5KL1B

Crystal structure of the pumilio-nos-hunchback rna complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
SRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Maternal protein pumilio
publication title Drosophila Nanos acts as a molecular clamp that modulates the RNA-binding and repression activities of Pumilio.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein/rna
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05741 zf-nanos Nanos RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.680 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 5kl1B00
5KL8B 5KL1B 3ALRA
chains in the Genus database with same CATH superfamily
2HOQA 1HUOA 1YZ6A 1PVQA 4ECTA 2W54A 3H4DA 8ICXA 4QZGA 2R8GA 1WG8A 3NVVA 1O03A 2LBOA 7ICKA 4QIWF 5HR7A 5E79U 1ZRNA 1CEZA 4PHAA 4GC6A 2W43A 8ICKA 3NTUA 2ZIWA 4PGQA 2M0NA 4EZ9A 2MUTB 4F8RA 1S10A 4J9PA 7ICSA 3MC1A 1X9XA 2DUYA 3QU5A 5KG2A 4Z6CA 4Y2TA 4OJPA 1SZHA 2R18A 1JUDA 3CW2C 1TAQA 4O3QA 2MRLA 3O0FA 5H2FU 5F9NA 4IQUA 1C20A 5AIBA 4YFKA 1N5WA 3NVZA 1KEJA 3ONNA 4KLHA 5ALFA 3I1YA 2W55A 3RJIA 3Q8MA 4RQMA 2W7PA 1NK4A 4UB3A 1KSPA 1Q8KA 3JPRA 4DS5A 3V7LA 4Y2PA 3QZ7A 1QSLA 4F93B 2FPLA 4DL3A 3L3FX 3WK9A 4PZOA 5AK3A 2HHSA 4QJFB 2FDRA 2JEIA 4DFPA 1ED1A 2RDIA 3RB6A 3SV4A 1SL1A 2HI0A 5KL8B 4QZEA 4OO1J 3T5LA 4KLQA 3EPIA 1RPLA 4FO6A 1LV5A 8ICWA 2H3ZA 4ED0A 2WFAA 4DOCA 3RRGA 9ICLA 3F5AA 2WF7A 2Q0ZX 1FIQA 2W3RA 1X2IA 3SAHA 3ISBA 4ZH4A 2C28A 1IIPA 2MA1A 4ACOA 4F2RA 4BWMA 2W9BA 3RJEA 2OXOA 3QYPA 3OPXA 1XC9A 4O3OA 4M9LA 4F4KA 4KLTA 4BX9C 5DLFA 2E8PA 2ASJA 4E0DA 2PKEA 5IINA 4R66A 9ICHA 3FYHA 4RQ6A 2K60A 1JXEA 4QWAA 4O3PA 1NK7A 2JXJA 2KJ8A 2KHVA 3BS5A 1ZQOA 2EZYA 2K4IA 1ZD3A 1JRPA 5KFNA 1S0OA 3HWTA 4RPYA 2HHQA 2R8KA 4B9NA 1UT8A 5AKYA 1AQ6A 2DPJA 4GFJA 5AK4A 4I2BA 3AQFA 4UQGA 2ZIUA 5J2FA 2FLPA 8ICMA 2CXYA 2IA6A 3T5HA 2HVIA 3RAXA 1ZQGA 2UVWA 5G5GA 3PMLA 1S97A 2HHTA 5DG7A 4Q44A 2E8MA 3UPQA 2KHQA 4PZNA 3BQ2A 4B6JA 4EYHB 1KFTA 3M9NB 4OJ6A 3TADC 4ED3A 7ICVA 4DQQA 1JROA 5AI0A 4C0ZA 2YQEA 4UAZA 2BPGA 5J0OA 4ICAA 2W3SA 2NRTA 3G6VA 2MUTA 2KNJA 4YN4A 2KSOB 5D49A 2RP5A 2K4EA 4EX6A 3E58A 3T3FA 2DWQA 3LDAA 5KG4A 1TK0A 4QWEA 3LVVA 5AICA 1L7OA 4CF5A 4ECSA 3PW0A 1NK5A 8ICRA 8ICVA 1DRGA 2LM1A 1Z19A 2V4RA 5ALVA 5KFPA 2EQYA 9ICFA 1U47A 5ALXA 3AQEA 4ECYA 1ZD5A 5AM2A 3EW9A 4F72A 4RPXA 2F3NA 5J0QA 4DSIA 3J81j 1KLNA 1JALA 2P6RA 2KZZA 3AM9A 5AI6A 2FPMA 4NV0A 1ZQXA 1Q3VA 2DQNB 2BDUA 2ISPA 5KFFA 1MC8A 1MQ2A 1Q3UA 5AM3A 7ICGA 3KFUF 4YXJA 1T3QA 2XGQA 1IXRA 2LHTA 5DBBA 4XRHA 2H5XA 3VCBA 4MFCA 3B0YA 1LKYB 3WKEA 4QZAA 1XNSA 1ZQCA 5KAIU 1ZQBA 2Y1IA 3RJKA 2V4QA 2E5SA 5CHGA 2JZBB 5ALZA 1ZQJA 3SAFA 9ICIA 2ASDA 4KLMA 2DF4B 4IRDA 2B21A 3CYMA 1MSWD 5KFKA 2FMQA 4UBBA 5J0PA 4ECRA 4P4OA 4FBUA 1BGXT 3H4BA 4XUSA 1N56A 4RQ1A 3DDHA 4FBTA 4C7ZA 4G3IA 4NLZA 3SEIA 4KMOB 3GV8B 3TARA 4YQWA 1TFRA 1KBUA 1L3UA 3JPOA 3PMNA 2JV3A 3ZDBA 7ICEA 3SZ2A 1XO1A 1JN3A 5J0WA 5ALOA 5HR6A 3QEAZ 4R64A 4F4XA 3ZD9A 5KFHA 4PGXA 4M9HA 3T79A 5T14A 1ZQFA 2D8CA 3NVYA 5ALGA 3ZDCA 4MFFA 8ICPA 4UB8U 4P2HA 1SL0A 3C21A 5KFXA 4IRCA 2AH5A 4UAVA 3KHGA 2ZIWB 5AM0A 1UT5A 1ZQRA 4F5RA 3RR8A 9ICBA 9ICKA 4DFDA 4DEZA 5EE3A 1MA7A 1L3VA 2ZJ5A 3BQ0A 5DB8A 1ZQHA 3Q8RB 3BQ7A 2C2RA 1WCLA 4IS7A 1XS9D 1NJWA 1A0PA 3IM1A 3F2CA 2JR5A 1N2XA 5DG9A 1QTMA 5KT2A 2FLNA 2KSOA 5AM4A 3A0BU 4ED7A 3M6ZA 3U26A 3ETRA 3V6JA 4DQPA 4US8A 2BQUA 3ZDAA 5L1KA 2E1FA 3M7DA 2G06A 4O5EA 1A77A 1VJ5A 1ZQEA 3SQIA 9ICCA 2RRDA 3TANA 4DOAA 1WYGA 4PL1A 5DDYA 2YMMA 1KFDA 1BVSA 2BR0A 5KG5A 2ODGA 1X9SA 3ALRA 2R8IA 4CGZA 2VIXA 3GU3A 5J2HA 3SMVA 4GIBA 1Z3EB 2JMGA 5KFGA 5ALIA 5ALEA 2YY6A 1ZQKA 3HT3A 2ZXIA 3PO5A 3GIJA 2F8LA 2KIVA 4F2SA 4DWIA 3GIKA 2DGZA 4B9LA 5TZVA 5BPCA 4KX5A 1NZBA 5C0YA 3RJGA 4UASA 3AMZA 4UB5A 2D6FC 4Q43A 5FP0A 4I2FA 4KLSA 1F5SA 5AKJA 1LKYA 4DQIA 3MBYA 3M1YA 3PW2A 5K4LA 7ICQA 2KD1A 2CN1A 4QWDA 4DL4A 3HX0A 4NLKA 3N28A 5ALYA 4KITB 5KTQA 3D2NA 4TQSA 5AI4A 3QU4A 2GWSA 4O3MA 2FMPA 3N7SC 5EE1A 2KIWA 5KFZA 3Q8SB 5ALNA 1ZQWA 4DL5A 1RXWA 3JPTA 1ECWA 2ALZA 2V9WA 2W7OA 1ZQTA 4ED2A 5ALTA 1NNLA 4JWNA 5J2EA 1PK1A 3HRDD 1OUQA 1TV9A 2PFQA 2XO7A 1JIHA 3AUOA 3KHLA 2ZIUB 4DLEA 4Z6FA 2G5IB 1BPXA 2CRXA 1S77D 3IG5A 4YD1A 3JPQA 3QUCA 4R65A 1ZYQA 4DL2A 4C8LA 4F3OA 2HHWA 4NLGA 3QU9A 4BDPA 7ICOA 2JH1A 4DQRA 2XVTA 4USAA 4DSFA 4GC7A 2BPFA 2WAQF 3PSPA 4I27A 3JPNA 3M6KA 4R8UA 4Y2UA 3G6YA 1JI7A 2Y9UA 3NGDA 4ELTA 3JPSA 2HW3A 9ICEA 3C2LA 4U6PA 1V97A 4LZDA 4YD2A 2EH9A 1IV8A 8ICHA 1FEZA 3MGHA 3HKZC 2HCFA 5KT5A 1D8YA 9ICSA 2YB1A 1XSLA 4X5VA 3ZDDA 4JMUA 3IV6A 2ZTEA 4DFKA 5EWFA 3SYZA 3OHBA 5HHIA 3RAQA 1T8EA 2E3TA 9ICVA 1ZXIA 2KK0A 4UARA 3T5KA 1L5UA 7ICMA 2AHOB 5KFVA 1ZQ1C 4YVZA 4RT2A 1L8OA 2AGOA 1EXNA 1N63A 4C4SA 1ZQDA 8ICBA 2K8BB 4RQ4A 2KJ9A 3RB0A 3KTQA 4BGDA 3H0MB 1DK3A 5BOLA 2YTUA 2W04A 2FE9A 5IIMA 1WUDA 2JH7A 1NKCA 3C28A 3IN5A 4P0QA 2KICA 2KMDA 1SXDA 9ICJA 2HBMA 2BCRA 1IM4A 1ZD4A 1F44A 2F2AB 5ALPA 3MR3A 1J97A 4Z6DA 2J6TA 3M9OB 2MU2A 2Y1JA 5J0TA 2PMZC 5AI8A 4J9KA 5ALUA 7ICNA 5DLGA 2EZZA 4C7YA 3BQTA 3PR5B 5KT6A 3NRWA 1XU4A 3UMCA 4GLXA 4RQ7A 1BPEA 5AKZA 1BPYA 4NJ8A 5ALWA 7ICRA 2DL0A 4MFAA 1FFUA 2DKZA 3RTVA 9ICNA 2J6UA 5J2AA 2F1HA 3RH5A 4I2JA 2P66A 8ICOA 3V7KA 3C23A 2WTFA 3RRHA 4ECQA 2H3FA 4C8OA 1SGGA 1X66A 2VA3A 4FZNA 3SAGA 5HMMA 3PSTA 3EYZA 2WAQC 4FZLA 3TACB 3TI0A 4Y2VA 3BZCA 2HMXA 4NM1A 4QZCA 4FS2A 4DF4A 7ICUA 2WF8A 2YMPA 1X6JA 8ICAA 1RDFA 5KFWA 5KFRA 4I2HA 3IG8A 2GO7A 4DFMA 1X9MA 1ZQVA 1N60A 1SKRA 3FAHA 3K75D 2XI9A 4EBEA 1WCNA 5CP2A 5KFAA 5DB7A 4GXJA 1L3TA 1ZQMA 3OSNA 3C2MA 1S0MA 1KRPA 4O5KA 1QH9A 3NS1A 2YN4A 4QWBA 2DBYA 1SKSA 5GTHU 3RB4A 2AJQA 5L9XA 5F3XB 3ETLA 3QX7A 4ED6A 4BJQA 5HP4A 2ZTCA 3FM9A 1MQ3A 2HBJA 3PSIA 5KFYA 7ICJA 2DKXA 4RNNA 4J9QA 3RH4A 4YMMA 2OCEA 2BCUA 2HHXA 2OM6A 4R63A 1XSPA 3QXGA 4HAIA 4F4YA 4P4MA 4F91B 2PFPA 3GILA 2XCAA 5KT7A 2KJ5A 2W9CA 4KN4A 1DOQA 4F4WA 8ICIA 5G5HA 4RQ5A 2W9MA 8ICJA 1U49A 2AU0A 3H0LB 3KKAA 1ZQZA 4QWCA 4OD0A 4MHVA 3L5KA 2BCVA 4B9VA 1RYSA 2NRWA 2QKQA 5AIAA 5KFQA 2B6GA 3Q8KA 2IBKA 1V9PA 2OEHA 5DBAA 2KOBA 3Q8QB 1PZNA 4AP9A 1SL2A 4M2YA 4FZMA 4Y2JA 2ASLA 3EUB2 5DKWA 2HBKA 4NWIA 4RQ2A 3V7JA 4C4TA 2XY6A 1NK9A 2IOHA 1D9DA 3KZXA 3PO4A 2YMQA 5J0SA 3BDPA 5AM1A 2K4HA 2BKEA 4RUAA 4RQ3A 5CRXA 1NJYA 7ICHA 3L4PA 3Q8PB 2VANA 8ICQA 4DLGA 2WHEA 1URJA 3UM9A 3WK8A 4NL9A 3MDCA 4M9JA 5ALLA 4PGYA 9ICTA 2ZXHA 1B22A 3EWAA 3ISDA 1Z1BA 4MEXA 3FC4A 1ZD2P 5ALQA 5J2JA 1NJXA 3N7RC 4KTQA 5J0RA 2YB4A 1J2NA 1RQNA 4IQTA 2LYHA 4I28A 1RYUA 2LYBA 3QU2A 2HOIA 4ECXA 2QB1A 2YMLA 1NKEA 4IR9A 3PW5A 1SWVA 2KP7A 3TAQA 3THVA 4ECUA 1Z1VA 2ZG6A 4F50A 3IP4B 1K5OA 2H3IA 1Z4NA 3PX0A 2OH2A 4Q45A 1PK1B 4YR3A 2HHVA 4UAYA 3RJJA 3B0XA 3SD7A 3A0HU 1NOMA 1S9FA 3AL0B 3LWLA 2A1AA 5ALHA 2G07A 4ZOHC 1JMSA 2R8HA 2NO4A 4M6WB 1WWVA 5CR0A 5KFDA 3WK4A 2VJ4A 4Y2SA 4EEYA 5EOZA 1D9FA 2K4PA 1ZOLA 4IC9A 2OHFA 1P7DA 2OYYA 8ICCA 2KEYA 4R8UB 5IIIA 4BWJA 2PI5A 3MFHA 1NI3A 5KFJA 8ICTA 4OJOA 5AKGA 5CEHA 1S0NA 2XICA 4UB4A 5KFUA 3N4MB 2WF5A 1Z4OA 3WKBA 3PY8A 2NRXA 4QZHA 3C1ZA 4G9BA 3T5JA 3TFRA 4UAUA 5KAFU 4I2EA 2FI1A 5AKLA 4GXIA 2JEFA 3G6XA 3OGUA 2ZUBA 1TVAA 3F2BA 4J9NA 3QUBA 1BNPA 3KZIU 4QNLA 2FJ6A 2N1RA 5ALKA 2F1JA 2XIDA 5TISU 2NO5A 2AXTU 3K1ZA 1OXJA 4KLLA 2QLTA 4F71A 3F5EA 3NUQA 1KKXA 2H3QA 1DK2A 5KT3A 1NKBA 4M0AA 4O9MA 3HKZF 5DB9A 1U9LA 3GZFA 1SKWA 4C4RA 4XA5A 5JTIA 3MR2A 2HOFA 2FLLA 1N62A 1BPDA 2ZIVA 3HILA 3KD3A 3FDSA 2W8KA 1ZQNA 1L6NA 4YMNA 7ICLA 2B0CA 2Q4TA 2F8KA 4BXOA 3PW7A 3H8SA 5KFSA 3N7PD 4P0QB 2KE7A 2IHNA 4KMUA 3KHHA 4PL2A 1A6SA 2F44A 1O08A 4OJLA 1BNOA 3HPOA 3OJSA 8ICLA 5IIJA 3DV9A 4PHPA 5CWRA 1NK8A 2HSZA 4DL7A 1D8BA 4GXKA 4DSEA 5JUMA 3E2EA 2DPIA 3LWMA 4CCHA 3QEBZ 2LYAA 1YZ7A 1QSSA 2ESEA 4ELUA 5KFBA 4NLNA 3OSPA 3MGVA 4F92B 2KV2A 1QCKA 4DCCA 2RHFA 1N48A 3CRXA 4KLDA 3LVWA 2GH1A 4O3NA 4FFDA 3QZ8A 1S76D 4ELVA 2OWOA 3C2KA 5AM5A 5DQIA 5DBCA 4J9RA 1PVRA 4JB3A 2BQRA 8ICZA 2PMZF 5KFOA 1HIWA 4LJXA 2W03A 2ZIXA 3HJEA 5CJ7A 2I1QA 2BQ3A 5AKIA 4UW9A 5KG6A 4M47A 1Q46A 1SB3C 9ICAA 4IL6U 2QB0B 4IRKA 4J9OA 4P0PA 1U4BA 3H0RB 2KVSA 1HUZA 5KT4A 2UVUA 4O3SA 5J2CA 2A19A 2YX8A 2ZTDA 2ZJAA 2A1JA 4YP3A 1COKA 1ZQUA 4F5NA 5L1JA 2LI6A 2NYVA 1HEKA 4EEKA 2A3VA 4I29A 1VLBA 2KVCA 2KTQA 4AYBC 4M6WA 5KFTA 5KG3A 4CDGA 2I9GA 2E1EA 1T94A 2ATLA 3MGIA 3E0FA 5EE0A 3UXOA 1COOA 4JV2A 3RF9A 3F2DA 8ICSA 4EZ6A 1A76A 1DGSA 5DQHA 4EBCA 1HJPA 3QUTA 2JEJA 9ICOA 4DL6A 3UXNA 4IQVA 1Z00A 2BGWA 2BPCA 1DXSA 4QZIA 3ORYA 5HNKA 3RBEA 2K89A 2VJ5A 4QZFA 3GV7B 4NLBA 4TUPA 1ZJMA 4C8NA 2KKVA 1J2MA 3WK7A 3OJUA 3MFIA 1S5LU 4K4HA 1C7YA 4XQ8A 8ICYA 2W9CB 5AHXA 1NJZA 5IIKA 4BUGA 8ICEA 4YMOA 1XSNA 3KHRA 3PNCA 3ZDEA 1L8LA 1KFSA 1UA0A 2C2EA 4B9MA 2Y0SF 5J8YA 5ALSA 4CRXA 5AKHA 4RZRA 3QUQA 4ECZA 1KW4A 2JRZA 4DSKA 2F76X 4WJ3B 4A8EA 1K1SA 5AK5A 4IR1A 4I2IA 1L3SA 1UCVA 1RG6A 2EDUA 2P6UA 3IDWA 1KN5A 2RDJA 4YR0A 5CA7A 2RQ5A 1SV0A 1KDHA 5JRTA 1S0VA 5J0XA 1N61A 3H7IA 5J2IA 2QARB 1ZQPA 3GV5B 2PFNA 3ZI4A 4RQNA 2F77X 2W9AA 3QE9Y 3RR7A 2EAOA 4YR2A 3JPPA 1QQ7A 1ZQYA 5HMLA 3SI8A 2MAXA 1H38A 4KN7A 1RYRA 4ECWA 4C8MA 2AQ0A 9ICWA 5B66U 4KLOA 3ICXA 2KZ3A 3KKAC 3VC8A 5KFEA 4M9NA 4KLJA 4ED8A 3R9KA 4I2GA 2R8JA 8ICNA 4OCZA 2I6XA 1RM6C 3PW4A 2CPRA 4KLEA 3GQCA 5AI5A 1RZTA 3SR6A 3GIIA 3ZD8A 3ED5A 3M8SA 3SENA 2L5YA 2Y9TA 3Q8LA 4B9SA 3OTQA 2PI4A 4RNMA 4ECVA 3M9MB 4I2DA 4DSLA 3PR4A 1ZQQA 2BHNA 1ZQLA 4UB6U 4DOBA 5C5JA 1K1QA 2QB0A 3BQ1A 4K4IA 3V6KA 5CB1A 3H40A 3PX4A 1F0MA 5AK6A 3PVXA 2E8OA 1PK3A 4UATA 4NL9C 4RQ0A 4I2AA 5AKXA 3BJYA 4CE6A 4CF4A 1TK5A 1KL9A 2K8CB 4QIWC 2WF6A 2BCQA 3KBBA 1V38A 2KFNA 1MN8A 1SV4A 3RBDA 4M9GA 3H8MA 1SIJA 1B0XA 4JV1A 1X40A 1ZETA 4UAWA 4KLUA 2C2DA 5KFCA 1M6YA 3PZPA 5KG1A 2AGQA 1JXLA 3QNMA 2J6SA 3UXPA 4QW9A 9ICQA 7ICFA 4O0IA 3CP8A 4J9MA 5F9LA 3MABA 2EANA 2NV3A 4O3RA 4PHEA 2WB1F 2Y0SC 2ES6A 2G09A 4RPZA 1T4GA 1ZRMA 1CRXA 3S6JA 2IOFA 4UB2A 2KG5A 4NLCA 5B5EU 4US9A 1L7MA 3MR6A 4NY8A 1X6IA 2XY7A 4F4ZA 3C5GA 5L1IA 5EWGA 5KNIA 2I5HA 1RXVA 9ICMA 4Q8FA 2ZIVB 2KZMA 5KFIA 2MSNA 4EBDA 2GLEA 2LKYA 4BXOB 3UQ0A 4M04A 1TAMA 9ICGA 3EZ5A 4JWMA 3RB3A 3ISCA 1U45A 4PH5A 8ICGA 2W8LA 4EENA 2C22A 1ZQIA 5J2GA 3N97B 5ALJA 1U48A 8ICFA 2AGPA 3LK9A 3MR5A 5GTIU 4TQRA 1IG6A 3HW8A 1LB2B 5A0LA 1NK0A 3GDXA 4TURA 3TQ1A 1Y88A 2NRZA 2QARA 4QW8A 3RJFA 2KN7A 4O5CA 2FMSA 4LVSA 4QZDA 3WKAA 5J0UA 1CI4A 2DFLA 4Q8EA 4JUZA 5J29A 4NXZA 3OHAA 3EPGA 1LVHA 3UMBA 4HYKA 3WKCA 5AKEA 3RFAA 4RT3A 4U7CA 4YCXA 1WWUA 4Y2XA 1FO4A 2IOFK 4Y2RA 3QU7A 1CUKA 3NASA 2HDOA 3PX6A 2PXIA 2PFOA 1PVPA 4DFJA 1T7PA 2KFZA 2BZFA 2ZIXB 3M8RA 1T3NA 2EZXA 5JU5A 1GO3F 3WK6A 4P0PB 2IMWP 2GOLA 3C5FA 4MF2A 2ZUCA 2F1IA 5EE9A 2A1JB 3AEVA 5DB6A 4QZ9A 2O6KA 4QZBA 1B43A 4J9LA 3TADA 3RH6A 4J03A 1X9WA 4EYIB 4RU9A 4MEYA 2VKQA 4ED1A 5KFLA 2XC9A 1ZQAA 1UPHA 7ICPA 5KG0A 2WB1C 3AN1A 3TFSA 2ZUDA 5D4BA 4F5QA 5EWEA 3K1RB 3UMGA 9ICRA 2LM4A 3F53A 4Y2YA 1L7NA 2P35A 1FFVA 4KLFA 2UVVA 3B9JA 1Z00B 1QLNA 3MDAA 2NRVA 2FPKA 4AYBF 5J2DA 4FE3A 4CF3A 4Y2QA 4RNOA 1NK6A 3WK5A 3H8WA 1DGJA 5D46A 3SV3A 2M9NA 4DS4A 2BDPA 1TE2A 3D2SA 3NVWA 9ICUA 4B9UA 1JX4A 1SXEA 5DGBA 5KL1B 3V72A 3KOOA 1L7PA 1BPZA 1X42A 2IHMA 4K4GA 5KG7A 2H3VA 1PUZA 3I28A 5ALDA 1KQQA 5L1MA 1TKDA 2HHUA 1VDVA 3TAPA 3AU2A 2EAPA 4TUSA 4KX3A 2G0AA 4KLIA 4DQSA 3H8JA 4YXMA 5KFMA 4UB1A 1UA1A 5DGAA 4I2CA 5AI9A 2JEGA 4C8KA 5J0YA 4PHDA 2VA8A 1B4FA 1ZQSA 2G08A 4DF8A 3WU2U 3HP6A 4JV0A 8ICUA 2D3DA 4C80A 1UQVA 4DO9A 1TAUA 5DDMA 4DSJA 2LPEA 3D2QA 5DG8A 3GIMA 4MF8A 4FS1A 2RLTA 4OJ5A 1N5XA 9ICPA 1V85A 3TKAA 3PV8A 3V6HA 5DQGA 4TUQA 3GFKB 4PJ0U 1QQ5A 1BPBA 4F5OA 3UQ2A 3WKDA 9ICXA 1RQLA 7ICIA 2ISOA 2JHDA 2EAMA 4J9SA 4YG2A 2UVRA 3I76A 1D8LA 5L1LA 5J8YC 2K8AA 3D6JA 2XGPA 4RQ8A 1XWLA 4EELA 4CNQA 1UHUA 5IIOA 5J2BA 3C1YA 7ICTA 3BS7A 3PSFA 1XO0A 1KTQA 2XY5A 2ZJ8A 1SV0C 4RUCA 5J2KA 4QZ8A 5HHHA 1QQ6A 4F5PA 5IILA 3BZKA 2VA2A 3K4GA 2W9BB 3CNHA 5ALRA 4P4PA 1NZPA 2JZBA 2HVHA 2BCSA 4PPXA 3LYSA 2XCPA 3IRUA 1QSYA 4KLGA 3AU6A 2HBLA 4JK1A 2WF9A 3C29A 1ZJNA 2JGAA 4IQWA 3IHQB 3RJHA 1YT3A 3BS5B 2W11A 4NM2A 2KKPA 1S8OA 4B9TA 3NRZA 1TK8A 5ALMA 4Z6EA 1AROP 4EX7A 2E8NA 5AKKA 3DEEA 4UBCA 1SZPA 2Z7JA 4LZGA 1SWWA 5BOMA 1OW5A 2G5HB 2LMRA 2AQ4A
chains in the Genus database with same CATH topology
3C28A 2HOQA 3IN5A 1PVQA 4ICAA 1PVRA 2WB1C 5CRXA 4BUGA 1OUQA 4P0QA 2KICA 3SAFA 2E1FA 2PMZF 2XI9A 3M7DA 1URJA 1HIWA 2DF4B 2G06A 2ZIUB 3F2BA 3SQIA 2LBOA 2HBMA 2W03A 2ZIXA 3CYMA 2G5IB 3F53A 4QIWF 2CRXA 3IG5A 2KNJA 5HR7A 2RRDA 4QNLA 2H3ZA 2ZXHA 1F44A 2Y0SF 2F2AB 2N1RA 2RP5A 1Z1BA 4PL1A 4CRXA 2JHDA 5A0LA 2K4EA 3F5AA 2XIDA 3K1ZA 2JH1A 3N7RC 3SAHA 2XVTA 2K8AA 3F5EA 3NUQA 4BJQA 2H3QA 2PMZC 4P0PA 2F76X 4WJ3B 1IIPA 2MA1A 2YB4A 4A8EA 3ALRA 4ACOA 4AYBF 3LVVA 2ZIWA 2M0NA 3H0RB 3HKZF 2K8CB 2WAQF 4CGZA 2VIXA 4KMOB 2OXOA 2LYBA 3GU3A 4FE3A 3PSPA 3OPXA 3SMVA 2HBJA 4QIWC 2HOIA 3PSIA 3M6KA 2YX8A 3GZFA 3NRWA 4BX9C 1DRGA 1KBUA 3PSFA 2JMGA 2ZG6A 3D2SA 3IP4B 1Z19A 1XO0A 2HOFA 4U6PA 1HEKA 2H3IA 2ZIVA 2A3VA 4OJPA 3RFAA 2KVCA 1SZHA 2R18A 2OM6A 2ZXIA 4AYBC 4U7CA 3PZPA 2OH2A 1L6NA 5KL8B 4OO1J 3HKZC 2F8LA 5KL1B 5HR6A 2Q4TA 3AQEA 2KJ8A 4C0ZA 2YB1A 2F77X 4CDGA 2KHVA 4JMUA 2E1EA 1T94A 2MRLA 2KJ5A 2H3VA 2DGZA 3CP8A 3N7PD 3O0FA 4P0QB 2K4IA 3T79A 5T14A 3E0FA 4KX5A 1PVPA 1NZBA 4PL2A 5C0YA 1A6SA 2NV3A 3AL0B 2ZIXB 3LYSA 2D6FC 4OJLA 2WB1F 2Y0SC 3RF9A 3ONNA 4NV0A 2G07A 2G09A 3F2DA 2H3FA 3H0LB 4GFJA 1Q3VA 3AQFA 2ZIUA 2DQNB 2BDUA 2HBLA 2KD1A 2CN1A 3C29A 2JGAA 2VJ4A 3ICXA 4FZNA 4KX3A 2G0AA 3SAGA 3VC8A 1CRXA 1D8BA 1GO3F 1YT3A 3PSTA 1Q3UA 2W7PA 1ZQ1C 3D2NA 4P0PB 3KFUF 2WAQC 4FZLA 2GOLA 2ZIWB 2KKPA 4IC9A 2KOBA 4O3MA 1P7DA 2OYYA 2CPRA 2LHTA 2LYAA 4NLCA 3N7SC 2HMXA 2KEYA 2KIWA 4FZMA 3VCBA 1MA7A 2G08A 2K8BB 2K89A 2KJ9A 2HBKA 3L3FX 4NWIA 4OJOA 3MGVA 2KHQA 2VJ5A 2KV2A 2XICA 2ZIVB 4QJFB 1A0PA 2RHFA 4OJ5A 1ECWA 1XNSA 4NLBA 3DEEA 3F2CA 2LKYA 3D2QA 2W7OA 1ED1A 2KKVA 2Z7JA 3CRXA 3H0MB 3LVWA 4OJ6A 2GH1A 3KZXA 2W04A 1TAMA 2VKQA 3M6ZA 2G5HB 2K4HA 1WUDA 2JH7A 3IG8A 2E5SA 1UPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KL8 B;  5KL1 B;  3ALR A; 
#chains in the Genus database with same CATH topology
 2HOQ A;  1HUO A;  1YZ6 A;  1PVQ A;  4ECT A;  2W54 A;  3H4D A;  8ICX A;  4QZG A;  2R8G A;  1WG8 A;  3NVV A;  1O03 A;  2LBO A;  7ICK A;  4QIW F;  5HR7 A;  5E79 U;  1ZRN A;  1CEZ A;  4PHA A;  4GC6 A;  2W43 A;  8ICK A;  3NTU A;  2ZIW A;  4PGQ A;  2M0N A;  4EZ9 A;  2MUT B;  4F8R A;  1S10 A;  4J9P A;  7ICS A;  3MC1 A;  1X9X A;  2DUY A;  3QU5 A;  5KG2 A;  4Z6C A;  4Y2T A;  4OJP A;  1SZH A;  2R18 A;  1JUD A;  3CW2 C;  1TAQ A;  4O3Q A;  2MRL A;  3O0F A;  5H2F U;  5F9N A;  4IQU A;  1C20 A;  5AIB A;  4YFK A;  1N5W A;  3NVZ A;  1KEJ A;  3ONN A;  4KLH A;  5ALF A;  3I1Y A;  2W55 A;  3RJI A;  3Q8M A;  4RQM A;  2W7P A;  1NK4 A;  4UB3 A;  1KSP A;  1Q8K A;  3JPR A;  4DS5 A;  3V7L A;  4Y2P A;  3QZ7 A;  1QSL A;  4F93 B;  2FPL A;  4DL3 A;  3L3F X;  3WK9 A;  4PZO A;  5AK3 A;  2HHS A;  4QJF B;  2FDR A;  2JEI A;  4DFP A;  1ED1 A;  2RDI A;  3RB6 A;  3SV4 A;  1SL1 A;  2HI0 A;  5KL8 B;  4QZE A;  4OO1 J;  3T5L A;  4KLQ A;  3EPI A;  1RPL A;  4FO6 A;  1LV5 A;  8ICW A;  2H3Z A;  4ED0 A;  2WFA A;  4DOC A;  3RRG A;  9ICL A;  3F5A A;  2WF7 A;  2Q0Z X;  1FIQ A;  2W3R A;  1X2I A;  3SAH A;  3ISB A;  4ZH4 A;  2C28 A;  1IIP A;  2MA1 A;  4ACO A;  4F2R A;  4BWM A;  2W9B A;  3RJE A;  2OXO A;  3QYP A;  3OPX A;  1XC9 A;  4O3O A;  4M9L A;  4F4K A;  4KLT A;  4BX9 C;  5DLF A;  2E8P A;  2ASJ A;  4E0D A;  2PKE A;  5IIN A;  4R66 A;  9ICH A;  3FYH A;  4RQ6 A;  2K60 A;  1JXE A;  4QWA A;  4O3P A;  1NK7 A;  2JXJ A;  2KJ8 A;  2KHV A;  3BS5 A;  1ZQO A;  2EZY A;  2K4I A;  1ZD3 A;  1JRP A;  5KFN A;  1S0O A;  3HWT A;  4RPY A;  2HHQ A;  2R8K A;  4B9N A;  1UT8 A;  5AKY A;  1AQ6 A;  2DPJ A;  4GFJ A;  5AK4 A;  4I2B A;  3AQF A;  4UQG A;  2ZIU A;  5J2F A;  2FLP A;  8ICM A;  2CXY A;  2IA6 A;  3T5H A;  2HVI A;  3RAX A;  1ZQG A;  2UVW A;  5G5G A;  3PML A;  1S97 A;  2HHT A;  5DG7 A;  4Q44 A;  2E8M A;  3UPQ A;  2KHQ A;  4PZN A;  3BQ2 A;  4B6J A;  4EYH B;  1KFT A;  3M9N B;  4OJ6 A;  3TAD C;  4ED3 A;  7ICV A;  4DQQ A;  1JRO A;  5AI0 A;  4C0Z A;  2YQE A;  4UAZ A;  2BPG A;  5J0O A;  4ICA A;  2W3S A;  2NRT A;  3G6V A;  2MUT A;  2KNJ A;  4YN4 A;  2KSO B;  5D49 A;  2RP5 A;  2K4E A;  4EX6 A;  3E58 A;  3T3F A;  2DWQ A;  3LDA A;  5KG4 A;  1TK0 A;  4QWE A;  3LVV A;  5AIC A;  1L7O A;  4CF5 A;  4ECS A;  3PW0 A;  1NK5 A;  8ICR A;  8ICV A;  1DRG A;  2LM1 A;  1Z19 A;  2V4R A;  5ALV A;  5KFP A;  2EQY A;  9ICF A;  1U47 A;  5ALX A;  3AQE A;  4ECY A;  1ZD5 A;  5AM2 A;  3EW9 A;  4F72 A;  4RPX A;  2F3N A;  5J0Q A;  4DSI A;  3J81 j;  1KLN A;  1JAL A;  2P6R A;  2KZZ A;  3AM9 A;  5AI6 A;  2FPM A;  4NV0 A;  1ZQX A;  1Q3V A;  2DQN B;  2BDU A;  2ISP A;  5KFF A;  1MC8 A;  1MQ2 A;  1Q3U A;  5AM3 A;  7ICG A;  3KFU F;  4YXJ A;  1T3Q A;  2XGQ A;  1IXR A;  2LHT A;  5DBB A;  4XRH A;  2H5X A;  3VCB A;  4MFC A;  3B0Y A;  1LKY B;  3WKE A;  4QZA A;  1XNS A;  1ZQC A;  5KAI U;  1ZQB A;  2Y1I A;  3RJK A;  2V4Q A;  2E5S A;  5CHG A;  2JZB B;  5ALZ A;  1ZQJ A;  3SAF A;  9ICI A;  2ASD A;  4KLM A;  2DF4 B;  4IRD A;  2B21 A;  3CYM A;  1MSW D;  5KFK A;  2FMQ A;  4UBB A;  5J0P A;  4ECR A;  4P4O A;  4FBU A;  1BGX T;  3H4B A;  4XUS A;  1N56 A;  4RQ1 A;  3DDH A;  4FBT A;  4C7Z A;  4G3I A;  4NLZ A;  3SEI A;  4KMO B;  3GV8 B;  3TAR A;  4YQW A;  1TFR A;  1KBU A;  1L3U A;  3JPO A;  3PMN A;  2JV3 A;  3ZDB A;  7ICE A;  3SZ2 A;  1XO1 A;  1JN3 A;  5J0W A;  5ALO A;  5HR6 A;  3QEA Z;  4R64 A;  4F4X A;  3ZD9 A;  5KFH A;  4PGX A;  4M9H A;  3T79 A;  5T14 A;  1ZQF A;  2D8C A;  3NVY A;  5ALG A;  3ZDC A;  4MFF A;  8ICP A;  4UB8 U;  4P2H A;  1SL0 A;  3C21 A;  5KFX A;  4IRC A;  2AH5 A;  4UAV A;  3KHG A;  2ZIW B;  5AM0 A;  1UT5 A;  1ZQR A;  4F5R A;  3RR8 A;  9ICB A;  9ICK A;  4DFD A;  4DEZ A;  5EE3 A;  1MA7 A;  1L3V A;  2ZJ5 A;  3BQ0 A;  5DB8 A;  1ZQH A;  3Q8R B;  3BQ7 A;  2C2R A;  1WCL A;  4IS7 A;  1XS9 D;  1NJW A;  1A0P A;  3IM1 A;  3F2C A;  2JR5 A;  1N2X A;  5DG9 A;  1QTM A;  5KT2 A;  2FLN A;  2KSO A;  5AM4 A;  3A0B U;  4ED7 A;  3M6Z A;  3U26 A;  3ETR A;  3V6J A;  4DQP A;  4US8 A;  2BQU A;  3ZDA A;  5L1K A;  2E1F A;  3M7D A;  2G06 A;  4O5E A;  1A77 A;  1VJ5 A;  1ZQE A;  3SQI A;  9ICC A;  2RRD A;  3TAN A;  4DOA A;  1WYG A;  4PL1 A;  5DDY A;  2YMM A;  1KFD A;  1BVS A;  2BR0 A;  5KG5 A;  2ODG A;  1X9S A;  3ALR A;  2R8I A;  4CGZ A;  2VIX A;  3GU3 A;  5J2H A;  3SMV A;  4GIB A;  1Z3E B;  2JMG A;  5KFG A;  5ALI A;  5ALE A;  2YY6 A;  1ZQK A;  3HT3 A;  2ZXI A;  3PO5 A;  3GIJ A;  2F8L A;  2KIV A;  4F2S A;  4DWI A;  3GIK A;  2DGZ A;  4B9L A;  5TZV A;  5BPC A;  4KX5 A;  1NZB A;  5C0Y A;  3RJG A;  4UAS A;  3AMZ A;  4UB5 A;  2D6F C;  4Q43 A;  5FP0 A;  4I2F A;  4KLS A;  1F5S A;  5AKJ A;  1LKY A;  4DQI A;  3MBY A;  3M1Y A;  3PW2 A;  5K4L A;  7ICQ A;  2KD1 A;  2CN1 A;  4QWD A;  4DL4 A;  3HX0 A;  4NLK A;  3N28 A;  5ALY A;  4KIT B;  5KTQ A;  3D2N A;  4TQS A;  5AI4 A;  3QU4 A;  2GWS A;  4O3M A;  2FMP A;  3N7S C;  5EE1 A;  2KIW A;  5KFZ A;  3Q8S B;  5ALN A;  1ZQW A;  4DL5 A;  1RXW A;  3JPT A;  1ECW A;  2ALZ A;  2V9W A;  2W7O A;  1ZQT A;  4ED2 A;  5ALT A;  1NNL A;  4JWN A;  5J2E A;  1PK1 A;  3HRD D;  1OUQ A;  1TV9 A;  2PFQ A;  2XO7 A;  1JIH A;  3AUO A;  3KHL A;  2ZIU B;  4DLE A;  4Z6F A;  2G5I B;  1BPX A;  2CRX A;  1S77 D;  3IG5 A;  4YD1 A;  3JPQ A;  3QUC A;  4R65 A;  1ZYQ A;  4DL2 A;  4C8L A;  4F3O A;  2HHW A;  4NLG A;  3QU9 A;  4BDP A;  7ICO A;  2JH1 A;  4DQR A;  2XVT A;  4USA A;  4DSF A;  4GC7 A;  2BPF A;  2WAQ F;  3PSP A;  4I27 A;  3JPN A;  3M6K A;  4R8U A;  4Y2U A;  3G6Y A;  1JI7 A;  2Y9U A;  3NGD A;  4ELT A;  3JPS A;  2HW3 A;  9ICE A;  3C2L A;  4U6P A;  1V97 A;  4LZD A;  4YD2 A;  2EH9 A;  1IV8 A;  8ICH A;  1FEZ A;  3MGH A;  3HKZ C;  2HCF A;  5KT5 A;  1D8Y A;  9ICS A;  2YB1 A;  1XSL A;  4X5V A;  3ZDD A;  4JMU A;  3IV6 A;  2ZTE A;  4DFK A;  5EWF A;  3SYZ A;  3OHB A;  5HHI A;  3RAQ A;  1T8E A;  2E3T A;  9ICV A;  1ZXI A;  2KK0 A;  4UAR A;  3T5K A;  1L5U A;  7ICM A;  2AHO B;  5KFV A;  1ZQ1 C;  4YVZ A;  4RT2 A;  1L8O A;  2AGO A;  1EXN A;  1N63 A;  4C4S A;  1ZQD A;  8ICB A;  2K8B B;  4RQ4 A;  2KJ9 A;  3RB0 A;  3KTQ A;  4BGD A;  3H0M B;  1DK3 A;  5BOL A;  2YTU A;  2W04 A;  2FE9 A;  5IIM A;  1WUD A;  2JH7 A;  1NKC A;  3C28 A;  3IN5 A;  4P0Q A;  2KIC A;  2KMD A;  1SXD A;  9ICJ A;  2HBM A;  2BCR A;  1IM4 A;  1ZD4 A;  1F44 A;  2F2A B;  5ALP A;  3MR3 A;  1J97 A;  4Z6D A;  2J6T A;  3M9O B;  2MU2 A;  2Y1J A;  5J0T A;  2PMZ C;  5AI8 A;  4J9K A;  5ALU A;  7ICN A;  5DLG A;  2EZZ A;  4C7Y A;  3BQT A;  3PR5 B;  5KT6 A;  3NRW A;  1XU4 A;  3UMC A;  4GLX A;  4RQ7 A;  1BPE A;  5AKZ A;  1BPY A;  4NJ8 A;  5ALW A;  7ICR A;  2DL0 A;  4MFA A;  1FFU A;  2DKZ A;  3RTV A;  9ICN A;  2J6U A;  5J2A A;  2F1H A;  3RH5 A;  4I2J A;  2P66 A;  8ICO A;  3V7K A;  3C23 A;  2WTF A;  3RRH A;  4ECQ A;  2H3F A;  4C8O A;  1SGG A;  1X66 A;  2VA3 A;  4FZN A;  3SAG A;  5HMM A;  3PST A;  3EYZ A;  2WAQ C;  4FZL A;  3TAC B;  3TI0 A;  4Y2V A;  3BZC A;  2HMX A;  4NM1 A;  4QZC A;  4FS2 A;  4DF4 A;  7ICU A;  2WF8 A;  2YMP A;  1X6J A;  8ICA A;  1RDF A;  5KFW A;  5KFR A;  4I2H A;  3IG8 A;  2GO7 A;  4DFM A;  1X9M A;  1ZQV A;  1N60 A;  1SKR A;  3FAH A;  3K75 D;  2XI9 A;  4EBE A;  1WCN A;  5CP2 A;  5KFA A;  5DB7 A;  4GXJ A;  1L3T A;  1ZQM A;  3OSN A;  3C2M A;  1S0M A;  1KRP A;  4O5K A;  1QH9 A;  3NS1 A;  2YN4 A;  4QWB A;  2DBY A;  1SKS A;  5GTH U;  3RB4 A;  2AJQ A;  5L9X A;  5F3X B;  3ETL A;  3QX7 A;  4ED6 A;  4BJQ A;  5HP4 A;  2ZTC A;  3FM9 A;  1MQ3 A;  2HBJ A;  3PSI A;  5KFY A;  7ICJ A;  2DKX A;  4RNN A;  4J9Q A;  3RH4 A;  4YMM A;  2OCE A;  2BCU A;  2HHX A;  2OM6 A;  4R63 A;  1XSP A;  3QXG A;  4HAI A;  4F4Y A;  4P4M A;  4F91 B;  2PFP A;  3GIL A;  2XCA A;  5KT7 A;  2KJ5 A;  2W9C A;  4KN4 A;  1DOQ A;  4F4W A;  8ICI A;  5G5H A;  4RQ5 A;  2W9M A;  8ICJ A;  1U49 A;  2AU0 A;  3H0L B;  3KKA A;  1ZQZ A;  4QWC A;  4OD0 A;  4MHV A;  3L5K A;  2BCV A;  4B9V A;  1RYS A;  2NRW A;  2QKQ A;  5AIA A;  5KFQ A;  2B6G A;  3Q8K A;  2IBK A;  1V9P A;  2OEH A;  5DBA A;  2KOB A;  3Q8Q B;  1PZN A;  4AP9 A;  1SL2 A;  4M2Y A;  4FZM A;  4Y2J A;  2ASL A;  3EUB 2;  5DKW A;  2HBK A;  4NWI A;  4RQ2 A;  3V7J A;  4C4T A;  2XY6 A;  1NK9 A;  2IOH A;  1D9D A;  3KZX A;  3PO4 A;  2YMQ A;  5J0S A;  3BDP A;  5AM1 A;  2K4H A;  2BKE A;  4RUA A;  4RQ3 A;  5CRX A;  1NJY A;  7ICH A;  3L4P A;  3Q8P B;  2VAN A;  8ICQ A;  4DLG A;  2WHE A;  1URJ A;  3UM9 A;  3WK8 A;  4NL9 A;  3MDC A;  4M9J A;  5ALL A;  4PGY A;  9ICT A;  2ZXH A;  1B22 A;  3EWA A;  3ISD A;  1Z1B A;  4MEX A;  3FC4 A;  1ZD2 P;  5ALQ A;  5J2J A;  1NJX A;  3N7R C;  4KTQ A;  5J0R A;  2YB4 A;  1J2N A;  1RQN A;  4IQT A;  2LYH A;  4I28 A;  1RYU A;  2LYB A;  3QU2 A;  2HOI A;  4ECX A;  2QB1 A;  2YML A;  1NKE A;  4IR9 A;  3PW5 A;  1SWV A;  2KP7 A;  3TAQ A;  3THV A;  4ECU A;  1Z1V A;  2ZG6 A;  4F50 A;  3IP4 B;  1K5O A;  2H3I A;  1Z4N A;  3PX0 A;  2OH2 A;  4Q45 A;  1PK1 B;  4YR3 A;  2HHV A;  4UAY A;  3RJJ A;  3B0X A;  3SD7 A;  3A0H U;  1NOM A;  1S9F A;  3AL0 B;  3LWL A;  2A1A A;  5ALH A;  2G07 A;  4ZOH C;  1JMS A;  2R8H A;  2NO4 A;  4M6W B;  1WWV A;  5CR0 A;  5KFD A;  3WK4 A;  2VJ4 A;  4Y2S A;  4EEY A;  5EOZ A;  1D9F A;  2K4P A;  1ZOL A;  4IC9 A;  2OHF A;  1P7D A;  2OYY A;  8ICC A;  2KEY A;  4R8U B;  5III A;  4BWJ A;  2PI5 A;  3MFH A;  1NI3 A;  5KFJ A;  8ICT A;  4OJO A;  5AKG A;  5CEH A;  1S0N A;  2XIC A;  4UB4 A;  5KFU A;  3N4M B;  2WF5 A;  1Z4O A;  3WKB A;  3PY8 A;  2NRX A;  4QZH A;  3C1Z A;  4G9B A;  3T5J A;  3TFR A;  4UAU A;  5KAF U;  4I2E A;  2FI1 A;  5AKL A;  4GXI A;  2JEF A;  3G6X A;  3OGU A;  2ZUB A;  1TVA A;  3F2B A;  4J9N A;  3QUB A;  1BNP A;  3KZI U;  4QNL A;  2FJ6 A;  2N1R A;  5ALK A;  2F1J A;  2XID A;  5TIS U;  2NO5 A;  2AXT U;  3K1Z A;  1OXJ A;  4KLL A;  2QLT A;  4F71 A;  3F5E A;  3NUQ A;  1KKX A;  2H3Q A;  1DK2 A;  5KT3 A;  1NKB A;  4M0A A;  4O9M A;  3HKZ F;  5DB9 A;  1U9L A;  3GZF A;  1SKW A;  4C4R A;  4XA5 A;  5JTI A;  3MR2 A;  2HOF A;  2FLL A;  1N62 A;  1BPD A;  2ZIV A;  3HIL A;  3KD3 A;  3FDS A;  2W8K A;  1ZQN A;  1L6N A;  4YMN A;  7ICL A;  2B0C A;  2Q4T A;  2F8K A;  4BXO A;  3PW7 A;  3H8S A;  5KFS A;  3N7P D;  4P0Q B;  2KE7 A;  2IHN A;  4KMU A;  3KHH A;  4PL2 A;  1A6S A;  2F44 A;  1O08 A;  4OJL A;  1BNO A;  3HPO A;  3OJS A;  8ICL A;  5IIJ A;  3DV9 A;  4PHP A;  5CWR A;  1NK8 A;  2HSZ A;  4DL7 A;  1D8B A;  4GXK A;  4DSE A;  5JUM A;  3E2E A;  2DPI A;  3LWM A;  4CCH A;  3QEB Z;  2LYA A;  1YZ7 A;  1QSS A;  2ESE A;  4ELU A;  5KFB A;  4NLN A;  3OSP A;  3MGV A;  4F92 B;  2KV2 A;  1QCK A;  4DCC A;  2RHF A;  1N48 A;  3CRX A;  4KLD A;  3LVW A;  2GH1 A;  4O3N A;  4FFD A;  3QZ8 A;  1S76 D;  4ELV A;  2OWO A;  3C2K A;  5AM5 A;  5DQI A;  5DBC A;  4J9R A;  1PVR A;  4JB3 A;  2BQR A;  8ICZ A;  2PMZ F;  5KFO A;  1HIW A;  4LJX A;  2W03 A;  2ZIX A;  3HJE A;  5CJ7 A;  2I1Q A;  2BQ3 A;  5AKI A;  4UW9 A;  5KG6 A;  4M47 A;  1Q46 A;  1SB3 C;  9ICA A;  4IL6 U;  2QB0 B;  4IRK A;  4J9O A;  4P0P A;  1U4B A;  3H0R B;  2KVS A;  1HUZ A;  5KT4 A;  2UVU A;  4O3S A;  5J2C A;  2A19 A;  2YX8 A;  2ZTD A;  2ZJA A;  2A1J A;  4YP3 A;  1COK A;  1ZQU A;  4F5N A;  5L1J A;  2LI6 A;  2NYV A;  1HEK A;  4EEK A;  2A3V A;  4I29 A;  1VLB A;  2KVC A;  2KTQ A;  4AYB C;  4M6W A;  5KFT A;  5KG3 A;  4CDG A;  2I9G A;  2E1E A;  1T94 A;  2ATL A;  3MGI A;  3E0F A;  5EE0 A;  3UXO A;  1COO A;  4JV2 A;  3RF9 A;  3F2D A;  8ICS A;  4EZ6 A;  1A76 A;  1DGS A;  5DQH A;  4EBC A;  1HJP A;  3QUT A;  2JEJ A;  9ICO A;  4DL6 A;  3UXN A;  4IQV A;  1Z00 A;  2BGW A;  2BPC A;  1DXS A;  4QZI A;  3ORY A;  5HNK A;  3RBE A;  2K89 A;  2VJ5 A;  4QZF A;  3GV7 B;  4NLB A;  4TUP A;  1ZJM A;  4C8N A;  2KKV A;  1J2M A;  3WK7 A;  3OJU A;  3MFI A;  1S5L U;  4K4H A;  1C7Y A;  4XQ8 A;  8ICY A;  2W9C B;  5AHX A;  1NJZ A;  5IIK A;  4BUG A;  8ICE A;  4YMO A;  1XSN A;  3KHR A;  3PNC A;  3ZDE A;  1L8L A;  1KFS A;  1UA0 A;  2C2E A;  4B9M A;  2Y0S F;  5J8Y A;  5ALS A;  4CRX A;  5AKH A;  4RZR A;  3QUQ A;  4ECZ A;  1KW4 A;  2JRZ A;  4DSK A;  2F76 X;  4WJ3 B;  4A8E A;  1K1S A;  5AK5 A;  4IR1 A;  4I2I A;  1L3S A;  1UCV A;  1RG6 A;  2EDU A;  2P6U A;  3IDW A;  1KN5 A;  2RDJ A;  4YR0 A;  5CA7 A;  2RQ5 A;  1SV0 A;  1KDH A;  5JRT A;  1S0V A;  5J0X A;  1N61 A;  3H7I A;  5J2I A;  2QAR B;  1ZQP A;  3GV5 B;  2PFN A;  3ZI4 A;  4RQN A;  2F77 X;  2W9A A;  3QE9 Y;  3RR7 A;  2EAO A;  4YR2 A;  3JPP A;  1QQ7 A;  1ZQY A;  5HML A;  3SI8 A;  2MAX A;  1H38 A;  4KN7 A;  1RYR A;  4ECW A;  4C8M A;  2AQ0 A;  9ICW A;  5B66 U;  4KLO A;  3ICX A;  2KZ3 A;  3KKA C;  3VC8 A;  5KFE A;  4M9N A;  4KLJ A;  4ED8 A;  3R9K A;  4I2G A;  2R8J A;  8ICN A;  4OCZ A;  2I6X A;  1RM6 C;  3PW4 A;  2CPR A;  4KLE A;  3GQC A;  5AI5 A;  1RZT A;  3SR6 A;  3GII A;  3ZD8 A;  3ED5 A;  3M8S A;  3SEN A;  2L5Y A;  2Y9T A;  3Q8L A;  4B9S A;  3OTQ A;  2PI4 A;  4RNM A;  4ECV A;  3M9M B;  4I2D A;  4DSL A;  3PR4 A;  1ZQQ A;  2BHN A;  1ZQL A;  4UB6 U;  4DOB A;  5C5J A;  1K1Q A;  2QB0 A;  3BQ1 A;  4K4I A;  3V6K A;  5CB1 A;  3H40 A;  3PX4 A;  1F0M A;  5AK6 A;  3PVX A;  2E8O A;  1PK3 A;  4UAT A;  4NL9 C;  4RQ0 A;  4I2A A;  5AKX A;  3BJY A;  4CE6 A;  4CF4 A;  1TK5 A;  1KL9 A;  2K8C B;  4QIW C;  2WF6 A;  2BCQ A;  3KBB A;  1V38 A;  2KFN A;  1MN8 A;  1SV4 A;  3RBD A;  4M9G A;  3H8M A;  1SIJ A;  1B0X A;  4JV1 A;  1X40 A;  1ZET A;  4UAW A;  4KLU A;  2C2D A;  5KFC A;  1M6Y A;  3PZP A;  5KG1 A;  2AGQ A;  1JXL A;  3QNM A;  2J6S A;  3UXP A;  4QW9 A;  9ICQ A;  7ICF A;  4O0I A;  3CP8 A;  4J9M A;  5F9L A;  3MAB A;  2EAN A;  2NV3 A;  4O3R A;  4PHE A;  2WB1 F;  2Y0S C;  2ES6 A;  2G09 A;  4RPZ A;  1T4G A;  1ZRM A;  1CRX A;  3S6J A;  2IOF A;  4UB2 A;  2KG5 A;  4NLC A;  5B5E U;  4US9 A;  1L7M A;  3MR6 A;  4NY8 A;  1X6I A;  2XY7 A;  4F4Z A;  3C5G A;  5L1I A;  5EWG A;  5KNI A;  2I5H A;  1RXV A;  9ICM A;  4Q8F A;  2ZIV B;  2KZM A;  5KFI A;  2MSN A;  4EBD A;  2GLE A;  2LKY A;  4BXO B;  3UQ0 A;  4M04 A;  1TAM A;  9ICG A;  3EZ5 A;  4JWM A;  3RB3 A;  3ISC A;  1U45 A;  4PH5 A;  8ICG A;  2W8L A;  4EEN A;  2C22 A;  1ZQI A;  5J2G A;  3N97 B;  5ALJ A;  1U48 A;  8ICF A;  2AGP A;  3LK9 A;  3MR5 A;  5GTI U;  4TQR A;  1IG6 A;  3HW8 A;  1LB2 B;  5A0L A;  1NK0 A;  3GDX A;  4TUR A;  3TQ1 A;  1Y88 A;  2NRZ A;  2QAR A;  4QW8 A;  3RJF A;  2KN7 A;  4O5C A;  2FMS A;  4LVS A;  4QZD A;  3WKA A;  5J0U A;  1CI4 A;  2DFL A;  4Q8E A;  4JUZ A;  5J29 A;  4NXZ A;  3OHA A;  3EPG A;  1LVH A;  3UMB A;  4HYK A;  3WKC A;  5AKE A;  3RFA A;  4RT3 A;  4U7C A;  4YCX A;  1WWU A;  4Y2X A;  1FO4 A;  2IOF K;  4Y2R A;  3QU7 A;  1CUK A;  3NAS A;  2HDO A;  3PX6 A;  2PXI A;  2PFO A;  1PVP A;  4DFJ A;  1T7P A;  2KFZ A;  2BZF A;  2ZIX B;  3M8R A;  1T3N A;  2EZX A;  5JU5 A;  1GO3 F;  3WK6 A;  4P0P B;  2IMW P;  2GOL A;  3C5F A;  4MF2 A;  2ZUC A;  2F1I A;  5EE9 A;  2A1J B;  3AEV A;  5DB6 A;  4QZ9 A;  2O6K A;  4QZB A;  1B43 A;  4J9L A;  3TAD A;  3RH6 A;  4J03 A;  1X9W A;  4EYI B;  4RU9 A;  4MEY A;  2VKQ A;  4ED1 A;  5KFL A;  2XC9 A;  1ZQA A;  1UPH A;  7ICP A;  5KG0 A;  2WB1 C;  3AN1 A;  3TFS A;  2ZUD A;  5D4B A;  4F5Q A;  5EWE A;  3K1R B;  3UMG A;  9ICR A;  2LM4 A;  3F53 A;  4Y2Y A;  1L7N A;  2P35 A;  1FFV A;  4KLF A;  2UVV A;  3B9J A;  1Z00 B;  1QLN A;  3MDA A;  2NRV A;  2FPK A;  4AYB F;  5J2D A;  4FE3 A;  4CF3 A;  4Y2Q A;  4RNO A;  1NK6 A;  3WK5 A;  3H8W A;  1DGJ A;  5D46 A;  3SV3 A;  2M9N A;  4DS4 A;  2BDP A;  1TE2 A;  3D2S A;  3NVW A;  9ICU A;  4B9U A;  1JX4 A;  1SXE A;  5DGB A;  5KL1 B;  3V72 A;  3KOO A;  1L7P A;  1BPZ A;  1X42 A;  2IHM A;  4K4G A;  5KG7 A;  2H3V A;  1PUZ A;  3I28 A;  5ALD A;  1KQQ A;  5L1M A;  1TKD A;  2HHU A;  1VDV A;  3TAP A;  3AU2 A;  2EAP A;  4TUS A;  4KX3 A;  2G0A A;  4KLI A;  4DQS A;  3H8J A;  4YXM A;  5KFM A;  4UB1 A;  1UA1 A;  5DGA A;  4I2C A;  5AI9 A;  2JEG A;  4C8K A;  5J0Y A;  4PHD A;  2VA8 A;  1B4F A;  1ZQS A;  2G08 A;  4DF8 A;  3WU2 U;  3HP6 A;  4JV0 A;  8ICU A;  2D3D A;  4C80 A;  1UQV A;  4DO9 A;  1TAU A;  5DDM A;  4DSJ A;  2LPE A;  3D2Q A;  5DG8 A;  3GIM A;  4MF8 A;  4FS1 A;  2RLT A;  4OJ5 A;  1N5X A;  9ICP A;  1V85 A;  3TKA A;  3PV8 A;  3V6H A;  5DQG A;  4TUQ A;  3GFK B;  4PJ0 U;  1QQ5 A;  1BPB A;  4F5O A;  3UQ2 A;  3WKD A;  9ICX A;  1RQL A;  7ICI A;  2ISO A;  2JHD A;  2EAM A;  4J9S A;  4YG2 A;  2UVR A;  3I76 A;  1D8L A;  5L1L A;  5J8Y C;  2K8A A;  3D6J A;  2XGP A;  4RQ8 A;  1XWL A;  4EEL A;  4CNQ A;  1UHU A;  5IIO A;  5J2B A;  3C1Y A;  7ICT A;  3BS7 A;  3PSF A;  1XO0 A;  1KTQ A;  2XY5 A;  2ZJ8 A;  1SV0 C;  4RUC A;  5J2K A;  4QZ8 A;  5HHH A;  1QQ6 A;  4F5P A;  5IIL A;  3BZK A;  2VA2 A;  3K4G A;  2W9B B;  3CNH A;  5ALR A;  4P4P A;  1NZP A;  2JZB A;  2HVH A;  2BCS A;  4PPX A;  3LYS A;  2XCP A;  3IRU A;  1QSY A;  4KLG A;  3AU6 A;  2HBL A;  4JK1 A;  2WF9 A;  3C29 A;  1ZJN A;  2JGA A;  4IQW A;  3IHQ B;  3RJH A;  1YT3 A;  3BS5 B;  2W11 A;  4NM2 A;  2KKP A;  1S8O A;  4B9T A;  3NRZ A;  1TK8 A;  5ALM A;  4Z6E A;  1ARO P;  4EX7 A;  2E8N A;  5AKK A;  3DEE A;  4UBC A;  1SZP A;  2Z7J A;  4LZG A;  1SWW A;  5BOM A;  1OW5 A;  2G5H B;  2LMR A;  2AQ4 A; 
#chains in the Genus database with same CATH homology
 3C28 A;  2HOQ A;  3IN5 A;  1PVQ A;  4ICA A;  1PVR A;  2WB1 C;  5CRX A;  4BUG A;  1OUQ A;  4P0Q A;  2KIC A;  3SAF A;  2E1F A;  2PMZ F;  2XI9 A;  3M7D A;  1URJ A;  1HIW A;  2DF4 B;  2G06 A;  2ZIU B;  3F2B A;  3SQI A;  2LBO A;  2HBM A;  2W03 A;  2ZIX A;  3CYM A;  2G5I B;  3F53 A;  4QIW F;  2CRX A;  3IG5 A;  2KNJ A;  5HR7 A;  2RRD A;  4QNL A;  2H3Z A;  2ZXH A;  1F44 A;  2Y0S F;  2F2A B;  2N1R A;  2RP5 A;  1Z1B A;  4PL1 A;  4CRX A;  2JHD A;  5A0L A;  2K4E A;  3F5A A;  2XID A;  3K1Z A;  2JH1 A;  3N7R C;  3SAH A;  2XVT A;  2K8A A;  3F5E A;  3NUQ A;  4BJQ A;  2H3Q A;  2PMZ C;  4P0P A;  2F76 X;  4WJ3 B;  1IIP A;  2MA1 A;  2YB4 A;  4A8E A;  3ALR A;  4ACO A;  4AYB F;  3LVV A;  2ZIW A;  2M0N A;  3H0R B;  3HKZ F;  2K8C B;  2WAQ F;  4CGZ A;  2VIX A;  4KMO B;  2OXO A;  2LYB A;  3GU3 A;  4FE3 A;  3PSP A;  3OPX A;  3SMV A;  2HBJ A;  4QIW C;  2HOI A;  3PSI A;  3M6K A;  2YX8 A;  3GZF A;  3NRW A;  4BX9 C;  1DRG A;  1KBU A;  3PSF A;  2JMG A;  2ZG6 A;  3D2S A;  3IP4 B;  1Z19 A;  1XO0 A;  2HOF A;  4U6P A;  1HEK A;  2H3I A;  2ZIV A;  2A3V A;  4OJP A;  3RFA A;  2KVC A;  1SZH A;  2R18 A;  2OM6 A;  2ZXI A;  4AYB C;  4U7C A;  3PZP A;  2OH2 A;  1L6N A;  5KL8 B;  4OO1 J;  3HKZ C;  2F8L A;  5KL1 B;  5HR6 A;  2Q4T A;  3AQE A;  2KJ8 A;  4C0Z A;  2YB1 A;  2F77 X;  4CDG A;  2KHV A;  4JMU A;  2E1E A;  1T94 A;  2MRL A;  2KJ5 A;  2H3V A;  2DGZ A;  3CP8 A;  3N7P D;  3O0F A;  4P0Q B;  2K4I A;  3T79 A;  5T14 A;  3E0F A;  4KX5 A;  1PVP A;  1NZB A;  4PL2 A;  5C0Y A;  1A6S A;  2NV3 A;  3AL0 B;  2ZIX B;  3LYS A;  2D6F C;  4OJL A;  2WB1 F;  2Y0S C;  3RF9 A;  3ONN A;  4NV0 A;  2G07 A;  2G09 A;  3F2D A;  2H3F A;  3H0L B;  4GFJ A;  1Q3V A;  3AQF A;  2ZIU A;  2DQN B;  2BDU A;  2HBL A;  2KD1 A;  2CN1 A;  3C29 A;  2JGA A;  2VJ4 A;  3ICX A;  4FZN A;  4KX3 A;  2G0A A;  3SAG A;  3VC8 A;  1CRX A;  1D8B A;  1GO3 F;  1YT3 A;  3PST A;  1Q3U A;  2W7P A;  1ZQ1 C;  3D2N A;  4P0P B;  3KFU F;  2WAQ C;  4FZL A;  2GOL A;  2ZIW B;  2KKP A;  4IC9 A;  2KOB A;  4O3M A;  1P7D A;  2OYY A;  2CPR A;  2LHT A;  2LYA A;  4NLC A;  3N7S C;  2HMX A;  2KEY A;  2KIW A;  4FZM A;  3VCB A;  1MA7 A;  2G08 A;  2K8B B;  2K89 A;  2KJ9 A;  2HBK A;  3L3F X;  4NWI A;  4OJO A;  3MGV A;  2KHQ A;  2VJ5 A;  2KV2 A;  2XIC A;  2ZIV B;  4QJF B;  1A0P A;  2RHF A;  4OJ5 A;  1ECW A;  1XNS A;  4NLB A;  3DEE A;  3F2C A;  2LKY A;  3D2Q A;  2W7O A;  1ED1 A;  2KKV A;  2Z7J A;  3CRX A;  3H0M B;  3LVW A;  4OJ6 A;  2GH1 A;  3KZX A;  2W04 A;  1TAM A;  2VKQ A;  3M6Z A;  2G5H B;  2K4H A;  1WUD A;  2JH7 A;  3IG8 A;  2E5S A;  1UPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...