5KKZC

Rhodobacter sphaeroides bc1 with famoxadone
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
b'GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
molecule tags Oxidoreductase
source organism Rhodobacter sphaeroides
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
total genus 51
structure length 179
sequence length 179
chains with identical sequence G, M, Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5kkzC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5kkzC02
2QJYC 2WSCJ 3GCEA 1SQQE 1O7NA 4H44D 2YFJA 2FYNC 4IL6X 4KT0J 1L0NE 1EZVE 3EN1A 3GKEA 1VCKA 2B24A 2NUKA 4HJLA 2CKFA 2JO6A 3BCCE 4NBFD 4QDCA 4HM5A 4QCKA 5AEWA 4QUPA 4H0LB 2D2CD 2YVJB 4P1BH 3VMHD 2WSEJ 3L72E 2Q3WA 4HM8A 1WQLA 5KLIC 2XR8A 1NDOA 1O7HA 4NBHD 4RKUJ 4NB9D 3L73E 2E74D 1RIEA 2E4QA 5L8RJ 1SJGA 4QDFB 1PP9E 3GTSA 3GTEA 3DQYA 2FYUE 2D2CB 2DE5D 3CXHE 1ULJA 2NVGA 1EG9A 1O7WA 2E76B 3EQQA 3L70E 2BMRA 4EMJB 3FOUA 5CXMA 4HM6A 1O7MA 1VF5D 1SQPE 3H1HE 2BMOA 1RFSA 3GL0A 1SQBE 1UUVA 2B1XA 2ZYLA 2YIUC 4I7ZB 2HMJA 3VMGD 4NBAD 2ZT9D 2DE7D 2XSOA 2XSHA 2QPZA 2NVEA 4OGQD 3LW5J 4NBDD 2QJKC 4NB8D 2QSIA 4PV1D 1UUWA 2JZAA 2XRXA 2WPVB 5AEUA 4NBED 4HM4A 3VCAA 1ZRTE 2DE6D 3GL2A 3AZCA 3H1KE 3L74E 4AAYB 1NU1E 3GB4A 2K9YA 3C8VA 2O01J 3N0QA 1FQTA 4HM0A 3CWBE 3D89A 2HMKA 4PD4E 4OGQB 4H13D 4QURA 4PV1B 1BCCE 1NTME 2E74B 2HMNA 1NTZE 2NVFA 1O7PA 3L71E 3VMID 2E4PA 4P1CH 4H44B 1Q90C 4HKVA 4QUQA 4NBCD 1SQXE 1G8KB 4HM3A 1JB0J 1KB9E 1NTKE 2GBWA 2E76D 1L0LE 1S5LX 1SQVE 2QJPC 2QIWA 2A06E 3C0DA 5BOKA 1VF5B 4H0LD 2GBXA 2YFLA 2E75D 3H1LE 1KYOE 3VCPA 3CX5E 2ZT9B 2IBZE 4NBGD 2WSFJ 4Y28J 4QDFA 4U3FE 2NUMA 5KKZC 2NWFA 5KLVE 1O7GA 2BMQA 2HMLA 4NBBD 1Q90D 3GZYA 1NYKA 4AIVA 4HM2A 4QDDA 1ULIA 3TGUE 1PPJE 4H13B 3GZXA 3H1IE 4HM7A 2E75B 1VM9A 4HM1A 2BCCE 2YFIA 2HMOA 3GOBA 3L75E 2HMMA 1BE3E 1JM1A 5HL4A 1G8JB 1P84E 3H1JE 2I7FA
chains in the Genus database with same CATH superfamily
3L75G 4K3AA 1YYCA 3UIAA 1LTAC 3G4SP 2KSJA 3HRNA 3M0AA 1KILB 3GLMA 5CBNA 1EC5A 1IFNA 2IFNA 4ZMDA 3PLNA 4H0LC 1URQA 3NFQA 3CCMP 1PP9G 2Z5IA 4RKUJ 4GOEA 2O01H 2M3EA 3L37A 1LTTC 3M9QA 1ZN5A 2ZVNB 4NPFX 1VQ6P 4D6TE 3PHLA 3L73J 4EMJB 1BGYJ 2OTKE 2FKWB 2B1XA 2YIUC 2NPSA 3VMZA 1N73B 4AUWA 4OGQD 1GL2C 4I2LC 2GA1A 3G6EP 2QSIA 5KJ7C 2Q5UA 1EDJA 3CX5H 3EWKA 3B5NB 3Q2YA 2AEMA 3O8ZA 4WY4A 2FXMA 1FJPA 1LP1B 1RHZB 3SWYA 2WSEH 4H44B 1FE6A 1LTJC 3TGUG 1L4AA 1ZP0C 1NTKE 1JM0A 1YTZT 2KK7A 1SQVE 2KZJA 2A45I 1VF5B 2IBZG 3V4QA 3LIDA 3M0DA 3VMAA 5CCGC 1ZR2A 4DCKA 1U57A 4GKGA 1O7GA 3RL0D 3SWFA 2E75B 3VMXA 3BCCG 4BXLA 3D70A 2A06G 2OTJP 1M56D 1T3JA 5AVVB 1SFCB 3KZIH 3L71J 1RF0C 2RN0A 3H1JG 1UIXA 4XFJA 1SFCA 1VQPP 2FYNC 1U7JA 1RE4C 1BDDA 2CKFA 1LGHB 1KC8Q 1PL5A 4P1BH 3VOPA 3CCJP 2K9JB 2IZ0A 3L72E 1NHLA 2BCCD 3P32A 5KLIC 4NBHD 4U3FD 1AVOA 3RK3C 1NTZK 1CI6A 2QVAA 1FS0E 3F89A 2KNCB 1KFNA 1NH4A 1YI2P 1GDTA 1VQLP 2QE7H 1UUVA 2YO3A 4QMAA 1FZGA 2ZYDA 2PP6A 4U3FJ 1EXJA 1WT6A 1R5LA 1ZRTE 1RE3A 3RK2B 3GB4A 1KILC 3VP8A 4L76A 4JPZB 4W7YA 2GUVA 3MHVA 5KLVG 1SQXG 4WWIA 1O7PA 3VMID 3L72J 2H89C 4HKVA 2OQQA 3GHGC 4NBCD 2Q9IA 3AE9C 2M5AA 2GBWA 3KXDA 4HB1A 1JUNA 1SQQK 1FJKA 2NWFA 2BMQA 2HMLA 3CC2P 1L4AB 3FX0A 1JMBA 2K37A 2BCCE 2CK3H 3M91A 2KSEA 5APUA 2IPPA 1D7MA 1K05A 1P84E 2I7FA 1QX8A 2QJYC 3R4YA 1SQQE 2WT7B 4KT0J 2KB7P 1K8AQ 4Z1MH 1NJIQ 3L74J 4TT3H 4NBFD 5AEWA 3B5NC 1N73A 3Q5SA 3H1LG 2WPRA 1GL2B 3D6YA 4H44C 1SJGA 1LT9C 2WSSH 3GTSA 1AQTA 3L73G 2KUBA 4AYCA 3L74G 3KDPB 1O7WA 3BRTB 1KMIZ 4DZOA 2QRXA 4NBAD 4TLFA 1DD3A 2XDJA 3H1LJ 1SQBG 1RF1A 1KN7A 1H89A 3LW5J 4PV1D 1L0LD 5KJ7A 5TISH 1FC2C 1Q82Q 3CXHD 2HMKA 1M7LA 2Q6QA 3GF3A 1NTZJ 2M0BA 2E74B 2HMNA 3L71E 3H25A 3V2RA 1U7MA 2KXPB 1URQD 2Q1KA 3AE3C 1PGQA 1LTGC 1N7LA 2I1KA 3CPWO 2Y0DA 3K5BA 3MIWA 1GK6A 2ZFCA 4JYCA 3TNUA 2AXCA 1X9VA 5B66E 2RH0A 1RF0A 3T97A 4YXWH 1KORA 2J58A 1N8RQ 1NTZD 3L36A 5CJ4A 2NRGA 2I1JA 3I5CA 2FFDA 2W27A 5APSA 2QJPB 4XA4A 1JCDA 1LTIC 1SLQA 2WT7A 3WUTA 1VDFA 2KLVA 1YIJP 2YO2A 3GMAA 5APXA 2D2CB 2DE5D 3CC7P 1FDIA 1AV1A 1SFCD 1JY3O 2N1TD 2L5GB 1NKZB 1X79B 3MZWB 2HODB 2XU6A 3KYQA 4XE5B 4NBED 1FZAA 1GW3A 2W83C 3AE6C 4UB6H 3IR9A 2WWWA 1BSNA 2B88A 1SQXJ 2QM8A 1IZNB 1USDA 2E4PA 2OYOA 3M06A 1KV4A 5AVRB 1JNMA 2JDIH 1G2CB 4WY4B 3AEFC 3HD7D 1S1CX 5APTA 2OGUA 5CCHC 3BVHA 2IBZE 2ZT9B 1EZVD 4LC1A 1GMJA 2NUMA 1GL2D 3H32A 3C9IA 5M1BA 1ZXGA 1H8AA 1IFDA 5BU5A 1BE3D 3BATA 1GL2A 1RQUA 2A06D 3FXEA 3B4SA 1TU3F 2HPCB 1MFZA 1GU5A 1IFIA 1Q86Q 5AW3B 4GOFA 4PD4D 1FZBA 2FYUJ 1NU1J 1L0LJ 3L71G 3JC22 2LXCB 2E4QA 2YNYA 5KAIH 5CMZA 3DQYA 2FYUE 1IFPA 1CI6B 3L35A 3EQQA 3USSA 3V6IA 4ZNCA 1ZV8A 4R4LA 3D71A 1X22A 2QJKC 2E5YA 4BRYA 5CCGD 5KLVJ 3V2PA 2YMYA 3RL0g 3N0QA 1ZR4A 4EOTA 3TYYA 2RKLA 3GHGB 3S9OA 2R32A 4EIJA 1IO4A 1G8KB 1FAVA 2KZIA 2AXTH 4N6JA 2N9BA 2A06E 4H0LD 4DOJA 3H1LE 4KJMA 4IL6E 1HBWA 1NGMB 3KHUA 4I1LA 1BCCG 1VL2A 4EYYQ 2PFXA 1JTHA 2CPSA 1BCCD 2A45H 4I7ZC 2BEZF 1OFCX 3PH0A 2Z4EA 1KILD 1VQOP 5HL4A 1T2KD 4ZKUA 1BGYG 4N78D 1HGVA 1KILA 1KTMA 3L71D 2IFMA 2FFDB 4HM5A 1DH3A 1VF5C 2R3CA 2WSEJ 3MUDA 1JO5A 1L4AC 2FFDC 5AW2B 2KIKA 1SQVJ 2NPSB 3MGNA 1EG9A 2SPZA 1E5WA 1SQPE 1SQPD 2HODA 2IZ1A 1WRGA 3BASA 4I7ZB 4K35A 1WMKA 5KLIB 4GDOA 1AQ5A 1L4AD 1PPJG 2WPVB 3WUUA 3CC4P 2AEFA 4ASVA 1SQBJ 2R44A 3MD0A 2O01J 3IF4A 1KB9H 3VN0A 1KZUB 2GM4A 4A7PA 1OW6A 2ZYGA 3I56P 3AE5C 2QIWA 1S72P 1KYOE 3B71A 1S4XA 3GF7A 5CCHA 1Y8AA 3H1LD 4HM7A 1FZFA 2IYPA 3CWBJ 3SFEC 2HMMA 5KTBA 4JYBA 2W6BA 2Y0EA 2E43A 1MFTA 2YFJA 1QVGO 3RL0C 3GKEA 1JMMA 1SQBD 4MN4C 1A02J 1DX7A 2D2CD 3L70G 3C1LA 1NDOA 2PAJA 1RIEA 3GTEA 3H1KD 5GTHH 3RBZA 4WBAA 2BMRA 2YXQB 1VF5D 1NTKJ 5AVTB 4UB6E 3HTKB 2XSHA 2O1KA 3BCCJ 3VCAA 1LWUA 5TISE 1L2PA 1OMIA 4O9BA 4PD4E 3B5NA 3V4WA 1L0NJ 2C0WA 2M3BA 2KP8A 3W68A 4C7NB 1KB9E 1MKMA 5AW4B 1P84D 4Y28J 1UIIA 1QVFO 1GW4A 5KLVE 2MJZA 1NYKA 4WY4D 2OYHA 4AIVA 4QDDA 1M1JA 2WPSA 4DT0A 1S2EA 1JOCA 1BE3E 1JM1A 3L74D 1DEEG 1XTCC 4U7JA 2E74C 3D6ZA 1EZVE 4EDFA 1NAFA 1CSBA 1RH5B 2ZT9C 2JO1A 1S9KD 5KAIE 2HLOA 3CMAP 3HE5A 4HM8A 1KB9D 2XR8A 2YKOA 3MTUE 2J59M 3JSVC 3A7OA 3A0BH 3E1IA 4WVZA 2G3AA 1IK9A 4N78E 3H1HG 2D2CC 5CXMA 1O7MA 1Q7YQ 2BCCG 1SS1A 4BRYB 2IYOA 2XRXA 3TK1A 3O6QB 4L73A 3CXHI 2V4HA 5DJTB 1K04A 4M3LA 3BRVB 4OGQB 1JEKA 2R3SA 4PV1B 2NPSD 1PZQA 5CJ0A 1KQSO 1SQXD 3S1KA 1SQXE 1SQPJ 2E76D 1S5LX 1NTKG 2E75D 1K9MQ 3KQGA 1R5SA 2GUSA 1HUCA 1PPJE 1OW8A 3CMEP 4KHXA 1Q81Q 3RK2D 5TJHA 3AEAC 2YFIA 3GOBA 3FXDA 3SFDC 2FYZA 3CXHH 2H8PD 2P58A 3G71P 1W2BO 1PGOA 3HD7C 1LT9B 2MKVA 1HJ0A 2FYUD 2W8ZA 5B66H 5AVQB 1QLED 4D6TG 4QUPA 3LIEA 3VMHD 3HTKA 1KYOI 2Q3WA 2K1AA 4PJ0H 3P8CD 3L73E 3AE2C 5L8RJ 3GG2A 1NTKD 1FOSF 2W6AA 2QJYB 1T3UA 4GT1A 4H13C 1G1IA 3CXHE 4EI2A 4JF7A 4Y99C 1GZLA 3A5TA 2K3RA 2E75C 1SQBE 2HG5D 1KQFB 1IK7A 3H1KJ 2KS1B 1BDCA 2K88A 2WITA 3PTZA 1QL1A 2Q3IA 2H88C 5BVZA 1NTMJ 2B9BA 1G2CA 2IBZD 5AW5B 3E1RA 1PP9D 3N7NA 1E79H 1OVUA 3IN6A 3RK3D 1MZ9A 1NTZE 4D6TD 1T2KC 4DJGA 3OA7A 3CD6P 2YFLA 3VMYA 3CWBG 4NBGD 1LTSC 1NKNA 3ABVC 2OYHB 4QDFA 1SVFA 2C9NY 4HM2A 5AVZB 1HH0A 1M1JC 1NTMK 3B5ND 4HM1A 2WMMA 3H6PA 1ZOYC 3KZIE 1JCCA 3TNUB 2I8DA 4IFFA 2WSCJ 5AW9B 3FGAD 2BEQD 2L91A 3A2AA 2V7QH 4YXDC 1X8YA 3OW2O 4QCKA 3CCLP 4L74A 4IL6H 2XNDH 1NVOA 1YJ9P 1O7HA 4N3YB 3L70J 2BASA 1CW5A 3P8CE 4UB8E 3FWLA 1IC2A 2HFED 3OAKA 5AVWB 4NPEA 3V2NA 3TF5A 3L70E 1AVYA 4HM6A 2WVRA 2O1JA 2P2UA 2NVEA 1IJDB 2QJKB 1HJBA 1JY2O 1KQLA 3R2PA 2QG4A 1L0NG 2CPBA 1FZCA 1JY3N 3MP7B 1FZCB 2QM7A 1N7SD 1YTZI 1LT1A 2WSFH 1HWTC 4I6MC 1NU1G 3CCEP 3RK3B 5E79H 5B5EE 1BCCJ 1EZVG 2M8RA 3H1HJ 2B87A 2YIUB 1URQB 2YMKA 3TGUE 3H1IE 1N7SC 2DW3A 3CCRP 1N86A 5AVSB 4NB9D 4QDFB 1T8ZA 2ZVOB 2FXPA 4IFDK 5GTIH 3HD7A 1VCKA 1W5CE 1EXIA 5E79E 4OVNF 1ZLLA 2IBZI 3AE4C 3CLQA 1RY3A 1OWAA 5AW6B 1EDIA 1EZVI 1OXZA 4CPGA 1M57D 1ULJA 1P84H 1LP1A 4ZKPA 2KS1A 3H1HD 3IAOA 3WUVA 3AE7C 3A0HE 3FWNA 2DE7D 2NPSC 2C0XA 1T6AA 3RGUA 1KYOH 3L74E 4AAYB 2N1TB 1X0TA 3C8VA 4WY4C 1NTZG 3TDKA 2Q3EA 1BCCE 1J2JB 5AW8B 4UB8H 1NOHA 2OYIA 3H32B 1PP9J 1LTJA 1NYHA 4HJGH 2V7QJ 3EFFK 1FDOA 1J1EC 5CCGA 2O01N 2P7JA 5AVXB 3U59A 2WZ7A 1QEXA 1Q90D 2G8YA 2AEJA 2HR3A 4C7NA 1VPCA 2KI7B 4GIFA 5APYA 3AE1C 4W80A 3H1JE 3Q3DA 3H1JD 4ASWA 1J1DC 1L0NE 1SFCC 1L0ND 1NTKK 3HE4A 2K9JA 4AQRD 1SP4A 1RE4A 5GTHE 2JR8A 1NTMD 1YJWP 2LR2A 1OVVA 4U3FG 1LJ2A 3KPEA 1YQ4C 2Q7CA 3RL0B 1J1EB 1S5LH 3EFGA 1M1KQ 4Y99B 2O3JA 2NVGA 3LW5H 2FXOA 5GTIE 2ZT9D 2JKVA 3L72D 2JZAA 1IFJA 1JY3P 3AEDC 2P1JA 4YPCA 5AW7B 1GTWA 3AZCA 1Q2NA 1MUUA 2HYNA 4LLHA 1SQQD 1KD1Q 4IFMA 3BCCD 3WMM0 4PV1C 4QUQA 1YBKA 2IX7C 3EQ2A 1L0LE 2QJPC 3C0DA 5BOKA 2LKMA 5AVYB 3AEGC 4OGQC 2XNXA 1Z56A 3M9HA 1BGYD 3GZXA 3AE8C 3H1ID 1SQBK 5H2FE 3CCQP 2A45G 2HMOA 1P84I 3CX5I 3CCVP 3L75D 2B89A 1KQGB 1IFMA 5K5GB 2B24A 2RMZA 3P7KA 3BCCE 3PRJA 1LNQA 5DJUB 2YVJB 1SQPK 5KJ7D 4OWFA 1PPJD 2FYNB 3HE4B 2E74D 5BU8B 3JCUH 1VQ9P 1LT9A 1AJYA 4RJTA 1KFMA 2E76C 3CCSP 3SSUA 2KNCA 3A3YB 5KAFH 2W6JH 3TSIA 2Y9ZA 1SQQG 3NTNA 1RF1C 1VQMP 1FBMA 1YITP 1LWUC 1N7SB 4W7ZA 1XTGB 4HM4A 5B5EH 2C9LY 2FYUG 2Y0CA 4HKZH 3D89A 4H13D 1YJNP 2OYIB 4QURA 3CI9A 2JP3A 1NTME 1J1DB 1LTJB 2E5TA 2AXTE 1H0TB 2OYIC 3Q5RA 1KYOD 1H0TA 1USEA 3JCUE 1VQ7P 3VCPA 5AW0B 1JY2N 3U1CA 1K73Q 4HH2A 3W67A 5C39A 4HYTB 5KKZC 1BGYE 3B8EB 3V5BA 2OYHC 1ZMEC 3P8MC 1ULIA 5APQA 1YHQP 1FU1A 5KLVK 3L75E 3L72G 4U3FE 1CZQA 1EDKA 2W90A 1RQVA 2ZAEB 1JY2P 4OH8B 2OTLP 4H44D 1VQ5P 1FZCC 1GU4A 1AFOA 1KB9I 1PV3A 5EFWB 2JO6A 3RK2C 5APVA 3H1IJ 3CL3D 2ZXEB 4PD4I 1H88A 2FY8A 2HPCA 1NU1K 2FYUK 1NAYA 1KILE 1L0NK 3E7KA 1VQKP 1YQ3C 1HVVA 2YKPA 2E76B 2XKMA 4PD4H 1QL2A 2BMOA 2ZYLA 3VMGD 2OARA 1RF1B 4NB8D 2M5AB 1SQVD 2IDBA 2N1TC 4C46A 3H1KE 3HUSA 1OZHA 2J5UA 2H43A 1Y47A 2FBWC 2WPQA 1S3JA 2ZJSE 3ZDMA 4P1CH 1Q90C 4C7RA 4HM3A 1HF9A 1W2EA 1FZEA 1M1JB 3L73D 4RO0A 3O6QA 2GBXA 1BE3G 2QA4P 3A0BE 3PP5A 1EDLA 1N2DC 1GD2E 1DEBA 2WSFJ 1ZRTD 5APWA 5KKZB 3NXSA 1SQXK 3GZYA 5AVUB 3L4FA 1L0LG 5KAFE 1VM9A 2WQYC 1EQ7A 4D6TJ 3GCEA 2Y9YA 2WSCH 2R5BA 4R4MA 5AW1B 4L75A 4PJ0E 3CX5D 3Q1MA 1PGJA 1URQC 1BE3J 4IOIH 3RK3E 3CCUP 1NTMG 1WQLA 4NPDA 4WB4A 3IFMA 1PP9E 2JWAA 4LGDE 5CHXA 2YKQA 1PFIA 3FOUA 3H1HE 3AEBC 3GL0A 1RFSA 3L70D 2HMJA 1N7SA 2XSOA 2QPZA 2XV5A 1LWUB 5AEUA 3H1KG 3M9BA 2JJLA 1FOSE 2ZXXA 2VRSA 2DE6D 3GL2A 2N9YB 1NU1E 2K9YA 1FQTA 2R5DA 3A0HH 3L75J 3VP9A 1N73C 1S5LE 1ZW0A 1SQVK 1JB0J 1S9KE 3AECC 1NWQA 2B87B 3M0DC 1DD4A 1QGKB 2P67A 1A02F 1VQNP 3T97B 2UWJE 3AEEC 1BSHA 4JQ0D 2POHA 3HD7B 2Z5HA 1SQVG 3QWOC 5CBOA 1LTBC 1G8JB 4H13B 3F5HA 3QH9A 1OIPA 2JWDA 2PRRA 1O7NA 3G3ZA 1NU1D 3ITKA 4RESB 4IL6X 2BCCJ 1Y9BA 3S4RA 3EN1A 3H1JJ 4HJLA 2NUKA 1R8EA 2JEEA 4QDCA 4H0LB 5KLVD 2PGDA 1PIXA 1SQPG 3U1AA 3MUDC 3WU2E 1GK4A 2P10A 2WTYA 1PGPA 3RBXA 3HE5B 4BWNA 4YTPC 3Q5PA 3SWKA 3PJSK 3II6A 3G9RA 1HGZA 3NMDA 1OW7A 3N4XA 4NBDD 2ITAA 5H2FH 1UUWA 1G1JA 3HUSB 5CCHD 2QEXP 1AA0A 1RE3C 1OX3A 2N1TA 3I55P 2LXBA 2KYVA 2XZRA 3HUSC 3VYIA 4HM0A 3CWBE 2H7HA 1HTLC 3V2QA 4JBZA 3OJAB 1DIPA 2NVFA 3GHGA 1FDMA 1M8OB 1SQQJ 1L0LK 2ZYAA 4B86A 3TGUD 1M90Q 1VQ8P 2KOGA 3H1IG 3CWBD 3VTPC 3CX5E 3WU2H 1JTHB 3GW6A 1OVRA 4NBBD 1MV8A 2NZ2A 2KLUA 2E42A 3TGUJ 1NO4A 4GODA 2YXRB 1VQ4P
chains in the Genus database with same CATH topology
2MKVA 1HJ0A 1KQGB 1TU3F 2B24A 3GLMA 3BCCE 4QUPA 4H0LC 2YVJB 3VMHD 2Q3WA 4RKUJ 3L73E 2E74D 3AE2C 2E4QA 5L8RJ 4H13C 3DQYA 1AJYA 2FYUE 3CXHE 2E76C 3EQQA 4EMJB 2E75C 1SQBE 2B1XA 2YIUC 1KQFB 1IK7A 4R4LA 3D71A 4OGQD 2QJKC 2QSIA 4HM4A 2H88C 3EWKA 3Q2YA 3RL0g 3N0QA 3D89A 4H13D 4QURA 2JP3A 3S9OA 1NTME 3IN6A 1NTZE 4H44B 1G8KB 3Q5RA 1ZP0C 1NTKE 1SQVE 2A06E 1VF5B 4H0LD 2YFLA 3H1LE 3VCPA 1NGMB 4NBGD 1VL2A 3ABVC 4QDFA 1U57A 5KKZC 1O7GA 1ZMEC 4HM2A 1ULIA 4I7ZC 2BEZF 2E75B 4HM1A 3D70A 1ZOYC 3L75E 5HL4A 4U3FE 1RQVA 2WSCJ 1UIXA 4XFJA 4H44D 2FYNC 3FGAD 2BEQD 1KTMA 4YXDC 1PV3A 2CKFA 2JO6A 4HM5A 4QCKA 1PL5A 4P1BH 1VF5C 2WSEJ 3L72E 5KLIC 1O7HA 4NBHD 1KILE 1YQ3C 1EG9A 2E76B 3L70E 4HM6A 1SQPE 2BMOA 1UUVA 2ZYLA 4I7ZB 3VMGD 1WMKA 2NVEA 4GDOA 4NB8D 1EXJA 2WPVB 2IDBA 1ZRTE 3H1KE 3GB4A 2O01J 2J5UA 2FBWC 1O7PA 3VMID 4P1CH 2H89C 1Q90C 4HKVA 1OW6A 2OQQA 4NBCD 3AE9C 4HM3A 1HF9A 3AE5C 2GBWA 2QIWA 3O6QA 2GBXA 1KYOE 3B71A 3GF7A 2WSFJ 2NWFA 2BMQA 2HMLA 3GZYA 2YMKA 3TGUE 3H1IE 4HM7A 1VM9A 2BCCE 3SFEC 2WQYC 2HMMA 4NB9D 1K05A 1P84E 4QDFB 2I7FA 2FXPA 2QJYC 3R4YA 3GCEA 1SQQE 2YFJA 4KT0J 4R4MA 3GKEA 1VCKA 4Z1MH 3Q1MA 4TT3H 1EXIA 4NBFD 5AEWA 2D2CD 3AE4C 3Q5SA 3RK3E 1WQLA 3D6YA 1NDOA 1RIEA 4H44C 1SJGA 1PP9E 3GTSA 3GTEA 1ULJA 1O7WA 2BMRA 1KMIZ 3FOUA 3IAOA 1VF5D 3H1HE 3AE7C 3AEBC 3GL0A 1RFSA 2HMJA 4NBAD 1DD3A 2DE7D 2XSOA 2XSHA 2QPZA 3LW5J 4PV1D 5AEUA 3VCAA 2DE6D 3GL2A 3L74E 1OMIA 4AAYB 1NU1E 2K9YA 3C8VA 1FQTA 2HMKA 4PD4E 3GF3A 1BCCE 2E74B 2HMNA 3L71E 3H25A 1JB0J 1NYHA 1KB9E 3AECC 1MKMA 2V7QJ 1FDOA 1DD4A 3AE3C 3T97B 3AEEC 4Y28J 5KLVE 1Q90D 1NYKA 2G8YA 4AIVA 4QDDA 3AE1C 1BE3E 1JM1A 1G8JB 3Q3DA 4H13B 3H1JE 4U7JA 1O7NA 2E74C 3D6ZA 1KORA 4IL6X 1L0NE 1EZVE 1Y9BA 3EN1A 4HJLA 2NUKA 1R8EA 2ZT9C 4QDCA 2JO1A 4H0LB 1PIXA 1YQ4C 4HM8A 2XR8A 2P10A 4YTPC 3Q5PA 3GMAA 2G3AA 2D2CB 2DE5D 2NVGA 3G9RA 1OW7A 2D2CC 5CXMA 1FDIA 1O7MA 2ZT9D 4NBDD 1UUWA 2JZAA 2XRXA 4NBED 3AEDC 3AE6C 1K04A 3AZCA 4HM0A 3CWBE 4OGQB 4PV1B 1DIPA 2NVFA 2E4PA 4PV1C 4QUQA 1SQXE 3AEFC 2E76D 2QJPC 1S5LX 1L0LE 3C0DA 5BOKA 1S1CX 2E75D 3CX5E 2ZT9B 2IBZE 3AEGC 1GMJA 4OGQC 2NUMA 4NBBD 2NZ2A 5M1BA 1PPJE 1OW8A 3GZXA 3AE8C 3AEAC 2YFIA 2HMOA 3GOBA 1RQUA 3SFDC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QJY C;  2WSC J;  3GCE A;  1SQQ E;  1O7N A;  4H44 D;  2YFJ A;  2FYN C;  4IL6 X;  4KT0 J;  1L0N E;  1EZV E;  3EN1 A;  3GKE A;  1VCK A;  2B24 A;  2NUK A;  4HJL A;  2CKF A;  2JO6 A;  3BCC E;  4NBF D;  4QDC A;  4HM5 A;  4QCK A;  5AEW A;  4QUP A;  4H0L B;  2D2C D;  2YVJ B;  4P1B H;  3VMH D;  2WSE J;  3L72 E;  2Q3W A;  4HM8 A;  1WQL A;  5KLI C;  2XR8 A;  1NDO A;  1O7H A;  4NBH D;  4RKU J;  4NB9 D;  3L73 E;  2E74 D;  1RIE A;  2E4Q A;  5L8R J;  1SJG A;  4QDF B;  1PP9 E;  3GTS A;  3GTE A;  3DQY A;  2FYU E;  2D2C B;  2DE5 D;  3CXH E;  1ULJ A;  2NVG A;  1EG9 A;  1O7W A;  2E76 B;  3EQQ A;  3L70 E;  2BMR A;  4EMJ B;  3FOU A;  5CXM A;  4HM6 A;  1O7M A;  1VF5 D;  1SQP E;  3H1H E;  2BMO A;  1RFS A;  3GL0 A;  1SQB E;  1UUV A;  2B1X A;  2ZYL A;  2YIU C;  4I7Z B;  2HMJ A;  3VMG D;  4NBA D;  2ZT9 D;  2DE7 D;  2XSO A;  2XSH A;  2QPZ A;  2NVE A;  4OGQ D;  3LW5 J;  4NBD D;  2QJK C;  4NB8 D;  2QSI A;  4PV1 D;  1UUW A;  2JZA A;  2XRX A;  2WPV B;  5AEU A;  4NBE D;  4HM4 A;  3VCA A;  1ZRT E;  2DE6 D;  3GL2 A;  3AZC A;  3H1K E;  3L74 E;  4AAY B;  1NU1 E;  3GB4 A;  2K9Y A;  3C8V A;  2O01 J;  3N0Q A;  1FQT A;  4HM0 A;  3CWB E;  3D89 A;  2HMK A;  4PD4 E;  4OGQ B;  4H13 D;  4QUR A;  4PV1 B;  1BCC E;  1NTM E;  2E74 B;  2HMN A;  1NTZ E;  2NVF A;  1O7P A;  3L71 E;  3VMI D;  2E4P A;  4P1C H;  4H44 B;  1Q90 C;  4HKV A;  4QUQ A;  4NBC D;  1SQX E;  1G8K B;  4HM3 A;  1JB0 J;  1KB9 E;  1NTK E;  2GBW A;  2E76 D;  1L0L E;  1S5L X;  1SQV E;  2QJP C;  2QIW A;  2A06 E;  3C0D A;  5BOK A;  1VF5 B;  4H0L D;  2GBX A;  2YFL A;  2E75 D;  3H1L E;  1KYO E;  3VCP A;  3CX5 E;  2ZT9 B;  2IBZ E;  4NBG D;  2WSF J;  4Y28 J;  4QDF A;  4U3F E;  2NUM A;  5KKZ C;  2NWF A;  5KLV E;  1O7G A;  2BMQ A;  2HML A;  4NBB D;  1Q90 D;  3GZY A;  1NYK A;  4AIV A;  4HM2 A;  4QDD A;  1ULI A;  3TGU E;  1PPJ E;  4H13 B;  3GZX A;  3H1I E;  4HM7 A;  2E75 B;  1VM9 A;  4HM1 A;  2BCC E;  2YFI A;  2HMO A;  3GOB A;  3L75 E;  2HMM A;  1BE3 E;  1JM1 A;  5HL4 A;  1G8J B;  1P84 E;  3H1J E;  2I7F A; 
#chains in the Genus database with same CATH topology
 3L75 G;  4K3A A;  1YYC A;  3UIA A;  1LTA C;  3G4S P;  2KSJ A;  3HRN A;  3M0A A;  1KIL B;  3GLM A;  5CBN A;  1EC5 A;  1IFN A;  2IFN A;  4ZMD A;  3PLN A;  4H0L C;  1URQ A;  3NFQ A;  3CCM P;  1PP9 G;  2Z5I A;  4RKU J;  4GOE A;  2O01 H;  2M3E A;  3L37 A;  1LTT C;  3M9Q A;  1ZN5 A;  2ZVN B;  4NPF X;  1VQ6 P;  4D6T E;  3PHL A;  3L73 J;  4EMJ B;  1BGY J;  2OTK E;  2FKW B;  2B1X A;  2YIU C;  2NPS A;  3VMZ A;  1N73 B;  4AUW A;  4OGQ D;  1GL2 C;  4I2L C;  2GA1 A;  3G6E P;  2QSI A;  5KJ7 C;  2Q5U A;  1EDJ A;  3CX5 H;  3EWK A;  3B5N B;  3Q2Y A;  2AEM A;  3O8Z A;  4WY4 A;  2FXM A;  1FJP A;  1LP1 B;  1RHZ B;  3SWY A;  2WSE H;  4H44 B;  1FE6 A;  1LTJ C;  3TGU G;  1L4A A;  1ZP0 C;  1NTK E;  1JM0 A;  1YTZ T;  2KK7 A;  1SQV E;  2KZJ A;  2A45 I;  1VF5 B;  2IBZ G;  3V4Q A;  3LID A;  3M0D A;  3VMA A;  5CCG C;  1ZR2 A;  4DCK A;  1U57 A;  4GKG A;  1O7G A;  3RL0 D;  3SWF A;  2E75 B;  3VMX A;  3BCC G;  4BXL A;  3D70 A;  2A06 G;  2OTJ P;  1M56 D;  1T3J A;  5AVV B;  1SFC B;  3KZI H;  3L71 J;  1RF0 C;  2RN0 A;  3H1J G;  1UIX A;  4XFJ A;  1SFC A;  1VQP P;  2FYN C;  1U7J A;  1RE4 C;  1BDD A;  2CKF A;  1LGH B;  1KC8 Q;  1PL5 A;  4P1B H;  3VOP A;  3CCJ P;  2K9J B;  2IZ0 A;  3L72 E;  1NHL A;  2BCC D;  3P32 A;  5KLI C;  4NBH D;  4U3F D;  1AVO A;  3RK3 C;  1NTZ K;  1CI6 A;  2QVA A;  1FS0 E;  3F89 A;  2KNC B;  1KFN A;  1NH4 A;  1YI2 P;  1GDT A;  1VQL P;  2QE7 H;  1UUV A;  2YO3 A;  4QMA A;  1FZG A;  2ZYD A;  2PP6 A;  4U3F J;  1EXJ A;  1WT6 A;  1R5L A;  1ZRT E;  1RE3 A;  3RK2 B;  3GB4 A;  1KIL C;  3VP8 A;  4L76 A;  4JPZ B;  4W7Y A;  2GUV A;  3MHV A;  5KLV G;  1SQX G;  4WWI A;  1O7P A;  3VMI D;  3L72 J;  2H89 C;  4HKV A;  2OQQ A;  3GHG C;  4NBC D;  2Q9I A;  3AE9 C;  2M5A A;  2GBW A;  3KXD A;  4HB1 A;  1JUN A;  1SQQ K;  1FJK A;  2NWF A;  2BMQ A;  2HML A;  3CC2 P;  1L4A B;  3FX0 A;  1JMB A;  2K37 A;  2BCC E;  2CK3 H;  3M91 A;  2KSE A;  5APU A;  2IPP A;  1D7M A;  1K05 A;  1P84 E;  2I7F A;  1QX8 A;  2QJY C;  3R4Y A;  1SQQ E;  2WT7 B;  4KT0 J;  2KB7 P;  1K8A Q;  4Z1M H;  1NJI Q;  3L74 J;  4TT3 H;  4NBF D;  5AEW A;  3B5N C;  1N73 A;  3Q5S A;  3H1L G;  2WPR A;  1GL2 B;  3D6Y A;  4H44 C;  1SJG A;  1LT9 C;  2WSS H;  3GTS A;  1AQT A;  3L73 G;  2KUB A;  4AYC A;  3L74 G;  3KDP B;  1O7W A;  3BRT B;  1KMI Z;  4DZO A;  2QRX A;  4NBA D;  4TLF A;  1DD3 A;  2XDJ A;  3H1L J;  1SQB G;  1RF1 A;  1KN7 A;  1H89 A;  3LW5 J;  4PV1 D;  1L0L D;  5KJ7 A;  5TIS H;  1FC2 C;  1Q82 Q;  3CXH D;  2HMK A;  1M7L A;  2Q6Q A;  3GF3 A;  1NTZ J;  2M0B A;  2E74 B;  2HMN A;  3L71 E;  3H25 A;  3V2R A;  1U7M A;  2KXP B;  1URQ D;  2Q1K A;  3AE3 C;  1PGQ A;  1LTG C;  1N7L A;  2I1K A;  3CPW O;  2Y0D A;  3K5B A;  3MIW A;  1GK6 A;  2ZFC A;  4JYC A;  3TNU A;  2AXC A;  1X9V A;  5B66 E;  2RH0 A;  1RF0 A;  3T97 A;  4YXW H;  1KOR A;  2J58 A;  1N8R Q;  1NTZ D;  3L36 A;  5CJ4 A;  2NRG A;  2I1J A;  3I5C A;  2FFD A;  2W27 A;  5APS A;  2QJP B;  4XA4 A;  1JCD A;  1LTI C;  1SLQ A;  2WT7 A;  3WUT A;  1VDF A;  2KLV A;  1YIJ P;  2YO2 A;  3GMA A;  5APX A;  2D2C B;  2DE5 D;  3CC7 P;  1FDI A;  1AV1 A;  1SFC D;  1JY3 O;  2N1T D;  2L5G B;  1NKZ B;  1X79 B;  3MZW B;  2HOD B;  2XU6 A;  3KYQ A;  4XE5 B;  4NBE D;  1FZA A;  1GW3 A;  2W83 C;  3AE6 C;  4UB6 H;  3IR9 A;  2WWW A;  1BSN A;  2B88 A;  1SQX J;  2QM8 A;  1IZN B;  1USD A;  2E4P A;  2OYO A;  3M06 A;  1KV4 A;  5AVR B;  1JNM A;  2JDI H;  1G2C B;  4WY4 B;  3AEF C;  3HD7 D;  1S1C X;  5APT A;  2OGU A;  5CCH C;  3BVH A;  2IBZ E;  2ZT9 B;  1EZV D;  4LC1 A;  1GMJ A;  2NUM A;  1GL2 D;  3H32 A;  3C9I A;  5M1B A;  1ZXG A;  1H8A A;  1IFD A;  5BU5 A;  1BE3 D;  3BAT A;  1GL2 A;  1RQU A;  2A06 D;  3FXE A;  3B4S A;  1TU3 F;  2HPC B;  1MFZ A;  1GU5 A;  1IFI A;  1Q86 Q;  5AW3 B;  4GOF A;  4PD4 D;  1FZB A;  2FYU J;  1NU1 J;  1L0L J;  3L71 G;  3JC2 2;  2LXC B;  2E4Q A;  2YNY A;  5KAI H;  5CMZ A;  3DQY A;  2FYU E;  1IFP A;  1CI6 B;  3L35 A;  3EQQ A;  3USS A;  3V6I A;  4ZNC A;  1ZV8 A;  4R4L A;  3D71 A;  1X22 A;  2QJK C;  2E5Y A;  4BRY A;  5CCG D;  5KLV J;  3V2P A;  2YMY A;  3RL0 g;  3N0Q A;  1ZR4 A;  4EOT A;  3TYY A;  2RKL A;  3GHG B;  3S9O A;  2R32 A;  4EIJ A;  1IO4 A;  1G8K B;  1FAV A;  2KZI A;  2AXT H;  4N6J A;  2N9B A;  2A06 E;  4H0L D;  4DOJ A;  3H1L E;  4KJM A;  4IL6 E;  1HBW A;  1NGM B;  3KHU A;  4I1L A;  1BCC G;  1VL2 A;  4EYY Q;  2PFX A;  1JTH A;  2CPS A;  1BCC D;  2A45 H;  4I7Z C;  2BEZ F;  1OFC X;  3PH0 A;  2Z4E A;  1KIL D;  1VQO P;  5HL4 A;  1T2K D;  4ZKU A;  1BGY G;  4N78 D;  1HGV A;  1KIL A;  1KTM A;  3L71 D;  2IFM A;  2FFD B;  4HM5 A;  1DH3 A;  1VF5 C;  2R3C A;  2WSE J;  3MUD A;  1JO5 A;  1L4A C;  2FFD C;  5AW2 B;  2KIK A;  1SQV J;  2NPS B;  3MGN A;  1EG9 A;  2SPZ A;  1E5W A;  1SQP E;  1SQP D;  2HOD A;  2IZ1 A;  1WRG A;  3BAS A;  4I7Z B;  4K35 A;  1WMK A;  5KLI B;  4GDO A;  1AQ5 A;  1L4A D;  1PPJ G;  2WPV B;  3WUU A;  3CC4 P;  2AEF A;  4ASV A;  1SQB J;  2R44 A;  3MD0 A;  2O01 J;  3IF4 A;  1KB9 H;  3VN0 A;  1KZU B;  2GM4 A;  4A7P A;  1OW6 A;  2ZYG A;  3I56 P;  3AE5 C;  2QIW A;  1S72 P;  1KYO E;  3B71 A;  1S4X A;  3GF7 A;  5CCH A;  1Y8A A;  3H1L D;  4HM7 A;  1FZF A;  2IYP A;  3CWB J;  3SFE C;  2HMM A;  5KTB A;  4JYB A;  2W6B A;  2Y0E A;  2E43 A;  1MFT A;  2YFJ A;  1QVG O;  3RL0 C;  3GKE A;  1JMM A;  1SQB D;  4MN4 C;  1A02 J;  1DX7 A;  2D2C D;  3L70 G;  3C1L A;  1NDO A;  2PAJ A;  1RIE A;  3GTE A;  3H1K D;  5GTH H;  3RBZ A;  4WBA A;  2BMR A;  2YXQ B;  1VF5 D;  1NTK J;  5AVT B;  4UB6 E;  3HTK B;  2XSH A;  2O1K A;  3BCC J;  3VCA A;  1LWU A;  5TIS E;  1L2P A;  1OMI A;  4O9B A;  4PD4 E;  3B5N A;  3V4W A;  1L0N J;  2C0W A;  2M3B A;  2KP8 A;  3W68 A;  4C7N B;  1KB9 E;  1MKM A;  5AW4 B;  1P84 D;  4Y28 J;  1UII A;  1QVF O;  1GW4 A;  5KLV E;  2MJZ A;  1NYK A;  4WY4 D;  2OYH A;  4AIV A;  4QDD A;  1M1J A;  2WPS A;  4DT0 A;  1S2E A;  1JOC A;  1BE3 E;  1JM1 A;  3L74 D;  1DEE G;  1XTC C;  4U7J A;  2E74 C;  3D6Z A;  1EZV E;  4EDF A;  1NAF A;  1CSB A;  1RH5 B;  2ZT9 C;  2JO1 A;  1S9K D;  5KAI E;  2HLO A;  3CMA P;  3HE5 A;  4HM8 A;  1KB9 D;  2XR8 A;  2YKO A;  3MTU E;  2J59 M;  3JSV C;  3A7O A;  3A0B H;  3E1I A;  4WVZ A;  2G3A A;  1IK9 A;  4N78 E;  3H1H G;  2D2C C;  5CXM A;  1O7M A;  1Q7Y Q;  2BCC G;  1SS1 A;  4BRY B;  2IYO A;  2XRX A;  3TK1 A;  3O6Q B;  4L73 A;  3CXH I;  2V4H A;  5DJT B;  1K04 A;  4M3L A;  3BRV B;  4OGQ B;  1JEK A;  2R3S A;  4PV1 B;  2NPS D;  1PZQ A;  5CJ0 A;  1KQS O;  1SQX D;  3S1K A;  1SQX E;  1SQP J;  2E76 D;  1S5L X;  1NTK G;  2E75 D;  1K9M Q;  3KQG A;  1R5S A;  2GUS A;  1HUC A;  1PPJ E;  1OW8 A;  3CME P;  4KHX A;  1Q81 Q;  3RK2 D;  5TJH A;  3AEA C;  2YFI A;  3GOB A;  3FXD A;  3SFD C;  2FYZ A;  3CXH H;  2H8P D;  2P58 A;  3G71 P;  1W2B O;  1PGO A;  3HD7 C;  1LT9 B;  2MKV A;  1HJ0 A;  2FYU D;  2W8Z A;  5B66 H;  5AVQ B;  1QLE D;  4D6T G;  4QUP A;  3LIE A;  3VMH D;  3HTK A;  1KYO I;  2Q3W A;  2K1A A;  4PJ0 H;  3P8C D;  3L73 E;  3AE2 C;  5L8R J;  3GG2 A;  1NTK D;  1FOS F;  2W6A A;  2QJY B;  1T3U A;  4GT1 A;  4H13 C;  1G1I A;  3CXH E;  4EI2 A;  4JF7 A;  4Y99 C;  1GZL A;  3A5T A;  2K3R A;  2E75 C;  1SQB E;  2HG5 D;  1KQF B;  1IK7 A;  3H1K J;  2KS1 B;  1BDC A;  2K88 A;  2WIT A;  3PTZ A;  1QL1 A;  2Q3I A;  2H88 C;  5BVZ A;  1NTM J;  2B9B A;  1G2C A;  2IBZ D;  5AW5 B;  3E1R A;  1PP9 D;  3N7N A;  1E79 H;  1OVU A;  3IN6 A;  3RK3 D;  1MZ9 A;  1NTZ E;  4D6T D;  1T2K C;  4DJG A;  3OA7 A;  3CD6 P;  2YFL A;  3VMY A;  3CWB G;  4NBG D;  1LTS C;  1NKN A;  3ABV C;  2OYH B;  4QDF A;  1SVF A;  2C9N Y;  4HM2 A;  5AVZ B;  1HH0 A;  1M1J C;  1NTM K;  3B5N D;  4HM1 A;  2WMM A;  3H6P A;  1ZOY C;  3KZI E;  1JCC A;  3TNU B;  2I8D A;  4IFF A;  2WSC J;  5AW9 B;  3FGA D;  2BEQ D;  2L91 A;  3A2A A;  2V7Q H;  4YXD C;  1X8Y A;  3OW2 O;  4QCK A;  3CCL P;  4L74 A;  4IL6 H;  2XND H;  1NVO A;  1YJ9 P;  1O7H A;  4N3Y B;  3L70 J;  2BAS A;  1CW5 A;  3P8C E;  4UB8 E;  3FWL A;  1IC2 A;  2HFE D;  3OAK A;  5AVW B;  4NPE A;  3V2N A;  3TF5 A;  3L70 E;  1AVY A;  4HM6 A;  2WVR A;  2O1J A;  2P2U A;  2NVE A;  1IJD B;  2QJK B;  1HJB A;  1JY2 O;  1KQL A;  3R2P A;  2QG4 A;  1L0N G;  2CPB A;  1FZC A;  1JY3 N;  3MP7 B;  1FZC B;  2QM7 A;  1N7S D;  1YTZ I;  1LT1 A;  2WSF H;  1HWT C;  4I6M C;  1NU1 G;  3CCE P;  3RK3 B;  5E79 H;  5B5E E;  1BCC J;  1EZV G;  2M8R A;  3H1H J;  2B87 A;  2YIU B;  1URQ B;  2YMK A;  3TGU E;  3H1I E;  1N7S C;  2DW3 A;  3CCR P;  1N86 A;  5AVS B;  4NB9 D;  4QDF B;  1T8Z A;  2ZVO B;  2FXP A;  4IFD K;  5GTI H;  3HD7 A;  1VCK A;  1W5C E;  1EXI A;  5E79 E;  4OVN F;  1ZLL A;  2IBZ I;  3AE4 C;  3CLQ A;  1RY3 A;  1OWA A;  5AW6 B;  1EDI A;  1EZV I;  1OXZ A;  4CPG A;  1M57 D;  1ULJ A;  1P84 H;  1LP1 A;  4ZKP A;  2KS1 A;  3H1H D;  3IAO A;  3WUV A;  3AE7 C;  3A0H E;  3FWN A;  2DE7 D;  2NPS C;  2C0X A;  1T6A A;  3RGU A;  1KYO H;  3L74 E;  4AAY B;  2N1T B;  1X0T A;  3C8V A;  4WY4 C;  1NTZ G;  3TDK A;  2Q3E A;  1BCC E;  1J2J B;  5AW8 B;  4UB8 H;  1NOH A;  2OYI A;  3H32 B;  1PP9 J;  1LTJ A;  1NYH A;  4HJG H;  2V7Q J;  3EFF K;  1FDO A;  1J1E C;  5CCG A;  2O01 N;  2P7J A;  5AVX B;  3U59 A;  2WZ7 A;  1QEX A;  1Q90 D;  2G8Y A;  2AEJ A;  2HR3 A;  4C7N A;  1VPC A;  2KI7 B;  4GIF A;  5APY A;  3AE1 C;  4W80 A;  3H1J E;  3Q3D A;  3H1J D;  4ASW A;  1J1D C;  1L0N E;  1SFC C;  1L0N D;  1NTK K;  3HE4 A;  2K9J A;  4AQR D;  1SP4 A;  1RE4 A;  5GTH E;  2JR8 A;  1NTM D;  1YJW P;  2LR2 A;  1OVV A;  4U3F G;  1LJ2 A;  3KPE A;  1YQ4 C;  2Q7C A;  3RL0 B;  1J1E B;  1S5L H;  3EFG A;  1M1K Q;  4Y99 B;  2O3J A;  2NVG A;  3LW5 H;  2FXO A;  5GTI E;  2ZT9 D;  2JKV A;  3L72 D;  2JZA A;  1IFJ A;  1JY3 P;  3AED C;  2P1J A;  4YPC A;  5AW7 B;  1GTW A;  3AZC A;  1Q2N A;  1MUU A;  2HYN A;  4LLH A;  1SQQ D;  1KD1 Q;  4IFM A;  3BCC D;  3WMM 0;  4PV1 C;  4QUQ A;  1YBK A;  2IX7 C;  3EQ2 A;  1L0L E;  2QJP C;  3C0D A;  5BOK A;  2LKM A;  5AVY B;  3AEG C;  4OGQ C;  2XNX A;  1Z56 A;  3M9H A;  1BGY D;  3GZX A;  3AE8 C;  3H1I D;  1SQB K;  5H2F E;  3CCQ P;  2A45 G;  2HMO A;  1P84 I;  3CX5 I;  3CCV P;  3L75 D;  2B89 A;  1KQG B;  1IFM A;  5K5G B;  2B24 A;  2RMZ A;  3P7K A;  3BCC E;  3PRJ A;  1LNQ A;  5DJU B;  2YVJ B;  1SQP K;  5KJ7 D;  4OWF A;  1PPJ D;  2FYN B;  3HE4 B;  2E74 D;  5BU8 B;  3JCU H;  1VQ9 P;  1LT9 A;  1AJY A;  4RJT A;  1KFM A;  2E76 C;  3CCS P;  3SSU A;  2KNC A;  3A3Y B;  5KAF H;  2W6J H;  3TSI A;  2Y9Z A;  1SQQ G;  3NTN A;  1RF1 C;  1VQM P;  1FBM A;  1YIT P;  1LWU C;  1N7S B;  4W7Z A;  1XTG B;  4HM4 A;  5B5E H;  2C9L Y;  2FYU G;  2Y0C A;  4HKZ H;  3D89 A;  4H13 D;  1YJN P;  2OYI B;  4QUR A;  3CI9 A;  2JP3 A;  1NTM E;  1J1D B;  1LTJ B;  2E5T A;  2AXT E;  1H0T B;  2OYI C;  3Q5R A;  1KYO D;  1H0T A;  1USE A;  3JCU E;  1VQ7 P;  3VCP A;  5AW0 B;  1JY2 N;  3U1C A;  1K73 Q;  4HH2 A;  3W67 A;  5C39 A;  4HYT B;  5KKZ C;  1BGY E;  3B8E B;  3V5B A;  2OYH C;  1ZME C;  3P8M C;  1ULI A;  5APQ A;  1YHQ P;  1FU1 A;  5KLV K;  3L75 E;  3L72 G;  4U3F E;  1CZQ A;  1EDK A;  2W90 A;  1RQV A;  2ZAE B;  1JY2 P;  4OH8 B;  2OTL P;  4H44 D;  1VQ5 P;  1FZC C;  1GU4 A;  1AFO A;  1KB9 I;  1PV3 A;  5EFW B;  2JO6 A;  3RK2 C;  5APV A;  3H1I J;  3CL3 D;  2ZXE B;  4PD4 I;  1H88 A;  2FY8 A;  2HPC A;  1NU1 K;  2FYU K;  1NAY A;  1KIL E;  1L0N K;  3E7K A;  1VQK P;  1YQ3 C;  1HVV A;  2YKP A;  2E76 B;  2XKM A;  4PD4 H;  1QL2 A;  2BMO A;  2ZYL A;  3VMG D;  2OAR A;  1RF1 B;  4NB8 D;  2M5A B;  1SQV D;  2IDB A;  2N1T C;  4C46 A;  3H1K E;  3HUS A;  1OZH A;  2J5U A;  2H43 A;  1Y47 A;  2FBW C;  2WPQ A;  1S3J A;  2ZJS E;  3ZDM A;  4P1C H;  1Q90 C;  4C7R A;  4HM3 A;  1HF9 A;  1W2E A;  1FZE A;  1M1J B;  3L73 D;  4RO0 A;  3O6Q A;  2GBX A;  1BE3 G;  2QA4 P;  3A0B E;  3PP5 A;  1EDL A;  1N2D C;  1GD2 E;  1DEB A;  2WSF J;  1ZRT D;  5APW A;  5KKZ B;  3NXS A;  1SQX K;  3GZY A;  5AVU B;  3L4F A;  1L0L G;  5KAF E;  1VM9 A;  2WQY C;  1EQ7 A;  4D6T J;  3GCE A;  2Y9Y A;  2WSC H;  2R5B A;  4R4M A;  5AW1 B;  4L75 A;  4PJ0 E;  3CX5 D;  3Q1M A;  1PGJ A;  1URQ C;  1BE3 J;  4IOI H;  3RK3 E;  3CCU P;  1NTM G;  1WQL A;  4NPD A;  4WB4 A;  3IFM A;  1PP9 E;  2JWA A;  4LGD E;  5CHX A;  2YKQ A;  1PFI A;  3FOU A;  3H1H E;  3AEB C;  3GL0 A;  1RFS A;  3L70 D;  2HMJ A;  1N7S A;  2XSO A;  2QPZ A;  2XV5 A;  1LWU B;  5AEU A;  3H1K G;  3M9B A;  2JJL A;  1FOS E;  2ZXX A;  2VRS A;  2DE6 D;  3GL2 A;  2N9Y B;  1NU1 E;  2K9Y A;  1FQT A;  2R5D A;  3A0H H;  3L75 J;  3VP9 A;  1N73 C;  1S5L E;  1ZW0 A;  1SQV K;  1JB0 J;  1S9K E;  3AEC C;  1NWQ A;  2B87 B;  3M0D C;  1DD4 A;  1QGK B;  2P67 A;  1A02 F;  1VQN P;  3T97 B;  2UWJ E;  3AEE C;  1BSH A;  4JQ0 D;  2POH A;  3HD7 B;  2Z5H A;  1SQV G;  3QWO C;  5CBO A;  1LTB C;  1G8J B;  4H13 B;  3F5H A;  3QH9 A;  1OIP A;  2JWD A;  2PRR A;  1O7N A;  3G3Z A;  1NU1 D;  3ITK A;  4RES B;  4IL6 X;  2BCC J;  1Y9B A;  3S4R A;  3EN1 A;  3H1J J;  4HJL A;  2NUK A;  1R8E A;  2JEE A;  4QDC A;  4H0L B;  5KLV D;  2PGD A;  1PIX A;  1SQP G;  3U1A A;  3MUD C;  3WU2 E;  1GK4 A;  2P10 A;  2WTY A;  1PGP A;  3RBX A;  3HE5 B;  4BWN A;  4YTP C;  3Q5P A;  3SWK A;  3PJS K;  3II6 A;  3G9R A;  1HGZ A;  3NMD A;  1OW7 A;  3N4X A;  4NBD D;  2ITA A;  5H2F H;  1UUW A;  1G1J A;  3HUS B;  5CCH D;  2QEX P;  1AA0 A;  1RE3 C;  1OX3 A;  2N1T A;  3I55 P;  2LXB A;  2KYV A;  2XZR A;  3HUS C;  3VYI A;  4HM0 A;  3CWB E;  2H7H A;  1HTL C;  3V2Q A;  4JBZ A;  3OJA B;  1DIP A;  2NVF A;  3GHG A;  1FDM A;  1M8O B;  1SQQ J;  1L0L K;  2ZYA A;  4B86 A;  3TGU D;  1M90 Q;  1VQ8 P;  2KOG A;  3H1I G;  3CWB D;  3VTP C;  3CX5 E;  3WU2 H;  1JTH B;  3GW6 A;  1OVR A;  4NBB D;  1MV8 A;  2NZ2 A;  2KLU A;  2E42 A;  3TGU J;  1NO4 A;  4GOD A;  2YXR B;  1VQ4 P; 
#chains in the Genus database with same CATH homology
 2MKV A;  1HJ0 A;  1KQG B;  1TU3 F;  2B24 A;  3GLM A;  3BCC E;  4QUP A;  4H0L C;  2YVJ B;  3VMH D;  2Q3W A;  4RKU J;  3L73 E;  2E74 D;  3AE2 C;  2E4Q A;  5L8R J;  4H13 C;  3DQY A;  1AJY A;  2FYU E;  3CXH E;  2E76 C;  3EQQ A;  4EMJ B;  2E75 C;  1SQB E;  2B1X A;  2YIU C;  1KQF B;  1IK7 A;  4R4L A;  3D71 A;  4OGQ D;  2QJK C;  2QSI A;  4HM4 A;  2H88 C;  3EWK A;  3Q2Y A;  3RL0 g;  3N0Q A;  3D89 A;  4H13 D;  4QUR A;  2JP3 A;  3S9O A;  1NTM E;  3IN6 A;  1NTZ E;  4H44 B;  1G8K B;  3Q5R A;  1ZP0 C;  1NTK E;  1SQV E;  2A06 E;  1VF5 B;  4H0L D;  2YFL A;  3H1L E;  3VCP A;  1NGM B;  4NBG D;  1VL2 A;  3ABV C;  4QDF A;  1U57 A;  5KKZ C;  1O7G A;  1ZME C;  4HM2 A;  1ULI A;  4I7Z C;  2BEZ F;  2E75 B;  4HM1 A;  3D70 A;  1ZOY C;  3L75 E;  5HL4 A;  4U3F E;  1RQV A;  2WSC J;  1UIX A;  4XFJ A;  4H44 D;  2FYN C;  3FGA D;  2BEQ D;  1KTM A;  4YXD C;  1PV3 A;  2CKF A;  2JO6 A;  4HM5 A;  4QCK A;  1PL5 A;  4P1B H;  1VF5 C;  2WSE J;  3L72 E;  5KLI C;  1O7H A;  4NBH D;  1KIL E;  1YQ3 C;  1EG9 A;  2E76 B;  3L70 E;  4HM6 A;  1SQP E;  2BMO A;  1UUV A;  2ZYL A;  4I7Z B;  3VMG D;  1WMK A;  2NVE A;  4GDO A;  4NB8 D;  1EXJ A;  2WPV B;  2IDB A;  1ZRT E;  3H1K E;  3GB4 A;  2O01 J;  2J5U A;  2FBW C;  1O7P A;  3VMI D;  4P1C H;  2H89 C;  1Q90 C;  4HKV A;  1OW6 A;  2OQQ A;  4NBC D;  3AE9 C;  4HM3 A;  1HF9 A;  3AE5 C;  2GBW A;  2QIW A;  3O6Q A;  2GBX A;  1KYO E;  3B71 A;  3GF7 A;  2WSF J;  2NWF A;  2BMQ A;  2HML A;  3GZY A;  2YMK A;  3TGU E;  3H1I E;  4HM7 A;  1VM9 A;  2BCC E;  3SFE C;  2WQY C;  2HMM A;  4NB9 D;  1K05 A;  1P84 E;  4QDF B;  2I7F A;  2FXP A;  2QJY C;  3R4Y A;  3GCE A;  1SQQ E;  2YFJ A;  4KT0 J;  4R4M A;  3GKE A;  1VCK A;  4Z1M H;  3Q1M A;  4TT3 H;  1EXI A;  4NBF D;  5AEW A;  2D2C D;  3AE4 C;  3Q5S A;  3RK3 E;  1WQL A;  3D6Y A;  1NDO A;  1RIE A;  4H44 C;  1SJG A;  1PP9 E;  3GTS A;  3GTE A;  1ULJ A;  1O7W A;  2BMR A;  1KMI Z;  3FOU A;  3IAO A;  1VF5 D;  3H1H E;  3AE7 C;  3AEB C;  3GL0 A;  1RFS A;  2HMJ A;  4NBA D;  1DD3 A;  2DE7 D;  2XSO A;  2XSH A;  2QPZ A;  3LW5 J;  4PV1 D;  5AEU A;  3VCA A;  2DE6 D;  3GL2 A;  3L74 E;  1OMI A;  4AAY B;  1NU1 E;  2K9Y A;  3C8V A;  1FQT A;  2HMK A;  4PD4 E;  3GF3 A;  1BCC E;  2E74 B;  2HMN A;  3L71 E;  3H25 A;  1JB0 J;  1NYH A;  1KB9 E;  3AEC C;  1MKM A;  2V7Q J;  1FDO A;  1DD4 A;  3AE3 C;  3T97 B;  3AEE C;  4Y28 J;  5KLV E;  1Q90 D;  1NYK A;  2G8Y A;  4AIV A;  4QDD A;  3AE1 C;  1BE3 E;  1JM1 A;  1G8J B;  3Q3D A;  4H13 B;  3H1J E;  4U7J A;  1O7N A;  2E74 C;  3D6Z A;  1KOR A;  4IL6 X;  1L0N E;  1EZV E;  1Y9B A;  3EN1 A;  4HJL A;  2NUK A;  1R8E A;  2ZT9 C;  4QDC A;  2JO1 A;  4H0L B;  1PIX A;  1YQ4 C;  4HM8 A;  2XR8 A;  2P10 A;  4YTP C;  3Q5P A;  3GMA A;  2G3A A;  2D2C B;  2DE5 D;  2NVG A;  3G9R A;  1OW7 A;  2D2C C;  5CXM A;  1FDI A;  1O7M A;  2ZT9 D;  4NBD D;  1UUW A;  2JZA A;  2XRX A;  4NBE D;  3AED C;  3AE6 C;  1K04 A;  3AZC A;  4HM0 A;  3CWB E;  4OGQ B;  4PV1 B;  1DIP A;  2NVF A;  2E4P A;  4PV1 C;  4QUQ A;  1SQX E;  3AEF C;  2E76 D;  2QJP C;  1S5L X;  1L0L E;  3C0D A;  5BOK A;  1S1C X;  2E75 D;  3CX5 E;  2ZT9 B;  2IBZ E;  3AEG C;  1GMJ A;  4OGQ C;  2NUM A;  4NBB D;  2NZ2 A;  5M1B A;  1PPJ E;  1OW8 A;  3GZX A;  3AE8 C;  3AEA C;  2YFI A;  2HMO A;  3GOB A;  1RQU A;  3SFD C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...