5KJPA

Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis h37rv
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
252
structure length
252
Chain Sequence
EPEVLVEQRDRILIITINRPKAKNAVNAAVSRGLADAMDQLDGDAGLSVAILTGGGGSFCAGMDLKAFARGENVVVEGRGLGFTERPPTKPLIAAVEGYALAGGTELALAADLIVAARDSAFGIPEVKRGLVAGGGGLLRLPERIPYAIAMELALTGDNLPAERAHELGLVNVLAEPGTALDAAIALAEKITANGPLAVVATKRIITESRGWSPDTMFAEQMKILVPVFTSNDAKEGAIAFAERRRPRWTGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of enoyl-CoA hydratase from Mycobacterium tuberculosis H37Rv
rcsb
source organism Mycobacterium tuberculosis (strain atcc 25618 / h37rv)
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase
total genus 91
structure length 252
sequence length 252
ec nomenclature ec 4.2.1.17: Enoyl-CoA hydratase.
pdb deposition date 2016-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 5kjpA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 5kjpA01
3WG5A 1FC7A 3QWDA 1Y7OA 5FUSA 4JFCA 3TZ3A 2W3PA 4Q1IA 2FW2A 2QQ3A 5C90A 3HINA 4JWVA 1N6FA 3QKAA 2F9YA 4RCNA 2WTBA 2Q2XA 3Q1TA 1O8UA 3HRXA 4U18A 5CTCA 3MFMA 3FDUA 2IEXA 4KD6A 4JCRA 1SG4A 3T88A 1RJNA 3DJAA 3IBBA 3PGQA 3GLMA 4ZDCA 1Q51A 3ZW9A 4FZWC 2F9IB 3QXZA 4FB8A 3KQFA 2J5IA 4QIIA 1MJ3A 3Q0GA 4ZDEA 4EMMA 5DTPA 4FNDA 3KTGA 1N6EA 2VSSE 4MXIA 3TLFA 3U9TB 4JCSA 1K39A 4LK5A 1UYSA 4JVTA 4JJTA 5E0SA 2DEOA 3K50A 2ZL3A 2Q34A 2A81A 3K8XA 2X58A 1FCFA 2UZFA 5IKLB 4JYLA 2NP9A 3R6HA 5G1SA 2VREA 1TG6A 2VX2A 3M6NA 1NZYA 1JXZA 4WZ8B 2J5GA 1HZDA 1WDKA 3P85A 4ZDDA 1N6DA 2EJ5A 3TVWA 2A7KA 1NZYB 1PIXA 1UYRA 3OT6A 5DU8A 3GF7A 2J5GD 2ZL4A 3L3SA 5C9GA 4K2NA 2CE3A 2FBMA 3LAOA 5E0SH 2A7SA 2PG8A 1EF9A 4QFEA 3T8BA 4U1AA 2GTRA 3VIVA 4Q0GA 5KDRB 3M6MA 4FZWA 2HW5A 3HLN1 4OG1A 4JCTA 1HNOA 3QMJA 3MYBA 1EF8A 5DUCA 1YG8A 4RYFA 2ZL0A 4F47A 4JCQA 2PPYA 3I47A 1ON3A 1YG6A 1DUBA 5DU4A 4U0HA 4ELXA 4KWBA 3SLLA 4QIJA 5KJPA 3G64A 4ZDFA 4GHNA 5DUFA 3RSIA 1FC6A 3STAA 3ZW8A 1WZ8A 4WCZA 4YLHA 4JYJA 3PZKA 3GF3A 3QREA 1HNUA 4JOTA 3V5EA 2F6IA 1PJHA 3OC7A 3NJDA 5DZKA 4I52A 3H0JA 5INFA 1XNWA 4FNBA 5DTWA 2VSSF 4IZBA 5G1QA 4RYFH 1UYTA 3SWXA 4HC8A 3IB9A 3RRVA 4K3WA 3PE8A 4FN7A 4EMPA 3V5IA 5FIFA 2D3TA 3TRRA 3R9TA 4OLQA 2Q35A 2VSUF 5JBWA 3R9SA 2CBYA 3H81A 1WDLA 3KTHA 1ON9A 4Z0MA 1FC9A 1J7XA 3R0OA 4ELWA 3H0SA 4FJWD 4U19A 2VSUA 3T3WA 3TVUA 1VRGA 4OMRA 5CTBA 4WYOB 1RJMA 3H02A 1DCIA 3MOYA 3T8AA 3RSTA 3GMAA 1OD2A 4JSBA 3ZWCA 2F9YB 1SZOA 4ELSA 3R9QA 4KNPA 3FF6A 3U9RB 4G2RA 3QK8A 5JBXA 3P5MA 1W2XA 4U0GH 3TT7A 4B3IA 4EMLA 1WDMA 2PBPA 3Q0JA 2J5IB 1TYFA 4ZU2A 3TT6A 4FN8A 4ZDBA 4I4ZA 5G1RA 3Q7HA 2X24A 3N6RB 5KDRA 4NEKA 2J5II 2BZRA 3PEAA 4L6WA 3GKBA 5DL1A 3HE2A 5MGBA 4IZCA 4NNQA 2VSUC 3LKEA 2DUBA 3QYRA 4B3HA 3TDCA 3KTKA 4IZDA 4K29A 1X0UA 1XNYA 3KTIA 4U0GA 5INGA 4KPKA 2FZSA 3MT6A 1Q52A 3IAVA 2VSSA 3ISAA 3T89A 5DZKH 2VSUE 4DI1A 2F6QA 1OD4A 2C8TA 3BEZA 4L8KA 2ZQQA 3H0UA 1K32A 4B3JA 3HP0A 2J5SA 5INIA 1XNVA 3TV5A 3QXIA 4MOUA 4MI2A 3ZWBA 1XO6A 4HNKA 4I42A 5DKPA 2ZQRA 1UYVA 4ASIA 4GM2A 3KTJA 3OMEA 3DORA 3P2LA 2F9IA 3U9SB 5E0NX 1UIYA 1EY3A 5DU6A 3NJBA 3BPPA 3H0QA 3ST9A 3JU1A 3BF0A 3ZWAA 2ZL2A 1XX4A
chains in the Genus database with same CATH superfamily
3WG5A 1FC7A 3QWDA 1Y7OA 5FUSA 4JFCA 3TZ3A 2W3PA 4Q1IA 2FW2A 2QQ3A 5C90A 3HINA 4JWVA 1N6FA 4HDTA 3QKAA 2F9YA 4RCNA 2WTBA 2Q2XA 3Q1TA 1O8UA 1Y64B 3HRXA 3L8IA 4U18A 5CTCA 3MFMA 3FDUA 2IEXA 4KD6A 4JCRA 1SG4A 3T88A 1RJNA 3BPTA 3DJAA 3IBBA 3PGQA 3GLMA 3W8HB 4ZDCA 1Q51A 3ZW9A 4FZWC 2F9IB 3QXZA 4FB8A 3KQFA 2J5IA 4QIIA 1MJ3A 3O4XE 3ADBA 3Q0GA 4ZDEA 4EMMA 5DTPA 4FNDA 3KTGA 1N6EA 2VSSE 4MXIA 3TLFA 3U9TB 4JCSA 1K39A 4LK5A 1UYSA 4JVTA 4JJTA 5E0SA 2DEOA 3K50A 2ZL3A 2Q34A 2A81A 3L8JA 3K8XA 2X58A 1FCFA 3ADDA 2UZFA 5IKLB 4JYLA 2NP9A 3R6HA 5G1SA 2VREA 1TG6A 2VX2A 3M6NA 1NZYA 1JXZA 4WZ8B 2J5GA 1HZDA 1WDKA 3P85A 4ZDDA 1N6DA 2EJ5A 3IRBA 3TVWA 2A7KA 1NZYB 1PIXA 1UYRA 3OT6A 5DU8A 3GF7A 2J5GD 2ZL4A 3L3SA 5C9GA 4K2NA 2CE3A 2FBMA 3LAOA 5E0SH 2A7SA 2PG8A 3A4LA 1EF9A 4QFEA 3T8BA 4U1AA 2GTRA 3VIVA 4Q0GA 5KDRB 3M6MA 4FZWA 2HW5A 3HLN1 4NARA 4OG1A 4JCTA 1HNOA 3QMJA 3MYBA 1EF8A 4J2UA 5DUCA 3A4NA 1YG8A 4RYFA 2ZL0A 4F47A 4JCQA 2PPYA 3I47A 1ON3A 1YG6A 2P63A 1DUBA 5DU4A 4U0HA 4ELXA 4KWBA 3SLLA 4QIJA 5KJPA 3G64A 4ZDFA 4GHNA 5DUFA 3RSIA 1FC6A 3STAA 3A4MA 3ZW8A 3AJMA 1WZ8A 4WCZA 4YLHA 4JYJA 3PZKA 3GF3A 3QREA 1HNUA 4JOTA 3V5EA 2F6IA 1PJHA 1UX5A 3OC7A 3NJDA 5DZKA 4I52A 3H0JA 5INFA 1XNWA 4FNBA 5DTWA 2VSSF 4IZBA 5G1QA 4RYFH 1UYTA 3SWXA 4HC8A 3IB9A 3RRVA 3RQGA 4K3WA 3PE8A 4FN7A 4EMPA 3V5IA 5FIFA 2D3TA 3TRRA 3R9TA 4OLQA 2Q35A 2VSUF 5JBWA 3R9SA 2CBYA 3H81A 1WDLA 3KTHA 1ON9A 4Z0MA 1FC9A 1J7XA 3R0OA 4ELWA 3H0SA 4FJWD 4U19A 3RQEA 2VSUA 3T3WA 3TVUA 1VRGA 4OMRA 5CTBA 4WYOB 1RJMA 3H02A 1DCIA 3MOYA 3T8AA 3RSTA 3GMAA 1OD2A 4JSBA 3ZWCA 2F9YB 1SZOA 4ELSA 3R9QA 4KNPA 3FF6A 3U9RB 4G2RA 3W8IB 3QK8A 5JBXA 3ADCA 1UX4A 3P5MA 1W2XA 4U0GH 3TT7A 4B3IA 4EMLA 1WDMA 2PBPA 3Q0JA 2J5IB 1TYFA 4ZU2A 3TT6A 4FN8A 4ZDBA 4I4ZA 5G1RA 3Q7HA 2X24A 3N6RB 5KDRA 4NEKA 2J5II 3RQFA 2BZRA 3PEAA 4L6WA 3GKBA 5DL1A 3HE2A 5MGBA 4IZCA 4NNQA 2VSUC 3LKEA 2DUBA 3QYRA 4B3HA 3TDCA 3KTKA 4IZDA 4K29A 1X0UA 1XNYA 3KTIA 4U0GA 5INGA 4KPKA 2FZSA 3MT6A 1Q52A 3IAVA 2VSSA 3ISAA 3T89A 5DZKH 2VSUE 4DI1A 2F6QA 1OD4A 2C8TA 3BEZA 4L8KA 2ZQQA 3H0UA 1K32A 4B3JA 3HP0A 2J5SA 2YJGA 4GEHB 5INIA 1XNVA 3TV5A 3QXIA 4MOUA 4MI2A 3ZWBA 5HUQA 1XO6A 4HNKA 4I42A 5DKPA 2ZQRA 1UYVA 4ASIA 4GM2A 3KTJA 3OMEA 3DORA 3P2LA 2F9IA 3AM1A 3U9SB 5E0NX 1UIYA 1EY3A 5DU6A 3NJBA 3BPPA 3H0QA 3ST9A 3JU1A 3BF0A 3ZWAA 2ZL2A 1XX4A
chains in the Genus database with same CATH topology
3WG5A 1FC7A 3QWDA 1Y7OA 5FUSA 4JFCA 3TZ3A 2W3PA 4Q1IA 2FW2A 2QQ3A 5C90A 3HINA 4JWVA 1N6FA 4HDTA 3QKAA 2F9YA 4RCNA 2WTBA 2Q2XA 3Q1TA 1O8UA 3HRXA 4U18A 5CTCA 3MFMA 3FDUA 2IEXA 4KD6A 4JCRA 1SG4A 3T88A 1RJNA 3BPTA 3DJAA 3IBBA 3PGQA 3GLMA 4ZDCA 1Q51A 3ZW9A 4FZWC 2F9IB 3QXZA 4FB8A 3KQFA 2J5IA 4QIIA 1MJ3A 3Q0GA 4ZDEA 4EMMA 5DTPA 4FNDA 3KTGA 1N6EA 2VSSE 4MXIA 3TLFA 3U9TB 4JCSA 1K39A 4LK5A 1UYSA 4JVTA 4JJTA 5E0SA 2DEOA 3K50A 2ZL3A 2Q34A 2A81A 3K8XA 2X58A 1FCFA 2UZFA 5IKLB 4JYLA 2NP9A 3R6HA 5G1SA 2VREA 1TG6A 2VX2A 3M6NA 1NZYA 1JXZA 4WZ8B 2J5GA 1HZDA 1WDKA 3P85A 4ZDDA 1N6DA 2EJ5A 3TVWA 2A7KA 1NZYB 1PIXA 1UYRA 3OT6A 5DU8A 3GF7A 2J5GD 2ZL4A 3L3SA 5C9GA 4K2NA 2CE3A 2FBMA 3LAOA 5E0SH 2A7SA 2PG8A 1EF9A 4QFEA 3T8BA 4U1AA 2GTRA 3VIVA 4Q0GA 5KDRB 3M6MA 4FZWA 2HW5A 3HLN1 4NARA 4OG1A 4JCTA 1HNOA 3QMJA 3MYBA 1EF8A 4J2UA 5DUCA 1YG8A 4RYFA 2ZL0A 4F47A 4JCQA 2PPYA 3I47A 1ON3A 1YG6A 1DUBA 5DU4A 4U0HA 4ELXA 4KWBA 3SLLA 4QIJA 5KJPA 3G64A 4ZDFA 4GHNA 5DUFA 3RSIA 1FC6A 3STAA 3ZW8A 1WZ8A 4WCZA 4YLHA 4JYJA 3PZKA 3GF3A 3QREA 1HNUA 4JOTA 3V5EA 2F6IA 1PJHA 3OC7A 3NJDA 5DZKA 4I52A 3H0JA 5INFA 1XNWA 4FNBA 5DTWA 2VSSF 4IZBA 5G1QA 4RYFH 1UYTA 3SWXA 4HC8A 3IB9A 3RRVA 4K3WA 3PE8A 4FN7A 4EMPA 3V5IA 5FIFA 2D3TA 3TRRA 3R9TA 4OLQA 2Q35A 2VSUF 5JBWA 3R9SA 2CBYA 3H81A 1WDLA 3KTHA 1ON9A 4Z0MA 1FC9A 1J7XA 3R0OA 4ELWA 3H0SA 4FJWD 4U19A 2VSUA 3T3WA 3TVUA 1VRGA 4OMRA 5CTBA 4WYOB 1RJMA 3H02A 1DCIA 3MOYA 3T8AA 3RSTA 3GMAA 1OD2A 4JSBA 3ZWCA 2F9YB 1SZOA 4ELSA 3R9QA 4KNPA 3FF6A 3U9RB 4G2RA 3QK8A 5JBXA 3P5MA 1W2XA 4U0GH 3TT7A 4B3IA 4EMLA 1WDMA 2PBPA 3Q0JA 2J5IB 1TYFA 4ZU2A 3TT6A 4FN8A 4ZDBA 4I4ZA 5G1RA 3Q7HA 2X24A 3N6RB 5KDRA 4NEKA 2J5II 2BZRA 3PEAA 4L6WA 3GKBA 5DL1A 3HE2A 5MGBA 4IZCA 4NNQA 2VSUC 3LKEA 2DUBA 3QYRA 4B3HA 3TDCA 3KTKA 4IZDA 4K29A 1X0UA 1XNYA 3KTIA 4U0GA 5INGA 4KPKA 2FZSA 3MT6A 1Q52A 3IAVA 2VSSA 3ISAA 3T89A 5DZKH 2VSUE 4DI1A 2F6QA 1OD4A 2C8TA 3BEZA 4L8KA 2ZQQA 3H0UA 1K32A 4B3JA 3HP0A 2J5SA 2YJGA 5INIA 1XNVA 3TV5A 3QXIA 4MOUA 4MI2A 3ZWBA 5HUQA 1XO6A 4HNKA 4I42A 5DKPA 2ZQRA 1UYVA 4ASIA 4GM2A 3KTJA 3OMEA 3DORA 3P2LA 2F9IA 3U9SB 5E0NX 1UIYA 1EY3A 5DU6A 3NJBA 3BPPA 3H0QA 3ST9A 3JU1A 3BF0A 3ZWAA 2ZL2A 1XX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WG5 A;  1FC7 A;  3QWD A;  1Y7O A;  5FUS A;  4JFC A;  3TZ3 A;  2W3P A;  4Q1I A;  2FW2 A;  2QQ3 A;  5C90 A;  3HIN A;  4JWV A;  1N6F A;  3QKA A;  2F9Y A;  4RCN A;  2WTB A;  2Q2X A;  3Q1T A;  1O8U A;  3HRX A;  4U18 A;  5CTC A;  3MFM A;  3FDU A;  2IEX A;  4KD6 A;  4JCR A;  1SG4 A;  3T88 A;  1RJN A;  3DJA A;  3IBB A;  3PGQ A;  3GLM A;  4ZDC A;  1Q51 A;  3ZW9 A;  4FZW C;  2F9I B;  3QXZ A;  4FB8 A;  3KQF A;  2J5I A;  4QII A;  1MJ3 A;  3Q0G A;  4ZDE A;  4EMM A;  5DTP A;  4FND A;  3KTG A;  1N6E A;  2VSS E;  4MXI A;  3TLF A;  3U9T B;  4JCS A;  1K39 A;  4LK5 A;  1UYS A;  4JVT A;  4JJT A;  5E0S A;  2DEO A;  3K50 A;  2ZL3 A;  2Q34 A;  2A81 A;  3K8X A;  2X58 A;  1FCF A;  2UZF A;  5IKL B;  4JYL A;  2NP9 A;  3R6H A;  5G1S A;  2VRE A;  1TG6 A;  2VX2 A;  3M6N A;  1NZY A;  1JXZ A;  4WZ8 B;  2J5G A;  1HZD A;  1WDK A;  3P85 A;  4ZDD A;  1N6D A;  2EJ5 A;  3TVW A;  2A7K A;  1NZY B;  1PIX A;  1UYR A;  3OT6 A;  5DU8 A;  3GF7 A;  2J5G D;  2ZL4 A;  3L3S A;  5C9G A;  4K2N A;  2CE3 A;  2FBM A;  3LAO A;  5E0S H;  2A7S A;  2PG8 A;  1EF9 A;  4QFE A;  3T8B A;  4U1A A;  2GTR A;  3VIV A;  4Q0G A;  5KDR B;  3M6M A;  4FZW A;  2HW5 A;  3HLN 1;  4OG1 A;  4JCT A;  1HNO A;  3QMJ A;  3MYB A;  1EF8 A;  5DUC A;  1YG8 A;  4RYF A;  2ZL0 A;  4F47 A;  4JCQ A;  2PPY A;  3I47 A;  1ON3 A;  1YG6 A;  1DUB A;  5DU4 A;  4U0H A;  4ELX A;  4KWB A;  3SLL A;  4QIJ A;  5KJP A;  3G64 A;  4ZDF A;  4GHN A;  5DUF A;  3RSI A;  1FC6 A;  3STA A;  3ZW8 A;  1WZ8 A;  4WCZ A;  4YLH A;  4JYJ A;  3PZK A;  3GF3 A;  3QRE A;  1HNU A;  4JOT A;  3V5E A;  2F6I A;  1PJH A;  3OC7 A;  3NJD A;  5DZK A;  4I52 A;  3H0J A;  5INF A;  1XNW A;  4FNB A;  5DTW A;  2VSS F;  4IZB A;  5G1Q A;  4RYF H;  1UYT A;  3SWX A;  4HC8 A;  3IB9 A;  3RRV A;  4K3W A;  3PE8 A;  4FN7 A;  4EMP A;  3V5I A;  5FIF A;  2D3T A;  3TRR A;  3R9T A;  4OLQ A;  2Q35 A;  2VSU F;  5JBW A;  3R9S A;  2CBY A;  3H81 A;  1WDL A;  3KTH A;  1ON9 A;  4Z0M A;  1FC9 A;  1J7X A;  3R0O A;  4ELW A;  3H0S A;  4FJW D;  4U19 A;  2VSU A;  3T3W A;  3TVU A;  1VRG A;  4OMR A;  5CTB A;  4WYO B;  1RJM A;  3H02 A;  1DCI A;  3MOY A;  3T8A A;  3RST A;  3GMA A;  1OD2 A;  4JSB A;  3ZWC A;  2F9Y B;  1SZO A;  4ELS A;  3R9Q A;  4KNP A;  3FF6 A;  3U9R B;  4G2R A;  3QK8 A;  5JBX A;  3P5M A;  1W2X A;  4U0G H;  3TT7 A;  4B3I A;  4EML A;  1WDM A;  2PBP A;  3Q0J A;  2J5I B;  1TYF A;  4ZU2 A;  3TT6 A;  4FN8 A;  4ZDB A;  4I4Z A;  5G1R A;  3Q7H A;  2X24 A;  3N6R B;  5KDR A;  4NEK A;  2J5I I;  2BZR A;  3PEA A;  4L6W A;  3GKB A;  5DL1 A;  3HE2 A;  5MGB A;  4IZC A;  4NNQ A;  2VSU C;  3LKE A;  2DUB A;  3QYR A;  4B3H A;  3TDC A;  3KTK A;  4IZD A;  4K29 A;  1X0U A;  1XNY A;  3KTI A;  4U0G A;  5ING A;  4KPK A;  2FZS A;  3MT6 A;  1Q52 A;  3IAV A;  2VSS A;  3ISA A;  3T89 A;  5DZK H;  2VSU E;  4DI1 A;  2F6Q A;  1OD4 A;  2C8T A;  3BEZ A;  4L8K A;  2ZQQ A;  3H0U A;  1K32 A;  4B3J A;  3HP0 A;  2J5S A;  5INI A;  1XNV A;  3TV5 A;  3QXI A;  4MOU A;  4MI2 A;  3ZWB A;  1XO6 A;  4HNK A;  4I42 A;  5DKP A;  2ZQR A;  1UYV A;  4ASI A;  4GM2 A;  3KTJ A;  3OME A;  3DOR A;  3P2L A;  2F9I A;  3U9S B;  5E0N X;  1UIY A;  1EY3 A;  5DU6 A;  3NJB A;  3BPP A;  3H0Q A;  3ST9 A;  3JU1 A;  3BF0 A;  3ZWA A;  2ZL2 A;  1XX4 A; 
#chains in the Genus database with same CATH topology
 3WG5 A;  1FC7 A;  3QWD A;  1Y7O A;  5FUS A;  4JFC A;  3TZ3 A;  2W3P A;  4Q1I A;  2FW2 A;  2QQ3 A;  5C90 A;  3HIN A;  4JWV A;  1N6F A;  4HDT A;  3QKA A;  2F9Y A;  4RCN A;  2WTB A;  2Q2X A;  3Q1T A;  1O8U A;  1Y64 B;  3HRX A;  3L8I A;  4U18 A;  5CTC A;  3MFM A;  3FDU A;  2IEX A;  4KD6 A;  4JCR A;  1SG4 A;  3T88 A;  1RJN A;  3BPT A;  3DJA A;  3IBB A;  3PGQ A;  3GLM A;  3W8H B;  4ZDC A;  1Q51 A;  3ZW9 A;  4FZW C;  2F9I B;  3QXZ A;  4FB8 A;  3KQF A;  2J5I A;  4QII A;  1MJ3 A;  3O4X E;  3ADB A;  3Q0G A;  4ZDE A;  4EMM A;  5DTP A;  4FND A;  3KTG A;  1N6E A;  2VSS E;  4MXI A;  3TLF A;  3U9T B;  4JCS A;  1K39 A;  4LK5 A;  1UYS A;  4JVT A;  4JJT A;  5E0S A;  2DEO A;  3K50 A;  2ZL3 A;  2Q34 A;  2A81 A;  3L8J A;  3K8X A;  2X58 A;  1FCF A;  3ADD A;  2UZF A;  5IKL B;  4JYL A;  2NP9 A;  3R6H A;  5G1S A;  2VRE A;  1TG6 A;  2VX2 A;  3M6N A;  1NZY A;  1JXZ A;  4WZ8 B;  2J5G A;  1HZD A;  1WDK A;  3P85 A;  4ZDD A;  1N6D A;  2EJ5 A;  3IRB A;  3TVW A;  2A7K A;  1NZY B;  1PIX A;  1UYR A;  3OT6 A;  5DU8 A;  3GF7 A;  2J5G D;  2ZL4 A;  3L3S A;  5C9G A;  4K2N A;  2CE3 A;  2FBM A;  3LAO A;  5E0S H;  2A7S A;  2PG8 A;  3A4L A;  1EF9 A;  4QFE A;  3T8B A;  4U1A A;  2GTR A;  3VIV A;  4Q0G A;  5KDR B;  3M6M A;  4FZW A;  2HW5 A;  3HLN 1;  4NAR A;  4OG1 A;  4JCT A;  1HNO A;  3QMJ A;  3MYB A;  1EF8 A;  4J2U A;  5DUC A;  3A4N A;  1YG8 A;  4RYF A;  2ZL0 A;  4F47 A;  4JCQ A;  2PPY A;  3I47 A;  1ON3 A;  1YG6 A;  2P63 A;  1DUB A;  5DU4 A;  4U0H A;  4ELX A;  4KWB A;  3SLL A;  4QIJ A;  5KJP A;  3G64 A;  4ZDF A;  4GHN A;  5DUF A;  3RSI A;  1FC6 A;  3STA A;  3A4M A;  3ZW8 A;  3AJM A;  1WZ8 A;  4WCZ A;  4YLH A;  4JYJ A;  3PZK A;  3GF3 A;  3QRE A;  1HNU A;  4JOT A;  3V5E A;  2F6I A;  1PJH A;  1UX5 A;  3OC7 A;  3NJD A;  5DZK A;  4I52 A;  3H0J A;  5INF A;  1XNW A;  4FNB A;  5DTW A;  2VSS F;  4IZB A;  5G1Q A;  4RYF H;  1UYT A;  3SWX A;  4HC8 A;  3IB9 A;  3RRV A;  3RQG A;  4K3W A;  3PE8 A;  4FN7 A;  4EMP A;  3V5I A;  5FIF A;  2D3T A;  3TRR A;  3R9T A;  4OLQ A;  2Q35 A;  2VSU F;  5JBW A;  3R9S A;  2CBY A;  3H81 A;  1WDL A;  3KTH A;  1ON9 A;  4Z0M A;  1FC9 A;  1J7X A;  3R0O A;  4ELW A;  3H0S A;  4FJW D;  4U19 A;  3RQE A;  2VSU A;  3T3W A;  3TVU A;  1VRG A;  4OMR A;  5CTB A;  4WYO B;  1RJM A;  3H02 A;  1DCI A;  3MOY A;  3T8A A;  3RST A;  3GMA A;  1OD2 A;  4JSB A;  3ZWC A;  2F9Y B;  1SZO A;  4ELS A;  3R9Q A;  4KNP A;  3FF6 A;  3U9R B;  4G2R A;  3W8I B;  3QK8 A;  5JBX A;  3ADC A;  1UX4 A;  3P5M A;  1W2X A;  4U0G H;  3TT7 A;  4B3I A;  4EML A;  1WDM A;  2PBP A;  3Q0J A;  2J5I B;  1TYF A;  4ZU2 A;  3TT6 A;  4FN8 A;  4ZDB A;  4I4Z A;  5G1R A;  3Q7H A;  2X24 A;  3N6R B;  5KDR A;  4NEK A;  2J5I I;  3RQF A;  2BZR A;  3PEA A;  4L6W A;  3GKB A;  5DL1 A;  3HE2 A;  5MGB A;  4IZC A;  4NNQ A;  2VSU C;  3LKE A;  2DUB A;  3QYR A;  4B3H A;  3TDC A;  3KTK A;  4IZD A;  4K29 A;  1X0U A;  1XNY A;  3KTI A;  4U0G A;  5ING A;  4KPK A;  2FZS A;  3MT6 A;  1Q52 A;  3IAV A;  2VSS A;  3ISA A;  3T89 A;  5DZK H;  2VSU E;  4DI1 A;  2F6Q A;  1OD4 A;  2C8T A;  3BEZ A;  4L8K A;  2ZQQ A;  3H0U A;  1K32 A;  4B3J A;  3HP0 A;  2J5S A;  2YJG A;  4GEH B;  5INI A;  1XNV A;  3TV5 A;  3QXI A;  4MOU A;  4MI2 A;  3ZWB A;  5HUQ A;  1XO6 A;  4HNK A;  4I42 A;  5DKP A;  2ZQR A;  1UYV A;  4ASI A;  4GM2 A;  3KTJ A;  3OME A;  3DOR A;  3P2L A;  2F9I A;  3AM1 A;  3U9S B;  5E0N X;  1UIY A;  1EY3 A;  5DU6 A;  3NJB A;  3BPP A;  3H0Q A;  3ST9 A;  3JU1 A;  3BF0 A;  3ZWA A;  2ZL2 A;  1XX4 A; 
#chains in the Genus database with same CATH homology
 3WG5 A;  1FC7 A;  3QWD A;  1Y7O A;  5FUS A;  4JFC A;  3TZ3 A;  2W3P A;  4Q1I A;  2FW2 A;  2QQ3 A;  5C90 A;  3HIN A;  4JWV A;  1N6F A;  4HDT A;  3QKA A;  2F9Y A;  4RCN A;  2WTB A;  2Q2X A;  3Q1T A;  1O8U A;  3HRX A;  4U18 A;  5CTC A;  3MFM A;  3FDU A;  2IEX A;  4KD6 A;  4JCR A;  1SG4 A;  3T88 A;  1RJN A;  3BPT A;  3DJA A;  3IBB A;  3PGQ A;  3GLM A;  4ZDC A;  1Q51 A;  3ZW9 A;  4FZW C;  2F9I B;  3QXZ A;  4FB8 A;  3KQF A;  2J5I A;  4QII A;  1MJ3 A;  3Q0G A;  4ZDE A;  4EMM A;  5DTP A;  4FND A;  3KTG A;  1N6E A;  2VSS E;  4MXI A;  3TLF A;  3U9T B;  4JCS A;  1K39 A;  4LK5 A;  1UYS A;  4JVT A;  4JJT A;  5E0S A;  2DEO A;  3K50 A;  2ZL3 A;  2Q34 A;  2A81 A;  3K8X A;  2X58 A;  1FCF A;  2UZF A;  5IKL B;  4JYL A;  2NP9 A;  3R6H A;  5G1S A;  2VRE A;  1TG6 A;  2VX2 A;  3M6N A;  1NZY A;  1JXZ A;  4WZ8 B;  2J5G A;  1HZD A;  1WDK A;  3P85 A;  4ZDD A;  1N6D A;  2EJ5 A;  3TVW A;  2A7K A;  1NZY B;  1PIX A;  1UYR A;  3OT6 A;  5DU8 A;  3GF7 A;  2J5G D;  2ZL4 A;  3L3S A;  5C9G A;  4K2N A;  2CE3 A;  2FBM A;  3LAO A;  5E0S H;  2A7S A;  2PG8 A;  1EF9 A;  4QFE A;  3T8B A;  4U1A A;  2GTR A;  3VIV A;  4Q0G A;  5KDR B;  3M6M A;  4FZW A;  2HW5 A;  3HLN 1;  4NAR A;  4OG1 A;  4JCT A;  1HNO A;  3QMJ A;  3MYB A;  1EF8 A;  4J2U A;  5DUC A;  1YG8 A;  4RYF A;  2ZL0 A;  4F47 A;  4JCQ A;  2PPY A;  3I47 A;  1ON3 A;  1YG6 A;  1DUB A;  5DU4 A;  4U0H A;  4ELX A;  4KWB A;  3SLL A;  4QIJ A;  5KJP A;  3G64 A;  4ZDF A;  4GHN A;  5DUF A;  3RSI A;  1FC6 A;  3STA A;  3ZW8 A;  1WZ8 A;  4WCZ A;  4YLH A;  4JYJ A;  3PZK A;  3GF3 A;  3QRE A;  1HNU A;  4JOT A;  3V5E A;  2F6I A;  1PJH A;  3OC7 A;  3NJD A;  5DZK A;  4I52 A;  3H0J A;  5INF A;  1XNW A;  4FNB A;  5DTW A;  2VSS F;  4IZB A;  5G1Q A;  4RYF H;  1UYT A;  3SWX A;  4HC8 A;  3IB9 A;  3RRV A;  4K3W A;  3PE8 A;  4FN7 A;  4EMP A;  3V5I A;  5FIF A;  2D3T A;  3TRR A;  3R9T A;  4OLQ A;  2Q35 A;  2VSU F;  5JBW A;  3R9S A;  2CBY A;  3H81 A;  1WDL A;  3KTH A;  1ON9 A;  4Z0M A;  1FC9 A;  1J7X A;  3R0O A;  4ELW A;  3H0S A;  4FJW D;  4U19 A;  2VSU A;  3T3W A;  3TVU A;  1VRG A;  4OMR A;  5CTB A;  4WYO B;  1RJM A;  3H02 A;  1DCI A;  3MOY A;  3T8A A;  3RST A;  3GMA A;  1OD2 A;  4JSB A;  3ZWC A;  2F9Y B;  1SZO A;  4ELS A;  3R9Q A;  4KNP A;  3FF6 A;  3U9R B;  4G2R A;  3QK8 A;  5JBX A;  3P5M A;  1W2X A;  4U0G H;  3TT7 A;  4B3I A;  4EML A;  1WDM A;  2PBP A;  3Q0J A;  2J5I B;  1TYF A;  4ZU2 A;  3TT6 A;  4FN8 A;  4ZDB A;  4I4Z A;  5G1R A;  3Q7H A;  2X24 A;  3N6R B;  5KDR A;  4NEK A;  2J5I I;  2BZR A;  3PEA A;  4L6W A;  3GKB A;  5DL1 A;  3HE2 A;  5MGB A;  4IZC A;  4NNQ A;  2VSU C;  3LKE A;  2DUB A;  3QYR A;  4B3H A;  3TDC A;  3KTK A;  4IZD A;  4K29 A;  1X0U A;  1XNY A;  3KTI A;  4U0G A;  5ING A;  4KPK A;  2FZS A;  3MT6 A;  1Q52 A;  3IAV A;  2VSS A;  3ISA A;  3T89 A;  5DZK H;  2VSU E;  4DI1 A;  2F6Q A;  1OD4 A;  2C8T A;  3BEZ A;  4L8K A;  2ZQQ A;  3H0U A;  1K32 A;  4B3J A;  3HP0 A;  2J5S A;  2YJG A;  5INI A;  1XNV A;  3TV5 A;  3QXI A;  4MOU A;  4MI2 A;  3ZWB A;  5HUQ A;  1XO6 A;  4HNK A;  4I42 A;  5DKP A;  2ZQR A;  1UYV A;  4ASI A;  4GM2 A;  3KTJ A;  3OME A;  3DOR A;  3P2L A;  2F9I A;  3U9S B;  5E0N X;  1UIY A;  1EY3 A;  5DU6 A;  3NJB A;  3BPP A;  3H0Q A;  3ST9 A;  3JU1 A;  3BF0 A;  3ZWA A;  2ZL2 A;  1XX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...