5KL1B

Crystal structure of the pumilio-nos-hunchback rna complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
SRHCVFCENNNEPEAVINSHSVRDNFNRVLCPKLRTYVCPICGASGDSAHTIKYCPKKPIITMEDAIKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Drosophila Nanos acts as a molecular clamp that modulates the RNA-binding and repression activities of Pumilio.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Rna binding protein/rna
molecule keywords Maternal protein pumilio
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2016-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05741 zf-nanos Nanos RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.680 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 5kl1B00
3ALRA 5KL8B 5KL1B
chains in the Genus database with same CATH superfamily
1B4FA 1L7MA 5ALOA 4YQWA 4DFKA 2G07A 3H40A 2Y1JA 4BXOA 2ZUCA 3GQCA 3PMLA 2ES6A 5D4BA 3QU9A 2JZBB 1BPXA 3DEEA 4OJPA 4PHPA 3WK6A 4J9PA 2E8MA 3RF9A 2EH9A 2ZUBA 4JWMA 1PK1A 4F4WA 1N48A 2QKQA 3M8RA 4AP9A 5KL1B 4UB6U 5KTQA 2LYBA 4UASA 2AU0A 4M9HA 1UT8A 7ICVA 2CN1A 4QWCA 2K8AA 4Y2JA 2XC9A 3VCBA 3PX4A 1BPBA 2KOBA 2JV3A 1XSPA 4JV0A 2F44A 2H3FA 1X9SA 4YR0A 1ZQJA 3G6XA 3UPQA 1K5OA 4UAWA 4QWEA 2J6TA 3RRHA 4IQWA 1DOQA 4TURA 3QUBA 2QLTA 2KN7A 1ZRNA 3QZ8A 4DCCA 1XNSA 4F3OA 4DFPA 1JRPA 3AEVA 2DGZA 2JXJA 3QE9Y 2YMLA 1ZQAA 4USAA 3OGUA 3SAHA 5TZVA 3GFKB 3M1YA 3RJFA 1PK1B 3F2BA 1HJPA 4MHVA 2OHFA 1Z19A 2K89A 3K1RB 3ETLA 3RJHA 4NLZA 1T94A 2VJ4A 3BJYA 4O3RA 3SAFA 3MFHA 2HSZA 5KG2A 2HCFA 4EYHB 5DDMA 1LKYA 1D8LA 1UHUA 2AQ0A 1T3QA 4J03A 3G6YA 3WU2U 3NS1A 4Q44A 2FE9A 2PXIA 3FAHA 2JR5A 9ICVA 1K1SA 2AGPA 2FJ6A 3KKAC 1A6SA 2LKYA 1ZOLA 3N7SC 4NM2A 8ICAA 4EELA 3OTQA 4C8KA 3KZXA 4DFMA 3DDHA 4K4IA 2YB1A 4Z6FA 3Q8QB 4UATA 3IN5A 2H5XA 2IOFA 4KLFA 2DFLA 1MN8A 1NJZA 3TFRA 2HOFA 7ICUA 3HJEA 3F5EA 4C4TA 3RB0A 4QZAA 3M9OB 2VA8A 2QARB 2AJQA 4J9QA 8ICXA 3KOOA 2KMDA 3GU3A 5KG6A 4CGZA 3QZ7A 3QU5A 4R8UB 2HVIA 4O5KA 4IQUA 1H38A 1DGJA 1SGGA 1ZD5A 4DOAA 2FMQA 5L1IA 2ZTDA 2CXYA 1ZQOA 2HHQA 2ISOA 5J0OA 5CWRA 3MR5A 3RJGA 2LI6A 4EBDA 4IR1A 2G5HB 3L4PA 4LZDA 3RBEA 9ICCA 4QW8A 4Y2RA 4KLQA 3ZD9A 2WB1C 4I2FA 1ZETA 2R8IA 4UBCA 1TFRA 2ATLA 2R8KA 4R66A 1X9WA 2Q4TA 3NRZA 5DB9A 4GIBA 1Q46A 3Q8PB 4RPYA 1F44A 1JXLA 2HOIA 3JPPA 1TV9A 2DL0A 2Y1IA 2FPMA 4B9TA 4C7ZA 2O6KA 5DG7A 3EW9A 4UB4A 7ICOA 2ASLA 1BPDA 2KHQA 3OJSA 4Q8FA 4CNQA 5KFNA 8ICOA 2EAOA 4YN4A 3R9KA 1N63A 4J9MA 2DF4B 4QZHA 3U26A 3I76A 1U45A 3FYHA 2V9WA 7ICEA 8ICRA 4QZBA 1NK0A 4F4KA 2LBOA 1T4GA 5J2CA 9ICRA 5AI8A 5KFTA 2JEIA 4TUSA 3SI8A 4OJLA 5AK3A 2BPFA 3ISCA 2HDOA 5CR0A 3H8WA 2ZIUB 1S0MA 5EWEA 2E1FA 2NO4A 4DQQA 3KKAA 2W8KA 2W03A 1ZQWA 3MR2A 2WF7A 2FMSA 2DPIA 3EWAA 1SIJA 2K8CB 1ZQBA 1DRGA 3V6HA 1Q3VA 2P6RA 5HMMA 3JPNA 3BS7A 3BZCA 1N5WA 3EPIA 1L7NA 3SD7A 3AN1A 1ZQCA 4I2AA 4QZFA 4ECTA 3F53A 1BNOA 4YXJA 3CNHA 3AQFA 2B6GA 1XO0A 4US9A 2MUTA 1C7YA 4ECRA 4F72A 5F9NA 4MF2A 4KLOA 4XA5A 5AI4A 1KSPA 3MGVA 1Q3UA 3B0XA 3HP6A 4EEYA 2W7PA 5KFHA 3WK7A 2KHVA 5AKHA 5ALEA 8ICHA 5DBCA 4F92B 9ICHA 4P0QB 3RTVA 1SWVA 1ZJNA 5AKLA 9ICOA 5IIJA 2AGOA 3IDWA 4RQ3A 5J0TA 4PPXA 4Y2YA 3LVWA 4B9MA 1JXEA 1LVHA 2HI0A 2WFAA 3CW2C 1RDFA 1L6NA 5D49A 4I2DA 1F5SA 3C21A 3MR6A 5J2IA 4F2RA 4JB3A 1KEJA 2FPLA 3PR5B 1KL9A 2WB1F 3H0RB 3OSPA 5ALTA 2K4IA 3MBYA 3RR7A 5DB7A 4ZH4A 2Q0ZX 1N2XA 4US8A 1L8OA 4LZGA 2XIDA 3HKZF 7ICFA 5J2DA 9ICUA 4DO9A 2A3VA 2I9GA 4P0PA 2BCUA 4B9UA 4BWJA 1L5UA 3RBDA 3IHQB 2ZIXA 3AM9A 2AQ4A 4DQRA 3GV8B 2K8BB 4QZDA 1ZD3A 8ICIA 3T79A 2KEYA 2OH2A 2G08A 4OD0A 8ICUA 2HHTA 2B0CA 2H3ZA 1RM6C 9ICPA 2D6FC 3C2MA 1HUZA 8ICVA 5DQIA 1NK5A 3ZD8A 5AKGA 4CF4A 5GTIU 2XY7A 4Q8EA 2KP7A 7ICMA 5KFOA 4DFJA 5ALIA 2H3QA 4QZEA 4I27A 4DF4A 4ED6A 3SENA 1GO3F 4O3QA 5ALXA 3BQ1A 2M9NA 4ED2A 4I28A 3SYZA 5KG5A 1QQ5A 3C5FA 2E1EA 2KFNA 1RYSA 3PR4A 1FEZA 4P4PA 2ASDA 3BZKA 4MFCA 1X9XA 1ZQNA 2HBJA 8ICZA 2L5YA 2MAXA 5KFSA 2YQEA 2W7OA 4GXKA 2ZIWA 5ALJA 3PW0A 3TARA 2BHNA 1Z1VA 1SL1A 1ZQRA 1KKXA 2M0NA 5JU5A 4UBBA 3BDPA 1M6YA 5J0XA 4I2JA 3JPQA 3KTQA 4JWNA 3QNMA 1FFVA 2OYYA 4B9LA 3AQEA 3HT3A 3D2NA 4YP3A 9ICIA 3N7PD 4PZNA 4DOCA 4QWAA 2G09A 4O3OA 5ALHA 3K1ZA 3V7KA 3GDXA 2Y0SC 3WKCA 2BDPA 2PFNA 2LHTA 4NLBA 9ICKA 1V38A 5IIKA 4UAZA 3QU2A 4FZMA 1TAMA 4EYIB 3Q8MA 1MQ2A 2LM1A 3NVVA 4BDPA 5AI5A 7ICTA 4PGXA 5KFBA 3RJJA 1J97A 3PW4A 2NO5A 2HVHA 1U47A 4B9SA 3ISBA 2I5HA 5J2KA 4DL5A 3RB6A 4QWDA 5D46A 2ZJAA 1SWWA 5AM1A 1Z00A 4CE6A 3N28A 5ALFA 1MC8A 4Y2VA 2ZUDA 1UQVA 3S6JA 4IS7A 3T5LA 4GLXA 5BPCA 4O9MA 4NM1A 2PI4A 1JI7A 3PW7A 2ZJ5A 3SAGA 1UCVA 2GO7A 2NRZA 1B0XA 4KLLA 5CP2A 1JMSA 3UMGA 2YMQA 1PK3A 3OSNA 3UMBA 3TFSA 4UAVA 1TVAA 3V72A 1NK4A 1Z3EB 3NGDA 1U49A 3CP8A 1ZYQA 2JGAA 3ZDCA 5KT4A 3N97B 2EZZA 1IXRA 1ZQIA 3QUCA 8ICQA 1NZPA 1S10A 3NTUA 4F4YA 1ZQSA 1JIHA 1TAQA 2HHVA 2YMMA 2KJ8A 1SL2A 3UXNA 1C20A 3E0FA 4EZ6A 1WWUA 1QCKA 5G5GA 3O0FA 2UVRA 1KQQA 1KLNA 4TQSA 5AM5A 1N5XA 2XVTA 4B9VA 7ICGA 4ICAA 5KAFU 1SKWA 3WK4A 2DKXA 2H3VA 1SV4A 2F77X 4KTQA 2QB0A 2B21A 5EWFA 3HKZC 4ECXA 3F5AA 5KFWA 3K75D 3KHLA 3SMVA 4J9NA 1V9PA 5AK6A 4Y2XA 4QZ9A 5AICA 5KAIU 4M04A 5J0RA 1XO1A 5ALKA 3L5KA 5DQGA 2KZ3A 5HHIA 3H0MB 3KFUF 3E2EA 1B43A 1NK7A 3RRGA 2YN4A 2KK0A 4YR3A 3QUQA 3JPOA 2RHFA 4ZOHC 2PMZF 5ALNA 5KG4A 2ZXHA 5C5JA 2KG5A 4DSEA 2RQ5A 3HILA 2W9MA 2P35A 9ICWA 2HBLA 2JHDA 1XWLA 3T5KA 4CCHA 3C2KA 1BGXT 5KFZA 5ALVA 4OJ5A 1SZPA 1N61A 5AM0A 3H4DA 5AKIA 1T8EA 5E79U 2KV2A 1UA1A 4P0QA 3RB3A 1VLBA 5ALSA 3C28A 3OJUA 2V4QA 1PVQA 2OEHA 4RT3A 4FFDA 3M6KA 2ASJA 3SEIA 1X2IA 3OHBA 1ZJMA 8ICSA 2G06A 5AM2A 5DGBA 2KKPA 4RUAA 2P6UA 3FDSA 3WK9A 4NL9C 4RQ0A 2VIXA 2EZYA 3V7LA 4DSFA 3JPSA 1ZQYA 4F91B 3GIIA 5EE0A 2LYAA 2HW3A 5B66U 5AKEA 4CRXA 4NJ8A 4BWMA 3JPRA 2KZZA 3IG5A 2VKQA 2HOQA 4M9JA 4GFJA 2EQYA 2KSOA 4BUGA 4LJXA 3TAQA 4KLDA 1ECWA 2KJ9A 4GXJA 4DFDA 3THVA 3BS5B 9ICTA 2BPGA 4YVZA 1QLNA 2WTFA 3K4GA 8ICCA 3RH4A 1JALA 2PI5A 2RP5A 3NASA 4C8LA 1ZRMA 4PHEA 1BPZA 2MSNA 1COOA 4EZ9A 2K4HA 3TADA 1VDVA 2V4RA 3VC8A 1JUDA 4B6JA 4RQNA 9ICFA 4C8OA 8ICJA 4F5RA 5A0LA 4YR2A 2CPRA 4DWIA 1IIPA 3RR8A 4KX3A 5HP4A 1RQLA 3H7IA 4GC7A 3D2QA 2JEFA 5KFMA 4AYBC 1DGSA 5AI0A 4DL6A 1MSWD 1ZXIA 3HRDD 4UB8U 2NYVA 3DV9A 4F5PA 4U6PA 1RZTA 1TK5A 4Y2PA 5IIOA 5ALZA 4PL2A 1D8YA 1QSYA 2IOHA 5J0WA 4P0PB 1PUZA 5AKKA 4ECUA 1S8OA 4E0DA 5TISU 1XSNA 1TE2A 4R8UA 2FLLA 3TACB 4OCZA 1KFTA 5EE9A 1BPEA 4UB5A 4A8EA 2RDIA 3ZDBA 2W8LA 3UQ0A 4OO1J 2EAMA 1PVRA 4KLGA 3BQ2A 1HEKA 1RYRA 5KFXA 2XCPA 4F8RA 2UVWA 4JV1A 3MR3A 3JPTA 5L9XA 1SKSA 2KFZA 2G5IB 5IINA 2NRVA 4J9LA 4JMUA 4DQSA 3LWMA 2KSOB 4Y2TA 3KHRA 1QTMA 4QWBA 1SV0C 4F2SA 2F8LA 2ZIXB 2OWOA 4IR9A 1QQ6A 4GXIA 1RXWA 4CF3A 2QB0B 5EE1A 1TK0A 4BJQA 1NKBA 3QYPA 2BCVA 5DLFA 2AHOB 2AXTU 4EX7A 3ORYA 4UW9A 2HHWA 3PSTA 2YX8A 1L3UA 2ZIVA 1X40A 4F4ZA 1KDHA 5EE3A 2BR0A 5AK5A 1L7PA 5KT5A 4ED3A 5J0PA 2FLPA 3QEBZ 4DL4A 2G0AA 4C8NA 4R65A 4I2IA 5F9LA 1SXDA 5AK4A 7ICSA 4O3SA 3C5GA 3RJIA 1TKDA 3AMZA 3H4BA 1ZQVA 3FC4A 2W11A 5IILA 4RQ5A 2OCEA 2IHNA 5F3XB 3NRWA 4X5VA 3GIKA 5KFFA 3TI0A 2UVVA 3ETRA 2ZIWB 3B9JA 3C29A 2LPEA 5J2GA 1URJA 4IRCA 3PY8A 2PFOA 3LYSA 4KLSA 3CYMA 1FFUA 2ZIUA 3E58A 1U4BA 2HHUA 4R64A 4O3NA 2IOFK 3RJKA 1U48A 3GZFA 5KNIA 4I2EA 3PMNA 3UXOA 4EX6A 4C4RA 1RG6A 4IQTA 1O03A 1Z00B 1Z1BA 9ICQA 1ZQ1C 3H8SA 4YMMA 2FDRA 3KHGA 8ICFA 3UMCA 1SB3C 1OXJA 5AKJA 8ICPA 2HBKA 4C0ZA 1QSLA 3SR6A 3NVZA 4KITB 1B22A 4M6WA 5AIBA 4RNMA 2KE7A 5KT2A 3D6JA 9ICEA 2YB4A 3OPXA 2F8KA 1ZD2P 4NXZA 3EYZA 9ICMA 4IRDA 5K4LA 5DB8A 4CF5A 9ICBA 1BNPA 3ZI4A 4I2CA 3AUOA 2RRDA 4ELTA 5EOZA 5J8YC 2F76X 5KFPA 1WUDA 3MDCA 3QX7A 4DQPA 2KIWA 1OUQA 3PX0A 3QEAZ 2A19A 5J2FA 4NL9A 3BQTA 4DSJA 4I29A 5ALPA 7ICIA 4DLGA 1KFSA 4PL1A 4OJ6A 5DBBA 4YG2A 4PH5A 5J2HA 4BXOB 1UPHA 4ED1A 1XU4A 3OHAA 1QQ7A 5KFAA 2JZBA 1NJYA 9ICJA 5DLGA 1S77D 5J2EA 3G6VA 1QH9A 4QZIA 3F2CA 3RB4A 2BQRA 2F2AB 2W55A 5L1KA 1OW5A 1A0PA 3BQ7A 5IIMA 5IIIA 3SQIA 2E8PA 5AKZA 5J2JA 4RQ8A 2W04A 4DL3A 4O0IA 2BCRA 5AI9A 4Y2UA 3I28A 1KW4A 3EUB2 5CJ7A 5KG0A 2ISPA 2J6UA 1FO4A 4R63A 1IV8A 2UVUA 1NOMA 1KTQA 5AM4A 5KFGA 2XY6A 2LM4A 2ZTEA 1ED1A 1TAUA 2Y9TA 4PJ0U 3UQ2A 1HUOA 2MA1A 2KZMA 5CB1A 1S5LU 4JV2A 4RQ2A 5KFUA 4DL7A 4ECSA 2DWQA 1D9FA 4M9NA 5KFCA 2GOLA 2BGWA 2KTQA 1CI4A 4UAYA 4YD1A 2I1QA 4K4HA 4LVSA 3M9NB 3F2DA 1T7PA 3IP4B 4F50A 4KLJA 5DQHA 4OJOA 2WAQF 3J81j 4DS4A 1Z4NA 2JH7A 4MFFA 1SZHA 2XY5A 4M9GA 3ZDEA 2QB1A 3LK9A 1PVPA 3WKDA 4M0AA 3QU7A 4RPXA 1KRPA 4BGDA 1DK3A 5C0YA 5KFQA 4DF8A 1Q8KA 3QUTA 4FO6A 5H2FU 3N7RC 2KIVA 1ZQQA 3MDAA 1UT5A 5ALRA 7ICKA 2DPJA 1SKRA 1A76A 9ICLA 4NLCA 1A77A 7ICNA 8ICKA 3C2LA 1DK2A 2K60A 2XICA 2WAQC 4WJ3B 5JTIA 4P2HA 1LKYB 4EENA 4EBCA 3PV8A 2WF6A 4QZCA 2WF5A 3HPOA 5J0SA 3RH5A 1NK8A 4RUCA 4NLKA 2PFPA 4FZLA 1WWVA 3ED5A 4YD2A 4RQ4A 1VJ5A 5DGAA 2FLNA 5KFYA 3PNCA 1BVSA 7ICPA 5J0YA 2E5SA 1ZQKA 2C2RA 2XI9A 4ECWA 1D8BA 5HHHA 3T3FA 2R8JA 3Q8KA 2KJ5A 2OM6A 4PZOA 3V6JA 1JN3A 4KX5A 3MGIA 3TAPA 1LV5A 5KFRA 3SV4A 3RAQA 4Y2SA 2BQ3A 5CRXA 5BOLA 1YZ7A 4DSKA 1K1QA 4F5QA 2QARA 1F0MA 2PFQA 1O08A 1L7OA 4JUZA 4ED8A 4HYKA 2F3NA 4NV0A 1N56A 1NJWA 8ICYA 1ZQEA 2DUYA 4XQ8A 3RH6A 3V6KA 2H3IA 2HHXA 1LB2B 4O3MA 1SL0A 5JRTA 1X6JA 3TQ1A 4MEXA 4I2HA 1D9DA 2ALZA 2ZJ8A 4O5EA 4Q43A 2I6XA 5KT6A 1AQ6A 3IRUA 1DXSA 3BS5A 2JH1A 2DBYA 8ICMA 1NZBA 3ALRA 3A0BU 3T5HA 1P7DA 3BQ0A 4RQ6A 3TKAA 3HWTA 3SZ2A 3RFAA 4FS1A 3KZIU 1RQNA 4ELUA 4FBTA 1L8LA 4BX9C 3ISDA 1COKA 5ALYA 3MGHA 5J29A 2JEGA 2FPKA 1EXNA 1J2NA 4C8MA 9ICXA 4MEYA 3C1ZA 3PW5A 4M9LA 4QIWF 3RJEA 1XC9A 3PO5A 4JK1A 3KBBA 4B9NA 4UARA 4QNLA 1Y88A 5DKWA 5DG8A 3PSFA 4IC9A 5KFKA 3B0YA 8ICWA 4RZRA 2J6SA 5AKXA 1S76D 3NVYA 4ECVA 5DG9A 5KT3A 1WCNA 2IA6A 4I2BA 1ZQMA 1ZQGA 2K4EA 4TQRA 1X66A 4EBEA 5HNKA 2LMRA 1J2MA 3QU4A 3M8SA 1N62A 3UM9A 4ECZA 8ICNA 2KNJA 4RT2A 4UB2A 4RPZA 2MUTB 3V7JA 4F93B 4MFAA 3TADC 2K4PA 4YCXA 1XS9D 2NV3A 7ICLA 8ICLA 1S9FA 3KHHA 2BCQA 1RYUA 4F5OA 2VA2A 4NWIA 3NUQA 2JEJA 2HMXA 5ALDA 3WKEA 1NNLA 2R18A 2Y0SF 2R8HA 9ICGA 4U7CA 2F1IA 3GIMA 5AM3A 1ZQXA 5ALUA 2A1AA 3PX6A 5BOMA 2XGPA 1S97A 3UXPA 5J8YA 4DS5A 2GH1A 4PHDA 4RQMA 5J2BA 2ZXIA 2KVSA 1WG8A 3M7DA 3EZ5A 1MQ3A 4RQ1A 3H8MA 4IRKA 9ICSA 4Z6DA 2KKVA 5AI6A 4C7YA 4XRHA 2FI1A 1RXVA 1CUKA 5L1MA 8ICTA 1NK9A 5DDYA 4F5NA 3MABA 3A0HU 2GWSA 3GV5B 3EPGA 4QJFB 4RU9A 3CRXA 3I1YA 2W54A 5J2AA 1SV0A 2ZTCA 4XUSA 3WK8A 1WCLA 1NI3A 3WK5A 1JROA 4M6WB 2P66A 3PSPA 5ALQA 1XSLA 1QSSA 1AROP 5KG1A 1L3TA 2W3SA 3T5JA 2W9CB 2OXOA 3AL0B 5KFIA 1NKEA 2EZXA 3IM1A 4F71A 4DEZA 2AGQA 4NLNA 4KN7A 4I2GA 2KVCA 2LYHA 3C1YA 1S0VA 3RAXA 2RLTA 4Y2QA 9ICAA 3AU2A 2DKZA 3H0LB 4Q45A 2NRXA 4KN4A 2WF9A 5DBAA 2BKEA 4PGYA 2KD1A 3TANA 4Z6EA 3C23A 4G9BA 4M47A 4CDGA 1IM4A 4J9RA 5FP0A 3ZDAA 7ICHA 3LWLA 1T3NA 4UAUA 2ODGA 5KFEA 1V85A 4QIWC 1UA0A 3PO4A 2VJ5A 3PVXA 2VANA 4FS2A 4QZ8A 3FM9A 5KFDA 2W43A 2WHEA 1IG6A 2PMZC 2VA3A 2D3DA 1X42A 2YTUA 4AYBF 4DOBA 2D8CA 1X9MA 5GTHU 2RDJA 5JUMA 5L1LA 2E3TA 2DQNB 2WF8A 2IMWP 2W9CA 1MA7A 5ALLA 4YFKA 2A1JA 2W9BB 7ICRA 4YMOA 5KL8B 4M2YA 1NK6A 1ZQFA 1FIQA 5J0QA 1NKCA 3ZDDA 2XGQA 3GIJA 4J9SA 4DLEA 1PZNA 3GV7B 3M9MB 4FBUA 3N4MB 2W3RA 2GLEA 2NRTA 1TK8A 3PZPA 1S0OA 5AKYA 4FZNA 2EDUA 4ACOA 4C80A 4IQVA 2MRLA 2ZIVB 2HHSA 2W9BA 2A1JB 4IL6U 4P4MA 3WKBA 2E8NA 5CEHA 1JX4A 8ICGA 1L3SA 4UB1A 4J9KA 4KMUA 3SV3A 2JMGA 1V97A 4DQIA 4TUQA 4KLEA 4KLIA 4HAIA 4FE3A 3MC1A 5KFJA 4Z6CA 1KFDA 3ONNA 2YMPA 5KFVA 3Q8SB 3Q8RB 4K4GA 1YZ6A 3L3FX 4ECYA 5HMLA 4ECQA 4QZGA 4UB3A 3GILA 4RQ7A 1RPLA 1HIWA 5KG7A 1N60A 1U9LA 4UQGA 3AU6A 2FMPA 5J0UA 2EAPA 1CRXA 5HR7A 2HBMA 4RNNA 2BPCA 2YY6A 4NLGA 3LDAA 5KG3A 4DL2A 2F1JA 1X6IA 2E8OA 3PSIA 4J9OA 2Z7JA 2ZG6A 2F1HA 2JRZA 3HX0A 2BCSA 2KICA 3QXGA 5L1JA 4QW9A 2BDUA 3PW2A 1CEZA 4ELVA 4KLHA 3IG8A 2EANA 4DSLA 3IV6A 1KBUA 4YMNA 1S0NA 4KLMA 8ICBA 5G5HA 5ALMA 2CRXA 1BPYA 2N1RA 3D2SA 5CHGA 3NVWA 3KD3A 5CA7A 9ICNA 1ZD4A 2W9AA 2ESEA 2C2EA 1NJXA 4KLUA 4KLTA 2C22A 5KT7A 1ZQPA 4DSIA 8ICEA 2AH5A 4O5CA 2C2DA 2BQUA 1ZQLA 7ICQA 4F4XA 4EEKA 5DB6A 3MFIA 3H8JA 3M6ZA 4PGQA 2MU2A 2XCAA 4P4OA 1Z4OA 2XO7A 2IBKA 5ALWA 1SXEA 5EWGA 2C28A 4RNOA 5ALGA 4ED7A 5T14A 1ZQTA 5AHXA 4C4SA 4MF8A 1YT3A 1ZQUA 4O3PA 4GC6A 3ICXA 4YXMA 3LVVA 4ED0A 7ICJA 5AIAA 2PKEA 4KMOB 4NY8A 4TUPA 2NRWA 1L3VA 3HW8A 2IHMA 3Q8LA 3WKAA 4G3IA 5HR6A 1ZQZA 1KN5A 2BZFA 5KFLA 1ZQHA 1WYGA 4PHAA 5B5EU 2Y9UA 2R8GA 1ZQDA
chains in the Genus database with same CATH topology
3F5AA 1P7DA 3K1ZA 1PVRA 3M7DA 4OO1J 2PMZC 1UPHA 2ZIWB 2XICA 3F53A 3IG5A 3SMVA 1Z19A 2K89A 2HOQA 2VKQA 2Y0SC 3RFAA 3C29A 2G07A 1HEKA 2H3ZA 4GFJA 1URJA 2WAQC 4AYBF 2LHTA 3AQFA 4BUGA 4NLBA 4WJ3B 5HR7A 2D6FC 1XO0A 4BX9C 2Q4TA 1ECWA 2HBMA 3LYSA 4FZMA 1T94A 1TAMA 2KKVA 2KJ9A 2VJ4A 3SAFA 3CYMA 3F2CA 2ZIUA 2DQNB 2F2AB 3MGVA 1F44A 3DEEA 2G5IB 1A0PA 4OJPA 1Q3UA 3GZFA 3PSIA 3H0MB 2Z7JA 2ZG6A 1MA7A 2HOIA 3SQIA 3KFUF 2KICA 4FZLA 2W7PA 2RP5A 4JMUA 3RF9A 5KL8B 2BDUA 2W04A 4QJFB 2KHVA 4QIWF 2H3QA 3CRXA 1Z1BA 3IG8A 1ZQ1C 1GO3F 2K4HA 2RHFA 4P0QB 2F8LA 4QNLA 2ZIXB 1KBUA 2PMZF 2E5SA 2KHQA 5KL1B 2CRXA 3PSFA 4IC9A 2N1RA 3VC8A 1A6SA 2XI9A 2ZXHA 3D2SA 2LKYA 1D8BA 2HBKA 2LYBA 3N7SC 4C0ZA 2E1EA 3PSPA 2KJ5A 3SAGA 2OM6A 3KZXA 1ED1A 2DF4B 5A0LA 2HBLA 2JHDA 4BJQA 2CPRA 4KX5A 2MA1A 3PZPA 4FZNA 2OXOA 4ACOA 3AL0B 2YB1A 3LVWA 2CN1A 1IIPA 2YB4A 3IN5A 4KX3A 2K4EA 2MRLA 2ZIVB 2K8AA 3OPXA 4OJ5A 5CRXA 2GOLA 1L6NA 2LBOA 3D2QA 3VCBA 3PSTA 2YX8A 2KVCA 2KV2A 3M6ZA 2ZIVA 4AYBC 2KOBA 2HBJA 2HOFA 4P0QA 3F2DA 3IP4B 3CP8A 4OJLA 3C28A 2JGAA 2KNJA 3F5EA 1PVQA 4NV0A 2RRDA 2WB1F 2WAQF 4OJOA 2H3FA 3H0RB 3M6KA 4U6PA 2ZIUB 2W7OA 3H0LB 2JMGA 2K4IA 2JH7A 2ZIWA 1CRXA 2E1FA 2NV3A 3GU3A 4CGZA 2F76X 4PL2A 1SZHA 1WUDA 2G0AA 2XIDA 2KD1A 3HKZF 5T14A 4NWIA 3NUQA 2W03A 2M0NA 1YT3A 4P0PB 2G06A 2H3IA 2HMXA 2KIWA 2KKPA 1PVPA 4O3MA 2KJ8A 1XNSA 1OUQA 2R18A 2Y0SF 2A3VA 3ICXA 4P0PA 3E0FA 4FE3A 4U7CA 3LVVA 4CDGA 5C0YA 3O0FA 2VIXA 2XVTA 3ONNA 4KMOB 2DGZA 2K8CB 4ICAA 1DRGA 2OYYA 1Q3VA 3N7RC 2ZIXA 2G5HB 3SAHA 3AQEA 4QIWC 2H3VA 4PL1A 3D2NA 3L3FX 4A8EA 5HR6A 2VJ5A 2F77X 4OJ6A 2LYAA 2JH1A 2K8BB 2GH1A 3N7PD 4CRXA 3T79A 3NRWA 2KEYA 3HKZC 1NZBA 3ALRA 2G09A 2OH2A 4NLCA 2G08A 1HIWA 2WB1C 2ZXIA 3F2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ALR A;  5KL8 B;  5KL1 B; 
#chains in the Genus database with same CATH topology
 1B4F A;  1L7M A;  5ALO A;  4YQW A;  4DFK A;  2G07 A;  3H40 A;  2Y1J A;  4BXO A;  2ZUC A;  3GQC A;  3PML A;  2ES6 A;  5D4B A;  3QU9 A;  2JZB B;  1BPX A;  3DEE A;  4OJP A;  4PHP A;  3WK6 A;  4J9P A;  2E8M A;  3RF9 A;  2EH9 A;  2ZUB A;  4JWM A;  1PK1 A;  4F4W A;  1N48 A;  2QKQ A;  3M8R A;  4AP9 A;  5KL1 B;  4UB6 U;  5KTQ A;  2LYB A;  4UAS A;  2AU0 A;  4M9H A;  1UT8 A;  7ICV A;  2CN1 A;  4QWC A;  2K8A A;  4Y2J A;  2XC9 A;  3VCB A;  3PX4 A;  1BPB A;  2KOB A;  2JV3 A;  1XSP A;  4JV0 A;  2F44 A;  2H3F A;  1X9S A;  4YR0 A;  1ZQJ A;  3G6X A;  3UPQ A;  1K5O A;  4UAW A;  4QWE A;  2J6T A;  3RRH A;  4IQW A;  1DOQ A;  4TUR A;  3QUB A;  2QLT A;  2KN7 A;  1ZRN A;  3QZ8 A;  4DCC A;  1XNS A;  4F3O A;  4DFP A;  1JRP A;  3AEV A;  2DGZ A;  2JXJ A;  3QE9 Y;  2YML A;  1ZQA A;  4USA A;  3OGU A;  3SAH A;  5TZV A;  3GFK B;  3M1Y A;  3RJF A;  1PK1 B;  3F2B A;  1HJP A;  4MHV A;  2OHF A;  1Z19 A;  2K89 A;  3K1R B;  3ETL A;  3RJH A;  4NLZ A;  1T94 A;  2VJ4 A;  3BJY A;  4O3R A;  3SAF A;  3MFH A;  2HSZ A;  5KG2 A;  2HCF A;  4EYH B;  5DDM A;  1LKY A;  1D8L A;  1UHU A;  2AQ0 A;  1T3Q A;  4J03 A;  3G6Y A;  3WU2 U;  3NS1 A;  4Q44 A;  2FE9 A;  2PXI A;  3FAH A;  2JR5 A;  9ICV A;  1K1S A;  2AGP A;  2FJ6 A;  3KKA C;  1A6S A;  2LKY A;  1ZOL A;  3N7S C;  4NM2 A;  8ICA A;  4EEL A;  3OTQ A;  4C8K A;  3KZX A;  4DFM A;  3DDH A;  4K4I A;  2YB1 A;  4Z6F A;  3Q8Q B;  4UAT A;  3IN5 A;  2H5X A;  2IOF A;  4KLF A;  2DFL A;  1MN8 A;  1NJZ A;  3TFR A;  2HOF A;  7ICU A;  3HJE A;  3F5E A;  4C4T A;  3RB0 A;  4QZA A;  3M9O B;  2VA8 A;  2QAR B;  2AJQ A;  4J9Q A;  8ICX A;  3KOO A;  2KMD A;  3GU3 A;  5KG6 A;  4CGZ A;  3QZ7 A;  3QU5 A;  4R8U B;  2HVI A;  4O5K A;  4IQU A;  1H38 A;  1DGJ A;  1SGG A;  1ZD5 A;  4DOA A;  2FMQ A;  5L1I A;  2ZTD A;  2CXY A;  1ZQO A;  2HHQ A;  2ISO A;  5J0O A;  5CWR A;  3MR5 A;  3RJG A;  2LI6 A;  4EBD A;  4IR1 A;  2G5H B;  3L4P A;  4LZD A;  3RBE A;  9ICC A;  4QW8 A;  4Y2R A;  4KLQ A;  3ZD9 A;  2WB1 C;  4I2F A;  1ZET A;  2R8I A;  4UBC A;  1TFR A;  2ATL A;  2R8K A;  4R66 A;  1X9W A;  2Q4T A;  3NRZ A;  5DB9 A;  4GIB A;  1Q46 A;  3Q8P B;  4RPY A;  1F44 A;  1JXL A;  2HOI A;  3JPP A;  1TV9 A;  2DL0 A;  2Y1I A;  2FPM A;  4B9T A;  4C7Z A;  2O6K A;  5DG7 A;  3EW9 A;  4UB4 A;  7ICO A;  2ASL A;  1BPD A;  2KHQ A;  3OJS A;  4Q8F A;  4CNQ A;  5KFN A;  8ICO A;  2EAO A;  4YN4 A;  3R9K A;  1N63 A;  4J9M A;  2DF4 B;  4QZH A;  3U26 A;  3I76 A;  1U45 A;  3FYH A;  2V9W A;  7ICE A;  8ICR A;  4QZB A;  1NK0 A;  4F4K A;  2LBO A;  1T4G A;  5J2C A;  9ICR A;  5AI8 A;  5KFT A;  2JEI A;  4TUS A;  3SI8 A;  4OJL A;  5AK3 A;  2BPF A;  3ISC A;  2HDO A;  5CR0 A;  3H8W A;  2ZIU B;  1S0M A;  5EWE A;  2E1F A;  2NO4 A;  4DQQ A;  3KKA A;  2W8K A;  2W03 A;  1ZQW A;  3MR2 A;  2WF7 A;  2FMS A;  2DPI A;  3EWA A;  1SIJ A;  2K8C B;  1ZQB A;  1DRG A;  3V6H A;  1Q3V A;  2P6R A;  5HMM A;  3JPN A;  3BS7 A;  3BZC A;  1N5W A;  3EPI A;  1L7N A;  3SD7 A;  3AN1 A;  1ZQC A;  4I2A A;  4QZF A;  4ECT A;  3F53 A;  1BNO A;  4YXJ A;  3CNH A;  3AQF A;  2B6G A;  1XO0 A;  4US9 A;  2MUT A;  1C7Y A;  4ECR A;  4F72 A;  5F9N A;  4MF2 A;  4KLO A;  4XA5 A;  5AI4 A;  1KSP A;  3MGV A;  1Q3U A;  3B0X A;  3HP6 A;  4EEY A;  2W7P A;  5KFH A;  3WK7 A;  2KHV A;  5AKH A;  5ALE A;  8ICH A;  5DBC A;  4F92 B;  9ICH A;  4P0Q B;  3RTV A;  1SWV A;  1ZJN A;  5AKL A;  9ICO A;  5IIJ A;  2AGO A;  3IDW A;  4RQ3 A;  5J0T A;  4PPX A;  4Y2Y A;  3LVW A;  4B9M A;  1JXE A;  1LVH A;  2HI0 A;  2WFA A;  3CW2 C;  1RDF A;  1L6N A;  5D49 A;  4I2D A;  1F5S A;  3C21 A;  3MR6 A;  5J2I A;  4F2R A;  4JB3 A;  1KEJ A;  2FPL A;  3PR5 B;  1KL9 A;  2WB1 F;  3H0R B;  3OSP A;  5ALT A;  2K4I A;  3MBY A;  3RR7 A;  5DB7 A;  4ZH4 A;  2Q0Z X;  1N2X A;  4US8 A;  1L8O A;  4LZG A;  2XID A;  3HKZ F;  7ICF A;  5J2D A;  9ICU A;  4DO9 A;  2A3V A;  2I9G A;  4P0P A;  2BCU A;  4B9U A;  4BWJ A;  1L5U A;  3RBD A;  3IHQ B;  2ZIX A;  3AM9 A;  2AQ4 A;  4DQR A;  3GV8 B;  2K8B B;  4QZD A;  1ZD3 A;  8ICI A;  3T79 A;  2KEY A;  2OH2 A;  2G08 A;  4OD0 A;  8ICU A;  2HHT A;  2B0C A;  2H3Z A;  1RM6 C;  9ICP A;  2D6F C;  3C2M A;  1HUZ A;  8ICV A;  5DQI A;  1NK5 A;  3ZD8 A;  5AKG A;  4CF4 A;  5GTI U;  2XY7 A;  4Q8E A;  2KP7 A;  7ICM A;  5KFO A;  4DFJ A;  5ALI A;  2H3Q A;  4QZE A;  4I27 A;  4DF4 A;  4ED6 A;  3SEN A;  1GO3 F;  4O3Q A;  5ALX A;  3BQ1 A;  2M9N A;  4ED2 A;  4I28 A;  3SYZ A;  5KG5 A;  1QQ5 A;  3C5F A;  2E1E A;  2KFN A;  1RYS A;  3PR4 A;  1FEZ A;  4P4P A;  2ASD A;  3BZK A;  4MFC A;  1X9X A;  1ZQN A;  2HBJ A;  8ICZ A;  2L5Y A;  2MAX A;  5KFS A;  2YQE A;  2W7O A;  4GXK A;  2ZIW A;  5ALJ A;  3PW0 A;  3TAR A;  2BHN A;  1Z1V A;  1SL1 A;  1ZQR A;  1KKX A;  2M0N A;  5JU5 A;  4UBB A;  3BDP A;  1M6Y A;  5J0X A;  4I2J A;  3JPQ A;  3KTQ A;  4JWN A;  3QNM A;  1FFV A;  2OYY A;  4B9L A;  3AQE A;  3HT3 A;  3D2N A;  4YP3 A;  9ICI A;  3N7P D;  4PZN A;  4DOC A;  4QWA A;  2G09 A;  4O3O A;  5ALH A;  3K1Z A;  3V7K A;  3GDX A;  2Y0S C;  3WKC A;  2BDP A;  2PFN A;  2LHT A;  4NLB A;  9ICK A;  1V38 A;  5IIK A;  4UAZ A;  3QU2 A;  4FZM A;  1TAM A;  4EYI B;  3Q8M A;  1MQ2 A;  2LM1 A;  3NVV A;  4BDP A;  5AI5 A;  7ICT A;  4PGX A;  5KFB A;  3RJJ A;  1J97 A;  3PW4 A;  2NO5 A;  2HVH A;  1U47 A;  4B9S A;  3ISB A;  2I5H A;  5J2K A;  4DL5 A;  3RB6 A;  4QWD A;  5D46 A;  2ZJA A;  1SWW A;  5AM1 A;  1Z00 A;  4CE6 A;  3N28 A;  5ALF A;  1MC8 A;  4Y2V A;  2ZUD A;  1UQV A;  3S6J A;  4IS7 A;  3T5L A;  4GLX A;  5BPC A;  4O9M A;  4NM1 A;  2PI4 A;  1JI7 A;  3PW7 A;  2ZJ5 A;  3SAG A;  1UCV A;  2GO7 A;  2NRZ A;  1B0X A;  4KLL A;  5CP2 A;  1JMS A;  3UMG A;  2YMQ A;  1PK3 A;  3OSN A;  3UMB A;  3TFS A;  4UAV A;  1TVA A;  3V72 A;  1NK4 A;  1Z3E B;  3NGD A;  1U49 A;  3CP8 A;  1ZYQ A;  2JGA A;  3ZDC A;  5KT4 A;  3N97 B;  2EZZ A;  1IXR A;  1ZQI A;  3QUC A;  8ICQ A;  1NZP A;  1S10 A;  3NTU A;  4F4Y A;  1ZQS A;  1JIH A;  1TAQ A;  2HHV A;  2YMM A;  2KJ8 A;  1SL2 A;  3UXN A;  1C20 A;  3E0F A;  4EZ6 A;  1WWU A;  1QCK A;  5G5G A;  3O0F A;  2UVR A;  1KQQ A;  1KLN A;  4TQS A;  5AM5 A;  1N5X A;  2XVT A;  4B9V A;  7ICG A;  4ICA A;  5KAF U;  1SKW A;  3WK4 A;  2DKX A;  2H3V A;  1SV4 A;  2F77 X;  4KTQ A;  2QB0 A;  2B21 A;  5EWF A;  3HKZ C;  4ECX A;  3F5A A;  5KFW A;  3K75 D;  3KHL A;  3SMV A;  4J9N A;  1V9P A;  5AK6 A;  4Y2X A;  4QZ9 A;  5AIC A;  5KAI U;  4M04 A;  5J0R A;  1XO1 A;  5ALK A;  3L5K A;  5DQG A;  2KZ3 A;  5HHI A;  3H0M B;  3KFU F;  3E2E A;  1B43 A;  1NK7 A;  3RRG A;  2YN4 A;  2KK0 A;  4YR3 A;  3QUQ A;  3JPO A;  2RHF A;  4ZOH C;  2PMZ F;  5ALN A;  5KG4 A;  2ZXH A;  5C5J A;  2KG5 A;  4DSE A;  2RQ5 A;  3HIL A;  2W9M A;  2P35 A;  9ICW A;  2HBL A;  2JHD A;  1XWL A;  3T5K A;  4CCH A;  3C2K A;  1BGX T;  5KFZ A;  5ALV A;  4OJ5 A;  1SZP A;  1N61 A;  5AM0 A;  3H4D A;  5AKI A;  1T8E A;  5E79 U;  2KV2 A;  1UA1 A;  4P0Q A;  3RB3 A;  1VLB A;  5ALS A;  3C28 A;  3OJU A;  2V4Q A;  1PVQ A;  2OEH A;  4RT3 A;  4FFD A;  3M6K A;  2ASJ A;  3SEI A;  1X2I A;  3OHB A;  1ZJM A;  8ICS A;  2G06 A;  5AM2 A;  5DGB A;  2KKP A;  4RUA A;  2P6U A;  3FDS A;  3WK9 A;  4NL9 C;  4RQ0 A;  2VIX A;  2EZY A;  3V7L A;  4DSF A;  3JPS A;  1ZQY A;  4F91 B;  3GII A;  5EE0 A;  2LYA A;  2HW3 A;  5B66 U;  5AKE A;  4CRX A;  4NJ8 A;  4BWM A;  3JPR A;  2KZZ A;  3IG5 A;  2VKQ A;  2HOQ A;  4M9J A;  4GFJ A;  2EQY A;  2KSO A;  4BUG A;  4LJX A;  3TAQ A;  4KLD A;  1ECW A;  2KJ9 A;  4GXJ A;  4DFD A;  3THV A;  3BS5 B;  9ICT A;  2BPG A;  4YVZ A;  1QLN A;  2WTF A;  3K4G A;  8ICC A;  3RH4 A;  1JAL A;  2PI5 A;  2RP5 A;  3NAS A;  4C8L A;  1ZRM A;  4PHE A;  1BPZ A;  2MSN A;  1COO A;  4EZ9 A;  2K4H A;  3TAD A;  1VDV A;  2V4R A;  3VC8 A;  1JUD A;  4B6J A;  4RQN A;  9ICF A;  4C8O A;  8ICJ A;  4F5R A;  5A0L A;  4YR2 A;  2CPR A;  4DWI A;  1IIP A;  3RR8 A;  4KX3 A;  5HP4 A;  1RQL A;  3H7I A;  4GC7 A;  3D2Q A;  2JEF A;  5KFM A;  4AYB C;  1DGS A;  5AI0 A;  4DL6 A;  1MSW D;  1ZXI A;  3HRD D;  4UB8 U;  2NYV A;  3DV9 A;  4F5P A;  4U6P A;  1RZT A;  1TK5 A;  4Y2P A;  5IIO A;  5ALZ A;  4PL2 A;  1D8Y A;  1QSY A;  2IOH A;  5J0W A;  4P0P B;  1PUZ A;  5AKK A;  4ECU A;  1S8O A;  4E0D A;  5TIS U;  1XSN A;  1TE2 A;  4R8U A;  2FLL A;  3TAC B;  4OCZ A;  1KFT A;  5EE9 A;  1BPE A;  4UB5 A;  4A8E A;  2RDI A;  3ZDB A;  2W8L A;  3UQ0 A;  4OO1 J;  2EAM A;  1PVR A;  4KLG A;  3BQ2 A;  1HEK A;  1RYR A;  5KFX A;  2XCP A;  4F8R A;  2UVW A;  4JV1 A;  3MR3 A;  3JPT A;  5L9X A;  1SKS A;  2KFZ A;  2G5I B;  5IIN A;  2NRV A;  4J9L A;  4JMU A;  4DQS A;  3LWM A;  2KSO B;  4Y2T A;  3KHR A;  1QTM A;  4QWB A;  1SV0 C;  4F2S A;  2F8L A;  2ZIX B;  2OWO A;  4IR9 A;  1QQ6 A;  4GXI A;  1RXW A;  4CF3 A;  2QB0 B;  5EE1 A;  1TK0 A;  4BJQ A;  1NKB A;  3QYP A;  2BCV A;  5DLF A;  2AHO B;  2AXT U;  4EX7 A;  3ORY A;  4UW9 A;  2HHW A;  3PST A;  2YX8 A;  1L3U A;  2ZIV A;  1X40 A;  4F4Z A;  1KDH A;  5EE3 A;  2BR0 A;  5AK5 A;  1L7P A;  5KT5 A;  4ED3 A;  5J0P A;  2FLP A;  3QEB Z;  4DL4 A;  2G0A A;  4C8N A;  4R65 A;  4I2I A;  5F9L A;  1SXD A;  5AK4 A;  7ICS A;  4O3S A;  3C5G A;  3RJI A;  1TKD A;  3AMZ A;  3H4B A;  1ZQV A;  3FC4 A;  2W11 A;  5IIL A;  4RQ5 A;  2OCE A;  2IHN A;  5F3X B;  3NRW A;  4X5V A;  3GIK A;  5KFF A;  3TI0 A;  2UVV A;  3ETR A;  2ZIW B;  3B9J A;  3C29 A;  2LPE A;  5J2G A;  1URJ A;  4IRC A;  3PY8 A;  2PFO A;  3LYS A;  4KLS A;  3CYM A;  1FFU A;  2ZIU A;  3E58 A;  1U4B A;  2HHU A;  4R64 A;  4O3N A;  2IOF K;  3RJK A;  1U48 A;  3GZF A;  5KNI A;  4I2E A;  3PMN A;  3UXO A;  4EX6 A;  4C4R A;  1RG6 A;  4IQT A;  1O03 A;  1Z00 B;  1Z1B A;  9ICQ A;  1ZQ1 C;  3H8S A;  4YMM A;  2FDR A;  3KHG A;  8ICF A;  3UMC A;  1SB3 C;  1OXJ A;  5AKJ A;  8ICP A;  2HBK A;  4C0Z A;  1QSL A;  3SR6 A;  3NVZ A;  4KIT B;  1B22 A;  4M6W A;  5AIB A;  4RNM A;  2KE7 A;  5KT2 A;  3D6J A;  9ICE A;  2YB4 A;  3OPX A;  2F8K A;  1ZD2 P;  4NXZ A;  3EYZ A;  9ICM A;  4IRD A;  5K4L A;  5DB8 A;  4CF5 A;  9ICB A;  1BNP A;  3ZI4 A;  4I2C A;  3AUO A;  2RRD A;  4ELT A;  5EOZ A;  5J8Y C;  2F76 X;  5KFP A;  1WUD A;  3MDC A;  3QX7 A;  4DQP A;  2KIW A;  1OUQ A;  3PX0 A;  3QEA Z;  2A19 A;  5J2F A;  4NL9 A;  3BQT A;  4DSJ A;  4I29 A;  5ALP A;  7ICI A;  4DLG A;  1KFS A;  4PL1 A;  4OJ6 A;  5DBB A;  4YG2 A;  4PH5 A;  5J2H A;  4BXO B;  1UPH A;  4ED1 A;  1XU4 A;  3OHA A;  1QQ7 A;  5KFA A;  2JZB A;  1NJY A;  9ICJ A;  5DLG A;  1S77 D;  5J2E A;  3G6V A;  1QH9 A;  4QZI A;  3F2C A;  3RB4 A;  2BQR A;  2F2A B;  2W55 A;  5L1K A;  1OW5 A;  1A0P A;  3BQ7 A;  5IIM A;  5III A;  3SQI A;  2E8P A;  5AKZ A;  5J2J A;  4RQ8 A;  2W04 A;  4DL3 A;  4O0I A;  2BCR A;  5AI9 A;  4Y2U A;  3I28 A;  1KW4 A;  3EUB 2;  5CJ7 A;  5KG0 A;  2ISP A;  2J6U A;  1FO4 A;  4R63 A;  1IV8 A;  2UVU A;  1NOM A;  1KTQ A;  5AM4 A;  5KFG A;  2XY6 A;  2LM4 A;  2ZTE A;  1ED1 A;  1TAU A;  2Y9T A;  4PJ0 U;  3UQ2 A;  1HUO A;  2MA1 A;  2KZM A;  5CB1 A;  1S5L U;  4JV2 A;  4RQ2 A;  5KFU A;  4DL7 A;  4ECS A;  2DWQ A;  1D9F A;  4M9N A;  5KFC A;  2GOL A;  2BGW A;  2KTQ A;  1CI4 A;  4UAY A;  4YD1 A;  2I1Q A;  4K4H A;  4LVS A;  3M9N B;  3F2D A;  1T7P A;  3IP4 B;  4F50 A;  4KLJ A;  5DQH A;  4OJO A;  2WAQ F;  3J81 j;  4DS4 A;  1Z4N A;  2JH7 A;  4MFF A;  1SZH A;  2XY5 A;  4M9G A;  3ZDE A;  2QB1 A;  3LK9 A;  1PVP A;  3WKD A;  4M0A A;  3QU7 A;  4RPX A;  1KRP A;  4BGD A;  1DK3 A;  5C0Y A;  5KFQ A;  4DF8 A;  1Q8K A;  3QUT A;  4FO6 A;  5H2F U;  3N7R C;  2KIV A;  1ZQQ A;  3MDA A;  1UT5 A;  5ALR A;  7ICK A;  2DPJ A;  1SKR A;  1A76 A;  9ICL A;  4NLC A;  1A77 A;  7ICN A;  8ICK A;  3C2L A;  1DK2 A;  2K60 A;  2XIC A;  2WAQ C;  4WJ3 B;  5JTI A;  4P2H A;  1LKY B;  4EEN A;  4EBC A;  3PV8 A;  2WF6 A;  4QZC A;  2WF5 A;  3HPO A;  5J0S A;  3RH5 A;  1NK8 A;  4RUC A;  4NLK A;  2PFP A;  4FZL A;  1WWV A;  3ED5 A;  4YD2 A;  4RQ4 A;  1VJ5 A;  5DGA A;  2FLN A;  5KFY A;  3PNC A;  1BVS A;  7ICP A;  5J0Y A;  2E5S A;  1ZQK A;  2C2R A;  2XI9 A;  4ECW A;  1D8B A;  5HHH A;  3T3F A;  2R8J A;  3Q8K A;  2KJ5 A;  2OM6 A;  4PZO A;  3V6J A;  1JN3 A;  4KX5 A;  3MGI A;  3TAP A;  1LV5 A;  5KFR A;  3SV4 A;  3RAQ A;  4Y2S A;  2BQ3 A;  5CRX A;  5BOL A;  1YZ7 A;  4DSK A;  1K1Q A;  4F5Q A;  2QAR A;  1F0M A;  2PFQ A;  1O08 A;  1L7O A;  4JUZ A;  4ED8 A;  4HYK A;  2F3N A;  4NV0 A;  1N56 A;  1NJW A;  8ICY A;  1ZQE A;  2DUY A;  4XQ8 A;  3RH6 A;  3V6K A;  2H3I A;  2HHX A;  1LB2 B;  4O3M A;  1SL0 A;  5JRT A;  1X6J A;  3TQ1 A;  4MEX A;  4I2H A;  1D9D A;  2ALZ A;  2ZJ8 A;  4O5E A;  4Q43 A;  2I6X A;  5KT6 A;  1AQ6 A;  3IRU A;  1DXS A;  3BS5 A;  2JH1 A;  2DBY A;  8ICM A;  1NZB A;  3ALR A;  3A0B U;  3T5H A;  1P7D A;  3BQ0 A;  4RQ6 A;  3TKA A;  3HWT A;  3SZ2 A;  3RFA A;  4FS1 A;  3KZI U;  1RQN A;  4ELU A;  4FBT A;  1L8L A;  4BX9 C;  3ISD A;  1COK A;  5ALY A;  3MGH A;  5J29 A;  2JEG A;  2FPK A;  1EXN A;  1J2N A;  4C8M A;  9ICX A;  4MEY A;  3C1Z A;  3PW5 A;  4M9L A;  4QIW F;  3RJE A;  1XC9 A;  3PO5 A;  4JK1 A;  3KBB A;  4B9N A;  4UAR A;  4QNL A;  1Y88 A;  5DKW A;  5DG8 A;  3PSF A;  4IC9 A;  5KFK A;  3B0Y A;  8ICW A;  4RZR A;  2J6S A;  5AKX A;  1S76 D;  3NVY A;  4ECV A;  5DG9 A;  5KT3 A;  1WCN A;  2IA6 A;  4I2B A;  1ZQM A;  1ZQG A;  2K4E A;  4TQR A;  1X66 A;  4EBE A;  5HNK A;  2LMR A;  1J2M A;  3QU4 A;  3M8S A;  1N62 A;  3UM9 A;  4ECZ A;  8ICN A;  2KNJ A;  4RT2 A;  4UB2 A;  4RPZ A;  2MUT B;  3V7J A;  4F93 B;  4MFA A;  3TAD C;  2K4P A;  4YCX A;  1XS9 D;  2NV3 A;  7ICL A;  8ICL A;  1S9F A;  3KHH A;  2BCQ A;  1RYU A;  4F5O A;  2VA2 A;  4NWI A;  3NUQ A;  2JEJ A;  2HMX A;  5ALD A;  3WKE A;  1NNL A;  2R18 A;  2Y0S F;  2R8H A;  9ICG A;  4U7C A;  2F1I A;  3GIM A;  5AM3 A;  1ZQX A;  5ALU A;  2A1A A;  3PX6 A;  5BOM A;  2XGP A;  1S97 A;  3UXP A;  5J8Y A;  4DS5 A;  2GH1 A;  4PHD A;  4RQM A;  5J2B A;  2ZXI A;  2KVS A;  1WG8 A;  3M7D A;  3EZ5 A;  1MQ3 A;  4RQ1 A;  3H8M A;  4IRK A;  9ICS A;  4Z6D A;  2KKV A;  5AI6 A;  4C7Y A;  4XRH A;  2FI1 A;  1RXV A;  1CUK A;  5L1M A;  8ICT A;  1NK9 A;  5DDY A;  4F5N A;  3MAB A;  3A0H U;  2GWS A;  3GV5 B;  3EPG A;  4QJF B;  4RU9 A;  3CRX A;  3I1Y A;  2W54 A;  5J2A A;  1SV0 A;  2ZTC A;  4XUS A;  3WK8 A;  1WCL A;  1NI3 A;  3WK5 A;  1JRO A;  4M6W B;  2P66 A;  3PSP A;  5ALQ A;  1XSL A;  1QSS A;  1ARO P;  5KG1 A;  1L3T A;  2W3S A;  3T5J A;  2W9C B;  2OXO A;  3AL0 B;  5KFI A;  1NKE A;  2EZX A;  3IM1 A;  4F71 A;  4DEZ A;  2AGQ A;  4NLN A;  4KN7 A;  4I2G A;  2KVC A;  2LYH A;  3C1Y A;  1S0V A;  3RAX A;  2RLT A;  4Y2Q A;  9ICA A;  3AU2 A;  2DKZ A;  3H0L B;  4Q45 A;  2NRX A;  4KN4 A;  2WF9 A;  5DBA A;  2BKE A;  4PGY A;  2KD1 A;  3TAN A;  4Z6E A;  3C23 A;  4G9B A;  4M47 A;  4CDG A;  1IM4 A;  4J9R A;  5FP0 A;  3ZDA A;  7ICH A;  3LWL A;  1T3N A;  4UAU A;  2ODG A;  5KFE A;  1V85 A;  4QIW C;  1UA0 A;  3PO4 A;  2VJ5 A;  3PVX A;  2VAN A;  4FS2 A;  4QZ8 A;  3FM9 A;  5KFD A;  2W43 A;  2WHE A;  1IG6 A;  2PMZ C;  2VA3 A;  2D3D A;  1X42 A;  2YTU A;  4AYB F;  4DOB A;  2D8C A;  1X9M A;  5GTH U;  2RDJ A;  5JUM A;  5L1L A;  2E3T A;  2DQN B;  2WF8 A;  2IMW P;  2W9C A;  1MA7 A;  5ALL A;  4YFK A;  2A1J A;  2W9B B;  7ICR A;  4YMO A;  5KL8 B;  4M2Y A;  1NK6 A;  1ZQF A;  1FIQ A;  5J0Q A;  1NKC A;  3ZDD A;  2XGQ A;  3GIJ A;  4J9S A;  4DLE A;  1PZN A;  3GV7 B;  3M9M B;  4FBU A;  3N4M B;  2W3R A;  2GLE A;  2NRT A;  1TK8 A;  3PZP A;  1S0O A;  5AKY A;  4FZN A;  2EDU A;  4ACO A;  4C80 A;  4IQV A;  2MRL A;  2ZIV B;  2HHS A;  2W9B A;  2A1J B;  4IL6 U;  4P4M A;  3WKB A;  2E8N A;  5CEH A;  1JX4 A;  8ICG A;  1L3S A;  4UB1 A;  4J9K A;  4KMU A;  3SV3 A;  2JMG A;  1V97 A;  4DQI A;  4TUQ A;  4KLE A;  4KLI A;  4HAI A;  4FE3 A;  3MC1 A;  5KFJ A;  4Z6C A;  1KFD A;  3ONN A;  2YMP A;  5KFV A;  3Q8S B;  3Q8R B;  4K4G A;  1YZ6 A;  3L3F X;  4ECY A;  5HML A;  4ECQ A;  4QZG A;  4UB3 A;  3GIL A;  4RQ7 A;  1RPL A;  1HIW A;  5KG7 A;  1N60 A;  1U9L A;  4UQG A;  3AU6 A;  2FMP A;  5J0U A;  2EAP A;  1CRX A;  5HR7 A;  2HBM A;  4RNN A;  2BPC A;  2YY6 A;  4NLG A;  3LDA A;  5KG3 A;  4DL2 A;  2F1J A;  1X6I A;  2E8O A;  3PSI A;  4J9O A;  2Z7J A;  2ZG6 A;  2F1H A;  2JRZ A;  3HX0 A;  2BCS A;  2KIC A;  3QXG A;  5L1J A;  4QW9 A;  2BDU A;  3PW2 A;  1CEZ A;  4ELV A;  4KLH A;  3IG8 A;  2EAN A;  4DSL A;  3IV6 A;  1KBU A;  4YMN A;  1S0N A;  4KLM A;  8ICB A;  5G5H A;  5ALM A;  2CRX A;  1BPY A;  2N1R A;  3D2S A;  5CHG A;  3NVW A;  3KD3 A;  5CA7 A;  9ICN A;  1ZD4 A;  2W9A A;  2ESE A;  2C2E A;  1NJX A;  4KLU A;  4KLT A;  2C22 A;  5KT7 A;  1ZQP A;  4DSI A;  8ICE A;  2AH5 A;  4O5C A;  2C2D A;  2BQU A;  1ZQL A;  7ICQ A;  4F4X A;  4EEK A;  5DB6 A;  3MFI A;  3H8J A;  3M6Z A;  4PGQ A;  2MU2 A;  2XCA A;  4P4O A;  1Z4O A;  2XO7 A;  2IBK A;  5ALW A;  1SXE A;  5EWG A;  2C28 A;  4RNO A;  5ALG A;  4ED7 A;  5T14 A;  1ZQT A;  5AHX A;  4C4S A;  4MF8 A;  1YT3 A;  1ZQU A;  4O3P A;  4GC6 A;  3ICX A;  4YXM A;  3LVV A;  4ED0 A;  7ICJ A;  5AIA A;  2PKE A;  4KMO B;  4NY8 A;  4TUP A;  2NRW A;  1L3V A;  3HW8 A;  2IHM A;  3Q8L A;  3WKA A;  4G3I A;  5HR6 A;  1ZQZ A;  1KN5 A;  2BZF A;  5KFL A;  1ZQH A;  1WYG A;  4PHA A;  5B5E U;  2Y9U A;  2R8G A;  1ZQD A; 
#chains in the Genus database with same CATH homology
 3F5A A;  1P7D A;  3K1Z A;  1PVR A;  3M7D A;  4OO1 J;  2PMZ C;  1UPH A;  2ZIW B;  2XIC A;  3F53 A;  3IG5 A;  3SMV A;  1Z19 A;  2K89 A;  2HOQ A;  2VKQ A;  2Y0S C;  3RFA A;  3C29 A;  2G07 A;  1HEK A;  2H3Z A;  4GFJ A;  1URJ A;  2WAQ C;  4AYB F;  2LHT A;  3AQF A;  4BUG A;  4NLB A;  4WJ3 B;  5HR7 A;  2D6F C;  1XO0 A;  4BX9 C;  2Q4T A;  1ECW A;  2HBM A;  3LYS A;  4FZM A;  1T94 A;  1TAM A;  2KKV A;  2KJ9 A;  2VJ4 A;  3SAF A;  3CYM A;  3F2C A;  2ZIU A;  2DQN B;  2F2A B;  3MGV A;  1F44 A;  3DEE A;  2G5I B;  1A0P A;  4OJP A;  1Q3U A;  3GZF A;  3PSI A;  3H0M B;  2Z7J A;  2ZG6 A;  1MA7 A;  2HOI A;  3SQI A;  3KFU F;  2KIC A;  4FZL A;  2W7P A;  2RP5 A;  4JMU A;  3RF9 A;  5KL8 B;  2BDU A;  2W04 A;  4QJF B;  2KHV A;  4QIW F;  2H3Q A;  3CRX A;  1Z1B A;  3IG8 A;  1ZQ1 C;  1GO3 F;  2K4H A;  2RHF A;  4P0Q B;  2F8L A;  4QNL A;  2ZIX B;  1KBU A;  2PMZ F;  2E5S A;  2KHQ A;  5KL1 B;  2CRX A;  3PSF A;  4IC9 A;  2N1R A;  3VC8 A;  1A6S A;  2XI9 A;  2ZXH A;  3D2S A;  2LKY A;  1D8B A;  2HBK A;  2LYB A;  3N7S C;  4C0Z A;  2E1E A;  3PSP A;  2KJ5 A;  3SAG A;  2OM6 A;  3KZX A;  1ED1 A;  2DF4 B;  5A0L A;  2HBL A;  2JHD A;  4BJQ A;  2CPR A;  4KX5 A;  2MA1 A;  3PZP A;  4FZN A;  2OXO A;  4ACO A;  3AL0 B;  2YB1 A;  3LVW A;  2CN1 A;  1IIP A;  2YB4 A;  3IN5 A;  4KX3 A;  2K4E A;  2MRL A;  2ZIV B;  2K8A A;  3OPX A;  4OJ5 A;  5CRX A;  2GOL A;  1L6N A;  2LBO A;  3D2Q A;  3VCB A;  3PST A;  2YX8 A;  2KVC A;  2KV2 A;  3M6Z A;  2ZIV A;  4AYB C;  2KOB A;  2HBJ A;  2HOF A;  4P0Q A;  3F2D A;  3IP4 B;  3CP8 A;  4OJL A;  3C28 A;  2JGA A;  2KNJ A;  3F5E A;  1PVQ A;  4NV0 A;  2RRD A;  2WB1 F;  2WAQ F;  4OJO A;  2H3F A;  3H0R B;  3M6K A;  4U6P A;  2ZIU B;  2W7O A;  3H0L B;  2JMG A;  2K4I A;  2JH7 A;  2ZIW A;  1CRX A;  2E1F A;  2NV3 A;  3GU3 A;  4CGZ A;  2F76 X;  4PL2 A;  1SZH A;  1WUD A;  2G0A A;  2XID A;  2KD1 A;  3HKZ F;  5T14 A;  4NWI A;  3NUQ A;  2W03 A;  2M0N A;  1YT3 A;  4P0P B;  2G06 A;  2H3I A;  2HMX A;  2KIW A;  2KKP A;  1PVP A;  4O3M A;  2KJ8 A;  1XNS A;  1OUQ A;  2R18 A;  2Y0S F;  2A3V A;  3ICX A;  4P0P A;  3E0F A;  4FE3 A;  4U7C A;  3LVV A;  4CDG A;  5C0Y A;  3O0F A;  2VIX A;  2XVT A;  3ONN A;  4KMO B;  2DGZ A;  2K8C B;  4ICA A;  1DRG A;  2OYY A;  1Q3V A;  3N7R C;  2ZIX A;  2G5H B;  3SAH A;  3AQE A;  4QIW C;  2H3V A;  4PL1 A;  3D2N A;  3L3F X;  4A8E A;  5HR6 A;  2VJ5 A;  2F77 X;  4OJ6 A;  2LYA A;  2JH1 A;  2K8B B;  2GH1 A;  3N7P D;  4CRX A;  3T79 A;  3NRW A;  2KEY A;  3HKZ C;  1NZB A;  3ALR A;  2G09 A;  2OH2 A;  4NLC A;  2G08 A;  1HIW A;  2WB1 C;  2ZXI A;  3F2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...