5KLIB

Rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Cytochrome b
total genus 67
structure length 256
sequence length 256
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5kliB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 5kliB02
2N18C 3PH2B 1DW0A 1NTZD 1CHJA 3HQ9A 3DR0A 1CIHA 3A0BV 4FA4A 4L3GA 3PXSA 1BCCD 3CX5W 4FANA 1COTA 3CXHW 2RN0A 3H1KD 2O3JA 3WC8A 1SQQD 4D6TD 3O0RC 1H9XA 1N50A 3L70D 3C2CA 5AURA 3PRJA 1CCHA 1YFCA 4GYDA 5CICB 4P4QB 1I8OA 4H0KA 4V2KA 2PCCB 2BGVX 2B4ZA 5H2FV 4PW9B 4U3FD 1HJ3A 4WQBA 1CNOA 3WUIA 5E79V 3WFCC 1BE3D 3ITKA 1C7MA 1FCDC 1LC1A 155CA 2B0ZB 5GTIV 3L73D 1NMIA 1H1OA 5DJQB 4XYDB 3TDKA 1CHHA 3TGUD 1HH7A 3DP5A 1QL3A 5KAIV 2MTAC 1N90A 2GC4D 1GJQA 2N9JA 4PWAA 3VRDA 3X39A 1B7VA 3NWVA 3ZBMA 2D0SA 1F1CA 2C1DB 1SQVD 5B6QA 1RAQA 3M97X 3VNWA 2FYNB 5KLIB 2B11B 2C8SA 1IZL0 4Q5PA 1YEAA 5CIHB 1CRCA 1AYGA 1I55A 3H1ID 1NIRA 2JWAA 2V07A 2Y0CA 3TYIA 1A2SA 2CXBA 1AOFA 1CTJA 1J3SA 1CC5A 1I6DA 3HQ7A 2BH5X 1H33B 3RN0A 3CYTI 5CIBB 1LC2A 1EB7A 1ZZHA 4LJIA 4WQ8A 1KX2A 1PPJD 1RZ6A 1CIEA 2OZ1B 1BGYD 1KB0A 2C2CA 1C6OA 1R0QA 2BCNB 1HZUA 3L72D 4AALA 1CSVA 3VMAA 2Y0DA 4FA9A 1M6ZA 2MHMA 4PD4D 4EICA 4AANA 3PLNA 1I5TA 1CRJA 2BH4X 1NU1D 3CX5D 1H33A 1A56A 3GG2A 4FA1A 4RSZA 3MK7C 3ZOXA 1EZVD 2JTIB 1C2RA 1M70A 4FB1A 2CA4B 1KYOW 4L1QA 3NBTA 3L4OA 1HJ5A 5CYTR 1C6SA 3JBTB 4EIFA 2K9JB 1FI3A 1U75B 1BL9A 2DVHA 2ZONG 3ZOWA 1I6EA 1HZVA 4GEDB 4H0JA 2B12B 1AOQA 2I8FA 2CE0A 1IRWA 1WVEC 3WFEC 4EIDA 4AAOA 1DT1A 2CE1A 1H9YA 4JCGA 2KNCB 4K3IA 3SJLA 1MG3D 1HRCA 1S5LV 4RJTA 1N15A 1YTCA 1SQXD 2YQBA 3ZOYA 4EDFA 1QN2A 5TISV 3NBSA 5GTHV 2OZ1A 5CIFB 1KX7A 4MU8A 2QJYB 3H1HD 1DIQC 5EXQA 2N3YA 2C1UA 1CXCA 1JDLA 3SLEA 1NMLA 2LITA 2QG4A 2Q3EA 5CIGB 2ZZS1 5CIDB 1OCDA 5DFSA 2C9XB 1CRGA 3ZCFA 2AI5A 1AKKA 2N9YB 2YK3A 4WQAA 1C6RA 4A7PA 2ORLA 3O1YA 1FOCA 1RZ5A 1SQPD 2ZOOA 1CRHA 3OA8B 1KB9D 1NTKD 2JQRA 3GW6A 2ZXYA 1CTYA 1DVHA 2QJPB 2AXTV 1SQBD 5C0ZA 2CA3B 3L75D 1CYCA 1E29A 1GDVA 4WQDA 1DW2A 1LFMA 1FJ0A 3O5CA 3H1LD 1GIWA 4UB6V 4N0KA 1WEJF 3SVWA 3TF5A 5KKZB 3HQ6A 1M60A 4DY9A 4WQCA 1KYOD 351CA 3HQ8A 3DMIA 2L91A 2IBZD 3VYMA 3RMZA 1K3GA 3PHLA 2BLFB 3PXTA 4AX3A 4L3HA 3ZIYA 1DW1A 2A06D 1C52A 1LS9A 1PP9D 1CTZA 1HJ4A 4O1WA 1QKSA 1YNRA 1YEBA 1CIFA 1MZ4A 4PJ0V 2D0WA 1U74B 1S6VB 1CYJA 2KS1A 5B5EV 3SWSA 3WFDC 4NFGB 2ZBOA 1RAPA 1IQCA 1CO6A 1ZRTD 2FRCA 2EXVA 1CXAA 2N9IA 1N9CA 1CIGA 1CSWA 3H1JD 1MG2D 1NTMD 3L74D 4KMGA 2AIUA 2C1DA 2GIWA 1CHIA 1CRYA 5C9MA 1QYZA 5DJQC 4Y5RA 2DGEA 451CA 1HCMA 3CU4A 3ORVA 1GKSA 1OAEA 1L9JC 3MK7B 4IL6V 3PTZA 3L71D 2FWLA 4FAVA 3OCDB 2C1VA 1KIBA 1KV9A 1K3HA 2PCBB 3KZIV 1A8CA 3CXHD 1FI7A 3A0HV 5B66V 1CSUA 4AAMA 1DW3A 3A9FA 2QJKB 2B10B 4YE1A 3SXTA 2RMZA 1C2NA 1L9BC 1L0LD 1YCCA 3PXWA 2GC7D 1F1FA 3WFBC 1CRIA 5KLVD 1H31A 1P84D 2HV4A 4J20A 2YCCA 1YICA 2XTSB 4UB8V 1GQ1A 1YIQA 1FI9A 1CYIA 2BPBB 4WQ7A 1I8PA 1H31B 1LMSA 3ZOOA 1FHBA 4WQEA 4FA5A 1CSXA 1DVVA 2YIUB 5KAFV 2FYUD 2BCCD 5DF5A 2L4DA 2N3BA 1CORA 5IY51 3CWBD 1H32A 3RN1A 3KHUA 2LIRA 1W2LA 1VYDA 1NNOA 4XXLA 5CIEB 2VHDA 2Y0EA 3FWLA 1E8EA 1E2RA 1ETPA 1H32B 1QL4A 3WU2V 1CCRA 2V08A 3O20A 4EIEA 1W5CT 3OCDA 2GB8B 4O1QA 2N18B 1CEDA 1L0ND 1IRVA 4WQ9A 3BCCD 1GU2A 1IO3A 1HROA 3L4MA 1I54A 3CP5A 2PACA 1C75A 4QAOA 5TJHA 1DIIC 3RLMA 3OA8A
chains in the Genus database with same CATH superfamily
3PH2B 2ZFCA 1GU4A 4HH2A 3R2PA 5AW1B 4L3GA 3EFFK 3CX5W 4FANA 1COTA 2RN0A 3H1KD 2O3JA 2R5DA 4RKUJ 4B86A 2R3SA 1L4AB 2IZ0A 2GA1A 3BCCE 3C2CA 1NWQA 2IBZE 3H1KJ 2YNYA 4V2KA 1SQBE 1VQ8P 3WU2E 4YXDC 1JOCA 4U3FD 1L4AC 4WQBA 2QSIA 5E79V 4H44D 4R4MA 3H1LG 2P1JA 1FCDC 2L5GB 3AE9C 155CA 3L73D 1H1OA 4EOTA 2FYUE 1GMJA 3AE7C 3CMEP 1LTSC 1KQSO 2QM7A 3TDKA 1CHHA 3I56P 1N90A 2WZ7A 3AEFC 1GJQA 2N9JA 4PWAA 3VRDA 3ZBMA 1CZQA 5TISH 2WT7A 2W83C 3RK3C 1SQXE 3ABVC 1RAQA 3LIDA 2C8SA 4TT3H 1IZL0 3L71E 2JWAA 2NPSA 2V07A 4JQ0D 4LC1A 1DH3A 3JCUE 4YXWH 3B5NB 3TGUE 2N9BA 3RN0A 5B5EE 3IF4A 1KQGB 1LC2A 5AVWB 4WQ8A 3BRVB 3MUDC 3HE4A 4WBAA 5AW4B 1OZHA 1KB0A 3CMAP 2BCNB 1LP1B 3P8CE 1HZUA 1ZR2A 1U7JA 4AALA 2OQQA 3VMAA 1PP9J 3U1CA 4FA9A 1S1CX 1M6ZA 4EICA 4AANA 1RE3A 1L0NG 1ZN5A 2BH4X 1NU1D 2W27A 4HKZH 1A56A 4FA1A 4RSZA 3KZIH 4I1LA 4RO0A 2JTIB 1LTTC 3P8MC 1NTZE 1HH0A 5AVXB 3NBTA 1C6SA 2R44A 3E7KA 1AQ5A 4ZKPA 3JBTB 4IFDK 5AVUB 5APTA 2ZONG 3ZOWA 3HUSA 3KPEA 3VN0A 2B12B 1YBKA 1N73C 3H1LJ 5GTIH 3V4QA 1IRWA 3TGUG 1PIXA 3O6QA 2CE1A 2M5AA 5AW5B 4K3IA 4LGDE 2I1KA 1MG3D 4PD4I 1S5LV 2A45I 3P32A 4OGQB 4ZNCA 1S5LH 4EIJA 1P84I 2B87B 1Y47A 5KJ7D 5EFWB 3ZOYA 4EDFA 1HUCA 3NBSA 1CI6A 3GLMA 5CIFB 4MU8A 2QJYB 3HD7B 4OGQC 1S2EA 3HD7A 2O1KA 4HB1A 2C1UA 3Q2YA 1T6AA 2WPQA 2FYUK 3HD7C 4PJ0E 1RHZB 1RH5B 3L35A 1JEKA 2C9XB 1CRGA 2GUSA 1AKKA 1BE3G 1JY2P 4A7PA 1FOCA 1ZR4A 2ZT9D 3G71P 1KYOE 3HUSB 1KN7A 2XZRA 1DVHA 3A0BE 2QJPB 1L4AD 1IFDA 1YJ9P 1P84E 1FDIA 1N8RQ 1BDDA 2WT7B 1GL2B 2KZIA 2XNXA 1N7SA 3A7OA 1ZOYC 5DJTB 4OGQD 1FU1A 2E76C 4BWNA 4JF7A 5M1BA 3H1LD 4UB6V 1GL2C 4N0KA 1GU5A 3TF5A 5H2FH 4XFJA 2CPBA 1LP1A 4AUWA 1KYOD 3SSUA 5BU8B 3DMIA 2L91A 2IBZD 3OA7A 4L74A 1QX8A 1S9KD 2BLFB 2O01N 2B89A 4L3HA 1JNMA 1RF1B 1PP9D 1CTZA 3HRNA 2FFDA 1FS0E 2YKPA 1W2BO 3F89A 1VF5D 3VTPC 3CXHI 3B4SA 1MZ4A 4PJ0V 3MUDA 1U74B 3L4FA 2M3EA 2QE7H 5K5GB 1H89A 2WSCH 1SQPG 3WUUA 2WSFH 3AE5C 4HYTB 3CWBE 2ZBOA 2G8YA 4O9BA 1M1KQ 3CD6P 3MGNA 5CMZA 3H1JD 1NAFA 1RE4C 2GUVA 2ZXXA 3SFEC 2AIUA 1CHIA 4Y5RA 2DGEA 1HGVA 1L9JC 3MK7B 1Q82Q 3RL0B 1GK6A 2KOGA 1A02F 3L75J 3G9RA 2C1VA 4KJMA 5L8RJ 1K3HA 4W7ZA 3KZIV 3H1HE 1ZRTE 1A8CA 1IO4A 3CXHD 1SFCD 3RK3E 1KB9E 1NTKE 3RL0C 1S9KE 3A0HV 5B66V 4N78D 1CSUA 4UB6E 1DW3A 3EWKA 2KI7B 5KLVK 2FY8A 2B10B 1LTIC 3L36A 3TSIA 4U3FE 4L76A 1ZMEC 1L0LD 3GF3A 1L0LJ 2QJKC 1SQPE 1E5WA 2H8PD 1YCCA 2R3CA 1LTJC 3WFBC 1CRIA 3AE1C 3RBXA 1KILB 1EDJA 1KILE 2WPSA 3M9HA 1YJNP 2P7JA 1LT9B 4H44B 4UB8V 1GQ1A 2A06G 1FI9A 2D2CD 1L0LG 1CYIA 1PPJG 1J1DC 2KS1B 2A45H 4WQ7A 1I8PA 1IK7A 4WQEA 5CCGD 4HJGH 1VQ7P 5E79E 4C46A 2FYUD 1NTKG 2BCCD 1EDIA 5DF5A 1S72P 2L4DA 4XE5B 4C7RA 4H13D 3L72G 5IY51 1H32A 2K3RA 3RN1A 2CPSA 3KHUA 2FXPA 2LIRA 1QVFO 2IX7C 4MN4C 4D6TJ 5AVVB 3L75G 1KD1Q 2VHDA 2Y0EA 1NTZJ 3FWLA 1N73B 1E2RA 1PP9G 1SFCC 4OH8B 3AE6C 1H32B 3AECC 2V08A 3O20A 3MZWB 2YKQA 2E43A 1SQQE 1W5CT 5KJ7A 5CBNA 5APSA 3T97A 3CX5E 1GL2A 2O01J 1L0ND 1IRVA 4C7NA 1N7LA 1IO3A 1I54A 3LW5J 3CP5A 2A06E 2P67A 1C75A 4QAOA 4EI2A 5TJHA 2QJYC 3OA8A 2N18C 1BGYE 3BASA 4NPEA 2PRRA 3CXHH 3WC8A 2JO1A 1J2JB 1YQ3C 1M1JB 2LXBA 4IOIH 1SQQJ 1SQQD 3A5TA 1RF1A 1HBWA 3B8EB 1OVVA 2Q7CA 4TLFA 1AV1A 3QWOC 1YFCA 4GYDA 2NPSD 1VQKP 1NTME 5H2FV 2V4HA 1PP9E 1CNOA 4W7YA 2KUBA 1VQ4P 1QL1A 4JPZB 1NTZK 1C7MA 1LC1A 4GT1A 2B0ZB 5GTIV 5KJ7C 1NMIA 5DJQB 3U1AA 2J5UA 1JMBA 1USEA 2E75C 2KZJA 2MTAC 5KLIC 3X39A 1T3JA 1F1CA 3L71J 1SQVD 5B6QA 3H1KE 3VNWA 1NKNA 5KLIB 2B11B 1YITP 2YXQB 3IR9A 1YEAA 2V7QJ 5CIHB 1AYGA 2OYHB 3H1ID 5KAIE 3CL3D 1RF1C 1A2SA 3H32B 4N6JA 1CTJA 3CXHE 3RK3D 4YTPC 3CCLP 2FYUG 1J3SA 1I6DA 1LGHB 3V2PA 1T3UA 1IFJA 1QVGO 3Q3DA 1K8AQ 1H33B 3GHGB 3CYTI 2KLVA 2FFDB 5CIBB 3CC4P 1ZZHA 2JKVA 1SQBK 1RZ6A 4Y99C 1KB9H 3H1IJ 1HWTC 1RE3C 1C6OA 3D0WA 2AXTH 2Y0DA 1DX7A 3L73J 1KILD 1L2PA 1J1EB 1G2CA 5KLVE 3TGUJ 1SQQK 2OTKE 3MK7C 2B87A 1VQMP 3HD7D 1NVOA 3L74G 1M70A 3USSA 1N7SB 2BASA 2CA4B 2QM8A 2QIWA 2C9NY 3LW5H 1PGQA 1GDTA 3Q5PA 2WVRA 1FI3A 4BRYB 1I6EA 1EZVI 2GM4A 1SQXK 1HZVA 1Q90D 1KQLA 1AOQA 1EXIA 2I8FA 3I5CA 3KQGA 4EIDA 2BCCG 3RBZA 1DT1A 5KAFH 3RL0D 4K35A 2POHA 1LTJB 1N15A 2PGDA 1LWUA 1A02J 2ZJSE 3AEBC 2YQBA 1AJYA 2Z5IA 5TISV 2OZ1A 3H1JJ 1N7SD 1L0NK 3HE5A 1VF5C 1DIQC 1IFMA 3TNUA 5EXQA 3TYYA 1CXCA 3SLEA 3CC2P 4EYYQ 2ZZS1 5AW8B 1Z56A 3Q1MA 5DFSA 4CPGA 2KYVA 4JYCA 2IBZI 3ZCFA 1PGPA 1Y9BA 2YK3A 4WQAA 1PL5A 1SQVG 3V2QA 1BCCE 1SQPD 3V6IA 3RK2D 1RQVA 2ZOOA 2KXPB 3MTUE 3A0HE 1JTHB 5B66E 2E5TA 5APWA 1HGZA 1SFCB 1JO5A 4L73A 2E76B 3CC7P 1NHLA 1SQBD 3WMM0 2B9BA 2E75D 4GOFA 1CYCA 3CCMP 2Z4EA 1E29A 1KZUB 1GDVA 4WQDA 1DW2A 1LFMA 2HPCA 1FJ0A 3QH9A 3O5CA 1BE3E 3L37A 2E74C 3HQ6A 1KC8Q 5C39A 3HQ8A 3VYMA 3RMZA 2M8RA 1K3GA 3L70E 3PXTA 2YO2A 4N3YB 1DW1A 1E79H 2W6AA 1JM0A 5KKZC 1BGYG 1VPCA 1SQBG 5AW2B 2NPSC 1HJ4A 1SQVE 4R4LA 1TU3F 4O1WA 3AEGC 4DZOA 1YNRA 1U7MA 3H1KG 1NTKK 1L4AA 2LKMA 2KS1A 1CYJA 2K1AA 3CPWO 3SWSA 2NPSB 1XTCC 3WFDC 1CXAA 2O1JA 2N9IA 1N9CA 4DJGA 1CSWA 2ZYGA 3SWFA 2C1DA 1T8ZA 5C9MA 1IFIA 3N7NA 5DJQC 1HCMA 1EQ7A 1FJKA 1ZW0A 1GKSA 1OAEA 2KB7P 1SS1A 3PTZA 1X8YA 2WQYC 1SQVJ 2E74D 1N73A 3OCDB 2OTLP 3L71G 1T2KD 3NTNA 3L70G 1VQOP 1KTMA 1DEBA 2WMMA 1URQC 1FI7A 5KLVG 3SWKA 2QJKB 1H0TB 3LIEA 3EFGA 3SXTA 4I7ZB 3PP5A 5BVZA 5BU5A 1URQB 2D2CB 1IC2A 4W80A 3VMYA 1FAVA 1OFCX 3SWYA 1JB0J 4H44C 2IDBA 3M9BA 5KLVD 2D2CC 5CJ4A 1NJIQ 3H1JE 3B71A 2HV4A 4J20A 2YCCA 1FZAA 1KILA 4N78E 2E5YA 1L0LK 3GF7A 2JEEA 1Q81Q 1G1IA 2AEJA 1R5LA 5GTIE 2HG5D 3W68A 1LMSA 1NO4A 1NYHA 3T97B 5CHXA 4FA5A 1GTWA 2I8DA 1KORA 3KYQA 1AFOA 1S5LE 1FZCA 1CORA 3H25A 1DIPA 2OTJP 5APXA 5B5EH 1BSNA 3M0AA 3CCEP 4XXLA 5CIEB 3PJSK 1E8EA 2P2UA 4H13C 3U59A 2WTYA 1QL4A 3IN6A 1CCRA 1IFNA 1IJDB 1FZCB 4EIEA 1BCCG 1NH4A 3OCDA 4IFFA 5AW6B 1NU1E 2N18B 3UIAA 5TISE 4YPCA 4WQ9A 3CI9A 3L4MA 1SFCA 1D7MA 3WU2H 1DIIC 1VF5B 5CCHA 1M1JC 1ZV8A 2N1TB 1NTZD 2PFXA 2Q9IA 3HQ9A 2K9YA 3JCUH 3DR0A 1CIHA 3A0BV 4FA4A 3PXSA 1BCCD 4ASVA 1S4XA 3MIWA 3A0BH 2P10A 2E42A 3O0RC 2BEQD 1GZLA 1N50A 3L70D 2ZAEB 1YHQP 2ZYDA 2PCCB 2BGVX 2B4ZA 4GIFA 1OW8A 1HJ3A 4GODA 2IPPA 5E79H 2MJZA 3A3YB 1H8AA 3HE5B 1CW5A 3WUIA 3WFCC 1HTLC 1BE3D 2Z5HA 2E75B 1GL2D 1LWUB 2E76D 2KSEA 1L0NE 5CCGA 4XYDB 2FKWB 3FWNA 5KAIV 1FZFA 2GC4D 1R5SA 1B7VA 3F5HA 2D0SA 2OYHC 2LR2A 2C1DB 2HFED 3NXSA 2XNDH 2HLOA 1X79B 4Q5PA 2K37A 1CRCA 3GHGC 2IYOA 3HTKA 4WVZA 1AOFA 2G3AA 3AE3C 1EZVE 2FYNC 4Y99B 3HQ7A 1W2EA 1G1JA 3TK1A 3G3ZA 3M0DC 4LJIA 1NTMK 3AEDC 1IZNB 3K5BA 1H88A 3M0DA 4OVNF 2C2CA 4PV1B 4BXLA 3C9IA 2MHMA 1S3JA 3PLNA 5GTHE 1QLED 1I5TA 1CRJA 3BVHA 3GG2A 3ZOXA 2ITAA 2YMKA 2HPCB 1NU1K 1C2RA 2JDIH 3AE4C 1UIIA 1W5CE 1KYOW 5CYTR 2P58A 1USDA 1ZXGA 4L75A 1FBMA 1VQNP 4EIFA 1JY3N 2K9JB 1U75B 2DVHA 3P8CD 1YIJP 3Q5RA 4H0JA 1RY3A 2V7QH 3JC22 2CE0A 1DD3A 2PP6A 3E1IA 1WVEC 3WFEC 4AAOA 2XU6A 1H9YA 4JCGA 2OYIA 3D71A 1KFMA 2MKVA 3AEAC 4IL6E 2AEFA 3FXEA 2WSCJ 3N4XA 1PV3A 1KQFB 1K05A 1KILC 3H1IG 3L74J 1QN2A 1P84H 1RE4A 3L70J 3CX5I 2B88A 1G2CB 1KX7A 3H1HD 1FDOA 4M3LA 2YO3A 3CLQA 1NMLA 1JY3P 2Q3EA 3AE8C 5CIGB 4IL6H 5CIDB 1OCDA 1MZ9A 1Q2NA 1OMIA 1NTZG 4IL6X 3CX5H 3CCUP 2AI5A 1R8EA 1FE6A 2ORLA 2J58A 3O1YA 1KMIZ 3CCSP 2OYOA 1CRHA 2FYUJ 3BCCG 3OA8B 2XDJA 1KB9D 1NTKD 2Q6QA 2OYHA 1IK9A 1FDMA 3B5ND 3GW6A 4JYBA 3ZDMA 2K9JA 4IFMA 4XA4A 2WPVB 3CCRP 1FZCC 4PV1D 5C0ZA 2CA3B 3L75D 1WT6A 3FX0A 2YKOA 3VP9A 1L0LE 2BEZF 1RF0A 1LT1A 3BATA 2IYPA 2WSSH 5CCGC 1WEJF 2J59M 3BRTB 5KKZB 3P7KA 3RK3B 2N1TC 4WQCA 1AQTA 5AW0B 1S5LX 3ZIYA 4Z1MH 2UWJE 1L0NJ 4LLHA 1C52A 1LS9A 2NRGA 3L75E 3S4RA 3CCJP 1KYOH 3B5NC 3G4SP 1YEBA 3EQ2A 1T2KC 3KXDA 1HVVA 2JWDA 1JUNA 1NU1J 1S6VB 1SQQG 4NFGB 2H7HA 1HF9A 1EDKA 2WWWA 1MG2D 4H0LD 4KMGA 2GIWA 3FXDA 1KYOI 451CA 4GKGA 1PGOA 4IL6V 1OXZA 1URQA 3V2RA 1DEEG 3C8VA 4FAVA 1SVFA 1KIBA 3L73E 4D6TG 4U3FJ 1BDCA 3L72E 1JMMA 2PCBB 1H0TA 1VDFA 4WY4A 4AAMA 3A9FA 1NTKJ 4UB6H 1DD4A 3Q5SA 1FZEA 3A2AA 2HODA 1NTMJ 2N1TD 1AVOA 4KHXA 2WSEH 5CJ0A 2GC7D 1FZBA 4PD4E 1M7LA 1P84D 3KDPB 1JCDA 4PJ0H 3I55P 4PV1C 1BGYJ 1JCCA 2BPBB 2AXCA 2XKMA 3RK2C 4C7NB 1H31B 3L73G 3H1IE 3NMDA 1CSXA 3H1LE 2OGUA 5KAFV 4NPDA 3D6YA 2Q3IA 1YQ4C 3CWBD 2JR8A 1GK4A 3VYIA 1W2LA 1VYDA 1NNOA 2OARA 2WPRA 1EDLA 1ETPA 1ZP0C 3OJAB 3WU2V 4WY4B 3RL0g 1FJPA 3CCQP 1PGJA 3D70A 5H2FE 3AE2C 5AW9B 3CWBG 2GB8B 4AQRD 4O1QA 4WY4C 2DW3A 2IBZG 3M91A 3BCCD 5KTBA 1LJ2A 3VP8A 1LT9A 1NAYA 1DW0A 1CHJA 1OW6A 4ASWA 3CXHW 2WSEJ 1M90Q 4H0LB 1JY3O 4UB8H 3C1LA 2YMYA 4D6TD 4AYCA 1SQPJ 1H9XA 1YJWP 2JP3A 5AURA 3PRJA 1CCHA 1X9VA 1QL2A 2AEMA 3VOPA 5CICB 4P4QB 1I8OA 4H0KA 4H0LC 1SQXJ 5AVSB 5AVQB 4PW9B 2H88C 1LWUC 1YYCA 4U7JA 1SQXG 3IAOA 3IFMA 2CK3H 1CI6B 1OX3A 3ITKA 4K3AA 2QA4P 3OAKA 1WMKA 4DT0A 3TGUD 1HH7A 3DP5A 1QL3A 2Y9YA 1LTBC 1JY2N 1FOSE 1U57A 2O01H 3NWVA 1K04A 2I1JA 3V5BA 3M97X 4BRYA 2FYNB 2NZ2A 1MFTA 2LXCB 3CWBJ 4Y28J 1I55A 1JTHA 1NIRA 2Y0CA 3TYIA 2CXBA 4D6TE 1FZGA 2BCCE 1CC5A 2ZVOB 2BH5X 2KSJA 4I6MC 5APYA 4U3FG 1SQVK 3TNUB 3MHVA 1EB7A 2JJLA 1KX2A 2XV5A 1PPJD 1GW4A 1BCCJ 4WB4A 1CIEA 2IZ1A 2YXRB 5APQA 2OZ1B 1BGYD 1KB9I 1R0QA 3HE4B 1AA0A 1FC2C 3L72D 2Q5UA 1CSVA 2FYZA 1J1DB 4PD4D 2C9LY 5CBOA 2M5AB 3CX5D 1H33A 5AVYB 3O6QB 4OWFA 1EZVD 3VMZA 2YIUC 4FB1A 5KAFE 4L1QA 3L4OA 1HJ5A 4PD4H 3M9QA 2OYIB 2KNCA 2SPZA 1K9MQ 1QGKB 2KP8A 1GD2E 1BL9A 3PH0A 3RGUA 4GEDB 4UB8E 2WSFJ 2OYIC 1RQUA 4I7ZC 3V2NA 2FXMA 1Q7YQ 1NOHA 1X0TA 2Q1KA 1BSHA 1NTMG 1LTGC 5AW7B 2KNCB 4QMAA 3SJLA 1HRCA 3SFDC 4RJTA 1PFIA 4RESB 1YTCA 1SQXD 4ZMDA 4KT0J 5GTHV 2QRXA 3GMAA 5CCHD 2N3YA 4I2LC 3GHGA 1JDLA 2PAJA 3WUTA 2WITA 1OVUA 2QVAA 2LITA 2QG4A 3RK2B 1MFZA 3CCVP 3B5NA 3BCCJ 1IFPA 1LTJA 1EXJA 3HTKB 2K88A 2N9YB 1C6RA 1RZ5A 3AEEC 1YTZT 5DJUB 3D6ZA 5AVZB 2JQRA 3WUVA 1KV4A 1MV8A 2ZXYA 3NFQA 3OW2O 2W90A 1CTYA 4H13B 4GOEA 1NGMB 1MKMA 2AXTV 2C0XA 2BCCJ 1VQ6P 2M0BA 1OVRA 1FOSF 1KFNA 1M56D 2QJPC 2R5BA 2W8ZA 1MUUA 1GIWA 2AXTE 2QEXP 2KIKA 1LNQA 3SVWA 4GDOA 1Q86Q 1M60A 4DY9A 351CA 1HJ0A 2C0WA 2M3BA 2HYNA 1HJBA 3R4YA 3PHLA 2KK7A 4AX3A 3L74E 3V4WA 2KLUA 5APUA 2A06D 2IFMA 1N2DC 1PZQA 5CCHC 1QKSA 1CIFA 2D0WA 2FFDC 3MP7B 1WRGA 3H32A 3H1HG 5AVRB 5B5EV 1K73Q 1RAPA 1IQCA 1CO6A 1ZRTD 2FRCA 1BE3J 2EXVA 2HR3A 1CIGA 1NTMD 3L74D 1NKZB 4JBZA 4WY4D 3JSVC 1CRYA 1VQ9P 5APVA 5AVTB 1QYZA 1J1EC 3S1KA 3CU4A 3ORVA 2Y9ZA 1RF0C 4DCKA 1YTZI 3S9OA 1N7SC 3L71D 2FWLA 2ZYAA 2RH0A 1KV9A 2H89C 2R32A 2W6JH 1VQ5P 1GW3A 2A45G 1M8OB 1EZVG 3W67A 1ZLLA 4YE1A 1PPJE 2RMZA 1SQBJ 2IFNA 1URQD 1M57D 1C2NA 1X22A 1L9BC 3KZIE 1OIPA 1SLQA 3PXWA 1NU1G 2RKLA 2FBWC 3A0HH 5B66H 1M1JA 1F1FA 5AW3B 1H31A 1OW7A 1YI2P 1SP4A 1LTAC 2N1TA 1Y8AA 1YICA 2XTSB 3II6A 1JY2O 1YIQA 5GTHH 2VRSA 1XTGB 2H43A 3ZOOA 5KAIH 1FHBA 1LT9C 2ZT9C 1QEXA 4NPFX 1DVVA 2YIUB 1VQPP 4WWIA 3O8ZA 2ZXEB 2N3BA 1SQPK 1VQLP 3E1RA 1CSBA 3FGAD 1UIXA 2ZT9B 2HODB 3H6PA 1AVYA 4ZKUA 3HUSC 2FXOA 1N86A 1VL2A 3G6EP 5KLVJ 2W6BA 1CEDA 1OWAA 3VMXA 3MD0A 3M06A 1GU2A 3H1JG 1HROA 2ZVNB 1EC5A 4DOJA 2PACA 2E74B 3H1HJ 3L72J 3RLMA
chains in the Genus database with same CATH topology
2N18C 3PH2B 1DW0A 1NTZD 1CHJA 3HQ9A 3DR0A 1CIHA 3A0BV 4FA4A 4L3GA 3PXSA 1BCCD 3CX5W 4FANA 1COTA 3CXHW 2RN0A 3H1KD 2O3JA 3WC8A 1SQQD 4D6TD 3O0RC 1H9XA 1N50A 3L70D 3C2CA 5AURA 3PRJA 1CCHA 1YFCA 4GYDA 5CICB 4P4QB 1I8OA 4H0KA 4V2KA 2PCCB 2BGVX 2B4ZA 5H2FV 4PW9B 4U3FD 1HJ3A 4WQBA 1CNOA 3WUIA 5E79V 3WFCC 1BE3D 3ITKA 1C7MA 1FCDC 1LC1A 155CA 2B0ZB 5GTIV 3L73D 1NMIA 1H1OA 5DJQB 4XYDB 3TDKA 1CHHA 3TGUD 1HH7A 3DP5A 1QL3A 5KAIV 2MTAC 1N90A 2GC4D 1GJQA 2N9JA 4PWAA 3VRDA 3X39A 1B7VA 3NWVA 3ZBMA 2D0SA 1F1CA 2C1DB 1SQVD 5B6QA 1RAQA 3M97X 3VNWA 2FYNB 5KLIB 2B11B 2C8SA 1IZL0 4Q5PA 1YEAA 5CIHB 1CRCA 1AYGA 1I55A 3H1ID 1NIRA 2JWAA 2V07A 2Y0CA 3TYIA 1A2SA 2CXBA 1AOFA 1CTJA 1J3SA 1CC5A 1I6DA 3HQ7A 2BH5X 1H33B 3RN0A 3CYTI 5CIBB 1LC2A 1EB7A 1ZZHA 4LJIA 4WQ8A 1KX2A 1PPJD 1RZ6A 1CIEA 2OZ1B 1BGYD 1KB0A 2C2CA 1C6OA 1R0QA 2BCNB 1HZUA 3L72D 4AALA 1CSVA 3VMAA 2Y0DA 4FA9A 1M6ZA 2MHMA 4PD4D 4EICA 4AANA 3PLNA 1I5TA 1CRJA 2BH4X 1NU1D 3CX5D 1H33A 1A56A 3GG2A 4FA1A 4RSZA 3MK7C 3ZOXA 1EZVD 2JTIB 1C2RA 1M70A 4FB1A 2CA4B 1KYOW 4L1QA 3NBTA 3L4OA 1HJ5A 5CYTR 1C6SA 3JBTB 4EIFA 2K9JB 1FI3A 1U75B 1BL9A 2DVHA 2ZONG 3ZOWA 1I6EA 1HZVA 4GEDB 4H0JA 2B12B 1AOQA 2I8FA 2CE0A 1IRWA 1WVEC 3WFEC 4EIDA 4AAOA 1DT1A 2CE1A 1H9YA 4JCGA 2KNCB 4K3IA 3SJLA 1MG3D 1HRCA 1S5LV 4RJTA 1N15A 1YTCA 1SQXD 2YQBA 3ZOYA 4EDFA 1QN2A 5TISV 3NBSA 5GTHV 2OZ1A 5CIFB 1KX7A 4MU8A 2QJYB 3H1HD 1DIQC 5EXQA 2N3YA 2C1UA 1CXCA 1JDLA 3SLEA 1NMLA 2LITA 2QG4A 2Q3EA 5CIGB 2ZZS1 5CIDB 1OCDA 5DFSA 2C9XB 1CRGA 3ZCFA 2AI5A 1AKKA 2N9YB 2YK3A 4WQAA 1C6RA 4A7PA 2ORLA 3O1YA 1FOCA 1RZ5A 1SQPD 2ZOOA 1CRHA 3OA8B 1KB9D 1NTKD 2JQRA 3GW6A 2ZXYA 1CTYA 1DVHA 2QJPB 2AXTV 1SQBD 5C0ZA 2CA3B 3L75D 1CYCA 1E29A 1GDVA 4WQDA 1DW2A 1LFMA 1FJ0A 3O5CA 3H1LD 1GIWA 4UB6V 4N0KA 1WEJF 3SVWA 3TF5A 5KKZB 3HQ6A 1M60A 4DY9A 4WQCA 1KYOD 351CA 3HQ8A 3DMIA 2L91A 2IBZD 3VYMA 3RMZA 1K3GA 3PHLA 2BLFB 3PXTA 4AX3A 4L3HA 3ZIYA 1DW1A 2A06D 1C52A 1LS9A 1PP9D 1CTZA 1HJ4A 4O1WA 1QKSA 1YNRA 1YEBA 1CIFA 1MZ4A 4PJ0V 2D0WA 1U74B 1S6VB 1CYJA 2KS1A 5B5EV 3SWSA 3WFDC 4NFGB 2ZBOA 1RAPA 1IQCA 1CO6A 1ZRTD 2FRCA 2EXVA 1CXAA 2N9IA 1N9CA 1CIGA 1CSWA 3H1JD 1MG2D 1NTMD 3L74D 4KMGA 2AIUA 2C1DA 2GIWA 1CHIA 1CRYA 5C9MA 1QYZA 5DJQC 4Y5RA 2DGEA 451CA 1HCMA 3CU4A 3ORVA 1GKSA 1OAEA 1L9JC 3MK7B 4IL6V 3PTZA 3L71D 2FWLA 4FAVA 3OCDB 2C1VA 1KIBA 1KV9A 1K3HA 2PCBB 3KZIV 1A8CA 3CXHD 1FI7A 3A0HV 5B66V 1CSUA 4AAMA 1DW3A 3A9FA 2QJKB 2B10B 4YE1A 3SXTA 2RMZA 1C2NA 1L9BC 1L0LD 1YCCA 3PXWA 2GC7D 1F1FA 3WFBC 1CRIA 5KLVD 1H31A 1P84D 2HV4A 4J20A 2YCCA 1YICA 2XTSB 4UB8V 1GQ1A 1YIQA 1FI9A 1CYIA 2BPBB 4WQ7A 1I8PA 1H31B 1LMSA 3ZOOA 1FHBA 4WQEA 4FA5A 1CSXA 1DVVA 2YIUB 5KAFV 2FYUD 2BCCD 5DF5A 2L4DA 2N3BA 1CORA 5IY51 3CWBD 1H32A 3RN1A 3KHUA 2LIRA 1W2LA 1VYDA 1NNOA 4XXLA 5CIEB 2VHDA 2Y0EA 3FWLA 1E8EA 1E2RA 1ETPA 1H32B 1QL4A 3WU2V 1CCRA 2V08A 3O20A 4EIEA 1W5CT 3OCDA 2GB8B 4O1QA 2N18B 1CEDA 1L0ND 1IRVA 4WQ9A 3BCCD 1GU2A 1IO3A 1HROA 3L4MA 1I54A 3CP5A 2PACA 1C75A 4QAOA 5TJHA 1DIIC 3RLMA 3OA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N18 C;  3PH2 B;  1DW0 A;  1NTZ D;  1CHJ A;  3HQ9 A;  3DR0 A;  1CIH A;  3A0B V;  4FA4 A;  4L3G A;  3PXS A;  1BCC D;  3CX5 W;  4FAN A;  1COT A;  3CXH W;  2RN0 A;  3H1K D;  2O3J A;  3WC8 A;  1SQQ D;  4D6T D;  3O0R C;  1H9X A;  1N50 A;  3L70 D;  3C2C A;  5AUR A;  3PRJ A;  1CCH A;  1YFC A;  4GYD A;  5CIC B;  4P4Q B;  1I8O A;  4H0K A;  4V2K A;  2PCC B;  2BGV X;  2B4Z A;  5H2F V;  4PW9 B;  4U3F D;  1HJ3 A;  4WQB A;  1CNO A;  3WUI A;  5E79 V;  3WFC C;  1BE3 D;  3ITK A;  1C7M A;  1FCD C;  1LC1 A;  155C A;  2B0Z B;  5GTI V;  3L73 D;  1NMI A;  1H1O A;  5DJQ B;  4XYD B;  3TDK A;  1CHH A;  3TGU D;  1HH7 A;  3DP5 A;  1QL3 A;  5KAI V;  2MTA C;  1N90 A;  2GC4 D;  1GJQ A;  2N9J A;  4PWA A;  3VRD A;  3X39 A;  1B7V A;  3NWV A;  3ZBM A;  2D0S A;  1F1C A;  2C1D B;  1SQV D;  5B6Q A;  1RAQ A;  3M97 X;  3VNW A;  2FYN B;  5KLI B;  2B11 B;  2C8S A;  1IZL 0;  4Q5P A;  1YEA A;  5CIH B;  1CRC A;  1AYG A;  1I55 A;  3H1I D;  1NIR A;  2JWA A;  2V07 A;  2Y0C A;  3TYI A;  1A2S A;  2CXB A;  1AOF A;  1CTJ A;  1J3S A;  1CC5 A;  1I6D A;  3HQ7 A;  2BH5 X;  1H33 B;  3RN0 A;  3CYT I;  5CIB B;  1LC2 A;  1EB7 A;  1ZZH A;  4LJI A;  4WQ8 A;  1KX2 A;  1PPJ D;  1RZ6 A;  1CIE A;  2OZ1 B;  1BGY D;  1KB0 A;  2C2C A;  1C6O A;  1R0Q A;  2BCN B;  1HZU A;  3L72 D;  4AAL A;  1CSV A;  3VMA A;  2Y0D A;  4FA9 A;  1M6Z A;  2MHM A;  4PD4 D;  4EIC A;  4AAN A;  3PLN A;  1I5T A;  1CRJ A;  2BH4 X;  1NU1 D;  3CX5 D;  1H33 A;  1A56 A;  3GG2 A;  4FA1 A;  4RSZ A;  3MK7 C;  3ZOX A;  1EZV D;  2JTI B;  1C2R A;  1M70 A;  4FB1 A;  2CA4 B;  1KYO W;  4L1Q A;  3NBT A;  3L4O A;  1HJ5 A;  5CYT R;  1C6S A;  3JBT B;  4EIF A;  2K9J B;  1FI3 A;  1U75 B;  1BL9 A;  2DVH A;  2ZON G;  3ZOW A;  1I6E A;  1HZV A;  4GED B;  4H0J A;  2B12 B;  1AOQ A;  2I8F A;  2CE0 A;  1IRW A;  1WVE C;  3WFE C;  4EID A;  4AAO A;  1DT1 A;  2CE1 A;  1H9Y A;  4JCG A;  2KNC B;  4K3I A;  3SJL A;  1MG3 D;  1HRC A;  1S5L V;  4RJT A;  1N15 A;  1YTC A;  1SQX D;  2YQB A;  3ZOY A;  4EDF A;  1QN2 A;  5TIS V;  3NBS A;  5GTH V;  2OZ1 A;  5CIF B;  1KX7 A;  4MU8 A;  2QJY B;  3H1H D;  1DIQ C;  5EXQ A;  2N3Y A;  2C1U A;  1CXC A;  1JDL A;  3SLE A;  1NML A;  2LIT A;  2QG4 A;  2Q3E A;  5CIG B;  2ZZS 1;  5CID B;  1OCD A;  5DFS A;  2C9X B;  1CRG A;  3ZCF A;  2AI5 A;  1AKK A;  2N9Y B;  2YK3 A;  4WQA A;  1C6R A;  4A7P A;  2ORL A;  3O1Y A;  1FOC A;  1RZ5 A;  1SQP D;  2ZOO A;  1CRH A;  3OA8 B;  1KB9 D;  1NTK D;  2JQR A;  3GW6 A;  2ZXY A;  1CTY A;  1DVH A;  2QJP B;  2AXT V;  1SQB D;  5C0Z A;  2CA3 B;  3L75 D;  1CYC A;  1E29 A;  1GDV A;  4WQD A;  1DW2 A;  1LFM A;  1FJ0 A;  3O5C A;  3H1L D;  1GIW A;  4UB6 V;  4N0K A;  1WEJ F;  3SVW A;  3TF5 A;  5KKZ B;  3HQ6 A;  1M60 A;  4DY9 A;  4WQC A;  1KYO D;  351C A;  3HQ8 A;  3DMI A;  2L91 A;  2IBZ D;  3VYM A;  3RMZ A;  1K3G A;  3PHL A;  2BLF B;  3PXT A;  4AX3 A;  4L3H A;  3ZIY A;  1DW1 A;  2A06 D;  1C52 A;  1LS9 A;  1PP9 D;  1CTZ A;  1HJ4 A;  4O1W A;  1QKS A;  1YNR A;  1YEB A;  1CIF A;  1MZ4 A;  4PJ0 V;  2D0W A;  1U74 B;  1S6V B;  1CYJ A;  2KS1 A;  5B5E V;  3SWS A;  3WFD C;  4NFG B;  2ZBO A;  1RAP A;  1IQC A;  1CO6 A;  1ZRT D;  2FRC A;  2EXV A;  1CXA A;  2N9I A;  1N9C A;  1CIG A;  1CSW A;  3H1J D;  1MG2 D;  1NTM D;  3L74 D;  4KMG A;  2AIU A;  2C1D A;  2GIW A;  1CHI A;  1CRY A;  5C9M A;  1QYZ A;  5DJQ C;  4Y5R A;  2DGE A;  451C A;  1HCM A;  3CU4 A;  3ORV A;  1GKS A;  1OAE A;  1L9J C;  3MK7 B;  4IL6 V;  3PTZ A;  3L71 D;  2FWL A;  4FAV A;  3OCD B;  2C1V A;  1KIB A;  1KV9 A;  1K3H A;  2PCB B;  3KZI V;  1A8C A;  3CXH D;  1FI7 A;  3A0H V;  5B66 V;  1CSU A;  4AAM A;  1DW3 A;  3A9F A;  2QJK B;  2B10 B;  4YE1 A;  3SXT A;  2RMZ A;  1C2N A;  1L9B C;  1L0L D;  1YCC A;  3PXW A;  2GC7 D;  1F1F A;  3WFB C;  1CRI A;  5KLV D;  1H31 A;  1P84 D;  2HV4 A;  4J20 A;  2YCC A;  1YIC A;  2XTS B;  4UB8 V;  1GQ1 A;  1YIQ A;  1FI9 A;  1CYI A;  2BPB B;  4WQ7 A;  1I8P A;  1H31 B;  1LMS A;  3ZOO A;  1FHB A;  4WQE A;  4FA5 A;  1CSX A;  1DVV A;  2YIU B;  5KAF V;  2FYU D;  2BCC D;  5DF5 A;  2L4D A;  2N3B A;  1COR A;  5IY5 1;  3CWB D;  1H32 A;  3RN1 A;  3KHU A;  2LIR A;  1W2L A;  1VYD A;  1NNO A;  4XXL A;  5CIE B;  2VHD A;  2Y0E A;  3FWL A;  1E8E A;  1E2R A;  1ETP A;  1H32 B;  1QL4 A;  3WU2 V;  1CCR A;  2V08 A;  3O20 A;  4EIE A;  1W5C T;  3OCD A;  2GB8 B;  4O1Q A;  2N18 B;  1CED A;  1L0N D;  1IRV A;  4WQ9 A;  3BCC D;  1GU2 A;  1IO3 A;  1HRO A;  3L4M A;  1I54 A;  3CP5 A;  2PAC A;  1C75 A;  4QAO A;  5TJH A;  1DII C;  3RLM A;  3OA8 A; 
#chains in the Genus database with same CATH topology
 3PH2 B;  2ZFC A;  1GU4 A;  4HH2 A;  3R2P A;  5AW1 B;  4L3G A;  3EFF K;  3CX5 W;  4FAN A;  1COT A;  2RN0 A;  3H1K D;  2O3J A;  2R5D A;  4RKU J;  4B86 A;  2R3S A;  1L4A B;  2IZ0 A;  2GA1 A;  3BCC E;  3C2C A;  1NWQ A;  2IBZ E;  3H1K J;  2YNY A;  4V2K A;  1SQB E;  1VQ8 P;  3WU2 E;  4YXD C;  1JOC A;  4U3F D;  1L4A C;  4WQB A;  2QSI A;  5E79 V;  4H44 D;  4R4M A;  3H1L G;  2P1J A;  1FCD C;  2L5G B;  3AE9 C;  155C A;  3L73 D;  1H1O A;  4EOT A;  2FYU E;  1GMJ A;  3AE7 C;  3CME P;  1LTS C;  1KQS O;  2QM7 A;  3TDK A;  1CHH A;  3I56 P;  1N90 A;  2WZ7 A;  3AEF C;  1GJQ A;  2N9J A;  4PWA A;  3VRD A;  3ZBM A;  1CZQ A;  5TIS H;  2WT7 A;  2W83 C;  3RK3 C;  1SQX E;  3ABV C;  1RAQ A;  3LID A;  2C8S A;  4TT3 H;  1IZL 0;  3L71 E;  2JWA A;  2NPS A;  2V07 A;  4JQ0 D;  4LC1 A;  1DH3 A;  3JCU E;  4YXW H;  3B5N B;  3TGU E;  2N9B A;  3RN0 A;  5B5E E;  3IF4 A;  1KQG B;  1LC2 A;  5AVW B;  4WQ8 A;  3BRV B;  3MUD C;  3HE4 A;  4WBA A;  5AW4 B;  1OZH A;  1KB0 A;  3CMA P;  2BCN B;  1LP1 B;  3P8C E;  1HZU A;  1ZR2 A;  1U7J A;  4AAL A;  2OQQ A;  3VMA A;  1PP9 J;  3U1C A;  4FA9 A;  1S1C X;  1M6Z A;  4EIC A;  4AAN A;  1RE3 A;  1L0N G;  1ZN5 A;  2BH4 X;  1NU1 D;  2W27 A;  4HKZ H;  1A56 A;  4FA1 A;  4RSZ A;  3KZI H;  4I1L A;  4RO0 A;  2JTI B;  1LTT C;  3P8M C;  1NTZ E;  1HH0 A;  5AVX B;  3NBT A;  1C6S A;  2R44 A;  3E7K A;  1AQ5 A;  4ZKP A;  3JBT B;  4IFD K;  5AVU B;  5APT A;  2ZON G;  3ZOW A;  3HUS A;  3KPE A;  3VN0 A;  2B12 B;  1YBK A;  1N73 C;  3H1L J;  5GTI H;  3V4Q A;  1IRW A;  3TGU G;  1PIX A;  3O6Q A;  2CE1 A;  2M5A A;  5AW5 B;  4K3I A;  4LGD E;  2I1K A;  1MG3 D;  4PD4 I;  1S5L V;  2A45 I;  3P32 A;  4OGQ B;  4ZNC A;  1S5L H;  4EIJ A;  1P84 I;  2B87 B;  1Y47 A;  5KJ7 D;  5EFW B;  3ZOY A;  4EDF A;  1HUC A;  3NBS A;  1CI6 A;  3GLM A;  5CIF B;  4MU8 A;  2QJY B;  3HD7 B;  4OGQ C;  1S2E A;  3HD7 A;  2O1K A;  4HB1 A;  2C1U A;  3Q2Y A;  1T6A A;  2WPQ A;  2FYU K;  3HD7 C;  4PJ0 E;  1RHZ B;  1RH5 B;  3L35 A;  1JEK A;  2C9X B;  1CRG A;  2GUS A;  1AKK A;  1BE3 G;  1JY2 P;  4A7P A;  1FOC A;  1ZR4 A;  2ZT9 D;  3G71 P;  1KYO E;  3HUS B;  1KN7 A;  2XZR A;  1DVH A;  3A0B E;  2QJP B;  1L4A D;  1IFD A;  1YJ9 P;  1P84 E;  1FDI A;  1N8R Q;  1BDD A;  2WT7 B;  1GL2 B;  2KZI A;  2XNX A;  1N7S A;  3A7O A;  1ZOY C;  5DJT B;  4OGQ D;  1FU1 A;  2E76 C;  4BWN A;  4JF7 A;  5M1B A;  3H1L D;  4UB6 V;  1GL2 C;  4N0K A;  1GU5 A;  3TF5 A;  5H2F H;  4XFJ A;  2CPB A;  1LP1 A;  4AUW A;  1KYO D;  3SSU A;  5BU8 B;  3DMI A;  2L91 A;  2IBZ D;  3OA7 A;  4L74 A;  1QX8 A;  1S9K D;  2BLF B;  2O01 N;  2B89 A;  4L3H A;  1JNM A;  1RF1 B;  1PP9 D;  1CTZ A;  3HRN A;  2FFD A;  1FS0 E;  2YKP A;  1W2B O;  3F89 A;  1VF5 D;  3VTP C;  3CXH I;  3B4S A;  1MZ4 A;  4PJ0 V;  3MUD A;  1U74 B;  3L4F A;  2M3E A;  2QE7 H;  5K5G B;  1H89 A;  2WSC H;  1SQP G;  3WUU A;  2WSF H;  3AE5 C;  4HYT B;  3CWB E;  2ZBO A;  2G8Y A;  4O9B A;  1M1K Q;  3CD6 P;  3MGN A;  5CMZ A;  3H1J D;  1NAF A;  1RE4 C;  2GUV A;  2ZXX A;  3SFE C;  2AIU A;  1CHI A;  4Y5R A;  2DGE A;  1HGV A;  1L9J C;  3MK7 B;  1Q82 Q;  3RL0 B;  1GK6 A;  2KOG A;  1A02 F;  3L75 J;  3G9R A;  2C1V A;  4KJM A;  5L8R J;  1K3H A;  4W7Z A;  3KZI V;  3H1H E;  1ZRT E;  1A8C A;  1IO4 A;  3CXH D;  1SFC D;  3RK3 E;  1KB9 E;  1NTK E;  3RL0 C;  1S9K E;  3A0H V;  5B66 V;  4N78 D;  1CSU A;  4UB6 E;  1DW3 A;  3EWK A;  2KI7 B;  5KLV K;  2FY8 A;  2B10 B;  1LTI C;  3L36 A;  3TSI A;  4U3F E;  4L76 A;  1ZME C;  1L0L D;  3GF3 A;  1L0L J;  2QJK C;  1SQP E;  1E5W A;  2H8P D;  1YCC A;  2R3C A;  1LTJ C;  3WFB C;  1CRI A;  3AE1 C;  3RBX A;  1KIL B;  1EDJ A;  1KIL E;  2WPS A;  3M9H A;  1YJN P;  2P7J A;  1LT9 B;  4H44 B;  4UB8 V;  1GQ1 A;  2A06 G;  1FI9 A;  2D2C D;  1L0L G;  1CYI A;  1PPJ G;  1J1D C;  2KS1 B;  2A45 H;  4WQ7 A;  1I8P A;  1IK7 A;  4WQE A;  5CCG D;  4HJG H;  1VQ7 P;  5E79 E;  4C46 A;  2FYU D;  1NTK G;  2BCC D;  1EDI A;  5DF5 A;  1S72 P;  2L4D A;  4XE5 B;  4C7R A;  4H13 D;  3L72 G;  5IY5 1;  1H32 A;  2K3R A;  3RN1 A;  2CPS A;  3KHU A;  2FXP A;  2LIR A;  1QVF O;  2IX7 C;  4MN4 C;  4D6T J;  5AVV B;  3L75 G;  1KD1 Q;  2VHD A;  2Y0E A;  1NTZ J;  3FWL A;  1N73 B;  1E2R A;  1PP9 G;  1SFC C;  4OH8 B;  3AE6 C;  1H32 B;  3AEC C;  2V08 A;  3O20 A;  3MZW B;  2YKQ A;  2E43 A;  1SQQ E;  1W5C T;  5KJ7 A;  5CBN A;  5APS A;  3T97 A;  3CX5 E;  1GL2 A;  2O01 J;  1L0N D;  1IRV A;  4C7N A;  1N7L A;  1IO3 A;  1I54 A;  3LW5 J;  3CP5 A;  2A06 E;  2P67 A;  1C75 A;  4QAO A;  4EI2 A;  5TJH A;  2QJY C;  3OA8 A;  2N18 C;  1BGY E;  3BAS A;  4NPE A;  2PRR A;  3CXH H;  3WC8 A;  2JO1 A;  1J2J B;  1YQ3 C;  1M1J B;  2LXB A;  4IOI H;  1SQQ J;  1SQQ D;  3A5T A;  1RF1 A;  1HBW A;  3B8E B;  1OVV A;  2Q7C A;  4TLF A;  1AV1 A;  3QWO C;  1YFC A;  4GYD A;  2NPS D;  1VQK P;  1NTM E;  5H2F V;  2V4H A;  1PP9 E;  1CNO A;  4W7Y A;  2KUB A;  1VQ4 P;  1QL1 A;  4JPZ B;  1NTZ K;  1C7M A;  1LC1 A;  4GT1 A;  2B0Z B;  5GTI V;  5KJ7 C;  1NMI A;  5DJQ B;  3U1A A;  2J5U A;  1JMB A;  1USE A;  2E75 C;  2KZJ A;  2MTA C;  5KLI C;  3X39 A;  1T3J A;  1F1C A;  3L71 J;  1SQV D;  5B6Q A;  3H1K E;  3VNW A;  1NKN A;  5KLI B;  2B11 B;  1YIT P;  2YXQ B;  3IR9 A;  1YEA A;  2V7Q J;  5CIH B;  1AYG A;  2OYH B;  3H1I D;  5KAI E;  3CL3 D;  1RF1 C;  1A2S A;  3H32 B;  4N6J A;  1CTJ A;  3CXH E;  3RK3 D;  4YTP C;  3CCL P;  2FYU G;  1J3S A;  1I6D A;  1LGH B;  3V2P A;  1T3U A;  1IFJ A;  1QVG O;  3Q3D A;  1K8A Q;  1H33 B;  3GHG B;  3CYT I;  2KLV A;  2FFD B;  5CIB B;  3CC4 P;  1ZZH A;  2JKV A;  1SQB K;  1RZ6 A;  4Y99 C;  1KB9 H;  3H1I J;  1HWT C;  1RE3 C;  1C6O A;  3D0W A;  2AXT H;  2Y0D A;  1DX7 A;  3L73 J;  1KIL D;  1L2P A;  1J1E B;  1G2C A;  5KLV E;  3TGU J;  1SQQ K;  2OTK E;  3MK7 C;  2B87 A;  1VQM P;  3HD7 D;  1NVO A;  3L74 G;  1M70 A;  3USS A;  1N7S B;  2BAS A;  2CA4 B;  2QM8 A;  2QIW A;  2C9N Y;  3LW5 H;  1PGQ A;  1GDT A;  3Q5P A;  2WVR A;  1FI3 A;  4BRY B;  1I6E A;  1EZV I;  2GM4 A;  1SQX K;  1HZV A;  1Q90 D;  1KQL A;  1AOQ A;  1EXI A;  2I8F A;  3I5C A;  3KQG A;  4EID A;  2BCC G;  3RBZ A;  1DT1 A;  5KAF H;  3RL0 D;  4K35 A;  2POH A;  1LTJ B;  1N15 A;  2PGD A;  1LWU A;  1A02 J;  2ZJS E;  3AEB C;  2YQB A;  1AJY A;  2Z5I A;  5TIS V;  2OZ1 A;  3H1J J;  1N7S D;  1L0N K;  3HE5 A;  1VF5 C;  1DIQ C;  1IFM A;  3TNU A;  5EXQ A;  3TYY A;  1CXC A;  3SLE A;  3CC2 P;  4EYY Q;  2ZZS 1;  5AW8 B;  1Z56 A;  3Q1M A;  5DFS A;  4CPG A;  2KYV A;  4JYC A;  2IBZ I;  3ZCF A;  1PGP A;  1Y9B A;  2YK3 A;  4WQA A;  1PL5 A;  1SQV G;  3V2Q A;  1BCC E;  1SQP D;  3V6I A;  3RK2 D;  1RQV A;  2ZOO A;  2KXP B;  3MTU E;  3A0H E;  1JTH B;  5B66 E;  2E5T A;  5APW A;  1HGZ A;  1SFC B;  1JO5 A;  4L73 A;  2E76 B;  3CC7 P;  1NHL A;  1SQB D;  3WMM 0;  2B9B A;  2E75 D;  4GOF A;  1CYC A;  3CCM P;  2Z4E A;  1E29 A;  1KZU B;  1GDV A;  4WQD A;  1DW2 A;  1LFM A;  2HPC A;  1FJ0 A;  3QH9 A;  3O5C A;  1BE3 E;  3L37 A;  2E74 C;  3HQ6 A;  1KC8 Q;  5C39 A;  3HQ8 A;  3VYM A;  3RMZ A;  2M8R A;  1K3G A;  3L70 E;  3PXT A;  2YO2 A;  4N3Y B;  1DW1 A;  1E79 H;  2W6A A;  1JM0 A;  5KKZ C;  1BGY G;  1VPC A;  1SQB G;  5AW2 B;  2NPS C;  1HJ4 A;  1SQV E;  4R4L A;  1TU3 F;  4O1W A;  3AEG C;  4DZO A;  1YNR A;  1U7M A;  3H1K G;  1NTK K;  1L4A A;  2LKM A;  2KS1 A;  1CYJ A;  2K1A A;  3CPW O;  3SWS A;  2NPS B;  1XTC C;  3WFD C;  1CXA A;  2O1J A;  2N9I A;  1N9C A;  4DJG A;  1CSW A;  2ZYG A;  3SWF A;  2C1D A;  1T8Z A;  5C9M A;  1IFI A;  3N7N A;  5DJQ C;  1HCM A;  1EQ7 A;  1FJK A;  1ZW0 A;  1GKS A;  1OAE A;  2KB7 P;  1SS1 A;  3PTZ A;  1X8Y A;  2WQY C;  1SQV J;  2E74 D;  1N73 A;  3OCD B;  2OTL P;  3L71 G;  1T2K D;  3NTN A;  3L70 G;  1VQO P;  1KTM A;  1DEB A;  2WMM A;  1URQ C;  1FI7 A;  5KLV G;  3SWK A;  2QJK B;  1H0T B;  3LIE A;  3EFG A;  3SXT A;  4I7Z B;  3PP5 A;  5BVZ A;  5BU5 A;  1URQ B;  2D2C B;  1IC2 A;  4W80 A;  3VMY A;  1FAV A;  1OFC X;  3SWY A;  1JB0 J;  4H44 C;  2IDB A;  3M9B A;  5KLV D;  2D2C C;  5CJ4 A;  1NJI Q;  3H1J E;  3B71 A;  2HV4 A;  4J20 A;  2YCC A;  1FZA A;  1KIL A;  4N78 E;  2E5Y A;  1L0L K;  3GF7 A;  2JEE A;  1Q81 Q;  1G1I A;  2AEJ A;  1R5L A;  5GTI E;  2HG5 D;  3W68 A;  1LMS A;  1NO4 A;  1NYH A;  3T97 B;  5CHX A;  4FA5 A;  1GTW A;  2I8D A;  1KOR A;  3KYQ A;  1AFO A;  1S5L E;  1FZC A;  1COR A;  3H25 A;  1DIP A;  2OTJ P;  5APX A;  5B5E H;  1BSN A;  3M0A A;  3CCE P;  4XXL A;  5CIE B;  3PJS K;  1E8E A;  2P2U A;  4H13 C;  3U59 A;  2WTY A;  1QL4 A;  3IN6 A;  1CCR A;  1IFN A;  1IJD B;  1FZC B;  4EIE A;  1BCC G;  1NH4 A;  3OCD A;  4IFF A;  5AW6 B;  1NU1 E;  2N18 B;  3UIA A;  5TIS E;  4YPC A;  4WQ9 A;  3CI9 A;  3L4M A;  1SFC A;  1D7M A;  3WU2 H;  1DII C;  1VF5 B;  5CCH A;  1M1J C;  1ZV8 A;  2N1T B;  1NTZ D;  2PFX A;  2Q9I A;  3HQ9 A;  2K9Y A;  3JCU H;  3DR0 A;  1CIH A;  3A0B V;  4FA4 A;  3PXS A;  1BCC D;  4ASV A;  1S4X A;  3MIW A;  3A0B H;  2P10 A;  2E42 A;  3O0R C;  2BEQ D;  1GZL A;  1N50 A;  3L70 D;  2ZAE B;  1YHQ P;  2ZYD A;  2PCC B;  2BGV X;  2B4Z A;  4GIF A;  1OW8 A;  1HJ3 A;  4GOD A;  2IPP A;  5E79 H;  2MJZ A;  3A3Y B;  1H8A A;  3HE5 B;  1CW5 A;  3WUI A;  3WFC C;  1HTL C;  1BE3 D;  2Z5H A;  2E75 B;  1GL2 D;  1LWU B;  2E76 D;  2KSE A;  1L0N E;  5CCG A;  4XYD B;  2FKW B;  3FWN A;  5KAI V;  1FZF A;  2GC4 D;  1R5S A;  1B7V A;  3F5H A;  2D0S A;  2OYH C;  2LR2 A;  2C1D B;  2HFE D;  3NXS A;  2XND H;  2HLO A;  1X79 B;  4Q5P A;  2K37 A;  1CRC A;  3GHG C;  2IYO A;  3HTK A;  4WVZ A;  1AOF A;  2G3A A;  3AE3 C;  1EZV E;  2FYN C;  4Y99 B;  3HQ7 A;  1W2E A;  1G1J A;  3TK1 A;  3G3Z A;  3M0D C;  4LJI A;  1NTM K;  3AED C;  1IZN B;  3K5B A;  1H88 A;  3M0D A;  4OVN F;  2C2C A;  4PV1 B;  4BXL A;  3C9I A;  2MHM A;  1S3J A;  3PLN A;  5GTH E;  1QLE D;  1I5T A;  1CRJ A;  3BVH A;  3GG2 A;  3ZOX A;  2ITA A;  2YMK A;  2HPC B;  1NU1 K;  1C2R A;  2JDI H;  3AE4 C;  1UII A;  1W5C E;  1KYO W;  5CYT R;  2P58 A;  1USD A;  1ZXG A;  4L75 A;  1FBM A;  1VQN P;  4EIF A;  1JY3 N;  2K9J B;  1U75 B;  2DVH A;  3P8C D;  1YIJ P;  3Q5R A;  4H0J A;  1RY3 A;  2V7Q H;  3JC2 2;  2CE0 A;  1DD3 A;  2PP6 A;  3E1I A;  1WVE C;  3WFE C;  4AAO A;  2XU6 A;  1H9Y A;  4JCG A;  2OYI A;  3D71 A;  1KFM A;  2MKV A;  3AEA C;  4IL6 E;  2AEF A;  3FXE A;  2WSC J;  3N4X A;  1PV3 A;  1KQF B;  1K05 A;  1KIL C;  3H1I G;  3L74 J;  1QN2 A;  1P84 H;  1RE4 A;  3L70 J;  3CX5 I;  2B88 A;  1G2C B;  1KX7 A;  3H1H D;  1FDO A;  4M3L A;  2YO3 A;  3CLQ A;  1NML A;  1JY3 P;  2Q3E A;  3AE8 C;  5CIG B;  4IL6 H;  5CID B;  1OCD A;  1MZ9 A;  1Q2N A;  1OMI A;  1NTZ G;  4IL6 X;  3CX5 H;  3CCU P;  2AI5 A;  1R8E A;  1FE6 A;  2ORL A;  2J58 A;  3O1Y A;  1KMI Z;  3CCS P;  2OYO A;  1CRH A;  2FYU J;  3BCC G;  3OA8 B;  2XDJ A;  1KB9 D;  1NTK D;  2Q6Q A;  2OYH A;  1IK9 A;  1FDM A;  3B5N D;  3GW6 A;  4JYB A;  3ZDM A;  2K9J A;  4IFM A;  4XA4 A;  2WPV B;  3CCR P;  1FZC C;  4PV1 D;  5C0Z A;  2CA3 B;  3L75 D;  1WT6 A;  3FX0 A;  2YKO A;  3VP9 A;  1L0L E;  2BEZ F;  1RF0 A;  1LT1 A;  3BAT A;  2IYP A;  2WSS H;  5CCG C;  1WEJ F;  2J59 M;  3BRT B;  5KKZ B;  3P7K A;  3RK3 B;  2N1T C;  4WQC A;  1AQT A;  5AW0 B;  1S5L X;  3ZIY A;  4Z1M H;  2UWJ E;  1L0N J;  4LLH A;  1C52 A;  1LS9 A;  2NRG A;  3L75 E;  3S4R A;  3CCJ P;  1KYO H;  3B5N C;  3G4S P;  1YEB A;  3EQ2 A;  1T2K C;  3KXD A;  1HVV A;  2JWD A;  1JUN A;  1NU1 J;  1S6V B;  1SQQ G;  4NFG B;  2H7H A;  1HF9 A;  1EDK A;  2WWW A;  1MG2 D;  4H0L D;  4KMG A;  2GIW A;  3FXD A;  1KYO I;  451C A;  4GKG A;  1PGO A;  4IL6 V;  1OXZ A;  1URQ A;  3V2R A;  1DEE G;  3C8V A;  4FAV A;  1SVF A;  1KIB A;  3L73 E;  4D6T G;  4U3F J;  1BDC A;  3L72 E;  1JMM A;  2PCB B;  1H0T A;  1VDF A;  4WY4 A;  4AAM A;  3A9F A;  1NTK J;  4UB6 H;  1DD4 A;  3Q5S A;  1FZE A;  3A2A A;  2HOD A;  1NTM J;  2N1T D;  1AVO A;  4KHX A;  2WSE H;  5CJ0 A;  2GC7 D;  1FZB A;  4PD4 E;  1M7L A;  1P84 D;  3KDP B;  1JCD A;  4PJ0 H;  3I55 P;  4PV1 C;  1BGY J;  1JCC A;  2BPB B;  2AXC A;  2XKM A;  3RK2 C;  4C7N B;  1H31 B;  3L73 G;  3H1I E;  3NMD A;  1CSX A;  3H1L E;  2OGU A;  5KAF V;  4NPD A;  3D6Y A;  2Q3I A;  1YQ4 C;  3CWB D;  2JR8 A;  1GK4 A;  3VYI A;  1W2L A;  1VYD A;  1NNO A;  2OAR A;  2WPR A;  1EDL A;  1ETP A;  1ZP0 C;  3OJA B;  3WU2 V;  4WY4 B;  3RL0 g;  1FJP A;  3CCQ P;  1PGJ A;  3D70 A;  5H2F E;  3AE2 C;  5AW9 B;  3CWB G;  2GB8 B;  4AQR D;  4O1Q A;  4WY4 C;  2DW3 A;  2IBZ G;  3M91 A;  3BCC D;  5KTB A;  1LJ2 A;  3VP8 A;  1LT9 A;  1NAY A;  1DW0 A;  1CHJ A;  1OW6 A;  4ASW A;  3CXH W;  2WSE J;  1M90 Q;  4H0L B;  1JY3 O;  4UB8 H;  3C1L A;  2YMY A;  4D6T D;  4AYC A;  1SQP J;  1H9X A;  1YJW P;  2JP3 A;  5AUR A;  3PRJ A;  1CCH A;  1X9V A;  1QL2 A;  2AEM A;  3VOP A;  5CIC B;  4P4Q B;  1I8O A;  4H0K A;  4H0L C;  1SQX J;  5AVS B;  5AVQ B;  4PW9 B;  2H88 C;  1LWU C;  1YYC A;  4U7J A;  1SQX G;  3IAO A;  3IFM A;  2CK3 H;  1CI6 B;  1OX3 A;  3ITK A;  4K3A A;  2QA4 P;  3OAK A;  1WMK A;  4DT0 A;  3TGU D;  1HH7 A;  3DP5 A;  1QL3 A;  2Y9Y A;  1LTB C;  1JY2 N;  1FOS E;  1U57 A;  2O01 H;  3NWV A;  1K04 A;  2I1J A;  3V5B A;  3M97 X;  4BRY A;  2FYN B;  2NZ2 A;  1MFT A;  2LXC B;  3CWB J;  4Y28 J;  1I55 A;  1JTH A;  1NIR A;  2Y0C A;  3TYI A;  2CXB A;  4D6T E;  1FZG A;  2BCC E;  1CC5 A;  2ZVO B;  2BH5 X;  2KSJ A;  4I6M C;  5APY A;  4U3F G;  1SQV K;  3TNU B;  3MHV A;  1EB7 A;  2JJL A;  1KX2 A;  2XV5 A;  1PPJ D;  1GW4 A;  1BCC J;  4WB4 A;  1CIE A;  2IZ1 A;  2YXR B;  5APQ A;  2OZ1 B;  1BGY D;  1KB9 I;  1R0Q A;  3HE4 B;  1AA0 A;  1FC2 C;  3L72 D;  2Q5U A;  1CSV A;  2FYZ A;  1J1D B;  4PD4 D;  2C9L Y;  5CBO A;  2M5A B;  3CX5 D;  1H33 A;  5AVY B;  3O6Q B;  4OWF A;  1EZV D;  3VMZ A;  2YIU C;  4FB1 A;  5KAF E;  4L1Q A;  3L4O A;  1HJ5 A;  4PD4 H;  3M9Q A;  2OYI B;  2KNC A;  2SPZ A;  1K9M Q;  1QGK B;  2KP8 A;  1GD2 E;  1BL9 A;  3PH0 A;  3RGU A;  4GED B;  4UB8 E;  2WSF J;  2OYI C;  1RQU A;  4I7Z C;  3V2N A;  2FXM A;  1Q7Y Q;  1NOH A;  1X0T A;  2Q1K A;  1BSH A;  1NTM G;  1LTG C;  5AW7 B;  2KNC B;  4QMA A;  3SJL A;  1HRC A;  3SFD C;  4RJT A;  1PFI A;  4RES B;  1YTC A;  1SQX D;  4ZMD A;  4KT0 J;  5GTH V;  2QRX A;  3GMA A;  5CCH D;  2N3Y A;  4I2L C;  3GHG A;  1JDL A;  2PAJ A;  3WUT A;  2WIT A;  1OVU A;  2QVA A;  2LIT A;  2QG4 A;  3RK2 B;  1MFZ A;  3CCV P;  3B5N A;  3BCC J;  1IFP A;  1LTJ A;  1EXJ A;  3HTK B;  2K88 A;  2N9Y B;  1C6R A;  1RZ5 A;  3AEE C;  1YTZ T;  5DJU B;  3D6Z A;  5AVZ B;  2JQR A;  3WUV A;  1KV4 A;  1MV8 A;  2ZXY A;  3NFQ A;  3OW2 O;  2W90 A;  1CTY A;  4H13 B;  4GOE A;  1NGM B;  1MKM A;  2AXT V;  2C0X A;  2BCC J;  1VQ6 P;  2M0B A;  1OVR A;  1FOS F;  1KFN A;  1M56 D;  2QJP C;  2R5B A;  2W8Z A;  1MUU A;  1GIW A;  2AXT E;  2QEX P;  2KIK A;  1LNQ A;  3SVW A;  4GDO A;  1Q86 Q;  1M60 A;  4DY9 A;  351C A;  1HJ0 A;  2C0W A;  2M3B A;  2HYN A;  1HJB A;  3R4Y A;  3PHL A;  2KK7 A;  4AX3 A;  3L74 E;  3V4W A;  2KLU A;  5APU A;  2A06 D;  2IFM A;  1N2D C;  1PZQ A;  5CCH C;  1QKS A;  1CIF A;  2D0W A;  2FFD C;  3MP7 B;  1WRG A;  3H32 A;  3H1H G;  5AVR B;  5B5E V;  1K73 Q;  1RAP A;  1IQC A;  1CO6 A;  1ZRT D;  2FRC A;  1BE3 J;  2EXV A;  2HR3 A;  1CIG A;  1NTM D;  3L74 D;  1NKZ B;  4JBZ A;  4WY4 D;  3JSV C;  1CRY A;  1VQ9 P;  5APV A;  5AVT B;  1QYZ A;  1J1E C;  3S1K A;  3CU4 A;  3ORV A;  2Y9Z A;  1RF0 C;  4DCK A;  1YTZ I;  3S9O A;  1N7S C;  3L71 D;  2FWL A;  2ZYA A;  2RH0 A;  1KV9 A;  2H89 C;  2R32 A;  2W6J H;  1VQ5 P;  1GW3 A;  2A45 G;  1M8O B;  1EZV G;  3W67 A;  1ZLL A;  4YE1 A;  1PPJ E;  2RMZ A;  1SQB J;  2IFN A;  1URQ D;  1M57 D;  1C2N A;  1X22 A;  1L9B C;  3KZI E;  1OIP A;  1SLQ A;  3PXW A;  1NU1 G;  2RKL A;  2FBW C;  3A0H H;  5B66 H;  1M1J A;  1F1F A;  5AW3 B;  1H31 A;  1OW7 A;  1YI2 P;  1SP4 A;  1LTA C;  2N1T A;  1Y8A A;  1YIC A;  2XTS B;  3II6 A;  1JY2 O;  1YIQ A;  5GTH H;  2VRS A;  1XTG B;  2H43 A;  3ZOO A;  5KAI H;  1FHB A;  1LT9 C;  2ZT9 C;  1QEX A;  4NPF X;  1DVV A;  2YIU B;  1VQP P;  4WWI A;  3O8Z A;  2ZXE B;  2N3B A;  1SQP K;  1VQL P;  3E1R A;  1CSB A;  3FGA D;  1UIX A;  2ZT9 B;  2HOD B;  3H6P A;  1AVY A;  4ZKU A;  3HUS C;  2FXO A;  1N86 A;  1VL2 A;  3G6E P;  5KLV J;  2W6B A;  1CED A;  1OWA A;  3VMX A;  3MD0 A;  3M06 A;  1GU2 A;  3H1J G;  1HRO A;  2ZVN B;  1EC5 A;  4DOJ A;  2PAC A;  2E74 B;  3H1H J;  3L72 J;  3RLM A; 
#chains in the Genus database with same CATH homology
 2N18 C;  3PH2 B;  1DW0 A;  1NTZ D;  1CHJ A;  3HQ9 A;  3DR0 A;  1CIH A;  3A0B V;  4FA4 A;  4L3G A;  3PXS A;  1BCC D;  3CX5 W;  4FAN A;  1COT A;  3CXH W;  2RN0 A;  3H1K D;  2O3J A;  3WC8 A;  1SQQ D;  4D6T D;  3O0R C;  1H9X A;  1N50 A;  3L70 D;  3C2C A;  5AUR A;  3PRJ A;  1CCH A;  1YFC A;  4GYD A;  5CIC B;  4P4Q B;  1I8O A;  4H0K A;  4V2K A;  2PCC B;  2BGV X;  2B4Z A;  5H2F V;  4PW9 B;  4U3F D;  1HJ3 A;  4WQB A;  1CNO A;  3WUI A;  5E79 V;  3WFC C;  1BE3 D;  3ITK A;  1C7M A;  1FCD C;  1LC1 A;  155C A;  2B0Z B;  5GTI V;  3L73 D;  1NMI A;  1H1O A;  5DJQ B;  4XYD B;  3TDK A;  1CHH A;  3TGU D;  1HH7 A;  3DP5 A;  1QL3 A;  5KAI V;  2MTA C;  1N90 A;  2GC4 D;  1GJQ A;  2N9J A;  4PWA A;  3VRD A;  3X39 A;  1B7V A;  3NWV A;  3ZBM A;  2D0S A;  1F1C A;  2C1D B;  1SQV D;  5B6Q A;  1RAQ A;  3M97 X;  3VNW A;  2FYN B;  5KLI B;  2B11 B;  2C8S A;  1IZL 0;  4Q5P A;  1YEA A;  5CIH B;  1CRC A;  1AYG A;  1I55 A;  3H1I D;  1NIR A;  2JWA A;  2V07 A;  2Y0C A;  3TYI A;  1A2S A;  2CXB A;  1AOF A;  1CTJ A;  1J3S A;  1CC5 A;  1I6D A;  3HQ7 A;  2BH5 X;  1H33 B;  3RN0 A;  3CYT I;  5CIB B;  1LC2 A;  1EB7 A;  1ZZH A;  4LJI A;  4WQ8 A;  1KX2 A;  1PPJ D;  1RZ6 A;  1CIE A;  2OZ1 B;  1BGY D;  1KB0 A;  2C2C A;  1C6O A;  1R0Q A;  2BCN B;  1HZU A;  3L72 D;  4AAL A;  1CSV A;  3VMA A;  2Y0D A;  4FA9 A;  1M6Z A;  2MHM A;  4PD4 D;  4EIC A;  4AAN A;  3PLN A;  1I5T A;  1CRJ A;  2BH4 X;  1NU1 D;  3CX5 D;  1H33 A;  1A56 A;  3GG2 A;  4FA1 A;  4RSZ A;  3MK7 C;  3ZOX A;  1EZV D;  2JTI B;  1C2R A;  1M70 A;  4FB1 A;  2CA4 B;  1KYO W;  4L1Q A;  3NBT A;  3L4O A;  1HJ5 A;  5CYT R;  1C6S A;  3JBT B;  4EIF A;  2K9J B;  1FI3 A;  1U75 B;  1BL9 A;  2DVH A;  2ZON G;  3ZOW A;  1I6E A;  1HZV A;  4GED B;  4H0J A;  2B12 B;  1AOQ A;  2I8F A;  2CE0 A;  1IRW A;  1WVE C;  3WFE C;  4EID A;  4AAO A;  1DT1 A;  2CE1 A;  1H9Y A;  4JCG A;  2KNC B;  4K3I A;  3SJL A;  1MG3 D;  1HRC A;  1S5L V;  4RJT A;  1N15 A;  1YTC A;  1SQX D;  2YQB A;  3ZOY A;  4EDF A;  1QN2 A;  5TIS V;  3NBS A;  5GTH V;  2OZ1 A;  5CIF B;  1KX7 A;  4MU8 A;  2QJY B;  3H1H D;  1DIQ C;  5EXQ A;  2N3Y A;  2C1U A;  1CXC A;  1JDL A;  3SLE A;  1NML A;  2LIT A;  2QG4 A;  2Q3E A;  5CIG B;  2ZZS 1;  5CID B;  1OCD A;  5DFS A;  2C9X B;  1CRG A;  3ZCF A;  2AI5 A;  1AKK A;  2N9Y B;  2YK3 A;  4WQA A;  1C6R A;  4A7P A;  2ORL A;  3O1Y A;  1FOC A;  1RZ5 A;  1SQP D;  2ZOO A;  1CRH A;  3OA8 B;  1KB9 D;  1NTK D;  2JQR A;  3GW6 A;  2ZXY A;  1CTY A;  1DVH A;  2QJP B;  2AXT V;  1SQB D;  5C0Z A;  2CA3 B;  3L75 D;  1CYC A;  1E29 A;  1GDV A;  4WQD A;  1DW2 A;  1LFM A;  1FJ0 A;  3O5C A;  3H1L D;  1GIW A;  4UB6 V;  4N0K A;  1WEJ F;  3SVW A;  3TF5 A;  5KKZ B;  3HQ6 A;  1M60 A;  4DY9 A;  4WQC A;  1KYO D;  351C A;  3HQ8 A;  3DMI A;  2L91 A;  2IBZ D;  3VYM A;  3RMZ A;  1K3G A;  3PHL A;  2BLF B;  3PXT A;  4AX3 A;  4L3H A;  3ZIY A;  1DW1 A;  2A06 D;  1C52 A;  1LS9 A;  1PP9 D;  1CTZ A;  1HJ4 A;  4O1W A;  1QKS A;  1YNR A;  1YEB A;  1CIF A;  1MZ4 A;  4PJ0 V;  2D0W A;  1U74 B;  1S6V B;  1CYJ A;  2KS1 A;  5B5E V;  3SWS A;  3WFD C;  4NFG B;  2ZBO A;  1RAP A;  1IQC A;  1CO6 A;  1ZRT D;  2FRC A;  2EXV A;  1CXA A;  2N9I A;  1N9C A;  1CIG A;  1CSW A;  3H1J D;  1MG2 D;  1NTM D;  3L74 D;  4KMG A;  2AIU A;  2C1D A;  2GIW A;  1CHI A;  1CRY A;  5C9M A;  1QYZ A;  5DJQ C;  4Y5R A;  2DGE A;  451C A;  1HCM A;  3CU4 A;  3ORV A;  1GKS A;  1OAE A;  1L9J C;  3MK7 B;  4IL6 V;  3PTZ A;  3L71 D;  2FWL A;  4FAV A;  3OCD B;  2C1V A;  1KIB A;  1KV9 A;  1K3H A;  2PCB B;  3KZI V;  1A8C A;  3CXH D;  1FI7 A;  3A0H V;  5B66 V;  1CSU A;  4AAM A;  1DW3 A;  3A9F A;  2QJK B;  2B10 B;  4YE1 A;  3SXT A;  2RMZ A;  1C2N A;  1L9B C;  1L0L D;  1YCC A;  3PXW A;  2GC7 D;  1F1F A;  3WFB C;  1CRI A;  5KLV D;  1H31 A;  1P84 D;  2HV4 A;  4J20 A;  2YCC A;  1YIC A;  2XTS B;  4UB8 V;  1GQ1 A;  1YIQ A;  1FI9 A;  1CYI A;  2BPB B;  4WQ7 A;  1I8P A;  1H31 B;  1LMS A;  3ZOO A;  1FHB A;  4WQE A;  4FA5 A;  1CSX A;  1DVV A;  2YIU B;  5KAF V;  2FYU D;  2BCC D;  5DF5 A;  2L4D A;  2N3B A;  1COR A;  5IY5 1;  3CWB D;  1H32 A;  3RN1 A;  3KHU A;  2LIR A;  1W2L A;  1VYD A;  1NNO A;  4XXL A;  5CIE B;  2VHD A;  2Y0E A;  3FWL A;  1E8E A;  1E2R A;  1ETP A;  1H32 B;  1QL4 A;  3WU2 V;  1CCR A;  2V08 A;  3O20 A;  4EIE A;  1W5C T;  3OCD A;  2GB8 B;  4O1Q A;  2N18 B;  1CED A;  1L0N D;  1IRV A;  4WQ9 A;  3BCC D;  1GU2 A;  1IO3 A;  1HRO A;  3L4M A;  1I54 A;  3CP5 A;  2PAC A;  1C75 A;  4QAO A;  5TJH A;  1DII C;  3RLM A;  3OA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...