENE A;  4Q96 A;  3PH0 C;  2ILR A;  2B6C A;  4BES A;  3ZNG A;  2P9K G;  1QYM A;  2BF0 X;  2VSN A;  2G46 A;  3IBE A;  1V54 E;  4I6E A; 
#chains in the Genus database with same CATH homology
 4ANV A;  4XI9 A;  3IEG A;  5C1D A;  4M3O A;  5AJL A;  1OWO A;  4ILI A;  2PQN A;  4WNF A;  4F7A A;  3PRZ A;  3QJZ A;  4IN3 B;  4U07 A;  4GYY A;  1QQE A;  5CHE E;  1DNP A;  2EQX A;  1UJJ A;  2X6I A;  4U0U A;  3RIB A;  5BV0 A;  3E4B A;  4G1T A;  2F69 A;  4MI5 A;  3PE4 A;  1TJF A;  5BPP A;  4OVV A;  4BY6 A;  3QDN A;  3ONL A;  1A17 A;  3EHM A;  4AY6 A;  4IYP A;  4XX5 A;  4YPE A;  2VSY A;  3CVL A;  3PVL A;  4EBA A;  3JQ0 A;  1KLX A;  2X3M A;  5KJK A;  4ANU A;  4PS7 A;  2PM6 A;  3MO5 A;  3AS8 A;  3CVY A;  3RK6 A;  4G11 A;  2MRI A;  4GZD A;  2WXN A;  3FFL A;  4DI4 A;  1NA3 A;  3L13 A;  4FP7 A;  3MO0 A;  1MHQ A;  1PC2 A;  2E0I A;  4J8O A;  5A23 A;  1E8Z A;  1OWN A;  2VSX E;  3FUF A;  5TH7 A;  2XPI A;  3CHM A;  4N3B A;  3QNK A;  2HR2 A;  4AXH A;  4C1Q A;  5CMY A;  4XI0 A;  1H6K A;  3LXU X;  2C0L A;  4AV7 A;  3FTS A;  1U3D A;  3OPE A;  1ELW A;  4C0E A;  3FU5 A;  4PH4 B;  4XIF A;  3UUX A;  3RQ4 A;  4I17 A;  3MYV A;  4UQX A;  3IHY A;  4PS3 A;  4DK5 A;  4MI0 A;  3CHP A;  2GRL A;  3HDX A;  4WWN A;  3VTY A;  5CMW A;  4AJW A;  3U66 A;  5JHB A;  2AVP A;  1EPU A;  1H2T C;  2WXR A;  5F6L A;  2LSV A;  2X6K A;  3OXF A;  2YHC A;  3D9I A;  3K5K A;  5JHN A;  3FEX A;  5LSX A;  3SWC A;  4J8E A;  3ZYM A;  3KMJ A;  2WXF A;  4H12 A;  1IHG A;  3LY9 A;  2HYZ A;  1HU3 A;  2FEZ A;  4FLB A;  4G25 A;  4U8H A;  2KC7 A;  5J90 A;  5T0M A;  2XCC A;  3FU6 A;  2ZU6 B;  4U0Z A;  3UPV A;  1KT0 A;  3L16 A;  4I6J A;  5AYF A;  4GU5 A;  3RAY A;  4CT0 A;  4UQY A;  3SD5 A;  1INZ A;  3S8P A;  4JPS A;  3CV0 A;  3ZXS A;  2Q7F A;  2XGS A;  4UWH A;  3DPD A;  4B89 A;  3ZYQ A;  5JIN A;  4I9C A;  3CKB A;  5J08 A;  2WXO A;  3VLD A;  2C2L A;  3T8M A;  4ACL A;  4NRH B;  1HO8 A;  1JPL A;  3ZEF A;  4HOT A;  3FUJ A;  4N3C A;  4O30 A;  3M5A A;  5JJ0 A;  1YA0 A;  3AS4 A;  3MA5 A;  4BX8 A;  3ASG A;  4PS8 A;  4UWL A;  2KM4 A;  2NXP A;  2XRY A;  4FHJ A;  4YVO A;  1E8X A;  2KCK A;  5ENN A;  3T5V A;  4CDN A;  4URK A;  3EJN A;  3M54 A;  4RSY A;  2RFI A;  3Q5M A;  3VTX A;  4Q69 A;  4AOF A;  3G2U A;  3FWV A;  2WQH A;  3LEW A;  4L7T A;  1B89 A;  5DBK A;  5HQ8 A;  3CBO A;  3FTU A;  4GYW A;  4J8D A;  4J7I A;  1ML9 A;  2R17 C;  3Q49 B;  4EBA G;  4Z4P A;  4KYO B;  3KMT A;  3AU4 A;  4XE0 A;  2J08 A;  2L6J A;  5A6C A;  2IOS A;  3G2T A;  4JDS A;  4J8S A;  2NC9 A;  3FH5 A;  4GYO A;  3R7R A;  2WB2 A;  4TV3 A;  1ELR A;  1N54 A;  4YND A;  3FPD A;  2PM7 A;  3MV3 B;  4A1G A;  4AY5 A;  3ML9 A;  4GMJ A;  2CFU A;  4C9B B;  4E85 A;  3OOI A;  3FUK A;  4L23 A;  4XKC A;  3ZYL A;  1SZA A;  1E96 B;  2J07 A;  3CQG B;  3LCA A;  4HOS A;  5BUZ A;  4E6H A;  4UQZ A;  3C98 A;  2BTD A;  4LRZ A;  3L6A A;  2YIN A;  2W5Z A;  4IUL A;  3B7U X;  2IU1 A;  3EIQ C;  3S7F A;  2QY7 A;  5ANR A;  2V0P A;  4HOU A;  1HH8 A;  3D9P A;  4EZL A;  3QC1 A;  3F9Z A;  4BWR A;  2MOW A;  2PL2 A;  4YPU A;  2I6H A;  3BEE A;  1NZN A;  4KMO A;  4BT8 A;  4WNG A;  4UWG A;  3QWP A;  2WQ6 A;  5AIJ A;  3CHS A;  2WXK A;  3ESL A;  3R9A B;  1N52 A;  4BT9 A;  5KJL A;  4IRU A;  1L5J A;  3IKO B;  2I1K A;  3NQP A;  4TUU A;  5G05 J;  4CCA A;  4GAA A;  2V8S E;  5FTP A;  4DPR A;  2AXZ A;  3EDT B;  4FAD A;  1XNF A;  4B8C B;  1OUV A;  4OYS A;  1TJC A;  4EZJ A;  3OAW A;  4D10 C;  4WWP A;  2J09 A;  4I1A A;  2OVF A;  3S7J A;  2JLB A;  2AXV A;  2E2E A;  2WXJ A;  3LDZ A;  1UN9 A;  4NAC A;  3BO5 A;  5A7D B;  2Y4U A;  1Z3Y A;  3UT4 A;  5G05 C;  4I43 A;  1MVX A;  3PDN A;  3PUJ A;  2AXU A;  5EKQ D;  1Z6T A;  3BG0 B;  3U4T A;  3HNA A;  4JA9 A;  2LNI A;  1N6C A;  3UMV A;  2C0M A;  3LKU A;  4Y6C A;  5FQ7 A;  5E76 A;  3F9Y A;  2WXL A;  4XKB A;  1WM5 A;  2YQ8 A;  1FCH A;  4J83 A;  3FUE A;  5EG2 A;  3APF A;  3ZHE B;  4H7X A;  3EHN A;  1ZU2 A;  1Y6I A;  3MJW A;  3MKR A;  4JC8 A;  5T3R A;  1MUF A;  3GZS A;  1NP7 A;  4ME2 A;  4JHR A;  2YNQ A;  1HX8 A;  5KJN A;  4K0R A;  4GZC A;  4R7L A;  3MGB A;  3LY8 A;  5TEG A;  4YPA A;  4KZ0 A;  2KCL A;  3SF4 A;  1OWM A;  4JHK A;  1H2V C;  4EPZ A;  4GA0 A;  1MQS A;  2ION A;  3ZIM A;  4A55 A;  5JJ6 A;  3WXX A;  3FUD A;  5LX8 A;  2UY1 A;  2YHE A;  4LUN U;  1E7V A;  3MV2 B;  3ONK A;  5JJT A;  3M57 A;  3G2S A;  3CR3 A;  4JVS A;  2X38 A;  5F59 A;  3LJ3 A;  3PZD A;  3KEZ A;  1U3C A;  1E8Y A;  4GZ3 A;  2J4D A;  1MVH A;  1KT1 A;  3JQ1 A;  3D9O A;  5C2Y A;  3GYZ A;  1HF8 A;  4CGV A;  3HHM A;  5T5G A;  3Q15 A;  3B13 A;  3T5X A;  2KAT A;  5FJY A;  1IYG A;  4KXK B;  3KAE A;  4MKT A;  4N3A A;  5AYW D;  1PAQ A;  4XZ4 A;  2JV0 A;  3CHR A;  3VLF A;  2BUG A;  1N6A A;  2R3A A;  2CHZ A;  2XPY A;  2LAH A;  4UWF A;  2IGQ A;  3CVN A;  3FH7 A;  4B8A A;  2VQ2 A;  3Q47 B;  4ILG A;  3QAR A;  5G04 C;  3VUZ A;  5BV1 A;  5LSZ A;  4RVB A;  3FTX A;  2VJ8 A;  2FF4 A;  2IQC A;  3B7T A;  2DIW A;  2GW1 A;  4CDM A;  4JHJ A;  3I4G A;  4FC8 A;  4N5C A;  3TL5 A;  3FP3 A;  4AIF A;  3HYM B;  3U64 A;  3CVW A;  5LOZ A;  3KS2 A;  3CKC A;  3ZVV A;  3IHV A;  3QOU A;  4E47 A;  3JCK C;  1QNF A;  4JA7 A;  4WWO A;  2RD0 A;  3FUI A;  2MHK A;  3I5P A;  4MRU A;  2UY1 B;  3FUH A;  4HVB A;  1HXI A;  4CRW A;  4ANW A;  4BSX A;  3L17 A;  4FJY A;  3M56 A;  2WXG A;  3D9M A;  4G26 A;  3MKQ B;  2OOE A;  4ABN A;  3I4R B;  2UWJ G;  4W9R A;  4Q94 A;  3N71 A;  2KZT B;  4OVU A;  3CQC B;  3IV0 A;  4BFR A;  3LVR E;  5G55 A;  4APO A;  3S2A A;  3CEQ A;  2M63 A;  3AS5 A;  1SQM A;  3ML8 A;  4YVQ C;  5AEN A;  4A1S A;  3MEK A;  2WXI A;  2I2O A;  3D9N A;  3SI5 A;  1Y8M A;  3D9L A;  2WXH A;  3U9W A;  4FMU A;  2V5F A;  1E7U A;  3G2W A;  4LER A;  1XGW A;  4DLQ A;  3HVE A;  5ARF A;  1XQH A;  3SW9 A;  4NUR A;  4JEH A;  3GZ1 A;  5G2N A;  4DI3 A;  1FVH A;  4UI9 J;  1IQR A;  2R59 A;  3CST A;  3O4Z A;  3M55 A;  3EIJ A;  4FU3 A;  2PZI A;  1HE8 A;  3I3N A;  1H2U A;  2Y4T A;  4GB9 A;  1FVF A;  4WNE A;  4FLH A;  4QEO A;  3ZN3 A;  4PUC A;  3CBM A;  3F9X A;  3FDH A;  2QPW A;  3HIZ A;  4DJA A;  3NF1 A;  1HZ4 A;  4UI9 K;  2IJG X;  3PEV B;  3ULQ A;  1N3J A;  1HG5 A;  2AWI A;  3M53 A;  3OXL A;  4BTB A;  5E75 A;  3F9W A;  4RG6 A;  4CT4 A;  3CLJ A;  2V4L A;  3CHO A;  4ILH B;  3ZPJ A;  4NJ5 A;  2J9Q A;  4J8F A;  5LCW J;  3SFZ A;  4CGW A;  4HLE A;  4N2Q A;  4H7Y A;  2CHW A;  4HOQ A;  4IJD A;  3APC A;  4LDG A;  2R5S A;  4QEN A;  2IOL A;  4G24 A;  2FI7 A;  4HS2 A;  4L2Y A;  4RG9 A;  3CVU A;  3PEU B;  3TXN A;  2XGO A;  5F5E A;  3QWW A;  2QFC A;  4PDX A;  2DCP A;  3TG4 A;  1PEG A;  2LAI A;  3QB2 A;  2XCB A;  2A5U A;  3CBP A;  4HOR A;  1TEZ A;  1O9S A;  4I6G A;  4U04 A;  5T0K A;  3KMA A;  4ATG A;  5CPR B;  2FUL A;  4G2V A;  1E90 A;  3RRM B;  3FTW A;  2PQR A;  2XGM A;  3UT8 A;  4I2Z A;  2WXQ A;  3EP0 A;  3PNT B;  2VTB A;  3UT7 A;  4F3V A;  4V3I A;  4JZY A;  2FBN A;  3G2V A;  2Y3A A;  5JJ7 A;  3CVV A;  2J49 A;  3CVP A;  5ANL A;  3D3M A;  1QZ2 A;  5D0O D;  2WVI A;  3LVQ E;  3SBS A;  3SNX A;  4CEM A;  4AEZ C;  3BG1 B;  3PS6 A;  2L9B A;  1SZ9 A;  4JLG A;  4JL0 A;  5T8I A;  1HG2 A;  4EQF A;  5JIY A;  4LEU A;  4HXI A;  4MS6 A;  3P2B A;  3D9K A;  4I2W A;  4TRQ A;  4GCN A;  2XRZ A;  3FU3 A;  4ANX A;  2DBA A;  1UJK A;  2GGF A;  1UG3 A;  3ZW3 A;  4JXT A;  1MT6 A;  1W3B A;  2IFU A;  3FUN A;  5EX0 A;  4FA6 A;  3VLE A;  3GW4 A;  3FY4 A;  3LYA A;  4HFG A;  4BTA A;  1LF8 A;  4APF A;  1UW4 B;  4ACK A;  5EDS A;  3S7B A;  3UX4 A;  2P58 C;  4A3V A;  1P5Q A;  3RRU A;  1HS6 A;  3R7Q A;  2X6J A;  1OWL A;  3LS8 A;  2XPZ A;  2CG2 A;  3ZFW A;  3P1U A;  2VYI A;  3CK7 A;  3QWV A;  4WAF A;  3MX3 A;  4KT6 B;  5EX3 A;  1E8W A;  2CHX A;  3OXG A;  4FJZ A;  4KVM A;  3SHF A;  3MCX A;  3ZGQ A;  5M72 A;  2VTB B;  2O8J A;  3AU5 A;  3FUM A;  1WAO 1;  3JYS A;  4LCT A;  3FHE A;  3L22 A;  3FTY A;  3L08 A;  4GPK A;  4YNM A;  3FU0 A;  3PE3 A;  5CCM A;  3ZHE A;  4C0M A;  2WQ7 A;  2NSZ A;  3FTV A;  3CVQ A;  2XEV A;  4JW1 A;  4L2L A;  4U0S A;  1ELK A;  5F6K C;  5KJM A;  4GA2 A;  3OS5 A;  5LFA A;  2GRM A;  3PNL B;  2LSU A;  4GA1 A;  2L0T B;  3VV0 A;  5AJD A;  5LP0 A;  3URZ A;  2WXP A;  1EF1 C;  5ARG A;  5FZS A;  4NVQ A;  1ZBP A;  2XHE A;  1HFA A;  2WXM A;  2X6F A;  4B94 A;  5FT9 A;  3U3W A;  2WMN A;  3JUI A;  3ASF A;  4K03 A;  3LPZ A;  3FTZ A;  1WY6 A;  2RG8 A;  3HVE B;  1H3I A;  4FHK A;  1JWF A;  5CCL A;  5JHA A;  4Y6W A;  2A4Z A;  4I1M A;  3RKV A;  3UQ3 A;  3D9J A;  4N2S A;  2JEK A;  4QEP A;  4P29 A;  4UWK A;  1X5B A;  4A3T A;  3CK8 A;  3ZRH A;  5BT1 A;  3O48 A;  4QFV A;  1NA0 A;  4J0U A;  4EEC A;  1DVP A;  3QK0 A;  3ASD A;  4MLP A;  3RJV A;  2LO6 A;  3B7S A;  4KVO A;  4KZC A;  3MZL B;  3APD A;  3Q4A B;  5FQ6 A;  3IHX A;  5D0Q D;  2FO7 A;  2L0I A;  2BQZ A;  3B7R L;  5T4Y A;  4NQ0 A;  3SZ7 A;  3TG5 A;  1OWP A;  3ESK A;  4GCO A;  4RZ0 A;  3FUL A;  3GZ2 A;  3OTN A;  1EYH A;  3PUK A;  4GZ6 A;  4JEU A;  2WM9 A;  3RO3 A;  4I51 A;  4AU7 A;  3NZU A;  3ZYK A;  2J4B A;  1S0P A;  4L1B A;  4G23 A;  2CG3 A;  5HI7 A;  3K9I A;  4IJ8 A;  4UI9 C;  2CFZ A;  4AP2 A;  4YNP A;  2OVB A;  3ASH A;  3CIA A;  4WUY A;  4AM9 A;  2KZT A;  4I9E A;  3SBT B;  2AW6 A;  3DBS A;  4AVX A;  4N39 A;  3FH8 A;  2HO1 A;  5FZQ A;  1ZKK A;  1H19 A;  3RJW A;  2VSO E;  3DAL A;  1BPO A;  5BW8 C;  3TAX A;  3M59 A;  3RRN B;  5BNW A;  2KCV A;  2OND A;  5FZR A;  3TXM A;  3CK9 A;  4FUL A;  5FWQ A;  2XQ0 A;  3SGH A;  3CSF A;  3LY7 A;  4I1O B;  3M58 A;  5FQ4 A;  2VGX A;  4B0Z A;  3MKQ A;  4O6F A;  1UN8 A;  1VDY A;  3KD7 A;  3QAQ A;  5FQ8 A;  5DIZ A;  4CDR A;  4U63 A;  4BX9 A;  4DLO A;  2IF4 A;  4F1S A;  4BUP A;  2X6H A;  5G04 J;  1JWG A;  3CVX A;  2I9C A;  3RU0 A;  3MO2 A;  3TGO A;  3QKY A;  4KBQ A;  1JUQ A;  4GML A;  2VGY A;  3CGH A;  4F53 A;  2WMO A;  3FEY A;  3S7D A;  3NZS A;  3RO2 A;  3TJP A;  3DB5 A;  4J6I A;  3L54 A;  4J7F A;  4WND A;  4GZ5 A;  5TTF A;  2I1J A;  3ENE A;  3PRE A;  3CHQ A;  4Q96 A;  3PH0 C;  2ILR A;  4EZK A;  2W5Y A;  1GW6 A;  2HM8 A;  1H0A A;  2WPV A;  2VGX B;  5KCM A;  1Z3X A;  1EDU A;  2BF0 X;  2VSN A;  5LCW C;  2G46 A;  3IBE A;  1IQU A;  4I6E A;  1PY1 A;  2OV8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...