5KKZC

Rhodobacter sphaeroides bc1 with famoxadone
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
GTRRDFLYYATAGAGAVATGAAVWPLINQMNPSADVQALASIFVDVSSVEPGVQLTVKFLGKPIFIRRRTEADIELGRSVQLGQLVDTNARNANIDAGAEATDQNRTLDEAGEWLVMWGVCTHLGCVPIGGVSGDFGGWFCPCHGSHYDSAGRIRKGPAPENLPIPLAKFIDETTIQLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Cytochrome b
total genus 51
structure length 179
sequence length 179
chains with identical sequence G, M, Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00355 Rieske Rieske [2Fe-2S] domain
C PF10399 UCR_Fe-S_N Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 5kkzC01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5kkzC02
1SQBE 1O7PA 1ULJA 2NWFA 1Q90D 1JB0J 1ULIA 3FOUA 5CXMA 2CKFA 1EZVE 5HL4A 3D89A 2DE6D 2FYUE 4P1BH 1S5LX 2WSEJ 3H1HE 2JZAA 2QJKC 1O7HA 3L75E 4H13D 4HJLA 4HM7A 5BOKA 1SQQE 1UUVA 2A06E 1FQTA 1O7MA 5KKZC 2ZYLA 1PPJE 1G8KB 1VM9A 4Y28J 1L0LE 2I7FA 2NUMA 4RKUJ 3BCCE 4NB9D 4PD4E 5AEWA 2IBZE 1O7NA 2E4PA 1RFSA 5KLIC 3EN1A 3GTEA 4NB8D 1O7GA 3GL0A 4IL6X 4H44D 3L70E 4HM4A 2B1XA 1G8JB 2HMOA 3GOBA 1WQLA 3VCAA 4PV1D 2E76B 4QUQA 3VCPA 2QSIA 2QPZA 1VF5B 3H1LE 2WPVB 2K9YA 4HM2A 4NBED 3GCEA 4H0LD 1ZRTE 2NUKA 3L74E 3L72E 2YVJB 2BMQA 4NBCD 2QJYC 2ZT9B 2E4QA 4H0LB 5L8RJ 2GBWA 4NBDD 2XSHA 2WSFJ 1VF5D 2BMRA 4KT0J 1NDOA 3CX5E 3TGUE 2B24A 2DE5D 4H13B 4AAYB 2HMMA 3GZXA 5KLVE 2YIUC 2QIWA 2E75D 2E74D 1KYOE 3VMGD 3LW5J 4HM3A 2WSCJ 1JM1A 3GL2A 1NTME 4QUPA 1L0NE 1RIEA 4HM8A 2XRXA 2YFLA 4OGQD 1P84E 2YFJA 4NBFD 4HM6A 5AEUA 1O7WA 3AZCA 3N0QA 2D2CD 2FYNC 1KB9E 1NYKA 2HMNA 2JO6A 4U3FE 1NTKE 3H1IE 2XSOA 2D2CB 4I7ZB 3GZYA 3DQYA 2NVEA 4HKVA 1SJGA 3VMID 1NU1E 2HMKA 3GB4A 2BMOA 2NVFA 2E74B 3EQQA 2QJPC 1SQPE 3L73E 4QDCA 4OGQB 1VCKA 2BCCE 4HM1A 2GBXA 2YFIA 3H1KE 3CXHE 1Q90C 3CWBE 1PP9E 2HMJA 1SQXE 4PV1B 1UUWA 3GKEA 4QDFB 1BCCE 2E75B 3L71E 4QCKA 3C8VA 2Q3WA 3VMHD 4P1CH 3GTSA 1EG9A 3C0DA 3H1JE 2O01J 2NVGA 4NBGD 2E76D 4NBBD 1BE3E 4NBHD 4QDDA 4AIVA 2XR8A 2ZT9D 4QURA 4HM0A 4EMJB 1SQVE 2HMLA 4H44B 4NBAD 1NTZE 4HM5A 2DE7D 4QDFA
chains in the Genus database with same CATH superfamily
3TSIA 2BEQD 3HE5B 3CCEP 2H43A 1OW7A 3TGUD 4HJLA 2O01H 4Y28J 1LTBC 3G71P 2W8ZA 2OARA 2N9BA 1O7GA 1FZAA 2YXQB 1WQLA 3WU2E 2QPZA 4M3LA 4ZKUA 3SWFA 2H88C 3M0DA 1FOSF 1OWAA 4BWNA 2BMRA 2JO1A 3RK2C 2KOGA 3CXHI 3GZXA 4UB6H 4YTPC 3V4WA 3VMGD 1LTAC 2I8DA 2AEMA 1VQ5P 2N1TD 2O1JA 1GL2A 2XV5A 4EYYQ 3I55P 1NU1E 1URQC 1E5WA 2WITA 5BVZA 3L4FA 2OYIB 1SQXJ 1AQ5A 1OIPA 1QEXA 3CXHE 1VQOP 2HMJA 3OJAB 3CCUP 2OTLP 4BRYB 1PL5A 2Q3WA 4D6TG 2FYZA 1SQXG 2NVGA 3H1ID 3RBXA 3PRJA 1X0TA 4QDDA 4A7PA 4GIFA 1AJYA 1NOHA 2JR8A 4W7YA 1ZXGA 4NPFX 1E79H 2JZAA 3L75E 4H13D 4NPEA 1N7SD 3B71A 1FQTA 1K8AQ 2KXPB 1PGJA 5AEWA 2IBZE 3L71D 1UIXA 1PIXA 1JMMA 3VMXA 1NHLA 1KILC 1Q2NA 4R4MA 3BRTB 4ZNCA 1WRGA 2FXPA 1H89A 2Q3IA 5CCHD 2WZ7A 2ZT9B 2ITAA 3KXDA 4DCKA 3NMDA 2A45I 1KILB 3HUSC 1K05A 3L75G 2N9YB 1KYOE 2R32A 2KZIA 5AW9B 1L0NE 1M1JC 2KB7P 5AVVB 4EDFA 1HBWA 4L76A 1IO4A 2Y9ZA 3Q5PA 2V4HA 3CCSP 3GZYA 3H1KJ 2K37A 3TGUJ 2FYUG 4PD4I 4N78D 1KC8Q 1KFNA 3CI9A 2QJKB 4PV1B 1PPJD 5AVSB 1NVOA 3BCCD 2E75B 2L5GB 2FXMA 3H1JE 1NTKD 1ZR4A 5CBOA 1FZGA 1N73C 1KQLA 1KQFB 4H44B 2ZYDA 2IBZG 1OZHA 4HM7A 3RK3D 2FFDA 1KB9I 2R5BA 4UB8E 3H32A 1JUNA 3TNUA 1H0TA 3GL0A 2CK3H 2HMOA 2WQYC 5DJTB 2K88A 4HM2A 1QL2A 3WUVA 3LIDA 3MD0A 3A0HH 4C7NB 2BMQA 2KUBA 4NBCD 3L75J 2GUSA 1Y8AA 3JSVC 3EWKA 2ZVOB 2B24A 1MZ9A 2BCCD 2YIUC 1NYHA 3CXHD 5APSA 4OGQD 1O7WA 5GTIE 4IL6E 2FYNC 3HD7A 2Q1KA 1T6AA 2WSFH 2KP8A 1SJGA 2I1KA 2KNCA 1L0NG 1DX7A 2BMOA 5AW2B 4ASVA 4K3AA 3RL0C 1VCKA 5AVTB 1KFMA 1HUCA 2GBXA 2FYNB 3L75D 1SFCC 1N86A 1VQ9P 2PAJA 2P58A 1UUWA 2AXTH 1BCCE 1P84D 2FXOA 2QG4A 1BDCA 1BDDA 1QVFO 4IFMA 5AW7B 1NTZJ 1BE3E 4CPGA 3AE2C 4EMJB 1SQVE 2M3BA 5TISE 4NBAD 3G4SP 2BASA 2OYIC 1M7LA 4RO0A 3VOPA 1PP9D 1QL1A 1U57A 1VQ6P 2PGDA 4OVNF 1LTJB 1VQLP 2P67A 4WBAA 1RFSA 3EN1A 5AVZB 3L72J 1IFIA 2E76B 3FXEA 2PRRA 1S9KD 1R5SA 2E4QA 2JJLA 1L0LJ 2MJZA 1JMBA 1N7SC 4WY4C 4HB1A 2HMMA 1URQB 2M5AB 1KILD 1JM1A 3GL2A 1NTME 1N8RQ 2A45G 2FY8A 2OYOA 1BE3J 2P7JA 2OYHB 1XTCC 1HJBA 2OGUA 3L72D 4WB4A 1BGYG 1U7JA 2BCCG 2QJPC 3A0BH 1MUUA 2HG5D 1LT9A 1GMJA 1AVYA 4GODA 1NU1G 1QX8A 2A06D 3ZDMA 5TJHA 4QDFB 2W6JH 1X8YA 1W5CE 3P8CD 5B66E 3M9QA 1YTZT 1M90Q 5K5GB 3B5NC 1D7MA 4L73A 1GDTA 4AIVA 1VQ7P 1NAFA 4QURA 3A2AA 2GUVA 1GK6A 1ZV8A 2NWFA 1ZMEC 1EZVE 4YXDC 1NGMB 2FYUE 4P1BH 2RMZA 2R5DA 4RJTA 1NU1K 5H2FH 1W2EA 3KZIE 1RF0A 1YJNP 1N73A 3Q5RA 1SQPJ 1VF5B 3BCCG 1JY3N 3H1JG 3CCLP 1LNQA 2KZJA 2NPSC 1NTZK 3EQ2A 1QVGO 4H0LB 2M8RA 3RK3C 3VYIA 1GU5A 3AEAC 1M56D 1AVOA 1FDIA 4HM3A 1HGVA 2WSCH 2BEZF 1P84E 5KJ7C 1JCCA 4HM6A 1PGQA 1MV8A 1AFOA 2W6BA 3HD7D 3N7NA 2HPCA 1NTKG 3IAOA 2WVRA 2BCCJ 3I5CA 4AYCA 2WT7A 1BGYJ 5DJUB 1Q90C 1PP9E 1BGYE 3MHVA 1EQ7A 3FGAD 4LGDE 1BE3G 1UIIA 4Z1MH 4N6JA 5APYA 2E76D 4LC1A 3O8ZA 3CCRP 3Q1MA 5APWA 1NWQA 1R8EA 1SQBE 3L71J 4L74A 2DW3A 5CXMA 5HL4A 2ZXXA 1S5LX 2HODA 1UUVA 3MGNA 5KAFE 1IZNB 5KKZC 4NB9D 5CCHC 4PD4H 3IF4A 1DD4A 5KLIC 1EDKA 4NB8D 3M0DC 5KAIH 3H1IG 1VQMP 1ZW0A 4I1LA 1T2KD 3L72G 1HTLC 3H1LE 4BXLA 4I2LC 1RY3A 3GCEA 3TK1A 1KYOH 1M1JA 1H88A 3M9BA 1NU1D 4NBDD 5CJ4A 1VF5D 1FJPA 3H1HD 3QWOC 3O6QB 5KLVE 2QIWA 3CWBD 2Z4EA 1FS0E 1RIEA 1A02J 2LXCB 5AW1B 2HMNA 1KB9H 1ZR2A 1T3UA 3H1IE 2V7QH 3UIAA 2YIUB 2HMKA 3EQQA 2ZXEB 1NTKK 1OFCX 3HE5A 4H44C 2GA1A 3LIEA 3CCVP 4N3YB 3CX5D 3USSA 4PD4D 2G3AA 2ZAEB 2Q6QA 4U3FD 1S4XA 4JPZB 1U7MA 4NBBD 3PLNA 3AE7C 1SQVJ 5GTHE 3L74D 2K3RA 4RESB 2DE7D 2RN0A 2QA4P 2YNYA 1VQKP 3D89A 3H1KD 1LT9C 3V5BA 4I6MC 3U59A 2E75C 3RL0g 1P84I 5APTA 1PFIA 4DOJA 1N7SB 4H44D 4HM4A 2J58A 3O6QA 1S3JA 3OAKA 1J1EB 3E1IA 1ZRTE 1NTZD 2PP6A 2QJYC 2J59M 3N4XA 4KT0J 1GTWA 1JY2O 2KS1B 1FJKA 1VQPP 1SQQK 1Y9BA 1IFJA 1MKMA 3VTPC 2YFLA 4BRYA 4NBFD 1HF9A 3L73G 3CX5I 1NYKA 1ZLLA 2NPSA 1SQBG 4I7ZB 1S1CX 4HKVA 1M57D 1URQA 1M1KQ 2E5YA 2ZT9C 3VMAA 3P8MC 5AVQB 4ZMDA 3A5TA 2HPCB 2B87A 3SFDC 4OGQB 2Y0CA 2J5UA 1VQNP 2JKVA 3GKEA 1SQPK 3VN0A 1KB9D 1R5LA 3L70D 1RE3A 1OX3A 4EOTA 4TLFA 3V2NA 1LTJA 5AVYB 4OGQC 1X9VA 1RQUA 1GL2D 4N78E 3AE6C 4HM5A 2NPSD 1O7PA 1Q90D 3GLMA 1SQVG 2DE6D 1EXIA 3RK2D 5BOKA 1VL2A 5CCGC 1BSHA 1MFTA 3BCCE 1PP9G 1SVFA 3RK3B 4JF7A 2GM4A 4C46A 1DH3A 1G8JB 3ABVC 2YXRB 1DIPA 4H0LD 2NUKA 1SS1A 1CSBA 2A45H 3L70J 3GF3A 1YHQP 3E7KA 3AE9C 5AVUB 2HODB 3AEEC 1VPCA 2WSCJ 4D6TJ 1CZQA 2WMMA 2JO6A 2QRXA 2XSOA 1PGPA 1JY3O 1FDOA 4KHXA 5H2FE 3CPWO 3PJSK 2JEEA 1JM0A 5APVA 1MFZA 3L73E 4HYTB 3M0AA 3Q2YA 2BCCE 1QGKB 3H1KE 1LWUB 1Q82Q 3WU2H 3NFQA 1SQQJ 1L0LD 5APXA 1GD2E 1RF1A 1LJ2A 2O01J 3F89A 3K5BA 2FKWB 3M91A 2L91A 3AE1C 1RQVA 3L71G 5B5EH 1KMIZ 1KQSO 3W67A 1GZLA 2C9LY 2POHA 2O1KA 2WSEJ 4WY4B 4QMAA 2N1TA 3BASA 2R44A 1SFCA 3FWNA 2AXCA 1KN7A 3B5NB 2IZ1A 1Y47A 3HUSB 1NH4A 3MP7B 1KV4A 2YMKA 2WPVB 1SQVD 2C9NY 3ITKA 2JWDA 1GL2B 1JY2P 2D2CC 2RH0A 2WPSA 1NTKJ 1L0NK 3B5NA 2OTJP 1YBKA 1NTMJ 4MN4C 3QH9A 2DE5D 1TU3F 1LTSC 2E74D 4LLHA 1K73Q 3PTZA 4Y99C 4W7ZA 4QUPA 3F5HA 1W2BO 1X22A 3N0QA 1SFCD 2D2CD 1OVVA 1JY2N 3CLQA 3A0HE 1G1JA 3Q5SA 3PHLA 3DQYA 2FBWC 4OWFA 4NPDA 2RKLA 1J2JB 1KILA 1YJ9P 5AW8B 1NKZB 1KTMA 1IK7A 3SSUA 2H7HA 4HM1A 2FYUD 1ZOYC 3H1HJ 2HFED 3EFFK 2IPPA 1M8OB 3VP9A 1WT6A 5EFWB 4PJ0E 1SP4A 3L71E 4QCKA 4EI2A 3VMHD 1NO4A 1KZUB 1LGHB 3CL3D 3FX0A 5BU8B 5CCHA 3AE3C 5AW0B 2N1TC 4U3FG 2QM8A 4C7NA 1S2EA 3V4QA 4QDFA 1YTZI 3A3YB 3HD7B 1JB0J 2WT7B 5C39A 1LWUA 2QJKC 5AVWB 1KD1Q 2WSSH 1IFDA 2XZRA 3H32B 5AW4B 1KYOD 1O7NA 3V2QA 3GOBA 2ZVNB 1NU1J 2K9JB 2QSIA 4AUWA 1NAYA 1USDA 5AW5B 3CC2P 1RE4A 3E1RA 2XNXA 2FYUK 2GBWA 2WSFJ 5KJ7D 1AQTA 2E75D 3B4SA 1VDFA 2Z5HA 3H25A 2ZFCA 3L37A 4XA4A 3KQGA 1EC5A 1PZQA 1P84H 3TF5A 3H1LG 1OW8A 3KHUA 2E5TA 1XTGB 2W83C 3CC7P 3G6EP 3G9RA 1JO5A 4HKZH 2KLUA 5GTHH 4JYBA 5CCGD 2MKVA 1YQ3C 3GTSA 1EG9A 3C0DA 4DZOA 1Q7YQ 4NBHD 2C0WA 2Q3EA 1L4AB 1EXJA 3D70A 1ULIA 2YO2A 2QM7A 2K9JA 1KORA 1NTZG 1BGYD 3AEDC 4L75A 1SQXD 1X79B 5KLVD 2E43A 3H1LJ 1VM9A 3S9OA 2E4PA 2AEFA 2IDBA 4GOEA 3D6ZA 1FAVA 2JWAA 2Y9YA 1USEA 4NBED 3L70G 2XU6A 2KIKA 4W80A 3IN6A 4JQ0D 2E74C 2IYOA 4DJGA 5CBNA 1SQQD 3CCMP 1VQ8P 2E42A 1FC2C 2FFDB 1GW4A 3CXHH 5APQA 3GHGB 4JYCA 2WTYA 3RL0D 2P10A 3HE4B 3AZCA 3H1LD 2OYIA 3SWYA 4U3FE 1GL2C 1T3JA 1S5LE 1T8ZA 3JCUH 3AE4C 3CD6P 3CCQP 4H13C 1FBMA 2P2UA 1LTIC 3EFGA 1Z56A 3AEBC 1CI6B 1K04A 4P1CH 1HGZA 3WUUA 3CMEP 1J1EC 3MZWB 2CPSA 1CI6A 3H1HG 2Y0EA 3LW5H 1SQBJ 2YKPA 1G2CB 1FOSE 1G2CA 2C0XA 3P32A 1LTGC 1RHZB 2OQQA 1O7MA 3IFMA 3CX5E 4PD4E 1FZFA 4ASWA 5CJ0A 1EZVI 2M0BA 3L74G 1BE3D 5APUA 2Q5UA 3BVHA 2KYVA 3GHGA 3L74E 1YIJP 3L72E 3M06A 1GU4A 2FYUJ 5L8RJ 2WPRA 1PGOA 3OA7A 3M9HA 1S72P 3HUSA 3H1KG 1VQ4P 1NTMG 5B66H 2O01N 3A7OA 5KAIE 3V2RA 2CPBA 1SFCB 4HM8A 2A06G 2NPSB 1JEKA 4H0LC 3CC4P 3IR9A 1KB9E 4WY4D 3HTKA 2LR2A 5CHXA 1ZRTD 3SWKA 2AEJA 3AEGC 2VRSA 3BRVB 2KLVA 1HWTC 4QDCA 1BSNA 1RF0C 1JTHA 5E79H 4EIJA 3OW2O 1KILE 3WMM0 3D71A 1YQ4C 4IFDK 2KI7B 4UB8H 2HYNA 4ZKPA 2OTKE 1Q81Q 1N7SA 1FZCA 2JDIH 2ZT9D 4GKGA 1SQQG 3MUDC 1IK9A 1LTTC 3JCUE 1OVUA 2E76C 1ULJA 3HTKB 2CKFA 3G3ZA 1L2PA 2ZYLA 2I7FA 3CMAP 5BU5A 3P8CE 1L0ND 3L70E 1G1IA 2KSEA 3HD7C 4WWIA 3AECC 3D6YA 2WPQA 3S1KA 2Q9IA 2W90A 2NRGA 3B5ND 3L36A 2XSHA 2QJPB 4JBZA 3CCJP 3H1IJ 3VMYA 3BATA 1HJ0A 2R3CA 3NTNA 4D6TE 2K1AA 5AVRB 2AXTE 3TDKA 1URQD 1NTKE 3R2PA 4IOIH 5KJ7A 5AVXB 2B88A 4GDOA 1PP9J 2KNCB 3GB4A 4PJ0H 3KDPB 2V7QJ 4OH8B 1JOCA 1L0LK 2N1TB 1SLQA 2YFIA 4IFFA 3RK3E 3II6A 1N2DC 1RE4C 2LKMA 3GMAA 2IYPA 5KKZB 3C8VA 2O3JA 5E79E 1YITP 2B87B 5KLVK 4NBGD 3GW6A 1EZVG 1FZCB 1FZEA 1LT1A 4HM0A 2R3SA 4XE5B 2YKQA 1SQPD 1YJWP 5CCGA 1GK4A 3FOUA 2H89C 4B86A 3H1HE 5AW3B 1HH0A 4KJMA 4PV1C 5B5EE 1PPJE 1FZCC 2QJYB 1L0LE 2XKMA 3CWBJ 3GTEA 3H1JD 4Y99B 3L74J 2XDJA 3VCAA 1PPJG 1QLED 3L73J 3H6PA 1RE3C 2FFDC 3WUTA 1SQBK 1IJDB 2YVJB 1SQBD 1LTJC 3BCCJ 2HR3A 1VF5C 4K35A 1RH5B 4WVZA 1EDIA 3LW5J 2W6AA 1FU1A 1SQXK 3AE5C 2YFJA 2B9BA 1EDJA 1ZP0C 3C9IA 1IC2A 1H8AA 2D2CB 3S4RA 2ZYGA 2NVEA 1T2KC 4GT1A 3VMID 2NVFA 5M1BA 3V6IA 3A0BE 2IZ0A 1L4AC 3CWBE 3TYYA 1K9MQ 1YYCA 1HVVA 1OXZA 2JP3A 2KK7A 1Q86Q 3KPEA 3KZIH 3T97A 1NKNA 4GOFA 3P7KA 5KLIB 2HMLA 3U1AA 1S9KE 1NJIQ 1NTZE 5KLVJ 3RL0B 2QVAA 5KTBA 1AV1A 2W27A 1EDLA 3MIWA 2YKOA 3VP8A 1O7HA 1LP1A 1J1DB 2NUMA 1BCCD 4D6TD 2KS1A 3VMZA 2B89A 5CMZA 2QE7H 1L4AD 1RF1C 2B1XA 4PV1D 2UWJE 4YPCA 3VCPA 2ZYAA 3MTUE 2YO3A 2K9YA 1L0LG 2OYHC 2KSJA 3AE8C 3HE4A 1DEBA 1M1JB 1J1DC 5AW6B 3SFEC 1LT9B 3MUDA 3PP5A 3TGUE 4AAYB 1BCCG 1S5LH 4R4LA 3I56P 2IBZI 1N7LA 1YI2P 1PV3A 1CW5A 2XRXA 2OYHA 5AEUA 3C1LA 4YXWH 1BCCJ 1L4AA 3JC22 3RGUA 3CX5H 1DD3A 3V2PA 3GG2A 3T97B 3RK2B 1SQPE 1GW3A 2HLOA 5GTIH 1LP1B 4IL6H 3PH0A 4HH2A 4U7JA 3Q3DA 2PFXA 1SQXE 4DT0A 1NTMD 3FXDA 2WSEH 1WMKA 1AA0A 3U1CA 2XR8A 3RBZA 1LWUC 2Y0DA 1L0NJ 2WWWA 2Z5IA 5KLVG 3GF7A 1JY3P 1SQQE 2A06E 1G8KB 1N73B 4RKUJ 5TISH 1OMIA 2H8PD 1OVRA 3FWLA 4IL6X 3GHGC 2IFNA 2M3EA 4HJGH 2XNDH 4QUQA 3L35A 3AEFC 1FZBA 2Q7CA 4TT3H 4XFJA 3NXSA 4I7ZC 2G8YA 1OW6A 4UB6E 1SQVK 1EZVD 1NDOA 4H13B 1IFMA 3W68A 3HRNA 4U3FJ 3KYQA 2IBZD 3R4YA 1RF1B 1ZN5A 3H1JJ 1IFNA 4WY4A 1SQPG 1IFPA 1JTHB 1NTMK 3B8EB 3TNUB 1H0TB 2IFMA 1A02F 2YMYA 2E74B 2SPZA 2QEXP 2P1JA 1JCDA 4AQRD 1JNMA 2ZJSE 1FE6A 1KQGB 1FDMA 2IX7C 2M5AA 2LXBA 1KYOI 4C7RA 3CWBG 4O9BA 2NZ2A 2I1JA 1DEEG 3TGUG 3L73D 5KAFH
chains in the Genus database with same CATH topology
2BEQD 1ULJA 2E76C 2NWFA 1ZMEC 2CKFA 1EZVE 4YXDC 1NGMB 2FYUE 4P1BH 2WSEJ 1OW7A 4HJLA 2ZYLA 2I7FA 4Y28J 1O7GA 3L70E 3Q5RA 1WQLA 2QPZA 1VF5B 2YMKA 2WPVB 3AECC 3D6YA 2D2CC 2H88C 4H0LB 2XSHA 2BMRA 2JO1A 3AEAC 2DE5D 3GZXA 1TU3F 4YTPC 1HJ0A 2E74D 3VMGD 1FDIA 4HM3A 4QUPA 2BEZF 1P84E 4HM6A 3N0QA 2D2CD 1NTKE 3Q5SA 3DQYA 4GDOA 2FBWC 1NU1E 3GB4A 3IAOA 2V7QJ 1KTMA 1IK7A 4HM1A 2YFIA 3CXHE 1Q90C 1ZOYC 1PP9E 3RK3E 2HMJA 3FGAD 3GMAA 3L71E 4Z1MH 1PL5A 3C8VA 2Q3WA 4QCKA 3VMHD 4NBGD 2NVGA 2E76D 3AE3C 4QDDA 3Q1MA 4HM0A 1AJYA 1R8EA 4QDFA 1SQBE 1JB0J 3FOUA 5CXMA 2H89C 5HL4A 1S5LX 3H1HE 2JZAA 2QJKC 4H13D 3L75E 4PV1C 1UUVA 3B71A 1FQTA 5KKZC 1PPJE 4NB9D 5AEWA 1L0LE 2IBZE 1O7NA 1DD4A 5KLIC 3GTEA 4NB8D 1UIXA 1PIXA 3GOBA 3VCAA 4R4MA 2QSIA 3H1LE 2FXPA 3GCEA 2YVJB 2ZT9B 2GBWA 4NBDD 1VF5D 2WSFJ 5KLVE 1K05A 2E75D 2QIWA 1VF5C 1KYOE 3LW5J 1L0NE 1RIEA 3AE5C 2YFJA 3H25A 1ZP0C 2HMNA 3Q5PA 3H1IE 2D2CB 3GZYA 2NVEA 3VMID 2HMKA 1OW8A 2NVFA 5M1BA 3EQQA 3G9RA 4H44C 3CWBE 4PV1B 2MKVA 1YQ3C 2G3AA 2E75B 2JP3A 3GTSA 1EG9A 3C0DA 3H1JE 4NBBD 4NBHD 1KQFB 3AE7C 2HMLA 4H44B 1NTZE 1EXJA 2DE7D 3D70A 1ULIA 3D89A 1KORA 1O7HA 4HM7A 3AEDC 1VM9A 2NUMA 2E75C 3RL0g 3S9OA 2IDBA 2E4PA 3D6ZA 3GL0A 4H44D 4HM4A 2B1XA 2HMOA 3O6QA 2WQYC 4PV1D 3VCPA 2K9YA 4HM2A 4NBED 1ZRTE 3AE8C 2BMQA 4NBCD 2QJYC 3SFEC 3EWKA 3IN6A 2E74C 4KT0J 3TGUE 2B24A 4AAYB 2YIUC 4R4LA 1NYHA 1Y9BA 1MKMA 1PV3A 2XRXA 4OGQD 2YFLA 4NBFD 2P10A 1HF9A 5AEUA 1O7WA 3AZCA 2FYNC 1NYKA 4U3FE 4I7ZB 1S1CX 4HKVA 2ZT9C 1SJGA 3AE4C 2BMOA 1DD3A 3T97B 1SQPE 4H13C 3SFDC 4OGQB 1VCKA 4U7JA 2GBXA 3Q3DA 2J5UA 1SQXE 3AEBC 1UUWA 3GKEA 1K04A 1BCCE 4P1CH 1WMKA 1BE3E 4OGQC 2XR8A 3AE2C 4EMJB 1RQUA 1SQVE 4NBAD 3AE6C 4HM5A 1O7PA 1Q90D 3GLMA 3GF7A 2DE6D 1EXIA 1U57A 5BOKA 1SQQE 1VL2A 2OQQA 1O7MA 2A06E 3CX5E 1G8KB 3BCCE 4PD4E 4RKUJ 1OMIA 1RFSA 3EN1A 4IL6X 1G8JB 3ABVC 1DIPA 2E76B 4QUQA 3AEFC 4H0LD 4TT3H 4XFJA 2NUKA 3L74E 3L72E 4I7ZC 2E4QA 2G8YA 1OW6A 3GF3A 5L8RJ 1NDOA 4H13B 3AE9C 2HMMA 3AEEC 3R4YA 2WSCJ 1JM1A 3GL2A 1NTME 4HM8A 4H0LC 1KB9E 2JO6A 2XSOA 1FDOA 3AEGC 2E74B 2QJPC 3L73E 4QDCA 3Q2YA 1GMJA 2BCCE 3H1KE 1KQGB 1KILE 3D71A 1YQ4C 4QDFB 2O01J 2NZ2A 4AIVA 2ZT9D 4QURA 3AE1C 1RQVA 1KMIZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQB E;  1O7P A;  1ULJ A;  2NWF A;  1Q90 D;  1JB0 J;  1ULI A;  3FOU A;  5CXM A;  2CKF A;  1EZV E;  5HL4 A;  3D89 A;  2DE6 D;  2FYU E;  4P1B H;  1S5L X;  2WSE J;  3H1H E;  2JZA A;  2QJK C;  1O7H A;  3L75 E;  4H13 D;  4HJL A;  4HM7 A;  5BOK A;  1SQQ E;  1UUV A;  2A06 E;  1FQT A;  1O7M A;  5KKZ C;  2ZYL A;  1PPJ E;  1G8K B;  1VM9 A;  4Y28 J;  1L0L E;  2I7F A;  2NUM A;  4RKU J;  3BCC E;  4NB9 D;  4PD4 E;  5AEW A;  2IBZ E;  1O7N A;  2E4P A;  1RFS A;  5KLI C;  3EN1 A;  3GTE A;  4NB8 D;  1O7G A;  3GL0 A;  4IL6 X;  4H44 D;  3L70 E;  4HM4 A;  2B1X A;  1G8J B;  2HMO A;  3GOB A;  1WQL A;  3VCA A;  4PV1 D;  2E76 B;  4QUQ A;  3VCP A;  2QSI A;  2QPZ A;  1VF5 B;  3H1L E;  2WPV B;  2K9Y A;  4HM2 A;  4NBE D;  3GCE A;  4H0L D;  1ZRT E;  2NUK A;  3L74 E;  3L72 E;  2YVJ B;  2BMQ A;  4NBC D;  2QJY C;  2ZT9 B;  2E4Q A;  4H0L B;  5L8R J;  2GBW A;  4NBD D;  2XSH A;  2WSF J;  1VF5 D;  2BMR A;  4KT0 J;  1NDO A;  3CX5 E;  3TGU E;  2B24 A;  2DE5 D;  4H13 B;  4AAY B;  2HMM A;  3GZX A;  5KLV E;  2YIU C;  2QIW A;  2E75 D;  2E74 D;  1KYO E;  3VMG D;  3LW5 J;  4HM3 A;  2WSC J;  1JM1 A;  3GL2 A;  1NTM E;  4QUP A;  1L0N E;  1RIE A;  4HM8 A;  2XRX A;  2YFL A;  4OGQ D;  1P84 E;  2YFJ A;  4NBF D;  4HM6 A;  5AEU A;  1O7W A;  3AZC A;  3N0Q A;  2D2C D;  2FYN C;  1KB9 E;  1NYK A;  2HMN A;  2JO6 A;  4U3F E;  1NTK E;  3H1I E;  2XSO A;  2D2C B;  4I7Z B;  3GZY A;  3DQY A;  2NVE A;  4HKV A;  1SJG A;  3VMI D;  1NU1 E;  2HMK A;  3GB4 A;  2BMO A;  2NVF A;  2E74 B;  3EQQ A;  2QJP C;  1SQP E;  3L73 E;  4QDC A;  4OGQ B;  1VCK A;  2BCC E;  4HM1 A;  2GBX A;  2YFI A;  3H1K E;  3CXH E;  1Q90 C;  3CWB E;  1PP9 E;  2HMJ A;  1SQX E;  4PV1 B;  1UUW A;  3GKE A;  4QDF B;  1BCC E;  2E75 B;  3L71 E;  4QCK A;  3C8V A;  2Q3W A;  3VMH D;  4P1C H;  3GTS A;  1EG9 A;  3C0D A;  3H1J E;  2O01 J;  2NVG A;  4NBG D;  2E76 D;  4NBB D;  1BE3 E;  4NBH D;  4QDD A;  4AIV A;  2XR8 A;  2ZT9 D;  4QUR A;  4HM0 A;  4EMJ B;  1SQV E;  2HML A;  4H44 B;  4NBA D;  1NTZ E;  4HM5 A;  2DE7 D;  4QDF A; 
#chains in the Genus database with same CATH topology
 3TSI A;  2BEQ D;  3HE5 B;  3CCE P;  2H43 A;  1OW7 A;  3TGU D;  4HJL A;  2O01 H;  4Y28 J;  1LTB C;  3G71 P;  2W8Z A;  2OAR A;  2N9B A;  1O7G A;  1FZA A;  2YXQ B;  1WQL A;  3WU2 E;  2QPZ A;  4M3L A;  4ZKU A;  3SWF A;  2H88 C;  3M0D A;  1FOS F;  1OWA A;  4BWN A;  2BMR A;  2JO1 A;  3RK2 C;  2KOG A;  3CXH I;  3GZX A;  4UB6 H;  4YTP C;  3V4W A;  3VMG D;  1LTA C;  2I8D A;  2AEM A;  1VQ5 P;  2N1T D;  2O1J A;  1GL2 A;  2XV5 A;  4EYY Q;  3I55 P;  1NU1 E;  1URQ C;  1E5W A;  2WIT A;  5BVZ A;  3L4F A;  2OYI B;  1SQX J;  1AQ5 A;  1OIP A;  1QEX A;  3CXH E;  1VQO P;  2HMJ A;  3OJA B;  3CCU P;  2OTL P;  4BRY B;  1PL5 A;  2Q3W A;  4D6T G;  2FYZ A;  1SQX G;  2NVG A;  3H1I D;  3RBX A;  3PRJ A;  1X0T A;  4QDD A;  4A7P A;  4GIF A;  1AJY A;  1NOH A;  2JR8 A;  4W7Y A;  1ZXG A;  4NPF X;  1E79 H;  2JZA A;  3L75 E;  4H13 D;  4NPE A;  1N7S D;  3B71 A;  1FQT A;  1K8A Q;  2KXP B;  1PGJ A;  5AEW A;  2IBZ E;  3L71 D;  1UIX A;  1PIX A;  1JMM A;  3VMX A;  1NHL A;  1KIL C;  1Q2N A;  4R4M A;  3BRT B;  4ZNC A;  1WRG A;  2FXP A;  1H89 A;  2Q3I A;  5CCH D;  2WZ7 A;  2ZT9 B;  2ITA A;  3KXD A;  4DCK A;  3NMD A;  2A45 I;  1KIL B;  3HUS C;  1K05 A;  3L75 G;  2N9Y B;  1KYO E;  2R32 A;  2KZI A;  5AW9 B;  1L0N E;  1M1J C;  2KB7 P;  5AVV B;  4EDF A;  1HBW A;  4L76 A;  1IO4 A;  2Y9Z A;  3Q5P A;  2V4H A;  3CCS P;  3GZY A;  3H1K J;  2K37 A;  3TGU J;  2FYU G;  4PD4 I;  4N78 D;  1KC8 Q;  1KFN A;  3CI9 A;  2QJK B;  4PV1 B;  1PPJ D;  5AVS B;  1NVO A;  3BCC D;  2E75 B;  2L5G B;  2FXM A;  3H1J E;  1NTK D;  1ZR4 A;  5CBO A;  1FZG A;  1N73 C;  1KQL A;  1KQF B;  4H44 B;  2ZYD A;  2IBZ G;  1OZH A;  4HM7 A;  3RK3 D;  2FFD A;  1KB9 I;  2R5B A;  4UB8 E;  3H32 A;  1JUN A;  3TNU A;  1H0T A;  3GL0 A;  2CK3 H;  2HMO A;  2WQY C;  5DJT B;  2K88 A;  4HM2 A;  1QL2 A;  3WUV A;  3LID A;  3MD0 A;  3A0H H;  4C7N B;  2BMQ A;  2KUB A;  4NBC D;  3L75 J;  2GUS A;  1Y8A A;  3JSV C;  3EWK A;  2ZVO B;  2B24 A;  1MZ9 A;  2BCC D;  2YIU C;  1NYH A;  3CXH D;  5APS A;  4OGQ D;  1O7W A;  5GTI E;  4IL6 E;  2FYN C;  3HD7 A;  2Q1K A;  1T6A A;  2WSF H;  2KP8 A;  1SJG A;  2I1K A;  2KNC A;  1L0N G;  1DX7 A;  2BMO A;  5AW2 B;  4ASV A;  4K3A A;  3RL0 C;  1VCK A;  5AVT B;  1KFM A;  1HUC A;  2GBX A;  2FYN B;  3L75 D;  1SFC C;  1N86 A;  1VQ9 P;  2PAJ A;  2P58 A;  1UUW A;  2AXT H;  1BCC E;  1P84 D;  2FXO A;  2QG4 A;  1BDC A;  1BDD A;  1QVF O;  4IFM A;  5AW7 B;  1NTZ J;  1BE3 E;  4CPG A;  3AE2 C;  4EMJ B;  1SQV E;  2M3B A;  5TIS E;  4NBA D;  3G4S P;  2BAS A;  2OYI C;  1M7L A;  4RO0 A;  3VOP A;  1PP9 D;  1QL1 A;  1U57 A;  1VQ6 P;  2PGD A;  4OVN F;  1LTJ B;  1VQL P;  2P67 A;  4WBA A;  1RFS A;  3EN1 A;  5AVZ B;  3L72 J;  1IFI A;  2E76 B;  3FXE A;  2PRR A;  1S9K D;  1R5S A;  2E4Q A;  2JJL A;  1L0L J;  2MJZ A;  1JMB A;  1N7S C;  4WY4 C;  4HB1 A;  2HMM A;  1URQ B;  2M5A B;  1KIL D;  1JM1 A;  3GL2 A;  1NTM E;  1N8R Q;  2A45 G;  2FY8 A;  2OYO A;  1BE3 J;  2P7J A;  2OYH B;  1XTC C;  1HJB A;  2OGU A;  3L72 D;  4WB4 A;  1BGY G;  1U7J A;  2BCC G;  2QJP C;  3A0B H;  1MUU A;  2HG5 D;  1LT9 A;  1GMJ A;  1AVY A;  4GOD A;  1NU1 G;  1QX8 A;  2A06 D;  3ZDM A;  5TJH A;  4QDF B;  2W6J H;  1X8Y A;  1W5C E;  3P8C D;  5B66 E;  3M9Q A;  1YTZ T;  1M90 Q;  5K5G B;  3B5N C;  1D7M A;  4L73 A;  1GDT A;  4AIV A;  1VQ7 P;  1NAF A;  4QUR A;  3A2A A;  2GUV A;  1GK6 A;  1ZV8 A;  2NWF A;  1ZME C;  1EZV E;  4YXD C;  1NGM B;  2FYU E;  4P1B H;  2RMZ A;  2R5D A;  4RJT A;  1NU1 K;  5H2F H;  1W2E A;  3KZI E;  1RF0 A;  1YJN P;  1N73 A;  3Q5R A;  1SQP J;  1VF5 B;  3BCC G;  1JY3 N;  3H1J G;  3CCL P;  1LNQ A;  2KZJ A;  2NPS C;  1NTZ K;  3EQ2 A;  1QVG O;  4H0L B;  2M8R A;  3RK3 C;  3VYI A;  1GU5 A;  3AEA C;  1M56 D;  1AVO A;  1FDI A;  4HM3 A;  1HGV A;  2WSC H;  2BEZ F;  1P84 E;  5KJ7 C;  1JCC A;  4HM6 A;  1PGQ A;  1MV8 A;  1AFO A;  2W6B A;  3HD7 D;  3N7N A;  2HPC A;  1NTK G;  3IAO A;  2WVR A;  2BCC J;  3I5C A;  4AYC A;  2WT7 A;  1BGY J;  5DJU B;  1Q90 C;  1PP9 E;  1BGY E;  3MHV A;  1EQ7 A;  3FGA D;  4LGD E;  1BE3 G;  1UII A;  4Z1M H;  4N6J A;  5APY A;  2E76 D;  4LC1 A;  3O8Z A;  3CCR P;  3Q1M A;  5APW A;  1NWQ A;  1R8E A;  1SQB E;  3L71 J;  4L74 A;  2DW3 A;  5CXM A;  5HL4 A;  2ZXX A;  1S5L X;  2HOD A;  1UUV A;  3MGN A;  5KAF E;  1IZN B;  5KKZ C;  4NB9 D;  5CCH C;  4PD4 H;  3IF4 A;  1DD4 A;  5KLI C;  1EDK A;  4NB8 D;  3M0D C;  5KAI H;  3H1I G;  1VQM P;  1ZW0 A;  4I1L A;  1T2K D;  3L72 G;  1HTL C;  3H1L E;  4BXL A;  4I2L C;  1RY3 A;  3GCE A;  3TK1 A;  1KYO H;  1M1J A;  1H88 A;  3M9B A;  1NU1 D;  4NBD D;  5CJ4 A;  1VF5 D;  1FJP A;  3H1H D;  3QWO C;  3O6Q B;  5KLV E;  2QIW A;  3CWB D;  2Z4E A;  1FS0 E;  1RIE A;  1A02 J;  2LXC B;  5AW1 B;  2HMN A;  1KB9 H;  1ZR2 A;  1T3U A;  3H1I E;  2V7Q H;  3UIA A;  2YIU B;  2HMK A;  3EQQ A;  2ZXE B;  1NTK K;  1OFC X;  3HE5 A;  4H44 C;  2GA1 A;  3LIE A;  3CCV P;  4N3Y B;  3CX5 D;  3USS A;  4PD4 D;  2G3A A;  2ZAE B;  2Q6Q A;  4U3F D;  1S4X A;  4JPZ B;  1U7M A;  4NBB D;  3PLN A;  3AE7 C;  1SQV J;  5GTH E;  3L74 D;  2K3R A;  4RES B;  2DE7 D;  2RN0 A;  2QA4 P;  2YNY A;  1VQK P;  3D89 A;  3H1K D;  1LT9 C;  3V5B A;  4I6M C;  3U59 A;  2E75 C;  3RL0 g;  1P84 I;  5APT A;  1PFI A;  4DOJ A;  1N7S B;  4H44 D;  4HM4 A;  2J58 A;  3O6Q A;  1S3J A;  3OAK A;  1J1E B;  3E1I A;  1ZRT E;  1NTZ D;  2PP6 A;  2QJY C;  2J59 M;  3N4X A;  4KT0 J;  1GTW A;  1JY2 O;  2KS1 B;  1FJK A;  1VQP P;  1SQQ K;  1Y9B A;  1IFJ A;  1MKM A;  3VTP C;  2YFL A;  4BRY A;  4NBF D;  1HF9 A;  3L73 G;  3CX5 I;  1NYK A;  1ZLL A;  2NPS A;  1SQB G;  4I7Z B;  1S1C X;  4HKV A;  1M57 D;  1URQ A;  1M1K Q;  2E5Y A;  2ZT9 C;  3VMA A;  3P8M C;  5AVQ B;  4ZMD A;  3A5T A;  2HPC B;  2B87 A;  3SFD C;  4OGQ B;  2Y0C A;  2J5U A;  1VQN P;  2JKV A;  3GKE A;  1SQP K;  3VN0 A;  1KB9 D;  1R5L A;  3L70 D;  1RE3 A;  1OX3 A;  4EOT A;  4TLF A;  3V2N A;  1LTJ A;  5AVY B;  4OGQ C;  1X9V A;  1RQU A;  1GL2 D;  4N78 E;  3AE6 C;  4HM5 A;  2NPS D;  1O7P A;  1Q90 D;  3GLM A;  1SQV G;  2DE6 D;  1EXI A;  3RK2 D;  5BOK A;  1VL2 A;  5CCG C;  1BSH A;  1MFT A;  3BCC E;  1PP9 G;  1SVF A;  3RK3 B;  4JF7 A;  2GM4 A;  4C46 A;  1DH3 A;  1G8J B;  3ABV C;  2YXR B;  1DIP A;  4H0L D;  2NUK A;  1SS1 A;  1CSB A;  2A45 H;  3L70 J;  3GF3 A;  1YHQ P;  3E7K A;  3AE9 C;  5AVU B;  2HOD B;  3AEE C;  1VPC A;  2WSC J;  4D6T J;  1CZQ A;  2WMM A;  2JO6 A;  2QRX A;  2XSO A;  1PGP A;  1JY3 O;  1FDO A;  4KHX A;  5H2F E;  3CPW O;  3PJS K;  2JEE A;  1JM0 A;  5APV A;  1MFZ A;  3L73 E;  4HYT B;  3M0A A;  3Q2Y A;  2BCC E;  1QGK B;  3H1K E;  1LWU B;  1Q82 Q;  3WU2 H;  3NFQ A;  1SQQ J;  1L0L D;  5APX A;  1GD2 E;  1RF1 A;  1LJ2 A;  2O01 J;  3F89 A;  3K5B A;  2FKW B;  3M91 A;  2L91 A;  3AE1 C;  1RQV A;  3L71 G;  5B5E H;  1KMI Z;  1KQS O;  3W67 A;  1GZL A;  2C9L Y;  2POH A;  2O1K A;  2WSE J;  4WY4 B;  4QMA A;  2N1T A;  3BAS A;  2R44 A;  1SFC A;  3FWN A;  2AXC A;  1KN7 A;  3B5N B;  2IZ1 A;  1Y47 A;  3HUS B;  1NH4 A;  3MP7 B;  1KV4 A;  2YMK A;  2WPV B;  1SQV D;  2C9N Y;  3ITK A;  2JWD A;  1GL2 B;  1JY2 P;  2D2C C;  2RH0 A;  2WPS A;  1NTK J;  1L0N K;  3B5N A;  2OTJ P;  1YBK A;  1NTM J;  4MN4 C;  3QH9 A;  2DE5 D;  1TU3 F;  1LTS C;  2E74 D;  4LLH A;  1K73 Q;  3PTZ A;  4Y99 C;  4W7Z A;  4QUP A;  3F5H A;  1W2B O;  1X22 A;  3N0Q A;  1SFC D;  2D2C D;  1OVV A;  1JY2 N;  3CLQ A;  3A0H E;  1G1J A;  3Q5S A;  3PHL A;  3DQY A;  2FBW C;  4OWF A;  4NPD A;  2RKL A;  1J2J B;  1KIL A;  1YJ9 P;  5AW8 B;  1NKZ B;  1KTM A;  1IK7 A;  3SSU A;  2H7H A;  4HM1 A;  2FYU D;  1ZOY C;  3H1H J;  2HFE D;  3EFF K;  2IPP A;  1M8O B;  3VP9 A;  1WT6 A;  5EFW B;  4PJ0 E;  1SP4 A;  3L71 E;  4QCK A;  4EI2 A;  3VMH D;  1NO4 A;  1KZU B;  1LGH B;  3CL3 D;  3FX0 A;  5BU8 B;  5CCH A;  3AE3 C;  5AW0 B;  2N1T C;  4U3F G;  2QM8 A;  4C7N A;  1S2E A;  3V4Q A;  4QDF A;  1YTZ I;  3A3Y B;  3HD7 B;  1JB0 J;  2WT7 B;  5C39 A;  1LWU A;  2QJK C;  5AVW B;  1KD1 Q;  2WSS H;  1IFD A;  2XZR A;  3H32 B;  5AW4 B;  1KYO D;  1O7N A;  3V2Q A;  3GOB A;  2ZVN B;  1NU1 J;  2K9J B;  2QSI A;  4AUW A;  1NAY A;  1USD A;  5AW5 B;  3CC2 P;  1RE4 A;  3E1R A;  2XNX A;  2FYU K;  2GBW A;  2WSF J;  5KJ7 D;  1AQT A;  2E75 D;  3B4S A;  1VDF A;  2Z5H A;  3H25 A;  2ZFC A;  3L37 A;  4XA4 A;  3KQG A;  1EC5 A;  1PZQ A;  1P84 H;  3TF5 A;  3H1L G;  1OW8 A;  3KHU A;  2E5T A;  1XTG B;  2W83 C;  3CC7 P;  3G6E P;  3G9R A;  1JO5 A;  4HKZ H;  2KLU A;  5GTH H;  4JYB A;  5CCG D;  2MKV A;  1YQ3 C;  3GTS A;  1EG9 A;  3C0D A;  4DZO A;  1Q7Y Q;  4NBH D;  2C0W A;  2Q3E A;  1L4A B;  1EXJ A;  3D70 A;  1ULI A;  2YO2 A;  2QM7 A;  2K9J A;  1KOR A;  1NTZ G;  1BGY D;  3AED C;  4L75 A;  1SQX D;  1X79 B;  5KLV D;  2E43 A;  3H1L J;  1VM9 A;  3S9O A;  2E4P A;  2AEF A;  2IDB A;  4GOE A;  3D6Z A;  1FAV A;  2JWA A;  2Y9Y A;  1USE A;  4NBE D;  3L70 G;  2XU6 A;  2KIK A;  4W80 A;  3IN6 A;  4JQ0 D;  2E74 C;  2IYO A;  4DJG A;  5CBN A;  1SQQ D;  3CCM P;  1VQ8 P;  2E42 A;  1FC2 C;  2FFD B;  1GW4 A;  3CXH H;  5APQ A;  3GHG B;  4JYC A;  2WTY A;  3RL0 D;  2P10 A;  3HE4 B;  3AZC A;  3H1L D;  2OYI A;  3SWY A;  4U3F E;  1GL2 C;  1T3J A;  1S5L E;  1T8Z A;  3JCU H;  3AE4 C;  3CD6 P;  3CCQ P;  4H13 C;  1FBM A;  2P2U A;  1LTI C;  3EFG A;  1Z56 A;  3AEB C;  1CI6 B;  1K04 A;  4P1C H;  1HGZ A;  3WUU A;  3CME P;  1J1E C;  3MZW B;  2CPS A;  1CI6 A;  3H1H G;  2Y0E A;  3LW5 H;  1SQB J;  2YKP A;  1G2C B;  1FOS E;  1G2C A;  2C0X A;  3P32 A;  1LTG C;  1RHZ B;  2OQQ A;  1O7M A;  3IFM A;  3CX5 E;  4PD4 E;  1FZF A;  4ASW A;  5CJ0 A;  1EZV I;  2M0B A;  3L74 G;  1BE3 D;  5APU A;  2Q5U A;  3BVH A;  2KYV A;  3GHG A;  3L74 E;  1YIJ P;  3L72 E;  3M06 A;  1GU4 A;  2FYU J;  5L8R J;  2WPR A;  1PGO A;  3OA7 A;  3M9H A;  1S72 P;  3HUS A;  3H1K G;  1VQ4 P;  1NTM G;  5B66 H;  2O01 N;  3A7O A;  5KAI E;  3V2R A;  2CPB A;  1SFC B;  4HM8 A;  2A06 G;  2NPS B;  1JEK A;  4H0L C;  3CC4 P;  3IR9 A;  1KB9 E;  4WY4 D;  3HTK A;  2LR2 A;  5CHX A;  1ZRT D;  3SWK A;  2AEJ A;  3AEG C;  2VRS A;  3BRV B;  2KLV A;  1HWT C;  4QDC A;  1BSN A;  1RF0 C;  1JTH A;  5E79 H;  4EIJ A;  3OW2 O;  1KIL E;  3WMM 0;  3D71 A;  1YQ4 C;  4IFD K;  2KI7 B;  4UB8 H;  2HYN A;  4ZKP A;  2OTK E;  1Q81 Q;  1N7S A;  1FZC A;  2JDI H;  2ZT9 D;  4GKG A;  1SQQ G;  3MUD C;  1IK9 A;  1LTT C;  3JCU E;  1OVU A;  2E76 C;  1ULJ A;  3HTK B;  2CKF A;  3G3Z A;  1L2P A;  2ZYL A;  2I7F A;  3CMA P;  5BU5 A;  3P8C E;  1L0N D;  3L70 E;  1G1I A;  2KSE A;  3HD7 C;  4WWI A;  3AEC C;  3D6Y A;  2WPQ A;  3S1K A;  2Q9I A;  2W90 A;  2NRG A;  3B5N D;  3L36 A;  2XSH A;  2QJP B;  4JBZ A;  3CCJ P;  3H1I J;  3VMY A;  3BAT A;  1HJ0 A;  2R3C A;  3NTN A;  4D6T E;  2K1A A;  5AVR B;  2AXT E;  3TDK A;  1URQ D;  1NTK E;  3R2P A;  4IOI H;  5KJ7 A;  5AVX B;  2B88 A;  4GDO A;  1PP9 J;  2KNC B;  3GB4 A;  4PJ0 H;  3KDP B;  2V7Q J;  4OH8 B;  1JOC A;  1L0L K;  2N1T B;  1SLQ A;  2YFI A;  4IFF A;  3RK3 E;  3II6 A;  1N2D C;  1RE4 C;  2LKM A;  3GMA A;  2IYP A;  5KKZ B;  3C8V A;  2O3J A;  5E79 E;  1YIT P;  2B87 B;  5KLV K;  4NBG D;  3GW6 A;  1EZV G;  1FZC B;  1FZE A;  1LT1 A;  4HM0 A;  2R3S A;  4XE5 B;  2YKQ A;  1SQP D;  1YJW P;  5CCG A;  1GK4 A;  3FOU A;  2H89 C;  4B86 A;  3H1H E;  5AW3 B;  1HH0 A;  4KJM A;  4PV1 C;  5B5E E;  1PPJ E;  1FZC C;  2QJY B;  1L0L E;  2XKM A;  3CWB J;  3GTE A;  3H1J D;  4Y99 B;  3L74 J;  2XDJ A;  3VCA A;  1PPJ G;  1QLE D;  3L73 J;  3H6P A;  1RE3 C;  2FFD C;  3WUT A;  1SQB K;  1IJD B;  2YVJ B;  1SQB D;  1LTJ C;  3BCC J;  2HR3 A;  1VF5 C;  4K35 A;  1RH5 B;  4WVZ A;  1EDI A;  3LW5 J;  2W6A A;  1FU1 A;  1SQX K;  3AE5 C;  2YFJ A;  2B9B A;  1EDJ A;  1ZP0 C;  3C9I A;  1IC2 A;  1H8A A;  2D2C B;  3S4R A;  2ZYG A;  2NVE A;  1T2K C;  4GT1 A;  3VMI D;  2NVF A;  5M1B A;  3V6I A;  3A0B E;  2IZ0 A;  1L4A C;  3CWB E;  3TYY A;  1K9M Q;  1YYC A;  1HVV A;  1OXZ A;  2JP3 A;  2KK7 A;  1Q86 Q;  3KPE A;  3KZI H;  3T97 A;  1NKN A;  4GOF A;  3P7K A;  5KLI B;  2HML A;  3U1A A;  1S9K E;  1NJI Q;  1NTZ E;  5KLV J;  3RL0 B;  2QVA A;  5KTB A;  1AV1 A;  2W27 A;  1EDL A;  3MIW A;  2YKO A;  3VP8 A;  1O7H A;  1LP1 A;  1J1D B;  2NUM A;  1BCC D;  4D6T D;  2KS1 A;  3VMZ A;  2B89 A;  5CMZ A;  2QE7 H;  1L4A D;  1RF1 C;  2B1X A;  4PV1 D;  2UWJ E;  4YPC A;  3VCP A;  2ZYA A;  3MTU E;  2YO3 A;  2K9Y A;  1L0L G;  2OYH C;  2KSJ A;  3AE8 C;  3HE4 A;  1DEB A;  1M1J B;  1J1D C;  5AW6 B;  3SFE C;  1LT9 B;  3MUD A;  3PP5 A;  3TGU E;  4AAY B;  1BCC G;  1S5L H;  4R4L A;  3I56 P;  2IBZ I;  1N7L A;  1YI2 P;  1PV3 A;  1CW5 A;  2XRX A;  2OYH A;  5AEU A;  3C1L A;  4YXW H;  1BCC J;  1L4A A;  3JC2 2;  3RGU A;  3CX5 H;  1DD3 A;  3V2P A;  3GG2 A;  3T97 B;  3RK2 B;  1SQP E;  1GW3 A;  2HLO A;  5GTI H;  1LP1 B;  4IL6 H;  3PH0 A;  4HH2 A;  4U7J A;  3Q3D A;  2PFX A;  1SQX E;  4DT0 A;  1NTM D;  3FXD A;  2WSE H;  1WMK A;  1AA0 A;  3U1C A;  2XR8 A;  3RBZ A;  1LWU C;  2Y0D A;  1L0N J;  2WWW A;  2Z5I A;  5KLV G;  3GF7 A;  1JY3 P;  1SQQ E;  2A06 E;  1G8K B;  1N73 B;  4RKU J;  5TIS H;  1OMI A;  2H8P D;  1OVR A;  3FWL A;  4IL6 X;  3GHG C;  2IFN A;  2M3E A;  4HJG H;  2XND H;  4QUQ A;  3L35 A;  3AEF C;  1FZB A;  2Q7C A;  4TT3 H;  4XFJ A;  3NXS A;  4I7Z C;  2G8Y A;  1OW6 A;  4UB6 E;  1SQV K;  1EZV D;  1NDO A;  4H13 B;  1IFM A;  3W68 A;  3HRN A;  4U3F J;  3KYQ A;  2IBZ D;  3R4Y A;  1RF1 B;  1ZN5 A;  3H1J J;  1IFN A;  4WY4 A;  1SQP G;  1IFP A;  1JTH B;  1NTM K;  3B8E B;  3TNU B;  1H0T B;  2IFM A;  1A02 F;  2YMY A;  2E74 B;  2SPZ A;  2QEX P;  2P1J A;  1JCD A;  4AQR D;  1JNM A;  2ZJS E;  1FE6 A;  1KQG B;  1FDM A;  2IX7 C;  2M5A A;  2LXB A;  1KYO I;  4C7R A;  3CWB G;  4O9B A;  2NZ2 A;  2I1J A;  1DEE G;  3TGU G;  3L73 D;  5KAF H; 
#chains in the Genus database with same CATH homology
 2BEQ D;  1ULJ A;  2E76 C;  2NWF A;  1ZME C;  2CKF A;  1EZV E;  4YXD C;  1NGM B;  2FYU E;  4P1B H;  2WSE J;  1OW7 A;  4HJL A;  2ZYL A;  2I7F A;  4Y28 J;  1O7G A;  3L70 E;  3Q5R A;  1WQL A;  2QPZ A;  1VF5 B;  2YMK A;  2WPV B;  3AEC C;  3D6Y A;  2D2C C;  2H88 C;  4H0L B;  2XSH A;  2BMR A;  2JO1 A;  3AEA C;  2DE5 D;  3GZX A;  1TU3 F;  4YTP C;  1HJ0 A;  2E74 D;  3VMG D;  1FDI A;  4HM3 A;  4QUP A;  2BEZ F;  1P84 E;  4HM6 A;  3N0Q A;  2D2C D;  1NTK E;  3Q5S A;  3DQY A;  4GDO A;  2FBW C;  1NU1 E;  3GB4 A;  3IAO A;  2V7Q J;  1KTM A;  1IK7 A;  4HM1 A;  2YFI A;  3CXH E;  1Q90 C;  1ZOY C;  1PP9 E;  3RK3 E;  2HMJ A;  3FGA D;  3GMA A;  3L71 E;  4Z1M H;  1PL5 A;  3C8V A;  2Q3W A;  4QCK A;  3VMH D;  4NBG D;  2NVG A;  2E76 D;  3AE3 C;  4QDD A;  3Q1M A;  4HM0 A;  1AJY A;  1R8E A;  4QDF A;  1SQB E;  1JB0 J;  3FOU A;  5CXM A;  2H89 C;  5HL4 A;  1S5L X;  3H1H E;  2JZA A;  2QJK C;  4H13 D;  3L75 E;  4PV1 C;  1UUV A;  3B71 A;  1FQT A;  5KKZ C;  1PPJ E;  4NB9 D;  5AEW A;  1L0L E;  2IBZ E;  1O7N A;  1DD4 A;  5KLI C;  3GTE A;  4NB8 D;  1UIX A;  1PIX A;  3GOB A;  3VCA A;  4R4M A;  2QSI A;  3H1L E;  2FXP A;  3GCE A;  2YVJ B;  2ZT9 B;  2GBW A;  4NBD D;  1VF5 D;  2WSF J;  5KLV E;  1K05 A;  2E75 D;  2QIW A;  1VF5 C;  1KYO E;  3LW5 J;  1L0N E;  1RIE A;  3AE5 C;  2YFJ A;  3H25 A;  1ZP0 C;  2HMN A;  3Q5P A;  3H1I E;  2D2C B;  3GZY A;  2NVE A;  3VMI D;  2HMK A;  1OW8 A;  2NVF A;  5M1B A;  3EQQ A;  3G9R A;  4H44 C;  3CWB E;  4PV1 B;  2MKV A;  1YQ3 C;  2G3A A;  2E75 B;  2JP3 A;  3GTS A;  1EG9 A;  3C0D A;  3H1J E;  4NBB D;  4NBH D;  1KQF B;  3AE7 C;  2HML A;  4H44 B;  1NTZ E;  1EXJ A;  2DE7 D;  3D70 A;  1ULI A;  3D89 A;  1KOR A;  1O7H A;  4HM7 A;  3AED C;  1VM9 A;  2NUM A;  2E75 C;  3RL0 g;  3S9O A;  2IDB A;  2E4P A;  3D6Z A;  3GL0 A;  4H44 D;  4HM4 A;  2B1X A;  2HMO A;  3O6Q A;  2WQY C;  4PV1 D;  3VCP A;  2K9Y A;  4HM2 A;  4NBE D;  1ZRT E;  3AE8 C;  2BMQ A;  4NBC D;  2QJY C;  3SFE C;  3EWK A;  3IN6 A;  2E74 C;  4KT0 J;  3TGU E;  2B24 A;  4AAY B;  2YIU C;  4R4L A;  1NYH A;  1Y9B A;  1MKM A;  1PV3 A;  2XRX A;  4OGQ D;  2YFL A;  4NBF D;  2P10 A;  1HF9 A;  5AEU A;  1O7W A;  3AZC A;  2FYN C;  1NYK A;  4U3F E;  4I7Z B;  1S1C X;  4HKV A;  2ZT9 C;  1SJG A;  3AE4 C;  2BMO A;  1DD3 A;  3T97 B;  1SQP E;  4H13 C;  3SFD C;  4OGQ B;  1VCK A;  4U7J A;  2GBX A;  3Q3D A;  2J5U A;  1SQX E;  3AEB C;  1UUW A;  3GKE A;  1K04 A;  1BCC E;  4P1C H;  1WMK A;  1BE3 E;  4OGQ C;  2XR8 A;  3AE2 C;  4EMJ B;  1RQU A;  1SQV E;  4NBA D;  3AE6 C;  4HM5 A;  1O7P A;  1Q90 D;  3GLM A;  3GF7 A;  2DE6 D;  1EXI A;  1U57 A;  5BOK A;  1SQQ E;  1VL2 A;  2OQQ A;  1O7M A;  2A06 E;  3CX5 E;  1G8K B;  3BCC E;  4PD4 E;  4RKU J;  1OMI A;  1RFS A;  3EN1 A;  4IL6 X;  1G8J B;  3ABV C;  1DIP A;  2E76 B;  4QUQ A;  3AEF C;  4H0L D;  4TT3 H;  4XFJ A;  2NUK A;  3L74 E;  3L72 E;  4I7Z C;  2E4Q A;  2G8Y A;  1OW6 A;  3GF3 A;  5L8R J;  1NDO A;  4H13 B;  3AE9 C;  2HMM A;  3AEE C;  3R4Y A;  2WSC J;  1JM1 A;  3GL2 A;  1NTM E;  4HM8 A;  4H0L C;  1KB9 E;  2JO6 A;  2XSO A;  1FDO A;  3AEG C;  2E74 B;  2QJP C;  3L73 E;  4QDC A;  3Q2Y A;  1GMJ A;  2BCC E;  3H1K E;  1KQG B;  1KIL E;  3D71 A;  1YQ4 C;  4QDF B;  2O01 J;  2NZ2 A;  4AIV A;  2ZT9 D;  4QUR A;  3AE1 C;  1RQV A;  1KMI Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...