5KKZC

Rhodobacter sphaeroides bc1 with famoxadone
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
b'GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 51
structure length 179
sequence length 179
chains with identical sequence G, M, Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5kkzC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5kkzC02
3CX5E 3EQQA 2FYUE 1NDOA 3DQYA 5AEWA 5HL4A 1VF5D 4HM3A 2K9YA 3VMID 3CXHE 2E75D 2B1XA 2WPVB 4H13D 4QUQA 3GTSA 2XSOA 3LW5J 1ULIA 1O7PA 3D89A 3H1JE 4NBAD 4H0LB 3GCEA 3L71E 4U3FE 1RFSA 4QDFB 3GB4A 3L74E 1PP9E 4H44D 2HMLA 4P1BH 4HKVA 3L73E 1PPJE 1P84E 2FYNC 2DE5D 2QSIA 1O7WA 2HMNA 2NUKA 2B24A 1UUWA 1O7MA 2E74D 2D2CD 3GOBA 1SQPE 4PV1D 2NUMA 3AZCA 2BMOA 2Q3WA 4NBED 2E4QA 3L72E 2XSHA 2YIUC 1ZRTE 2GBXA 4NBBD 4NBDD 2JZAA 3C0DA 2ZT9D 2ZYLA 1SQBE 2E76D 2E75B 4OGQD 3H1LE 1Q90D 2IBZE 4HM0A 1VCKA 1FQTA 2BMQA 2QPZA 1O7GA 3VCAA 3C8VA 2YVJB 3H1IE 1SQXE 5L8RJ 2XRXA 3CWBE 2WSFJ 1VM9A 2NVEA 5BOKA 2BCCE 1JM1A 1S5LX 4I7ZB 5CXMA 4Y28J 2QIWA 4QDDA 1BE3E 5AEUA 3VMHD 3GKEA 2I7FA 4QDFA 4PV1B 4P1CH 2HMOA 2YFJA 2WSCJ 4AIVA 2XR8A 1JB0J 1VF5B 4QURA 5KKZC 2CKFA 4H13B 4KT0J 2QJYC 1G8JB 4NB9D 2QJPC 1G8KB 1L0LE 2DE6D 3L70E 1NTKE 4PD4E 1KB9E 3GTEA 1SQVE 2HMMA 4HM7A 3EN1A 1KYOE 3H1HE 5KLVE 1WQLA 4HM4A 3VMGD 4RKUJ 4HM8A 3N0QA 4NBGD 2A06E 3BCCE 4H44B 4NB8D 1SQQE 1NTZE 1SJGA 2E4PA 2YFIA 4HJLA 4HM6A 3L75E 3TGUE 1NU1E 2YFLA 2E74B 2D2CB 4HM5A 1O7HA 4H0LD 1RIEA 5KLIC 1ULJA 3FOUA 3GL2A 2JO6A 3H1KE 4NBHD 2DE7D 2HMJA 4AAYB 1BCCE 4QUPA 2NVGA 4NBCD 2ZT9B 2GBWA 2HMKA 3GZXA 4HM1A 3VCPA 1O7NA 1UUVA 4HM2A 2E76B 4OGQB 2O01J 1Q90C 4EMJB 3GL0A 2NVFA 2QJKC 4IL6X 3GZYA 2BMRA 4QCKA 1NYKA 1L0NE 1NTME 4NBFD 2WSEJ 4QDCA 1EG9A 2NWFA 1EZVE
chains in the Genus database with same CATH superfamily
4ZKUA 3KXDA 4HM3A 3VMID 1CI6A 3GTSA 2AEMA 3MP7B 4O9BA 4EDFA 3H1IG 3RL0C 3A0HH 3VYIA 3MIWA 3PP5A 2RMZA 1MZ9A 2KP8A 3G6EP 1QL2A 3RK2D 4AYCA 3W68A 1BSNA 2XU6A 3GOBA 4IOIH 3P8CD 1QL1A 1NH4A 2Q3WA 1LT9B 1M8OB 1G1JA 1YQ3C 2XSHA 1DEEG 1SQQK 1H89A 3LIEA 1GU4A 5KAFE 1PL5A 2FFDA 1ZP0C 3RK3B 1JCDA 1H8AA 3TGUG 1QEXA 1VM9A 5BOKA 3Q5PA 1URQD 2OGUA 1RE3A 1VF5C 2XKMA 1NHLA 3KZIE 1M90Q 3GHGC 1P84H 2W27A 4LGDE 2LXBA 4RKUJ 1PP9D 2KSEA 1JM0A 1JO5A 3TSIA 2E74B 5KJ7A 1L0ND 1Q81Q 2IBZG 5B5EH 4UB6E 2ZFCA 2O3JA 3IFMA 4U7JA 2W6JH 1KQSO 2DE7D 4QUPA 3L73G 2BCCG 1LGHB 3H1JD 3D6YA 2Q3EA 4IL6X 1AVYA 4NBFD 4KHXA 2R3SA 3AEGC 1M56D 1NDOA 3VP9A 4RJTA 2E75D 3P32A 5TJHA 2XSOA 3TDKA 1DD3A 2LR2A 1GL2D 4WWIA 3GB4A 1FJPA 2CK3H 2NUKA 5C39A 2WSEH 3A0BH 4Z1MH 2GUSA 3M9BA 4IFMA 4HB1A 1SQBJ 3F5HA 1NTZK 2H8PD 1HGVA 3WUTA 4HM0A 1CSBA 1SQXJ 3GHGB 1O7GA 2IZ0A 2NVEA 4L75A 3CCQP 2WVRA 2ZYAA 5AVZB 3VMHD 1LNQA 1JOCA 1LP1B 4UB8H 1AV1A 1VPCA 2OYIC 2CKFA 2K37A 2DE6D 1SQBK 2SPZA 3N0QA 1ZN5A 1SJGA 1HTLC 1SQXK 4HJLA 2D2CC 1JY2O 2NPSD 2OTKE 1LTJC 4D6TD 1PPJG 1DD4A 2O01J 1KQLA 1SS1A 1BGYG 3V2RA 3H6PA 2JR8A 4QDCA 1E5WA 1KFMA 1NYHA 3AE8C 5APQA 1DIPA 3HD7A 1YITP 3Q1MA 3GCEA 1FOSF 3AE5C 3Q2YA 2GM4A 2V7QJ 2FYNC 2NZ2A 3H1HD 1M7LA 1GW4A 2KZJA 1LJ2A 4NBED 2KK7A 1ZRTE 3L70G 1SQBE 2OYIB 2KUBA 1USDA 3VMXA 1SQXE 2BCCJ 2ITAA 1T2KC 1VQ5P 2HPCB 2IFMA 5AVRB 1N2DC 5CXMA 4Y28J 2C0XA 1U57A 1GTWA 2I1KA 2HMOA 3IAOA 1LTJB 1H0TB 1SQVJ 2RN0A 1KILA 2HG5D 5DJTB 5CBOA 2QEXP 1BCCD 1GL2B 2YMKA 1L4AC 1NU1J 3M9QA 3AEAC 4N3YB 1O7HA 4TT3H 1YYCA 1ULJA 3GL2A 5AW7B 1PZQA 2GA1A 3G71P 4DT0A 2FYNB 2QJKC 1NAFA 1SLQA 4BRYB 2FYUJ 2C9LY 3M0DC 3OW2O 2KS1B 3CXHE 1HJ0A 1ULIA 1YBKA 5BVZA 4N78E 3CCEP 3OJAB 3AE4C 1N7SA 1OXZA 2HMLA 4XE5B 1JY2N 3GF7A 5TISH 3D6ZA 4DOJA 4NBBD 2JZAA 4R4LA 2ZT9D 3SFDC 4OGQD 1T6AA 5CBNA 4H0LC 2FYUK 3VTPC 5H2FE 2IBZE 2NPSB 2Z5HA 3SFEC 2HFED 3HE5B 5K5GB 3MUDC 2BCCE 1L4AB 5CCHD 1FDIA 2IFNA 2FXOA 1CZQA 1IC2A 1SFCD 1SQQD 1AQTA 4JYCA 4A7PA 2QJYC 1G8JB 3MGNA 2Q7CA 2HODB 1SQVE 1JTHB 2QJKB 3L72G 3V4WA 3AE6C 1HVVA 4I7ZC 1M1JA 1NU1E 2N9YB 3CCSP 4C7NB 4NBHD 2M3EA 3TK1A 3BVHA 1BDCA 1RF1A 1VQ6P 1NTMJ 5B66E 3F89A 1OFCX 3AECC 1KORA 1EG9A 3SWYA 2FYUE 5AEWA 4W80A 2B1XA 3LW5J 4U3FJ 4H0LB 1A02J 5GTIE 1HWTC 1LTGC 2OTLP 2A06G 2JJLA 2HMNA 2C0WA 4YTPC 4C7RA 2QVAA 3USSA 1NTMK 3O8ZA 1IZNB 1M1JC 1IFJA 1SFCC 3B5NA 2QJYB 1Z56A 1FQTA 1X0TA 5KAIH 3CCJP 1RF1C 4I7ZB 4QDFA 1VQ9P 1NTZD 2YFJA 1YHQP 1JEKA 4H13C 4JQ0D 3RL0D 2KNCA 1RH5B 1DX7A 1KYOE 3H1KD 2WSFH 4H44C 4NB8D 3RBXA 3O6QB 2YXRB 3H25A 1EQ7A 3H1LG 2WSCH 3IN6A 3KZIH 2HYNA 2OYOA 3G4SP 1EDLA 2GUVA 2Z4EA 5APYA 2ZT9B 2HMKA 1SQBD 4OGQB 1ZXGA 3TNUB 3L36A 3S1KA 2NVFA 4DJGA 2KXPB 1N73A 3L74D 1NTME 1SQXD 1WT6A 1FE6A 4IFDK 2OYHA 1VF5D 1OVVA 2K9YA 1SFCB 1BDDA 1KILE 5M1BA 4U3FE 2JWDA 4HYTB 2B87A 3MHVA 1SQPJ 1LWUA 3CMEP 3AE2C 1S5LH 3H1ID 3L72J 1U7JA 2PGDA 3V2QA 1KFNA 4NBDD 1Q2NA 4NPEA 1GDTA 4YXDC 3KHUA 3M9HA 1VCKA 2BMQA 4WY4C 3FWNA 2M3BA 3HTKB 2W83C 1L2PA 4YXWH 4P1CH 3L71G 3TGUD 4QURA 2VRSA 2AEFA 5KLVJ 2QJPC 3GMAA 3VMAA 1KTMA 1Q82Q 2JP3A 5APTA 1EXIA 1NOHA 3PRJA 3BASA 1LWUC 1FZCB 3HUSB 3CX5D 3AEFC 4JYBA 1ZR4A 3V2NA 3W67A 4EI2A 3CXHI 2IBZD 1ZW0A 1NGMB 5KLVK 3L73D 1EZVE 1DH3A 1JNMA 2BCCD 3E7KA 1NVOA 3VMZA 1YJNP 4PJ0H 3GLMA 2QA4P 1JY3N 3CX5I 3T97B 3RL0B 1SVFA 2HLOA 1URQA 2IBZI 2D2CD 1SQPE 3HE4B 2FFDC 3L72E 2N9BA 3A3YB 3H1LJ 3C0DA 1S3JA 3SWKA 1S72P 1SQVG 5AW2B 4EYYQ 2QJPB 5APUA 5APVA 3I55P 1RE3C 1YJ9P 2YNYA 1BE3J 1NU1G 1QX8A 2AXTE 2YO2A 1JUNA 1OWAA 1R5SA 2YKQA 4AIVA 3CPWO 5AVVB 1L0LJ 1VF5B 1NTKJ 2HPCA 2R32A 2XDJA 1KV4A 5KJ7C 4OH8B 4HM7A 1W5CE 4GODA 1CI6B 5KLVE 2M5AA 3A0HE 3BCCJ 1GMJA 2A06E 2FYUG 4W7ZA 2IYOA 2Q6QA 1LT1A 1RQUA 1KQFB 4LC1A 2XZRA 2JEEA 3CMAP 4NBCD 2G3AA 1KMIZ 1T2KD 1Q90C 2H89C 2K3RA 2O01N 4ZKPA 1L0LK 1NTKK 4WBAA 3CCVP 2WWWA 3Q5SA 1PPJD 3ABVC 3DQYA 1BGYD 1VQ8P 3L71J 3HRNA 1QLED 3OAKA 5CMZA 4BRYA 2O01H 3IR9A 1VQ7P 4HKVA 1P84E 1L4AD 1G2CA 2LXCB 3EFGA 4AUWA 3CXHH 3QH9A 1IFNA 4K35A 3H32A 4AQRD 2Y0CA 3N7NA 3H1LE 3G3ZA 3BATA 1X79B 4L76A 2QPZA 1KC8Q 3WUUA 3VCAA 2I8DA 2V7QH 2Y0EA 2XRXA 3CL3D 3L70D 3CX5H 4CPGA 1BE3E 4N6JA 5H2FH 2XR8A 3FX0A 1FZAA 1L0LE 1NTKE 1WMKA 1KB9E 1NTMG 1D7MA 1S9KE 1X8YA 3BCCE 3L4FA 5CHXA 5E79E 2A45G 2WQYC 1XTCC 3K5BA 2D2CB 2Y9YA 4H0LD 4U3FG 4YPCA 2NVGA 2Q1KA 3AE9C 2BASA 4WVZA 1VQNP 1L0NJ 2P58A 1H88A 3HD7C 1MFTA 1LTBC 3VN0A 2IDBA 3H1JJ 1GZLA 1EDKA 4NBAD 2KLVA 3L71E 5B66H 5KTBA 2N1TA 4P1BH 1GK6A 3U59A 1KD1Q 1N7SD 1Y8AA 4GIFA 1SQVK 3PLNA 4DCKA 1BCCG 1L0NK 1ZMEC 5GTIH 2DW3A 1IFIA 1FU1A 1NU1K 1IJDB 2KOGA 4RO0A 3KDPB 3P8CE 1RHZB 1KILC 2OARA 1RE4A 3RBZA 4IL6E 1KZUB 2QM8A 1IFPA 3KQGA 3OA7A 1VL2A 1NAYA 3S9OA 1ZR2A 4NB9D 4NPFX 2R44A 3P7KA 1RF0A 2XV5A 3VMGD 4KJMA 5AW1B 1EZVG 3B71A 1HF9A 5APWA 2N1TC 1GW3A 1VQPP 5CCGA 1USEA 3TF5A 3L72D 3JC22 3PTZA 3O6QA 4HM1A 1UUVA 1J1DC 2WPRA 1SQPG 3V5BA 4D6TJ 1L0NE 2FY8A 1A02F 1N7SC 1FOSE 1LTSC 3R4YA 3AEDC 1RE4C 4H13D 3CCMP 3CI9A 4NPDA 3H1JE 1X22A 3NMDA 4H44D 3FXEA 2WPSA 5CCHA 1FZGA 2DE5D 3L75G 1VDFA 1O7MA 5AW4B 2CPBA 2NRGA 2A45H 2A06D 1JMBA 3LW5H 2ZYLA 4ASWA 5KLVG 4C46A 2IZ1A 3WU2E 4JPZB 3AEBC 4GDOA 1YIJP 2K9JB 1S5LX 3I56P 3MTUE 2QIWA 5APSA 3V2PA 2POHA 3HTKA 1KQGB 3SSUA 1G8KB 4PD4E 1W2EA 3UIAA 1J1DB 4RESB 1WQLA 1K9MQ 3B4SA 1LT9A 2E4PA 4BWNA 1N7SB 1WRGA 2YFLA 1N86A 5TISE 2ZVOB 4L73A 1BCCJ 5AW9B 2V4HA 4WY4D 5KAFH 3CC7P 2HMJA 5AVUB 1RQVA 4HKZH 1JY2P 3H1LD 3GL0A 3V6IA 2HR3A 1RY3A 1OVUA 2R5BA 1VQLP 1BSHA 2RKLA 4D6TE 3WMM0 2L5GB 1GU5A 3NTNA 3I5CA 1ZRTD 4JBZA 1HH0A 2B88A 1KB9D 3B5NC 1BE3G 1EC5A 1UUWA 1J2JB 2ZXXA 2JDIH 3L37A 3AZCA 4UB6H 3MD0A 1FS0E 3E1RA 2B89A 2ZXEB 1L0LG 1NTKG 5AW6B 1MKMA 2E76D 1M1JB 3IF4A 4R4MA 3BCCG 1QGKB 2B9BA 3C8VA 1PGPA 1KB9I 1RF1B 2CPSA 3M91A 1Y9BA 1Q86Q 4H13B 3N4XA 2WSSH 2HMMA 1X9VA 1SQQJ 3L71D 4I2LC 5AVWB 5AW8B 2AXTH 1M1KQ 4H44B 3L75J 1R8EA 4HM6A 2E74C 4PV1C 3GHGA 1N73C 5KLIC 1SQPK 3EWKA 3M06A 1SP4A 2OYHC 2G8YA 1FBMA 3CWBG 1BCCE 3C9IA 3CXHD 2Y9ZA 2GBWA 4HM2A 2Q5UA 1TU3F 1LP1A 3GZYA 3JCUE 2BMRA 3B5NB 1OW6A 4N78D 5KAIE 1AVOA 5GTHE 3NXSA 1UIXA 1EXJA 4ZNCA 3EQQA 2YMYA 1S4XA 3C1LA 3SWFA 1FDOA 1U7MA 2ZYGA 5KJ7D 3D89A 4ASVA 3E1IA 1M57D 1AJYA 4QDFB 2E76C 1NO4A 2PFXA 2R5DA 1KN7A 2QSIA 1O7WA 2KNCB 2MKVA 3CC2P 2Z5IA 1ZOYC 2I1JA 1FJKA 2YIUC 2GBXA 1UIIA 3V4QA 1LTAC 1Q7YQ 2OQQA 4TLFA 1Q90D 3CCUP 2R3CA 1QVGO 4WY4B 1HBWA 2IPPA 1Y47A 3CLQA 1SQVD 1JM1A 4GKGA 4EOTA 5AEUA 4IFFA 2I7FA 4PV1B 1N73B 3JSVC 3Q3DA 1PP9G 5KLIB 1NU1D 5KKZC 2OYHB 2WT7B 1ZLLA 5BU8B 3NFQA 1L0NG 1NTZJ 4OVNF 1MUUA 1SQQE 2PAJA 3RK2C 1LTIC 4WB4A 2OYIA 2YFIA 2B87B 3L75E 1S5LE 3H1JG 1T3UA 3H1KJ 1LWUB 1KB9H 2FYUD 3FGAD 2W6AA 3GZXA 1YTZT 2E76B 5CJ0A 5E79H 4I6MC 2P2UA 1J1EC 2WSEJ 1LTJA 1H0TA 2ZYDA 2XNXA 2YIUB 2MJZA 1URQC 5AVSB 1HGZA 1GL2A 1O7PA 2IYPA 3L74J 1PV3A 4OWFA 2KI7B 4BXLA 1K05A 5AW5B 4PD4D 1AFOA 3Q5RA 1FDMA 2K88A 2QE7H 1NJIQ 1HJBA 2FFDB 3PHLA 2YKOA 2QM7A 3RK3E 4DZOA 5KKZB 3H1IJ 3CWBJ 2J5UA 3HD7D 1AA0A 5L8RJ 3EQ2A 2KS1A 4M3LA 1MFZA 4QMAA 1PGJA 3AEEC 1KYOD 3RK2B 4PD4I 4Y99C 4QDDA 3GKEA 1OW8A 4XFJA 4GOEA 1YJWP 1JB0J 3D70A 2E75C 5B5EE 1HUCA 4PJ0E 2WPQA 2E5TA 1GL2C 2Q9IA 4IL6H 4D6TG 3TGUJ 1J1EB 1NTZE 4B86A 2NPSA 1KYOI 2M0BA 1NTMD 4HM5A 3BRTB 2KZIA 3HE5A 1URQB 1JY3P 1OW7A 3H1KE 1EDJA 1L4AA 2XNDH 5EFWB 3RL0g 1KILD 1IK7A 3GF3A 4U3FD 1OMIA 1PGOA 1GK4A 5AW0B 5AW3B 2PP6A 5BU5A 3CC4P 3A0BE 1PIXA 5HL4A 2HODA 1JTHA 2WPVB 3GW6A 1AQ5A 3A5TA 3MZWB 3H1HG 1T3JA 2WMMA 1PP9J 1RFSA 3L73J 3L74E 3M0DA 1OZHA 2KB7P 2A45I 2N1TD 2YO3A 2KIKA 4C7NA 1XTGB 2BEQD 4Y99B 2NUMA 2M5AB 2JKVA 1G1IA 2P10A 3M0AA 2ZJSE 4UB8E 2E75B 2NPSC 3PJSK 2P67A 2FXPA 2H88C 5AVYB 2P7JA 1FZFA 2JO1A 2E42A 3AE3C 2YVJB 3H1IE 3CWBE 1ZV8A 2YXQB 3ITKA 2QRXA 1EDIA 1W2BO 2W6BA 3AE1C 3BRVB 2ZVNB 3VMYA 2RH0A 3GG2A 3WU2H 4GOFA 3MUDA 2K9JA 3EN1A 1S2EA 1NKNA 1K04A 4I1LA 5CJ4A 3TGUE 2K1AA 1IFMA 4ZMDA 1G2CB 3LIDA 1EZVD 4PD4H 5CCGD 4AAYB 3U1AA 3VCPA 3H32B 2E43A 3U1CA 3HD7B 2O1KA 3CX5E 2KLUA 1SQPD 3KPEA 3RGUA 3FXDA 1KYOH 1EZVI 3R2PA 2M8RA 1VQKP 1PP9E 5AVTB 1VQ4P 3L73E 1BGYJ 1S1CX 2JWAA 2P1JA 3QWOC 2BMOA 2E4QA 3TNUA 4LLHA 3L75D 2W8ZA 4HJGH 3L35A 2IX7C 4K3AA 1SQQG 4W7YA 1GD2E 1FC2C 1YI2P 2E5YA 5KLVD 1KILB 4GT1A 1SFCA 1RF0C 3D71A 1K73Q 1K8AQ 2AEJA 3KYQA 2Q3IA 1YQ4C 4L74A 3L70J 2PRRA 1E79H 3H1HJ 2OTJP 5AVQB 5CCGC 1QVFO 3B5ND 3P8MC 3II6A 3WUVA 2W90A 4NBGD 2KYVA 2Y0DA 2H43A 2N1TB 2WTYA 3A7OA 1RIEA 2AXCA 3FOUA 1T8ZA 2ZT9C 3AE7C 4OGQC 1FAVA 3RK3D 1FZEA 2QG4A 2UWJE 3PH0A 2FXMA 1P84D 5CCHC 2FBWC 2ZAEB 5AVXB 3CCRP 4QUQA 1IFDA 1IK9A 1JMMA 3VP8A 1IO4A 3JCUH 1DEBA 1PPJE 5GTHH 2FYZA 1FZCA 3HUSA 2B24A 1N7LA 1YTZI 1BGYE 1R5LA 2E74D 3ZDMA 2KSJA 4PV1D 2YKPA 3A2AA 2J59M 1P84I 3G9RA 4XA4A 1NKZB 1BE3D 1VQMP 4EIJA 1VQOP 2L91A 3S4RA 1NTZG 2C9NY 1L0LD 2WSFJ 1OVRA 1NTKD 1JY3O 4MN4C 2O1JA 1S9KD 1MV8A 1LT9C 3BCCD 3TYYA 3H1KG 3T97A 4WY4A 2WSCJ 2J58A 5DJUB 4KT0J 3CCLP 3L70E 3GTEA 1JCCA 3EFFK 3H1HE 4HM4A 3HE4A 3RK3C 1NWQA 1N8RQ 4HM8A 2WZ7A 3CD6P 1PGQA 2WT7A 3VOPA 1SQBG 2H7HA 2FKWB 1FZCC 3HUSC 2WITA 1PFIA 3FWLA 1OX3A 3L74G 1SQXG 2JO6A 4HH2A 1OIPA 1FZBA 2LKMA 5APXA 1O7NA 4JF7A 1CW5A 3B8EB 4EMJB 2BEZF 4QCKA 1NYKA 2NWFA 3CWBD 1LTTC
chains in the Genus database with same CATH topology
2FYUE 5AEWA 4HM3A 3VMID 2IDBA 2B1XA 3GTSA 3LW5J 1O7PA 4NBAD 4H0LB 3L71E 1PV3A 1K05A 4P1BH 2HMNA 3Q5RA 4YTPC 3GOBA 2Q3WA 1YQ3C 2XSHA 1ZMEC 3RK3E 1FQTA 2J5UA 5L8RJ 1PL5A 1ZP0C 1VM9A 5BOKA 3AEEC 3Q5PA 4I7ZB 4QDDA 3GKEA 1OW8A 4QDFA 4XFJA 2YFJA 1VF5C 1JB0J 1VL2A 3D70A 2E75C 4H13C 3S9OA 4NB9D 1KYOE 3VMGD 3B71A 4H44C 4RKUJ 1HF9A 4NB8D 1NTZE 3H25A 2E74B 4HM5A 3IN6A 1OW7A 3H1KE 4U7JA 2DE7D 4QUPA 3O6QA 2ZT9B 2HMKA 4HM1A 1UUVA 4OGQB 3RL0g 2NVFA 1IK7A 3D6YA 3GF3A 4IL6X 1OMIA 1L0NE 1NTME 4NBFD 3AEGC 1NDOA 1PIXA 5HL4A 1VF5D 2K9YA 2E75D 3AEDC 2WPVB 3R4YA 4H13D 2XSOA 3H1JE 1DD3A 5M1BA 1KILE 4U3FE 1RFSA 3GB4A 3L74E 4H44D 2DE5D 2NUKA 1O7MA 3AE2C 4Z1MH 2BEQD 2NUMA 2P10A 4NBDD 2ZYLA 4YXDC 2E75B 2FXPA 2H88C 4HM0A 1VCKA 2BMQA 1O7GA 2JO1A 3AEBC 3AE3C 4GDOA 2YVJB 3H1IE 3CWBE 2NVEA 1S5LX 3AE1C 2QIWA 3VMHD 4P1CH 4QURA 2CKFA 1KQGB 2QJPC 3GMAA 1G8KB 2DE6D 4PD4E 3EN1A 1KTMA 1WQLA 2JP3A 3N0QA 1K04A 1EXIA 1SJGA 2E4PA 4HJLA 3TGUE 2D2CC 2YFLA 3AEFC 4AAYB 2HMJA 1RQVA 3VCPA 1DD4A 2O01J 3GL0A 1NGMB 4QDCA 1EZVE 3CX5E 1NYHA 3AE8C 1DIPA 3GLMA 3Q1MA 3GCEA 3AE5C 3T97B 1PP9E 3Q2YA 3L73E 2V7QJ 2FYNC 2NZ2A 1S1CX 1UUWA 2D2CD 1SQPE 3AZCA 2BMOA 4NBED 2E4QA 3L72E 1ZRTE 3C0DA 1SQBE 1MKMA 2E76D 4R4MA 3C8VA 1SQXE 5CXMA 4Y28J 1U57A 3D71A 2HMOA 4AIVA 1YQ4C 3IAOA 1VF5B 1Y9BA 4H13B 2HMMA 4HM7A 5KLVE 1GMJA 4NBGD 2A06E 2YMKA 4H44B 1R8EA 3AEAC 4HM6A 2E74C 4PV1C 1O7HA 4TT3H 1RIEA 5KLIC 1RQUA 1KQFB 3EWKA 1ULJA 3FOUA 3GL2A 2G8YA 2ZT9C 1BCCE 4NBCD 3AE7C 4OGQC 2GBWA 2G3AA 4HM2A 1KMIZ 1Q90C 2H89C 1TU3F 2QJKC 3GZYA 2BMRA 1OW6A 3Q5SA 1UIXA 1EXJA 3ABVC 3EQQA 2FBWC 3DQYA 3CXHE 4QUQA 1HJ0A 1ULIA 1FDOA 3D89A 1AJYA 4QDFB 2E76C 3AE4C 2HMLA 4HKVA 1PPJE 1P84E 2QSIA 1O7WA 3GF7A 2B24A 2MKVA 2E74D 4PV1D 3D6ZA 1ZOYC 2YIUC 2GBXA 4NBBD 3G9RA 2JZAA 4R4LA 2ZT9D 3SFDC 4OGQD 4H0LC 2OQQA 3H1LE 1Q90D 2IBZE 3SFEC 2QPZA 3VCAA 2XRXA 2WSFJ 2BCCE 1JM1A 1FDIA 5AEUA 1BE3E 2I7FA 4PV1B 2WSCJ 2XR8A 3Q3DA 5KKZC 4KT0J 2QJYC 1G8JB 1L0LE 3L70E 1WMKA 1NTKE 1KB9E 3GTEA 1SQVE 3H1HE 4HM4A 4HM8A 3BCCE 1SQQE 3AE6C 4I7ZC 2YFIA 3L75E 2WQYC 1NU1E 2D2CB 4H0LD 4NBHD 2JO6A 3FGAD 2NVGA 3GZXA 3AE9C 1O7NA 2E76B 4EMJB 3AECC 2BEZF 4QCKA 1KORA 1NYKA 2WSEJ 1EG9A 2NWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX5 E;  3EQQ A;  2FYU E;  1NDO A;  3DQY A;  5AEW A;  5HL4 A;  1VF5 D;  4HM3 A;  2K9Y A;  3VMI D;  3CXH E;  2E75 D;  2B1X A;  2WPV B;  4H13 D;  4QUQ A;  3GTS A;  2XSO A;  3LW5 J;  1ULI A;  1O7P A;  3D89 A;  3H1J E;  4NBA D;  4H0L B;  3GCE A;  3L71 E;  4U3F E;  1RFS A;  4QDF B;  3GB4 A;  3L74 E;  1PP9 E;  4H44 D;  2HML A;  4P1B H;  4HKV A;  3L73 E;  1PPJ E;  1P84 E;  2FYN C;  2DE5 D;  2QSI A;  1O7W A;  2HMN A;  2NUK A;  2B24 A;  1UUW A;  1O7M A;  2E74 D;  2D2C D;  3GOB A;  1SQP E;  4PV1 D;  2NUM A;  3AZC A;  2BMO A;  2Q3W A;  4NBE D;  2E4Q A;  3L72 E;  2XSH A;  2YIU C;  1ZRT E;  2GBX A;  4NBB D;  4NBD D;  2JZA A;  3C0D A;  2ZT9 D;  2ZYL A;  1SQB E;  2E76 D;  2E75 B;  4OGQ D;  3H1L E;  1Q90 D;  2IBZ E;  4HM0 A;  1VCK A;  1FQT A;  2BMQ A;  2QPZ A;  1O7G A;  3VCA A;  3C8V A;  2YVJ B;  3H1I E;  1SQX E;  5L8R J;  2XRX A;  3CWB E;  2WSF J;  1VM9 A;  2NVE A;  5BOK A;  2BCC E;  1JM1 A;  1S5L X;  4I7Z B;  5CXM A;  4Y28 J;  2QIW A;  4QDD A;  1BE3 E;  5AEU A;  3VMH D;  3GKE A;  2I7F A;  4QDF A;  4PV1 B;  4P1C H;  2HMO A;  2YFJ A;  2WSC J;  4AIV A;  2XR8 A;  1JB0 J;  1VF5 B;  4QUR A;  5KKZ C;  2CKF A;  4H13 B;  4KT0 J;  2QJY C;  1G8J B;  4NB9 D;  2QJP C;  1G8K B;  1L0L E;  2DE6 D;  3L70 E;  1NTK E;  4PD4 E;  1KB9 E;  3GTE A;  1SQV E;  2HMM A;  4HM7 A;  3EN1 A;  1KYO E;  3H1H E;  5KLV E;  1WQL A;  4HM4 A;  3VMG D;  4RKU J;  4HM8 A;  3N0Q A;  4NBG D;  2A06 E;  3BCC E;  4H44 B;  4NB8 D;  1SQQ E;  1NTZ E;  1SJG A;  2E4P A;  2YFI A;  4HJL A;  4HM6 A;  3L75 E;  3TGU E;  1NU1 E;  2YFL A;  2E74 B;  2D2C B;  4HM5 A;  1O7H A;  4H0L D;  1RIE A;  5KLI C;  1ULJ A;  3FOU A;  3GL2 A;  2JO6 A;  3H1K E;  4NBH D;  2DE7 D;  2HMJ A;  4AAY B;  1BCC E;  4QUP A;  2NVG A;  4NBC D;  2ZT9 B;  2GBW A;  2HMK A;  3GZX A;  4HM1 A;  3VCP A;  1O7N A;  1UUV A;  4HM2 A;  2E76 B;  4OGQ B;  2O01 J;  1Q90 C;  4EMJ B;  3GL0 A;  2NVF A;  2QJK C;  4IL6 X;  3GZY A;  2BMR A;  4QCK A;  1NYK A;  1L0N E;  1NTM E;  4NBF D;  2WSE J;  4QDC A;  1EG9 A;  2NWF A;  1EZV E; 
#chains in the Genus database with same CATH topology
 4ZKU A;  3KXD A;  4HM3 A;  3VMI D;  1CI6 A;  3GTS A;  2AEM A;  3MP7 B;  4O9B A;  4EDF A;  3H1I G;  3RL0 C;  3A0H H;  3VYI A;  3MIW A;  3PP5 A;  2RMZ A;  1MZ9 A;  2KP8 A;  3G6E P;  1QL2 A;  3RK2 D;  4AYC A;  3W68 A;  1BSN A;  2XU6 A;  3GOB A;  4IOI H;  3P8C D;  1QL1 A;  1NH4 A;  2Q3W A;  1LT9 B;  1M8O B;  1G1J A;  1YQ3 C;  2XSH A;  1DEE G;  1SQQ K;  1H89 A;  3LIE A;  1GU4 A;  5KAF E;  1PL5 A;  2FFD A;  1ZP0 C;  3RK3 B;  1JCD A;  1H8A A;  3TGU G;  1QEX A;  1VM9 A;  5BOK A;  3Q5P A;  1URQ D;  2OGU A;  1RE3 A;  1VF5 C;  2XKM A;  1NHL A;  3KZI E;  1M90 Q;  3GHG C;  1P84 H;  2W27 A;  4LGD E;  2LXB A;  4RKU J;  1PP9 D;  2KSE A;  1JM0 A;  1JO5 A;  3TSI A;  2E74 B;  5KJ7 A;  1L0N D;  1Q81 Q;  2IBZ G;  5B5E H;  4UB6 E;  2ZFC A;  2O3J A;  3IFM A;  4U7J A;  2W6J H;  1KQS O;  2DE7 D;  4QUP A;  3L73 G;  2BCC G;  1LGH B;  3H1J D;  3D6Y A;  2Q3E A;  4IL6 X;  1AVY A;  4NBF D;  4KHX A;  2R3S A;  3AEG C;  1M56 D;  1NDO A;  3VP9 A;  4RJT A;  2E75 D;  3P32 A;  5TJH A;  2XSO A;  3TDK A;  1DD3 A;  2LR2 A;  1GL2 D;  4WWI A;  3GB4 A;  1FJP A;  2CK3 H;  2NUK A;  5C39 A;  2WSE H;  3A0B H;  4Z1M H;  2GUS A;  3M9B A;  4IFM A;  4HB1 A;  1SQB J;  3F5H A;  1NTZ K;  2H8P D;  1HGV A;  3WUT A;  4HM0 A;  1CSB A;  1SQX J;  3GHG B;  1O7G A;  2IZ0 A;  2NVE A;  4L75 A;  3CCQ P;  2WVR A;  2ZYA A;  5AVZ B;  3VMH D;  1LNQ A;  1JOC A;  1LP1 B;  4UB8 H;  1AV1 A;  1VPC A;  2OYI C;  2CKF A;  2K37 A;  2DE6 D;  1SQB K;  2SPZ A;  3N0Q A;  1ZN5 A;  1SJG A;  1HTL C;  1SQX K;  4HJL A;  2D2C C;  1JY2 O;  2NPS D;  2OTK E;  1LTJ C;  4D6T D;  1PPJ G;  1DD4 A;  2O01 J;  1KQL A;  1SS1 A;  1BGY G;  3V2R A;  3H6P A;  2JR8 A;  4QDC A;  1E5W A;  1KFM A;  1NYH A;  3AE8 C;  5APQ A;  1DIP A;  3HD7 A;  1YIT P;  3Q1M A;  3GCE A;  1FOS F;  3AE5 C;  3Q2Y A;  2GM4 A;  2V7Q J;  2FYN C;  2NZ2 A;  3H1H D;  1M7L A;  1GW4 A;  2KZJ A;  1LJ2 A;  4NBE D;  2KK7 A;  1ZRT E;  3L70 G;  1SQB E;  2OYI B;  2KUB A;  1USD A;  3VMX A;  1SQX E;  2BCC J;  2ITA A;  1T2K C;  1VQ5 P;  2HPC B;  2IFM A;  5AVR B;  1N2D C;  5CXM A;  4Y28 J;  2C0X A;  1U57 A;  1GTW A;  2I1K A;  2HMO A;  3IAO A;  1LTJ B;  1H0T B;  1SQV J;  2RN0 A;  1KIL A;  2HG5 D;  5DJT B;  5CBO A;  2QEX P;  1BCC D;  1GL2 B;  2YMK A;  1L4A C;  1NU1 J;  3M9Q A;  3AEA C;  4N3Y B;  1O7H A;  4TT3 H;  1YYC A;  1ULJ A;  3GL2 A;  5AW7 B;  1PZQ A;  2GA1 A;  3G71 P;  4DT0 A;  2FYN B;  2QJK C;  1NAF A;  1SLQ A;  4BRY B;  2FYU J;  2C9L Y;  3M0D C;  3OW2 O;  2KS1 B;  3CXH E;  1HJ0 A;  1ULI A;  1YBK A;  5BVZ A;  4N78 E;  3CCE P;  3OJA B;  3AE4 C;  1N7S A;  1OXZ A;  2HML A;  4XE5 B;  1JY2 N;  3GF7 A;  5TIS H;  3D6Z A;  4DOJ A;  4NBB D;  2JZA A;  4R4L A;  2ZT9 D;  3SFD C;  4OGQ D;  1T6A A;  5CBN A;  4H0L C;  2FYU K;  3VTP C;  5H2F E;  2IBZ E;  2NPS B;  2Z5H A;  3SFE C;  2HFE D;  3HE5 B;  5K5G B;  3MUD C;  2BCC E;  1L4A B;  5CCH D;  1FDI A;  2IFN A;  2FXO A;  1CZQ A;  1IC2 A;  1SFC D;  1SQQ D;  1AQT A;  4JYC A;  4A7P A;  2QJY C;  1G8J B;  3MGN A;  2Q7C A;  2HOD B;  1SQV E;  1JTH B;  2QJK B;  3L72 G;  3V4W A;  3AE6 C;  1HVV A;  4I7Z C;  1M1J A;  1NU1 E;  2N9Y B;  3CCS P;  4C7N B;  4NBH D;  2M3E A;  3TK1 A;  3BVH A;  1BDC A;  1RF1 A;  1VQ6 P;  1NTM J;  5B66 E;  3F89 A;  1OFC X;  3AEC C;  1KOR A;  1EG9 A;  3SWY A;  2FYU E;  5AEW A;  4W80 A;  2B1X A;  3LW5 J;  4U3F J;  4H0L B;  1A02 J;  5GTI E;  1HWT C;  1LTG C;  2OTL P;  2A06 G;  2JJL A;  2HMN A;  2C0W A;  4YTP C;  4C7R A;  2QVA A;  3USS A;  1NTM K;  3O8Z A;  1IZN B;  1M1J C;  1IFJ A;  1SFC C;  3B5N A;  2QJY B;  1Z56 A;  1FQT A;  1X0T A;  5KAI H;  3CCJ P;  1RF1 C;  4I7Z B;  4QDF A;  1VQ9 P;  1NTZ D;  2YFJ A;  1YHQ P;  1JEK A;  4H13 C;  4JQ0 D;  3RL0 D;  2KNC A;  1RH5 B;  1DX7 A;  1KYO E;  3H1K D;  2WSF H;  4H44 C;  4NB8 D;  3RBX A;  3O6Q B;  2YXR B;  3H25 A;  1EQ7 A;  3H1L G;  2WSC H;  3IN6 A;  3KZI H;  2HYN A;  2OYO A;  3G4S P;  1EDL A;  2GUV A;  2Z4E A;  5APY A;  2ZT9 B;  2HMK A;  1SQB D;  4OGQ B;  1ZXG A;  3TNU B;  3L36 A;  3S1K A;  2NVF A;  4DJG A;  2KXP B;  1N73 A;  3L74 D;  1NTM E;  1SQX D;  1WT6 A;  1FE6 A;  4IFD K;  2OYH A;  1VF5 D;  1OVV A;  2K9Y A;  1SFC B;  1BDD A;  1KIL E;  5M1B A;  4U3F E;  2JWD A;  4HYT B;  2B87 A;  3MHV A;  1SQP J;  1LWU A;  3CME P;  3AE2 C;  1S5L H;  3H1I D;  3L72 J;  1U7J A;  2PGD A;  3V2Q A;  1KFN A;  4NBD D;  1Q2N A;  4NPE A;  1GDT A;  4YXD C;  3KHU A;  3M9H A;  1VCK A;  2BMQ A;  4WY4 C;  3FWN A;  2M3B A;  3HTK B;  2W83 C;  1L2P A;  4YXW H;  4P1C H;  3L71 G;  3TGU D;  4QUR A;  2VRS A;  2AEF A;  5KLV J;  2QJP C;  3GMA A;  3VMA A;  1KTM A;  1Q82 Q;  2JP3 A;  5APT A;  1EXI A;  1NOH A;  3PRJ A;  3BAS A;  1LWU C;  1FZC B;  3HUS B;  3CX5 D;  3AEF C;  4JYB A;  1ZR4 A;  3V2N A;  3W67 A;  4EI2 A;  3CXH I;  2IBZ D;  1ZW0 A;  1NGM B;  5KLV K;  3L73 D;  1EZV E;  1DH3 A;  1JNM A;  2BCC D;  3E7K A;  1NVO A;  3VMZ A;  1YJN P;  4PJ0 H;  3GLM A;  2QA4 P;  1JY3 N;  3CX5 I;  3T97 B;  3RL0 B;  1SVF A;  2HLO A;  1URQ A;  2IBZ I;  2D2C D;  1SQP E;  3HE4 B;  2FFD C;  3L72 E;  2N9B A;  3A3Y B;  3H1L J;  3C0D A;  1S3J A;  3SWK A;  1S72 P;  1SQV G;  5AW2 B;  4EYY Q;  2QJP B;  5APU A;  5APV A;  3I55 P;  1RE3 C;  1YJ9 P;  2YNY A;  1BE3 J;  1NU1 G;  1QX8 A;  2AXT E;  2YO2 A;  1JUN A;  1OWA A;  1R5S A;  2YKQ A;  4AIV A;  3CPW O;  5AVV B;  1L0L J;  1VF5 B;  1NTK J;  2HPC A;  2R32 A;  2XDJ A;  1KV4 A;  5KJ7 C;  4OH8 B;  4HM7 A;  1W5C E;  4GOD A;  1CI6 B;  5KLV E;  2M5A A;  3A0H E;  3BCC J;  1GMJ A;  2A06 E;  2FYU G;  4W7Z A;  2IYO A;  2Q6Q A;  1LT1 A;  1RQU A;  1KQF B;  4LC1 A;  2XZR A;  2JEE A;  3CMA P;  4NBC D;  2G3A A;  1KMI Z;  1T2K D;  1Q90 C;  2H89 C;  2K3R A;  2O01 N;  4ZKP A;  1L0L K;  1NTK K;  4WBA A;  3CCV P;  2WWW A;  3Q5S A;  1PPJ D;  3ABV C;  3DQY A;  1BGY D;  1VQ8 P;  3L71 J;  3HRN A;  1QLE D;  3OAK A;  5CMZ A;  4BRY A;  2O01 H;  3IR9 A;  1VQ7 P;  4HKV A;  1P84 E;  1L4A D;  1G2C A;  2LXC B;  3EFG A;  4AUW A;  3CXH H;  3QH9 A;  1IFN A;  4K35 A;  3H32 A;  4AQR D;  2Y0C A;  3N7N A;  3H1L E;  3G3Z A;  3BAT A;  1X79 B;  4L76 A;  2QPZ A;  1KC8 Q;  3WUU A;  3VCA A;  2I8D A;  2V7Q H;  2Y0E A;  2XRX A;  3CL3 D;  3L70 D;  3CX5 H;  4CPG A;  1BE3 E;  4N6J A;  5H2F H;  2XR8 A;  3FX0 A;  1FZA A;  1L0L E;  1NTK E;  1WMK A;  1KB9 E;  1NTM G;  1D7M A;  1S9K E;  1X8Y A;  3BCC E;  3L4F A;  5CHX A;  5E79 E;  2A45 G;  2WQY C;  1XTC C;  3K5B A;  2D2C B;  2Y9Y A;  4H0L D;  4U3F G;  4YPC A;  2NVG A;  2Q1K A;  3AE9 C;  2BAS A;  4WVZ A;  1VQN P;  1L0N J;  2P58 A;  1H88 A;  3HD7 C;  1MFT A;  1LTB C;  3VN0 A;  2IDB A;  3H1J J;  1GZL A;  1EDK A;  4NBA D;  2KLV A;  3L71 E;  5B66 H;  5KTB A;  2N1T A;  4P1B H;  1GK6 A;  3U59 A;  1KD1 Q;  1N7S D;  1Y8A A;  4GIF A;  1SQV K;  3PLN A;  4DCK A;  1BCC G;  1L0N K;  1ZME C;  5GTI H;  2DW3 A;  1IFI A;  1FU1 A;  1NU1 K;  1IJD B;  2KOG A;  4RO0 A;  3KDP B;  3P8C E;  1RHZ B;  1KIL C;  2OAR A;  1RE4 A;  3RBZ A;  4IL6 E;  1KZU B;  2QM8 A;  1IFP A;  3KQG A;  3OA7 A;  1VL2 A;  1NAY A;  3S9O A;  1ZR2 A;  4NB9 D;  4NPF X;  2R44 A;  3P7K A;  1RF0 A;  2XV5 A;  3VMG D;  4KJM A;  5AW1 B;  1EZV G;  3B71 A;  1HF9 A;  5APW A;  2N1T C;  1GW3 A;  1VQP P;  5CCG A;  1USE A;  3TF5 A;  3L72 D;  3JC2 2;  3PTZ A;  3O6Q A;  4HM1 A;  1UUV A;  1J1D C;  2WPR A;  1SQP G;  3V5B A;  4D6T J;  1L0N E;  2FY8 A;  1A02 F;  1N7S C;  1FOS E;  1LTS C;  3R4Y A;  3AED C;  1RE4 C;  4H13 D;  3CCM P;  3CI9 A;  4NPD A;  3H1J E;  1X22 A;  3NMD A;  4H44 D;  3FXE A;  2WPS A;  5CCH A;  1FZG A;  2DE5 D;  3L75 G;  1VDF A;  1O7M A;  5AW4 B;  2CPB A;  2NRG A;  2A45 H;  2A06 D;  1JMB A;  3LW5 H;  2ZYL A;  4ASW A;  5KLV G;  4C46 A;  2IZ1 A;  3WU2 E;  4JPZ B;  3AEB C;  4GDO A;  1YIJ P;  2K9J B;  1S5L X;  3I56 P;  3MTU E;  2QIW A;  5APS A;  3V2P A;  2POH A;  3HTK A;  1KQG B;  3SSU A;  1G8K B;  4PD4 E;  1W2E A;  3UIA A;  1J1D B;  4RES B;  1WQL A;  1K9M Q;  3B4S A;  1LT9 A;  2E4P A;  4BWN A;  1N7S B;  1WRG A;  2YFL A;  1N86 A;  5TIS E;  2ZVO B;  4L73 A;  1BCC J;  5AW9 B;  2V4H A;  4WY4 D;  5KAF H;  3CC7 P;  2HMJ A;  5AVU B;  1RQV A;  4HKZ H;  1JY2 P;  3H1L D;  3GL0 A;  3V6I A;  2HR3 A;  1RY3 A;  1OVU A;  2R5B A;  1VQL P;  1BSH A;  2RKL A;  4D6T E;  3WMM 0;  2L5G B;  1GU5 A;  3NTN A;  3I5C A;  1ZRT D;  4JBZ A;  1HH0 A;  2B88 A;  1KB9 D;  3B5N C;  1BE3 G;  1EC5 A;  1UUW A;  1J2J B;  2ZXX A;  2JDI H;  3L37 A;  3AZC A;  4UB6 H;  3MD0 A;  1FS0 E;  3E1R A;  2B89 A;  2ZXE B;  1L0L G;  1NTK G;  5AW6 B;  1MKM A;  2E76 D;  1M1J B;  3IF4 A;  4R4M A;  3BCC G;  1QGK B;  2B9B A;  3C8V A;  1PGP A;  1KB9 I;  1RF1 B;  2CPS A;  3M91 A;  1Y9B A;  1Q86 Q;  4H13 B;  3N4X A;  2WSS H;  2HMM A;  1X9V A;  1SQQ J;  3L71 D;  4I2L C;  5AVW B;  5AW8 B;  2AXT H;  1M1K Q;  4H44 B;  3L75 J;  1R8E A;  4HM6 A;  2E74 C;  4PV1 C;  3GHG A;  1N73 C;  5KLI C;  1SQP K;  3EWK A;  3M06 A;  1SP4 A;  2OYH C;  2G8Y A;  1FBM A;  3CWB G;  1BCC E;  3C9I A;  3CXH D;  2Y9Z A;  2GBW A;  4HM2 A;  2Q5U A;  1TU3 F;  1LP1 A;  3GZY A;  3JCU E;  2BMR A;  3B5N B;  1OW6 A;  4N78 D;  5KAI E;  1AVO A;  5GTH E;  3NXS A;  1UIX A;  1EXJ A;  4ZNC A;  3EQQ A;  2YMY A;  1S4X A;  3C1L A;  3SWF A;  1FDO A;  1U7M A;  2ZYG A;  5KJ7 D;  3D89 A;  4ASV A;  3E1I A;  1M57 D;  1AJY A;  4QDF B;  2E76 C;  1NO4 A;  2PFX A;  2R5D A;  1KN7 A;  2QSI A;  1O7W A;  2KNC B;  2MKV A;  3CC2 P;  2Z5I A;  1ZOY C;  2I1J A;  1FJK A;  2YIU C;  2GBX A;  1UII A;  3V4Q A;  1LTA C;  1Q7Y Q;  2OQQ A;  4TLF A;  1Q90 D;  3CCU P;  2R3C A;  1QVG O;  4WY4 B;  1HBW A;  2IPP A;  1Y47 A;  3CLQ A;  1SQV D;  1JM1 A;  4GKG A;  4EOT A;  5AEU A;  4IFF A;  2I7F A;  4PV1 B;  1N73 B;  3JSV C;  3Q3D A;  1PP9 G;  5KLI B;  1NU1 D;  5KKZ C;  2OYH B;  2WT7 B;  1ZLL A;  5BU8 B;  3NFQ A;  1L0N G;  1NTZ J;  4OVN F;  1MUU A;  1SQQ E;  2PAJ A;  3RK2 C;  1LTI C;  4WB4 A;  2OYI A;  2YFI A;  2B87 B;  3L75 E;  1S5L E;  3H1J G;  1T3U A;  3H1K J;  1LWU B;  1KB9 H;  2FYU D;  3FGA D;  2W6A A;  3GZX A;  1YTZ T;  2E76 B;  5CJ0 A;  5E79 H;  4I6M C;  2P2U A;  1J1E C;  2WSE J;  1LTJ A;  1H0T A;  2ZYD A;  2XNX A;  2YIU B;  2MJZ A;  1URQ C;  5AVS B;  1HGZ A;  1GL2 A;  1O7P A;  2IYP A;  3L74 J;  1PV3 A;  4OWF A;  2KI7 B;  4BXL A;  1K05 A;  5AW5 B;  4PD4 D;  1AFO A;  3Q5R A;  1FDM A;  2K88 A;  2QE7 H;  1NJI Q;  1HJB A;  2FFD B;  3PHL A;  2YKO A;  2QM7 A;  3RK3 E;  4DZO A;  5KKZ B;  3H1I J;  3CWB J;  2J5U A;  3HD7 D;  1AA0 A;  5L8R J;  3EQ2 A;  2KS1 A;  4M3L A;  1MFZ A;  4QMA A;  1PGJ A;  3AEE C;  1KYO D;  3RK2 B;  4PD4 I;  4Y99 C;  4QDD A;  3GKE A;  1OW8 A;  4XFJ A;  4GOE A;  1YJW P;  1JB0 J;  3D70 A;  2E75 C;  5B5E E;  1HUC A;  4PJ0 E;  2WPQ A;  2E5T A;  1GL2 C;  2Q9I A;  4IL6 H;  4D6T G;  3TGU J;  1J1E B;  1NTZ E;  4B86 A;  2NPS A;  1KYO I;  2M0B A;  1NTM D;  4HM5 A;  3BRT B;  2KZI A;  3HE5 A;  1URQ B;  1JY3 P;  1OW7 A;  3H1K E;  1EDJ A;  1L4A A;  2XND H;  5EFW B;  3RL0 g;  1KIL D;  1IK7 A;  3GF3 A;  4U3F D;  1OMI A;  1PGO A;  1GK4 A;  5AW0 B;  5AW3 B;  2PP6 A;  5BU5 A;  3CC4 P;  3A0B E;  1PIX A;  5HL4 A;  2HOD A;  1JTH A;  2WPV B;  3GW6 A;  1AQ5 A;  3A5T A;  3MZW B;  3H1H G;  1T3J A;  2WMM A;  1PP9 J;  1RFS A;  3L73 J;  3L74 E;  3M0D A;  1OZH A;  2KB7 P;  2A45 I;  2N1T D;  2YO3 A;  2KIK A;  4C7N A;  1XTG B;  2BEQ D;  4Y99 B;  2NUM A;  2M5A B;  2JKV A;  1G1I A;  2P10 A;  3M0A A;  2ZJS E;  4UB8 E;  2E75 B;  2NPS C;  3PJS K;  2P67 A;  2FXP A;  2H88 C;  5AVY B;  2P7J A;  1FZF A;  2JO1 A;  2E42 A;  3AE3 C;  2YVJ B;  3H1I E;  3CWB E;  1ZV8 A;  2YXQ B;  3ITK A;  2QRX A;  1EDI A;  1W2B O;  2W6B A;  3AE1 C;  3BRV B;  2ZVN B;  3VMY A;  2RH0 A;  3GG2 A;  3WU2 H;  4GOF A;  3MUD A;  2K9J A;  3EN1 A;  1S2E A;  1NKN A;  1K04 A;  4I1L A;  5CJ4 A;  3TGU E;  2K1A A;  1IFM A;  4ZMD A;  1G2C B;  3LID A;  1EZV D;  4PD4 H;  5CCG D;  4AAY B;  3U1A A;  3VCP A;  3H32 B;  2E43 A;  3U1C A;  3HD7 B;  2O1K A;  3CX5 E;  2KLU A;  1SQP D;  3KPE A;  3RGU A;  3FXD A;  1KYO H;  1EZV I;  3R2P A;  2M8R A;  1VQK P;  1PP9 E;  5AVT B;  1VQ4 P;  3L73 E;  1BGY J;  1S1C X;  2JWA A;  2P1J A;  3QWO C;  2BMO A;  2E4Q A;  3TNU A;  4LLH A;  3L75 D;  2W8Z A;  4HJG H;  3L35 A;  2IX7 C;  4K3A A;  1SQQ G;  4W7Y A;  1GD2 E;  1FC2 C;  1YI2 P;  2E5Y A;  5KLV D;  1KIL B;  4GT1 A;  1SFC A;  1RF0 C;  3D71 A;  1K73 Q;  1K8A Q;  2AEJ A;  3KYQ A;  2Q3I A;  1YQ4 C;  4L74 A;  3L70 J;  2PRR A;  1E79 H;  3H1H J;  2OTJ P;  5AVQ B;  5CCG C;  1QVF O;  3B5N D;  3P8M C;  3II6 A;  3WUV A;  2W90 A;  4NBG D;  2KYV A;  2Y0D A;  2H43 A;  2N1T B;  2WTY A;  3A7O A;  1RIE A;  2AXC A;  3FOU A;  1T8Z A;  2ZT9 C;  3AE7 C;  4OGQ C;  1FAV A;  3RK3 D;  1FZE A;  2QG4 A;  2UWJ E;  3PH0 A;  2FXM A;  1P84 D;  5CCH C;  2FBW C;  2ZAE B;  5AVX B;  3CCR P;  4QUQ A;  1IFD A;  1IK9 A;  1JMM A;  3VP8 A;  1IO4 A;  3JCU H;  1DEB A;  1PPJ E;  5GTH H;  2FYZ A;  1FZC A;  3HUS A;  2B24 A;  1N7L A;  1YTZ I;  1BGY E;  1R5L A;  2E74 D;  3ZDM A;  2KSJ A;  4PV1 D;  2YKP A;  3A2A A;  2J59 M;  1P84 I;  3G9R A;  4XA4 A;  1NKZ B;  1BE3 D;  1VQM P;  4EIJ A;  1VQO P;  2L91 A;  3S4R A;  1NTZ G;  2C9N Y;  1L0L D;  2WSF J;  1OVR A;  1NTK D;  1JY3 O;  4MN4 C;  2O1J A;  1S9K D;  1MV8 A;  1LT9 C;  3BCC D;  3TYY A;  3H1K G;  3T97 A;  4WY4 A;  2WSC J;  2J58 A;  5DJU B;  4KT0 J;  3CCL P;  3L70 E;  3GTE A;  1JCC A;  3EFF K;  3H1H E;  4HM4 A;  3HE4 A;  3RK3 C;  1NWQ A;  1N8R Q;  4HM8 A;  2WZ7 A;  3CD6 P;  1PGQ A;  2WT7 A;  3VOP A;  1SQB G;  2H7H A;  2FKW B;  1FZC C;  3HUS C;  2WIT A;  1PFI A;  3FWL A;  1OX3 A;  3L74 G;  1SQX G;  2JO6 A;  4HH2 A;  1OIP A;  1FZB A;  2LKM A;  5APX A;  1O7N A;  4JF7 A;  1CW5 A;  3B8E B;  4EMJ B;  2BEZ F;  4QCK A;  1NYK A;  2NWF A;  3CWB D;  1LTT C; 
#chains in the Genus database with same CATH homology
 2FYU E;  5AEW A;  4HM3 A;  3VMI D;  2IDB A;  2B1X A;  3GTS A;  3LW5 J;  1O7P A;  4NBA D;  4H0L B;  3L71 E;  1PV3 A;  1K05 A;  4P1B H;  2HMN A;  3Q5R A;  4YTP C;  3GOB A;  2Q3W A;  1YQ3 C;  2XSH A;  1ZME C;  3RK3 E;  1FQT A;  2J5U A;  5L8R J;  1PL5 A;  1ZP0 C;  1VM9 A;  5BOK A;  3AEE C;  3Q5P A;  4I7Z B;  4QDD A;  3GKE A;  1OW8 A;  4QDF A;  4XFJ A;  2YFJ A;  1VF5 C;  1JB0 J;  1VL2 A;  3D70 A;  2E75 C;  4H13 C;  3S9O A;  4NB9 D;  1KYO E;  3VMG D;  3B71 A;  4H44 C;  4RKU J;  1HF9 A;  4NB8 D;  1NTZ E;  3H25 A;  2E74 B;  4HM5 A;  3IN6 A;  1OW7 A;  3H1K E;  4U7J A;  2DE7 D;  4QUP A;  3O6Q A;  2ZT9 B;  2HMK A;  4HM1 A;  1UUV A;  4OGQ B;  3RL0 g;  2NVF A;  1IK7 A;  3D6Y A;  3GF3 A;  4IL6 X;  1OMI A;  1L0N E;  1NTM E;  4NBF D;  3AEG C;  1NDO A;  1PIX A;  5HL4 A;  1VF5 D;  2K9Y A;  2E75 D;  3AED C;  2WPV B;  3R4Y A;  4H13 D;  2XSO A;  3H1J E;  1DD3 A;  5M1B A;  1KIL E;  4U3F E;  1RFS A;  3GB4 A;  3L74 E;  4H44 D;  2DE5 D;  2NUK A;  1O7M A;  3AE2 C;  4Z1M H;  2BEQ D;  2NUM A;  2P10 A;  4NBD D;  2ZYL A;  4YXD C;  2E75 B;  2FXP A;  2H88 C;  4HM0 A;  1VCK A;  2BMQ A;  1O7G A;  2JO1 A;  3AEB C;  3AE3 C;  4GDO A;  2YVJ B;  3H1I E;  3CWB E;  2NVE A;  1S5L X;  3AE1 C;  2QIW A;  3VMH D;  4P1C H;  4QUR A;  2CKF A;  1KQG B;  2QJP C;  3GMA A;  1G8K B;  2DE6 D;  4PD4 E;  3EN1 A;  1KTM A;  1WQL A;  2JP3 A;  3N0Q A;  1K04 A;  1EXI A;  1SJG A;  2E4P A;  4HJL A;  3TGU E;  2D2C C;  2YFL A;  3AEF C;  4AAY B;  2HMJ A;  1RQV A;  3VCP A;  1DD4 A;  2O01 J;  3GL0 A;  1NGM B;  4QDC A;  1EZV E;  3CX5 E;  1NYH A;  3AE8 C;  1DIP A;  3GLM A;  3Q1M A;  3GCE A;  3AE5 C;  3T97 B;  1PP9 E;  3Q2Y A;  3L73 E;  2V7Q J;  2FYN C;  2NZ2 A;  1S1C X;  1UUW A;  2D2C D;  1SQP E;  3AZC A;  2BMO A;  4NBE D;  2E4Q A;  3L72 E;  1ZRT E;  3C0D A;  1SQB E;  1MKM A;  2E76 D;  4R4M A;  3C8V A;  1SQX E;  5CXM A;  4Y28 J;  1U57 A;  3D71 A;  2HMO A;  4AIV A;  1YQ4 C;  3IAO A;  1VF5 B;  1Y9B A;  4H13 B;  2HMM A;  4HM7 A;  5KLV E;  1GMJ A;  4NBG D;  2A06 E;  2YMK A;  4H44 B;  1R8E A;  3AEA C;  4HM6 A;  2E74 C;  4PV1 C;  1O7H A;  4TT3 H;  1RIE A;  5KLI C;  1RQU A;  1KQF B;  3EWK A;  1ULJ A;  3FOU A;  3GL2 A;  2G8Y A;  2ZT9 C;  1BCC E;  4NBC D;  3AE7 C;  4OGQ C;  2GBW A;  2G3A A;  4HM2 A;  1KMI Z;  1Q90 C;  2H89 C;  1TU3 F;  2QJK C;  3GZY A;  2BMR A;  1OW6 A;  3Q5S A;  1UIX A;  1EXJ A;  3ABV C;  3EQQ A;  2FBW C;  3DQY A;  3CXH E;  4QUQ A;  1HJ0 A;  1ULI A;  1FDO A;  3D89 A;  1AJY A;  4QDF B;  2E76 C;  3AE4 C;  2HML A;  4HKV A;  1PPJ E;  1P84 E;  2QSI A;  1O7W A;  3GF7 A;  2B24 A;  2MKV A;  2E74 D;  4PV1 D;  3D6Z A;  1ZOY C;  2YIU C;  2GBX A;  4NBB D;  3G9R A;  2JZA A;  4R4L A;  2ZT9 D;  3SFD C;  4OGQ D;  4H0L C;  2OQQ A;  3H1L E;  1Q90 D;  2IBZ E;  3SFE C;  2QPZ A;  3VCA A;  2XRX A;  2WSF J;  2BCC E;  1JM1 A;  1FDI A;  5AEU A;  1BE3 E;  2I7F A;  4PV1 B;  2WSC J;  2XR8 A;  3Q3D A;  5KKZ C;  4KT0 J;  2QJY C;  1G8J B;  1L0L E;  3L70 E;  1WMK A;  1NTK E;  1KB9 E;  3GTE A;  1SQV E;  3H1H E;  4HM4 A;  4HM8 A;  3BCC E;  1SQQ E;  3AE6 C;  4I7Z C;  2YFI A;  3L75 E;  2WQY C;  1NU1 E;  2D2C B;  4H0L D;  4NBH D;  2JO6 A;  3FGA D;  2NVG A;  3GZX A;  3AE9 C;  1O7N A;  2E76 B;  4EMJ B;  3AEC C;  2BEZ F;  4QCK A;  1KOR A;  1NYK A;  2WSE J;  1EG9 A;  2NWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...