5KLIB

Rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
b'AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 67
structure length 256
sequence length 256
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5kliB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 5kliB02
4EIFA 2L91A 1FI9A 4FB1A 3MK7C 5B6QA 1C6RA 1U75B 4AALA 1YNRA 3CX5D 2PCCB 5EXQA 2C1VA 4RSZA 3NWVA 1EB7A 2ZXYA 1NTMD 1HH7A 1A8CA 2DGEA 4EDFA 2GC4D 4XXLA 2HV4A 1CHJA 1E29A 1H33B 1W2LA 1W5CT 4FAVA 4WQ9A 2ZONG 1L9JC 4LJIA 2C2CA 3PH2B 4V2KA 1QL4A 2EXVA 1N15A 2YQBA 3O0RC 1CSWA 1CIEA 3HQ7A 2KNCB 1FI3A 2B0ZB 2B12B 2L4DA 1CC5A 4H0JA 1N50A 3SWSA 4RJTA 1R0QA 1M6ZA 4J20A 4PW9B 5C0ZA 4AAOA 1I55A 4WQEA 3DR0A 1FOCA 3SXTA 3H1ID 3M97X 1IQCA 5DJQB 1YFCA 4FA5A 1KIBA 1B7VA 2A06D 5CIGB 1DW3A 1E8EA 3GW6A 1GU2A 3RN0A 1C2RA 5KKZB 3ZOYA 1H9XA 2BH4X 2YCCA 1NMIA 1J3SA 1WVEC 3ZOOA 2AI5A 4EICA 2Q3EA 1WEJF 2Y0CA 1H31A 4Y5RA 3PXSA 3CYTI 2JWAA 3A0HV 5H2FV 3PXWA 2VHDA 5TJHA 1LC2A 1SQXD 3NBSA 2N3BA 2QJKB 1YIQA 3OCDA 3HQ9A 155CA 1KV9A 1NU1D 4L3GA 2BPBB 3O1YA 1YICA 1I6EA 2ORLA 2O3JA 4FA9A 5KAFV 5CIBB 1HJ4A 3PRJA 3L72D 1CRJA 1N90A 1CEDA 3NBTA 3MK7B 2C1UA 4O1WA 1I8OA 5KAIV 4AANA 1AOQA 1KB9D 1BL9A 3GG2A 2N9IA 4H0KA 2FRCA 1CTJA 3KHUA 2RN0A 2YK3A 5GTHV 1L9BC 1I5TA 1QYZA 1C7MA 1CRGA 2QG4A 3L74D 2N9YB 4WQDA 4FA1A 3VMAA 4L1QA 3PTZA 3X39A 1OCDA 2ZOOA 3A0BV 1H33A 2Y0DA 1CRHA 2PCBB 1KB0A 3CU4A 5CIHB 1LMSA 1KX7A 1A56A 1DW2A 3ITKA 1F1CA 5DFSA 3DP5A 3C2CA 2QJPB 1SQVD 2LIRA 1KX2A 1HJ5A 1C52A 3WFDC 1CNOA 1DIIC 2FWLA 1PPJD 2N3YA 5E79V 2B4ZA 1I6DA 3H1HD 2RMZA 4GEDB 5CIFB 1JDLA 4WQBA 3VYMA 1EZVD 2B10B 2BCNB 2GB8B 3ZCFA 4N0KA 1CRCA 2BCCD 3VNWA 3WU2V 2C1DB 1C6SA 2QJYB 1ETPA 5GTIV 1C75A 4IL6V 1DW1A 2OZ1B 1CXAA 2K9JB 2N9JA 2AIUA 1CORA 1HROA 4UB8V 1NTZD 1CTZA 1HZVA 2FYNB 5CICB 4Q5PA 1FJ0A 1H32B 1SQQD 2GIWA 3TF5A 2GC7D 1L0ND 2MTAC 1GQ1A 2LITA 1QN2A 1C2NA 3ZIYA 1CIGA 2N18C 1M70A 2BLFB 1CCRA 451CA 1AOFA 3OA8B 4MU8A 3L73D 5DF5A 1IRVA 5IY51 3WFBC 1AKKA 3H1LD 4EIDA 3L71D 1L0LD 3PXTA 1CSXA 5CIDB 3RN1A 1K3HA 4PJ0V 4AX3A 4GYDA 2FYUD 4KMGA 4YE1A 5B66V 1S5LV 3HQ8A 5C9MA 1GIWA 3KZIV 1RAQA 2C8SA 4DY9A 3RMZA 3H1JD 2KS1A 1CYJA 3SLEA 1DVHA 2B11B 4WQ7A 1PP9D 1U74B 2XTSB 1CXCA 2BGVX 5TISV 1CIHA 3WUIA 3SJLA 1MG3D 2Y0EA 1C6OA 1FI7A 1QKSA 2YIUB 1AYGA 1LFMA 4NFGB 1NIRA 4A7PA 5AURA 2CE0A 1LS9A 1COTA 1NMLA 4PD4D 4PWAA 1S6VB 1GKSA 3TYIA 1CRIA 5KLVD 1HCMA 3PLNA 3HQ6A 1CIFA 1GDVA 3WFCC 3O5CA 1NNOA 1K3GA 2DVHA 3RLMA 3ORVA 4AAMA 3L70D 3A9FA 4U3FD 1YEBA 4P4QB 3L4OA 3L4MA 4FA4A 3CWBD 4QAOA 1H1OA 4L3HA 1A2SA 2PACA 2CA3B 2MHMA 4UB6V 1DT1A 3CP5A 1DVVA 1CRYA 1SQPD 2CA4B 2D0SA 1RZ6A 1YTCA 1N9CA 4EIEA 1FCDC 1ZZHA 1NTKD 2C1DA 3TGUD 1BGYD 1GJQA 1QL3A 1YEAA 3PHLA 3WFEC 1DW0A 2JTIB 2OZ1A 3TDKA 2JQRA 5KLIB 1HZUA 2CE1A 1KYOW 2ZZS1 1CCHA 1H9YA 5B5EV 2CXBA 3BCCD 3ZOWA 1MZ4A 2AXTV 4O1QA 1CTYA 1I54A 3DMIA 4WQAA 5DJQC 1H32A 1CYCA 3SVWA 1BCCD 4WQCA 2IBZD 1SQBD 3JBTB 3O20A 4D6TD 1RAPA 1YCCA 1LC1A 4K3IA 5CYTR 2N18B 3FWLA 1F1FA 1IO3A 1FHBA 1CSUA 1MG2D 5CIEB 3H1KD 1H31B 1BE3D 1VYDA 3L75D 3CXHW 3OA8A 1HJ3A 351CA 1CO6A 1CSVA 2V08A 1IZL0 1KYOD 1P84D 2V07A 1CHIA 1I8PA 3CX5W 1E2RA 1M60A 2C9XB 4FANA 1CYIA 4WQ8A 2I8FA 3OCDB 1RZ5A 4XYDB 2ZBOA 1IRWA 1HRCA 3VRDA 2BH5X 1CHHA 4JCGA 3ZBMA 1DIQC 1ZRTD 3ZOXA 1OAEA 3WC8A 2D0WA 3CXHD
chains in the Genus database with same CATH superfamily
1KORA 1FI9A 1U7JA 2K1AA 2W27A 4FB1A 2E74C 3V4WA 4AALA 2IDBA 2O1JA 3C9IA 3AE6C 5EXQA 3NWVA 5CCHD 2ZXYA 1S3JA 5K5GB 3IN6A 1DH3A 1A8CA 2DGEA 1CI6A 4XXLA 4AYCA 2QSIA 1H33B 4EI2A 2NPSC 2RH0A 2AEFA 2Z5HA 1FJKA 2ZONG 2CK3H 4LJIA 3D70A 3H1HE 1QL4A 2EXVA 1JCDA 1IO4A 3O0RC 1CSWA 1LWUC 2E75B 1JB0J 1N73C 3A0HH 2WMMA 2NRGA 5APYA 1SLQA 1N50A 3FXDA 1RF1A 3SWSA 1NTKG 3TGUG 4RJTA 1BGYG 3P8CD 2WT7A 3LIDA 4J20A 3Q3DA 2QIWA 4AAOA 1FZFA 1I55A 3MIWA 3M97X 1EXIA 1Z56A 1G2CA 4OVNF 1GU5A 1B7VA 1ZLLA 1NTZE 3NFQA 5AVYB 1GU2A 1OX3A 1U57A 3BRTB 3IAOA 3TNUA 3AE8C 1H0TB 1GL2C 1U7MA 5B66H 1JEKA 4H44B 1IK7A 1YJ9P 1OWAA 1RE4C 5AVSB 2Q3EA 3WUVA 4H0LC 1FE6A 2DW3A 1HBWA 2IBZI 3GLMA 3A5TA 1K9MQ 1T6AA 5TJHA 2W90A 5APQA 3AEAC 2N3BA 3SWYA 3MD0A 1L0LE 1JY2P 1VQLP 1YIQA 3JC22 3KDPB 2YKQA 3M9HA 4I7ZC 1NU1D 4L3GA 1FDOA 1P84I 4K3AA 1S4XA 4ZKPA 3CCJP 1I6EA 5KAFV 1ZN5A 3L72D 1PP9E 1CRJA 1D7MA 1CEDA 1N2DC 3NBTA 3F89A 3MK7B 2C1UA 4AANA 2OYHC 2FYUJ 2N9IA 4H0KA 1M1JC 3CCEP 2FRCA 3D6YA 1RY3A 3Q5PA 1M8OB 1L9BC 1M57D 2KS1B 3L74J 1OFCX 3L74D 1NTMG 4WQDA 4FA1A 3M9BA 2HG5D 3A0BV 2WSFH 3HTKA 3C8VA 1IZNB 1AVOA 4Y28J 4U3FE 1GW3A 2YIUC 2BASA 5KTBA 4UB6E 1MFTA 1Q90D 1ZOYC 3OW2O 5KLVJ 3DP5A 2LIRA 1FOSF 2KXPB 1HJ5A 1C52A 1RQUA 3L70J 3BVHA 4N78D 3V2PA 1VF5C 1HVVA 2RMZA 3CWBJ 5CIFB 1JDLA 1L4AA 1FZAA 1JUNA 3VYMA 1EZVD 4C7NB 2MKVA 2B10B 1ZV8A 2A45G 2CPBA 1RHZB 5EFWB 1YJNP 4W80A 1R5SA 1CRCA 2BCCD 1N8RQ 4KT0J 3LIEA 3VNWA 1L4AD 3KPEA 4IL6V 2H89C 3U1CA 1SS1A 2HPCA 1LTGC 2B87B 3USSA 3BCCJ 2W6JH 2FFDC 1YBKA 1GDTA 1CORA 1HROA 1N7SB 1HZVA 1HWTC 1SQBK 1SQQD 1GK4A 1GQ1A 1EQ7A 1QN2A 4WVZA 4EIJA 1K73Q 2QA4P 2R3CA 1CIGA 2N18C 2SPZA 4HKZH 3FX0A 3I55P 3L37A 1URQB 2JDIH 2FY8A 2R3SA 3H1JE 4GKGA 4AUWA 2Y9YA 3JCUE 3WFBC 2WWWA 2ZT9D 5AVUB 4EIDA 2KB7P 4ZNCA 3CXHE 5CIDB 3RN1A 3G71P 1H89A 2B88A 5M1BA 1LT1A 4R4LA 2XU6A 3CD6P 1S5LV 3HQ8A 2B9BA 5C9MA 4XFJA 2C8SA 4DY9A 4UB6H 1NVOA 1CYJA 3SLEA 1U74B 4PD4E 1GW4A 1CXCA 2BGVX 4NPEA 1GD2E 2E74D 2Y9ZA 4JYCA 2J59M 2H88C 3SJLA 1MG3D 1IFIA 1FI7A 1QKSA 2B89A 3BATA 4HB1A 2CE0A 3W67A 1LJ2A 1LWUA 4ZKUA 3IF4A 4PWAA 3RK2C 1SQVG 2NPSD 1CRIA 1YTZI 1CIFA 1X9VA 3O5CA 5CMZA 1M90Q 3S9OA 1S1CX 3G4SP 3TK1A 3H1HG 4P4QB 3W68A 3L4OA 3AECC 3P8CE 5AW2B 1NTKE 4FA4A 3E1IA 3KXDA 4QAOA 2P10A 2P2UA 2CA3B 2MHMA 1XTGB 1Y47A 3WU2E 1DVVA 2QJPC 1SQPD 1IK9A 3H6PA 4EIEA 1Q7YQ 2C1DA 1EDLA 1GL2A 2I8DA 3H25A 4WWIA 1IJDB 1RE4A 2JQRA 2WSFJ 2HR3A 5B5EV 2AXTV 2JR8A 4O1QA 1I54A 5DJQC 2WSCJ 1GL2D 1BCCD 3TNUB 3JBTB 3D71A 3JCUH 5CYTR 3M0DC 2QJYC 4H0LD 1IO3A 5KKZC 3C1LA 3IFMA 3CL3D 1NTZK 5CJ0A 3H1KD 2ZXXA 1BE3D 1NU1E 3OA8A 351CA 1HGZA 4WBAA 5KAIE 4PD4H 3S1KA 3BASA 1KYOD 1PFIA 3L71G 1HTLC 1L0LG 3L72E 2OYHA 2KZIA 3HUSC 3N7NA 1I8PA 1M1JA 4BRYA 1RZ5A 2QJKC 2IYOA 1IRWA 1HRCA 3VRDA 2FYZA 1T2KC 2P7JA 3R2PA 3SSUA 1PP9G 3ZBMA 1DIQC 1LTJC 2LR2A 3ZOXA 3RK3C 5AVXB 1L0LK 5AW3B 1OAEA 3QH9A 2UWJE 1NTME 4EIFA 1JTHA 2L91A 3T97A 1LGHB 3RL0C 2KLUA 5B6QA 3VMZA 1YNRA 3H32A 3CX5D 4DT0A 4IL6X 2PCCB 1RH5B 1KQGB 1HH7A 2KZJA 3L4FA 3B5NC 2HV4A 1E29A 1W5CT 1M1KQ 2Q7CA 4U3FG 4N78E 1QL1A 4WQ9A 1ZXGA 1DD3A 2CPSA 2C2CA 2KYVA 2KP8A 3D6ZA 4DCKA 1N15A 2YQBA 3L35A 1FDMA 1LTAC 1VF5D 1EZVE 2E42A 1FI3A 1IFDA 1SFCC 3IR9A 2K88A 2L4DA 1CC5A 4H0JA 2L5GB 2BCCE 1M56D 1R0QA 5AVTB 2ZJSE 1M6ZA 1LT9B 1NYHA 5C0ZA 2IZ1A 2H8PD 2FFDA 5APWA 4H13B 3L36A 3H1IJ 4WQEA 3MUDC 3DR0A 1DX7A 3H1ID 1AA0A 4JQ0D 1FS0E 3MHVA 1S5LX 5CIGB 2KSEA 4TT3H 1YQ3C 5KAIH 1SQQE 2KIKA 1NKNA 5AVQB 1JY3O 2BH4X 2HPCB 1NMIA 3HD7C 1WVEC 5GTHH 4PV1C 2AI5A 3P7KA 2Y0CA 1WEJF 1H31A 1L0NJ 1EDKA 1IFNA 3A0HV 5DJTB 4OGQC 1VQKP 1OVVA 2ZT9B 2HFED 1EDIA 1T3JA 1LTTC 3HQ9A 1KV9A 2YNYA 2RKLA 2ORLA 2POHA 3PRJA 1N90A 2N1TC 2JKVA 1Q86Q 1NH4A 2E74B 3VMYA 1AOQA 3GG2A 3PJSK 3VN0A 1CTJA 1OVUA 2BEQD 2RN0A 1FZBA 1CRGA 1RF0C 1R8EA 1QVGO 3VMAA 1QGKB 3PTZA 1SQVE 1DEEG 1QLED 2W6AA 2A45H 1FZGA 2V7QH 3RK2D 1KV4A 4PD4I 1LWUB 3V6IA 3ITKA 1F1CA 1G1JA 4UB8H 1IFMA 1N86A 2OYOA 3CC7P 1CNOA 1DIIC 2FWLA 2M5AB 1SQPE 4I1LA 2B4ZA 5AW8B 3II6A 5L8RJ 4JPZB 4GEDB 2ZYGA 4WQBA 2QRXA 5AW6B 2GB8B 3ZCFA 5AVVB 1OMIA 2FXPA 1MUUA 3G3ZA 1NTKK 3TGUJ 1BGYJ 4IFDK 2H7HA 2C1DB 1PL5A 3M0DA 1GL2B 1BCCE 1JOCA 1KFMA 2YMKA 4H0LB 1CXAA 3KZIH 1JY2O 1KB9H 2N9JA 1SP4A 2WPSA 3H1KE 1BE3E 2M3BA 5CICB 5TISH 1FJ0A 2GIWA 1MFZA 2GC7D 2OTKE 3EWKA 3HUSA 2LITA 1VPCA 1KYOE 1PV3A 4AQRD 3R4YA 1C2NA 3L71E 2WPVB 1WT6A 4I7ZB 2ZVNB 2O01H 1NU1G 1Q82Q 2BLFB 5KAFE 1SVFA 1X22A 1LTJA 451CA 3FWNA 3L73J 1FZCC 1AOFA 3OA8B 3L73D 5DF5A 1IRVA 3PH0A 3CCUP 3AEBC 3CC4P 3L72G 2OYIC 2OYHB 5AW9B 4BRYB 3CMAP 1T2KD 1K3HA 4PJ0V 1USEA 1NU1K 1WMKA 3P32A 2H43A 2FYUD 4KMGA 3RK3D 4YE1A 1GIWA 1QL2A 3CX5E 2B11B 4ASWA 3L74G 2XTSB 1TU3F 3RL0D 3B5NA 3A0BE 4IOIH 3TYYA 1CIHA 3WUIA 1JTHB 3T97B 3AE3C 2YIUB 1LFMA 4A7PA 1KQFB 2YO2A 3V2NA 3H32B 5CCGC 4HJGH 1NMLA 1E5WA 1UIIA 3B5ND 1KTMA 3LW5H 1NTMK 3TYIA 1FAVA 5KLVD 1SFCA 3MZWB 1GDVA 3V5BA 4K35A 1NNOA 1YITP 3ORVA 4AAMA 5CBOA 2R5BA 3L70D 4JF7A 1YEBA 4L74A 3L4MA 2IX7C 1VQOP 1IFJA 3CWBD 3MUDA 1EZVG 1SFCD 1GU4A 4JYBA 4UB6V 1LTSC 2W83C 5DJUB 1S72P 4DOJA 4TLFA 2BCCG 1ZZHA 4QMAA 1GJQA 1KQSO 1KYOH 3WFEC 1DW0A 1PGQA 2FFDB 2E76C 3TDKA 3AEFC 2A45I 1HZUA 2CE1A 3RBXA 2K9JA 3FXEA 3BCCD 1YQ4C 3ZOWA 5KAFH 2FXMA 1CTYA 3DMIA 4WQAA 1SQQG 4D6TJ 1SQBJ 3SVWA 4I6MC 4D6TD 1SQBD 1OZHA 4PV1D 5KJ7C 2N18B 2G3AA 1LNQA 1FHBA 3HE4A 1CSUA 5CIEB 3L75J 4OGQD 1H31B 1SQQK 3L75D 1EDJA 1RE3C 2V08A 3E1RA 2N1TA 1IZL0 3A0BH 2E5YA 4GODA 3HE5A 2JP3A 1E2RA 4W7YA 1S5LE 3CCLP 4L76A 3N4XA 4WQ8A 2V4HA 4XYDB 2ZBOA 1X8YA 3I56P 2BH5X 1RF0A 2HLOA 2N1TD 4JCGA 1PZQA 4W7ZA 1ZRTD 1URQC 4RESB 2NPSA 2D0WA 4OH8B 2WQYC 1KB9I 2ZAEB 4WY4C 4I2LC 3TSIA 4N6JA 3NXSA 2AEMA 3FGAD 2Q3IA 4NPFX 2C1VA 5APTA 1N73A 2PGDA 4RSZA 1KZUB 1EB7A 1JY3N 3MGNA 1UIXA 4GOFA 4BWNA 2JO1A 1CI6B 3A3YB 4EDFA 1CHJA 1W2LA 1W5CE 2Q6QA 4IFMA 1KQLA 1Q2NA 4NPDA 4V2KA 1M7LA 1SQVK 1QVFO 1GTWA 2R44A 3HQ7A 1LP1A 4GDOA 4Y99B 1SQPG 2QM7A 3GF3A 4EOTA 2B12B 3H1HJ 3CI9A 5GTIE 1RF1B 2WT7B 4ASVA 1J1DC 5B5EE 1HGVA 1BSNA 1SQPK 2ITAA 3SXTA 4IFFA 5DJQB 1G2CB 4FA5A 3O8ZA 4M3LA 2A06D 3OAKA 2ZXEB 3V2RA 1X79B 1BCCG 3GW6A 1T8ZA 2D2CC 2KUBA 1VL2A 3MP7B 1C2RA 5KKZB 3ZOYA 2IYPA 1H9XA 1J1EC 1JM0A 3CXHH 1S5LH 4B86A 1KC8Q 3H1KG 5AVRB 4EICA 4ZMDA 3CMEP 1FZCA 1BE3G 1NTZJ 1FJPA 1L2PA 1T3UA 3PXSA 2OYIA 3G6EP 5H2FV 2VHDA 3HUSB 3O6QA 3L73E 2FYNC 1SQXJ 1WRGA 2IFMA 1SQXD 3NBSA 2WPRA 2QJKB 4KHXA 1KILC 155CA 1LTJB 2FYUE 3AEDC 3RK3E 1FBMA 3RK3B 2BPBB 1KYOI 1YICA 1BDCA 2KLVA 4FA9A 4C46A 1HJ4A 1HH0A 2LKMA 3L74E 1K05A 2O1KA 5KAIV 4O1WA 1I8OA 4YXDC 1MV8A 1BL9A 5CCGA 1OW8A 3KHUA 2K3RA 5GTHV 1PP9J 1QYZA 5AW7B 3B5NB 2N9YB 3U59A 1VDFA 3F5HA 5KLVE 3WU2H 1OCDA 5CCGD 3HTKB 3CLQA 1NO4A 5GTIH 2Y0DA 3L70E 2PCBB 3SWKA 1NAFA 3D0WA 3VP8A 2I1KA 1LMSA 1DW2A 5DFSA 5APSA 3CWBE 2I1JA 2C0WA 5BU5A 2KNCA 1K8AQ 4U3FJ 1CW5A 1PPJD 5E79V 4L73A 1I6DA 2YMYA 5BVZA 2LXBA 1LTBC 3MTUE 1L4AB 3RL0g 3B4SA 3HRNA 4C7NA 3H1IG 5AVZB 3BCCE 2C9NY 1YYCA 2ZYAA 1C6SA 2G8YA 5KJ7A 2E76D 3AE5C 1NWQA 2FKWB 4PV1B 1YIJP 1AQTA 1LT9C 1PGJA 2IPPA 2K9JB 3A0HE 2AIUA 1FZEA 4H13C 2MJZA 1RE3A 4UB8V 5KLIC 1CTZA 4OGQB 1FDIA 5KJ7D 1ZR4A 1W2BO 4Q5PA 3V4QA 1L0ND 1JMBA 2MTAC 3RGUA 1PGPA 2KK7A 3KYQA 4JBZA 1OVRA 1KN7A 4U7JA 1IC2A 1OW7A 1OXZA 5AW5B 4YTPC 2ZYDA 4XE5B 1URQA 4RKUJ 2N1TB 5IY51 3H1LJ 4WY4A 1ZRTE 3H1LD 3HE5B 1VQMP 1CSXA 5AW0B 4BXLA 4AX3A 1JCCA 2JEEA 3CC2P 1URQD 5B66V 1HF9A 3H1JJ 3KZIV 3H1JD 4WY4D 4WQ7A 3CXHI 5TISV 2NPSB 2Y0EA 5CHXA 2FBWC 5BU8B 4NFGB 3GHGC 1NIRA 3S4RA 4CPGA 2J58A 2PP6A 4PD4D 1N73B 1S6VB 1GKSA 2KSJA 1JO5A 1HCMA 3HQ6A 3B8EB 3WFCC 3I5CA 2NZ2A 1LP1B 3G9RA 3Q2YA 5C39A 2XNXA 1DT1A 3M0AA 3M91A 2E75C 1CRYA 2CA4B 2D0SA 1YTCA 1NTKJ 2A06E 1FCDC 1NTKD 3TGUD 1IFPA 1BGYD 3PHLA 4OWFA 2OZ1A 1FU1A 1KFNA 2C0XA 2ZZS1 2D2CD 1CCHA 2CXBA 3SFDC 1NOHA 1H32A 4WQCA 2IBZG 1R5LA 2GUSA 2J5UA 2IBZD 3ZDMA 3O20A 1LC1A 3NTNA 1EC5A 1KILA 1S9KD 2QVAA 1F1FA 3WUUA 1SQXE 1Y9BA 3CCSP 3SWFA 1FZCB 2XKMA 2XV5A 4H44C 2HODA 2IFNA 3CXHW 2OYIB 1ZP0C 3L73G 2WITA 1CO6A 3O6QB 1P84D 1KILD 1CHIA 4PJ0E 1KD1Q 1M1JB 2ZVOB 4GIFA 2C9XB 3M9QA 3GMAA 3BRVB 2P67A 2YXQB 1NU1J 2FYUG 1VQNP 3RBZA 1HUCA 2M3EA 4MN4C 3L72J 1AJYA 2K9YA 1FOSE 3WC8A 2YKPA 1GK6A 4O9BA 2BEZF 1YTZT 2FYUK 3MK7C 4DZOA 1MKMA 1C6RA 1U75B 2P58A 1CZQA 1NTMJ 2O01N 1J2JB 5KLVG 1NTMD 2GC4D 1VF5B 3A7OA 2M8RA 1YHQP 1G1IA 3L70G 1BSHA 4FAVA 1PPJE 1QEXA 1L9JC 3PH2B 2WSCH 3CWBG 5KLVK 1CIEA 2JJLA 2K37A 2KNCB 2B0ZB 3H1IE 2WSEH 4IL6E 2FXOA 1EXJA 2AXCA 2E76B 3HD7A 1LT9A 4PW9B 1EZVI 2YO3A 3VOPA 2N9BA 1ZMEC 1NAYA 1FOCA 3BCCG 2BCCJ 1IQCA 2V7QJ 3K5BA 1YFCA 2R32A 1KIBA 2WZ7A 2W6BA 1DW3A 1E8EA 4LC1A 3HD7D 3GF7A 4D6TG 1SQBG 3RN0A 1L0NE 2GA1A 4PJ0H 4Z1MH 1AFOA 4N3YB 4H13D 2YCCA 3QWOC 1J3SA 3NMDA 3ZOOA 1VQPP 3L75G 1SQQJ 4Y5RA 3CCVP 2WSSH 3CYTI 2JWAA 2HYNA 3CX5H 3AE4C 3PXWA 1N7SC 3Q1MA 1LC2A 4C7RA 3H1LE 1DIPA 4DJGA 2WPQA 3ABVC 3AE1C 2OTJP 3OCDA 2Q9IA 3CCQP 3O1YA 5CBNA 2O3JA 1KMIZ 2QEXP 5AW4B 5CIBB 4WY4B 3JSVC 4HH2A 3GHGA 1VQ7P 1KB9D 4GOEA 2R5DA 1PGOA 3OJAB 5APVA 3V2QA 2YK3A 3RK2B 1I5TA 1C7MA 1JMMA 1HJBA 2QG4A 2PFXA 1BDDA 3U1AA 1A02F 4L1QA 1VQ9P 2O01J 3X39A 3A2AA 2ZOOA 1H33A 5CCHC 1JNMA 1PIXA 3Q5RA 1CRHA 4IL6H 2OTLP 1KB0A 1YJWP 1H8AA 3CU4A 5CIHB 1KX7A 1A56A 1SQVJ 1HJ0A 5AW1B 3C2CA 2QJPB 1SQVD 4YPCA 1AVYA 1KX2A 3WFDC 3VP9A 2M5AA 3CCMP 3VYIA 2N3YA 1J1DB 3AE2C 3Q5SA 3H1HD 3TGUE 2PRRA 1BGYE 2OGUA 1XTCC 1LTIC 2E75D 1K04A 2AXTE 2BCNB 1SQPJ 3AE9C 4N0KA 2D2CB 2A06G 4Y99C 2OQQA 1VQ5P 1W2EA 1H88A 3WU2V 3PP5A 3LW5J 2QJYB 1ETPA 1J1EB 1QX8A 1ZW0A 1RF1C 5GTIV 1C75A 2AEJA 2E5TA 4LGDE 2IBZE 1DW1A 2OZ1B 2W8ZA 1H0TA 3UIAA 1S9KE 3SFEC 2WVRA 2XNDH 2XDJA 2KI7B 1Q81Q 5H2FE 1NTZG 3EFGA 1NTZD 1BCCJ 2FYNB 1H32B 3TF5A 2E43A 2JWDA 3P8MC 3WMM0 1P84E 1SQXG 4LLHA 1KILE 1KILB 3AE7C 4H44D 2P1JA 4KJMA 3ZIYA 2WSEJ 3H1KJ 1M70A 1BE3J 2HODB 1VQ6P 1VQ4P 1CCRA 4YXWH 5CJ4A 4MU8A 2OARA 4RO0A 1S2EA 1SQXK 1NKZB 3L71J 1L0LJ 2Q5UA 1AKKA 3RL0B 3L71D 5AVWB 1L0LD 3AEGC 3PXTA 3VMXA 5GTHE 4GYDA 2Z4EA 4L75A 4WB4A 2WTYA 3EQ2A 2Q1KA 1Y8AA 1RAQA 3RMZA 2KS1A 1DVHA 1PP9D 1E79H 3VTPC 1C6OA 1RQVA 2GM4A 1JY2N 1AYGA 1YI2P 5AURA 3M06A 1LS9A 2LXCB 3CX5I 2XZRA 1COTA 4XA4A 3CPWO 5B5EH 2Z5IA 4HYTB 2QE7H 2AXTH 1SFCB 3PLNA 5E79E 1NHLA 1K3GA 1PPJG 2DVHA 3RLMA 3A9FA 4U3FD 2M0BA 2PAJA 1NGMB 3E7KA 2ZFCA 1H1OA 4L3HA 1A2SA 2PACA 3CCRP 3WUTA 3CP5A 5H2FH 1RZ6A 1N9CA 1AV1A 2YXRB 2KOGA 1QL3A 3AEEC 1YEAA 3HD7B 1MZ9A 1P84H 1ZR2A 2GUVA 4D6TE 1SQBE 2JTIB 1CSBA 1L4AC 1OIPA 4UB8E 2B87A 5KLIB 5APUA 1KYOW 1H9YA 5APXA 1MZ4A 1N7SA 1OW6A 1L0NG 3L75E 4EYYQ 3B71A 1CYCA 1GZLA 1RAPA 1X0TA 1YCCA 4K3IA 3FWLA 3HE4B 1N7LA 3EFFK 1MG2D 4R4MA 1NJIQ 1N7SD 2YKOA 1VYDA 1DEBA 1L0NK 1GMJA 1HJ3A 1CSVA 1FC2C 2V07A 1JY3P 1AQ5A 3H1LG 3CX5W 1M60A 5B66E 4FANA 2QM8A 1USDA 3KZIE 2C9LY 2ZT9C 1CYIA 1VQ8P 2I8FA 3OCDB 1KB9E 2IZ0A 2VRSA 1A02J 3H1JG 1CHHA 5TISE 3KQGA 4GT1A 3OA7A 1DD4A 5CCHA 5E79H 3CXHD 3GHGB
chains in the Genus database with same CATH topology
4EIFA 2L91A 1FI9A 4FB1A 3MK7C 5B6QA 1C6RA 1U75B 4AALA 1YNRA 3CX5D 2PCCB 5EXQA 2C1VA 4RSZA 3NWVA 1EB7A 2ZXYA 1NTMD 1HH7A 1A8CA 2DGEA 4EDFA 2GC4D 4XXLA 2HV4A 1CHJA 1E29A 1H33B 1W2LA 1W5CT 4FAVA 4WQ9A 2ZONG 1L9JC 4LJIA 2C2CA 3PH2B 4V2KA 1QL4A 2EXVA 1N15A 2YQBA 3O0RC 1CSWA 1CIEA 3HQ7A 2KNCB 1FI3A 2B0ZB 2B12B 2L4DA 1CC5A 4H0JA 1N50A 3SWSA 4RJTA 1R0QA 1M6ZA 4J20A 4PW9B 5C0ZA 4AAOA 1I55A 4WQEA 3DR0A 1FOCA 3SXTA 3H1ID 3M97X 1IQCA 5DJQB 1YFCA 4FA5A 1KIBA 1B7VA 2A06D 5CIGB 1DW3A 1E8EA 3GW6A 1GU2A 3RN0A 1C2RA 5KKZB 3ZOYA 1H9XA 2BH4X 2YCCA 1NMIA 1J3SA 1WVEC 3ZOOA 2AI5A 4EICA 2Q3EA 1WEJF 2Y0CA 1H31A 4Y5RA 3PXSA 3CYTI 2JWAA 3A0HV 5H2FV 3PXWA 2VHDA 5TJHA 1LC2A 1SQXD 3NBSA 2N3BA 2QJKB 1YIQA 3OCDA 3HQ9A 155CA 1KV9A 1NU1D 4L3GA 2BPBB 3O1YA 1YICA 1I6EA 2ORLA 2O3JA 4FA9A 5KAFV 5CIBB 1HJ4A 3PRJA 3L72D 1CRJA 1N90A 1CEDA 3NBTA 3MK7B 2C1UA 4O1WA 1I8OA 5KAIV 4AANA 1AOQA 1KB9D 1BL9A 3GG2A 2N9IA 4H0KA 2FRCA 1CTJA 3KHUA 2RN0A 2YK3A 5GTHV 1L9BC 1I5TA 1QYZA 1C7MA 1CRGA 2QG4A 3L74D 2N9YB 4WQDA 4FA1A 3VMAA 4L1QA 3PTZA 3X39A 1OCDA 2ZOOA 3A0BV 1H33A 2Y0DA 1CRHA 2PCBB 1KB0A 3CU4A 5CIHB 1LMSA 1KX7A 1A56A 1DW2A 3ITKA 1F1CA 5DFSA 3DP5A 3C2CA 2QJPB 1SQVD 2LIRA 1KX2A 1HJ5A 1C52A 3WFDC 1CNOA 1DIIC 2FWLA 1PPJD 2N3YA 5E79V 2B4ZA 1I6DA 3H1HD 2RMZA 4GEDB 5CIFB 1JDLA 4WQBA 3VYMA 1EZVD 2B10B 2BCNB 2GB8B 3ZCFA 4N0KA 1CRCA 2BCCD 3VNWA 3WU2V 2C1DB 1C6SA 2QJYB 1ETPA 5GTIV 1C75A 4IL6V 1DW1A 2OZ1B 1CXAA 2K9JB 2N9JA 2AIUA 1CORA 1HROA 4UB8V 1NTZD 1CTZA 1HZVA 2FYNB 5CICB 4Q5PA 1FJ0A 1H32B 1SQQD 2GIWA 3TF5A 2GC7D 1L0ND 2MTAC 1GQ1A 2LITA 1QN2A 1C2NA 3ZIYA 1CIGA 2N18C 1M70A 2BLFB 1CCRA 451CA 1AOFA 3OA8B 4MU8A 3L73D 5DF5A 1IRVA 5IY51 3WFBC 1AKKA 3H1LD 4EIDA 3L71D 1L0LD 3PXTA 1CSXA 5CIDB 3RN1A 1K3HA 4PJ0V 4AX3A 4GYDA 2FYUD 4KMGA 4YE1A 5B66V 1S5LV 3HQ8A 5C9MA 1GIWA 3KZIV 1RAQA 2C8SA 4DY9A 3RMZA 3H1JD 2KS1A 1CYJA 3SLEA 1DVHA 2B11B 4WQ7A 1PP9D 1U74B 2XTSB 1CXCA 2BGVX 5TISV 1CIHA 3WUIA 3SJLA 1MG3D 2Y0EA 1C6OA 1FI7A 1QKSA 2YIUB 1AYGA 1LFMA 4NFGB 1NIRA 4A7PA 5AURA 2CE0A 1LS9A 1COTA 1NMLA 4PD4D 4PWAA 1S6VB 1GKSA 3TYIA 1CRIA 5KLVD 1HCMA 3PLNA 3HQ6A 1CIFA 1GDVA 3WFCC 3O5CA 1NNOA 1K3GA 2DVHA 3RLMA 3ORVA 4AAMA 3L70D 3A9FA 4U3FD 1YEBA 4P4QB 3L4OA 3L4MA 4FA4A 3CWBD 4QAOA 1H1OA 4L3HA 1A2SA 2PACA 2CA3B 2MHMA 4UB6V 1DT1A 3CP5A 1DVVA 1CRYA 1SQPD 2CA4B 2D0SA 1RZ6A 1YTCA 1N9CA 4EIEA 1FCDC 1ZZHA 1NTKD 2C1DA 3TGUD 1BGYD 1GJQA 1QL3A 1YEAA 3PHLA 3WFEC 1DW0A 2JTIB 2OZ1A 3TDKA 2JQRA 5KLIB 1HZUA 2CE1A 1KYOW 2ZZS1 1CCHA 1H9YA 5B5EV 2CXBA 3BCCD 3ZOWA 1MZ4A 2AXTV 4O1QA 1CTYA 1I54A 3DMIA 4WQAA 5DJQC 1H32A 1CYCA 3SVWA 1BCCD 4WQCA 2IBZD 1SQBD 3JBTB 3O20A 4D6TD 1RAPA 1YCCA 1LC1A 4K3IA 5CYTR 2N18B 3FWLA 1F1FA 1IO3A 1FHBA 1CSUA 1MG2D 5CIEB 3H1KD 1H31B 1BE3D 1VYDA 3L75D 3CXHW 3OA8A 1HJ3A 351CA 1CO6A 1CSVA 2V08A 1IZL0 1KYOD 1P84D 2V07A 1CHIA 1I8PA 3CX5W 1E2RA 1M60A 2C9XB 4FANA 1CYIA 4WQ8A 2I8FA 3OCDB 1RZ5A 4XYDB 2ZBOA 1IRWA 1HRCA 3VRDA 2BH5X 1CHHA 4JCGA 3ZBMA 1DIQC 1ZRTD 3ZOXA 1OAEA 3WC8A 2D0WA 3CXHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EIF A;  2L91 A;  1FI9 A;  4FB1 A;  3MK7 C;  5B6Q A;  1C6R A;  1U75 B;  4AAL A;  1YNR A;  3CX5 D;  2PCC B;  5EXQ A;  2C1V A;  4RSZ A;  3NWV A;  1EB7 A;  2ZXY A;  1NTM D;  1HH7 A;  1A8C A;  2DGE A;  4EDF A;  2GC4 D;  4XXL A;  2HV4 A;  1CHJ A;  1E29 A;  1H33 B;  1W2L A;  1W5C T;  4FAV A;  4WQ9 A;  2ZON G;  1L9J C;  4LJI A;  2C2C A;  3PH2 B;  4V2K A;  1QL4 A;  2EXV A;  1N15 A;  2YQB A;  3O0R C;  1CSW A;  1CIE A;  3HQ7 A;  2KNC B;  1FI3 A;  2B0Z B;  2B12 B;  2L4D A;  1CC5 A;  4H0J A;  1N50 A;  3SWS A;  4RJT A;  1R0Q A;  1M6Z A;  4J20 A;  4PW9 B;  5C0Z A;  4AAO A;  1I55 A;  4WQE A;  3DR0 A;  1FOC A;  3SXT A;  3H1I D;  3M97 X;  1IQC A;  5DJQ B;  1YFC A;  4FA5 A;  1KIB A;  1B7V A;  2A06 D;  5CIG B;  1DW3 A;  1E8E A;  3GW6 A;  1GU2 A;  3RN0 A;  1C2R A;  5KKZ B;  3ZOY A;  1H9X A;  2BH4 X;  2YCC A;  1NMI A;  1J3S A;  1WVE C;  3ZOO A;  2AI5 A;  4EIC A;  2Q3E A;  1WEJ F;  2Y0C A;  1H31 A;  4Y5R A;  3PXS A;  3CYT I;  2JWA A;  3A0H V;  5H2F V;  3PXW A;  2VHD A;  5TJH A;  1LC2 A;  1SQX D;  3NBS A;  2N3B A;  2QJK B;  1YIQ A;  3OCD A;  3HQ9 A;  155C A;  1KV9 A;  1NU1 D;  4L3G A;  2BPB B;  3O1Y A;  1YIC A;  1I6E A;  2ORL A;  2O3J A;  4FA9 A;  5KAF V;  5CIB B;  1HJ4 A;  3PRJ A;  3L72 D;  1CRJ A;  1N90 A;  1CED A;  3NBT A;  3MK7 B;  2C1U A;  4O1W A;  1I8O A;  5KAI V;  4AAN A;  1AOQ A;  1KB9 D;  1BL9 A;  3GG2 A;  2N9I A;  4H0K A;  2FRC A;  1CTJ A;  3KHU A;  2RN0 A;  2YK3 A;  5GTH V;  1L9B C;  1I5T A;  1QYZ A;  1C7M A;  1CRG A;  2QG4 A;  3L74 D;  2N9Y B;  4WQD A;  4FA1 A;  3VMA A;  4L1Q A;  3PTZ A;  3X39 A;  1OCD A;  2ZOO A;  3A0B V;  1H33 A;  2Y0D A;  1CRH A;  2PCB B;  1KB0 A;  3CU4 A;  5CIH B;  1LMS A;  1KX7 A;  1A56 A;  1DW2 A;  3ITK A;  1F1C A;  5DFS A;  3DP5 A;  3C2C A;  2QJP B;  1SQV D;  2LIR A;  1KX2 A;  1HJ5 A;  1C52 A;  3WFD C;  1CNO A;  1DII C;  2FWL A;  1PPJ D;  2N3Y A;  5E79 V;  2B4Z A;  1I6D A;  3H1H D;  2RMZ A;  4GED B;  5CIF B;  1JDL A;  4WQB A;  3VYM A;  1EZV D;  2B10 B;  2BCN B;  2GB8 B;  3ZCF A;  4N0K A;  1CRC A;  2BCC D;  3VNW A;  3WU2 V;  2C1D B;  1C6S A;  2QJY B;  1ETP A;  5GTI V;  1C75 A;  4IL6 V;  1DW1 A;  2OZ1 B;  1CXA A;  2K9J B;  2N9J A;  2AIU A;  1COR A;  1HRO A;  4UB8 V;  1NTZ D;  1CTZ A;  1HZV A;  2FYN B;  5CIC B;  4Q5P A;  1FJ0 A;  1H32 B;  1SQQ D;  2GIW A;  3TF5 A;  2GC7 D;  1L0N D;  2MTA C;  1GQ1 A;  2LIT A;  1QN2 A;  1C2N A;  3ZIY A;  1CIG A;  2N18 C;  1M70 A;  2BLF B;  1CCR A;  451C A;  1AOF A;  3OA8 B;  4MU8 A;  3L73 D;  5DF5 A;  1IRV A;  5IY5 1;  3WFB C;  1AKK A;  3H1L D;  4EID A;  3L71 D;  1L0L D;  3PXT A;  1CSX A;  5CID B;  3RN1 A;  1K3H A;  4PJ0 V;  4AX3 A;  4GYD A;  2FYU D;  4KMG A;  4YE1 A;  5B66 V;  1S5L V;  3HQ8 A;  5C9M A;  1GIW A;  3KZI V;  1RAQ A;  2C8S A;  4DY9 A;  3RMZ A;  3H1J D;  2KS1 A;  1CYJ A;  3SLE A;  1DVH A;  2B11 B;  4WQ7 A;  1PP9 D;  1U74 B;  2XTS B;  1CXC A;  2BGV X;  5TIS V;  1CIH A;  3WUI A;  3SJL A;  1MG3 D;  2Y0E A;  1C6O A;  1FI7 A;  1QKS A;  2YIU B;  1AYG A;  1LFM A;  4NFG B;  1NIR A;  4A7P A;  5AUR A;  2CE0 A;  1LS9 A;  1COT A;  1NML A;  4PD4 D;  4PWA A;  1S6V B;  1GKS A;  3TYI A;  1CRI A;  5KLV D;  1HCM A;  3PLN A;  3HQ6 A;  1CIF A;  1GDV A;  3WFC C;  3O5C A;  1NNO A;  1K3G A;  2DVH A;  3RLM A;  3ORV A;  4AAM A;  3L70 D;  3A9F A;  4U3F D;  1YEB A;  4P4Q B;  3L4O A;  3L4M A;  4FA4 A;  3CWB D;  4QAO A;  1H1O A;  4L3H A;  1A2S A;  2PAC A;  2CA3 B;  2MHM A;  4UB6 V;  1DT1 A;  3CP5 A;  1DVV A;  1CRY A;  1SQP D;  2CA4 B;  2D0S A;  1RZ6 A;  1YTC A;  1N9C A;  4EIE A;  1FCD C;  1ZZH A;  1NTK D;  2C1D A;  3TGU D;  1BGY D;  1GJQ A;  1QL3 A;  1YEA A;  3PHL A;  3WFE C;  1DW0 A;  2JTI B;  2OZ1 A;  3TDK A;  2JQR A;  5KLI B;  1HZU A;  2CE1 A;  1KYO W;  2ZZS 1;  1CCH A;  1H9Y A;  5B5E V;  2CXB A;  3BCC D;  3ZOW A;  1MZ4 A;  2AXT V;  4O1Q A;  1CTY A;  1I54 A;  3DMI A;  4WQA A;  5DJQ C;  1H32 A;  1CYC A;  3SVW A;  1BCC D;  4WQC A;  2IBZ D;  1SQB D;  3JBT B;  3O20 A;  4D6T D;  1RAP A;  1YCC A;  1LC1 A;  4K3I A;  5CYT R;  2N18 B;  3FWL A;  1F1F A;  1IO3 A;  1FHB A;  1CSU A;  1MG2 D;  5CIE B;  3H1K D;  1H31 B;  1BE3 D;  1VYD A;  3L75 D;  3CXH W;  3OA8 A;  1HJ3 A;  351C A;  1CO6 A;  1CSV A;  2V08 A;  1IZL 0;  1KYO D;  1P84 D;  2V07 A;  1CHI A;  1I8P A;  3CX5 W;  1E2R A;  1M60 A;  2C9X B;  4FAN A;  1CYI A;  4WQ8 A;  2I8F A;  3OCD B;  1RZ5 A;  4XYD B;  2ZBO A;  1IRW A;  1HRC A;  3VRD A;  2BH5 X;  1CHH A;  4JCG A;  3ZBM A;  1DIQ C;  1ZRT D;  3ZOX A;  1OAE A;  3WC8 A;  2D0W A;  3CXH D; 
#chains in the Genus database with same CATH topology
 1KOR A;  1FI9 A;  1U7J A;  2K1A A;  2W27 A;  4FB1 A;  2E74 C;  3V4W A;  4AAL A;  2IDB A;  2O1J A;  3C9I A;  3AE6 C;  5EXQ A;  3NWV A;  5CCH D;  2ZXY A;  1S3J A;  5K5G B;  3IN6 A;  1DH3 A;  1A8C A;  2DGE A;  1CI6 A;  4XXL A;  4AYC A;  2QSI A;  1H33 B;  4EI2 A;  2NPS C;  2RH0 A;  2AEF A;  2Z5H A;  1FJK A;  2ZON G;  2CK3 H;  4LJI A;  3D70 A;  3H1H E;  1QL4 A;  2EXV A;  1JCD A;  1IO4 A;  3O0R C;  1CSW A;  1LWU C;  2E75 B;  1JB0 J;  1N73 C;  3A0H H;  2WMM A;  2NRG A;  5APY A;  1SLQ A;  1N50 A;  3FXD A;  1RF1 A;  3SWS A;  1NTK G;  3TGU G;  4RJT A;  1BGY G;  3P8C D;  2WT7 A;  3LID A;  4J20 A;  3Q3D A;  2QIW A;  4AAO A;  1FZF A;  1I55 A;  3MIW A;  3M97 X;  1EXI A;  1Z56 A;  1G2C A;  4OVN F;  1GU5 A;  1B7V A;  1ZLL A;  1NTZ E;  3NFQ A;  5AVY B;  1GU2 A;  1OX3 A;  1U57 A;  3BRT B;  3IAO A;  3TNU A;  3AE8 C;  1H0T B;  1GL2 C;  1U7M A;  5B66 H;  1JEK A;  4H44 B;  1IK7 A;  1YJ9 P;  1OWA A;  1RE4 C;  5AVS B;  2Q3E A;  3WUV A;  4H0L C;  1FE6 A;  2DW3 A;  1HBW A;  2IBZ I;  3GLM A;  3A5T A;  1K9M Q;  1T6A A;  5TJH A;  2W90 A;  5APQ A;  3AEA C;  2N3B A;  3SWY A;  3MD0 A;  1L0L E;  1JY2 P;  1VQL P;  1YIQ A;  3JC2 2;  3KDP B;  2YKQ A;  3M9H A;  4I7Z C;  1NU1 D;  4L3G A;  1FDO A;  1P84 I;  4K3A A;  1S4X A;  4ZKP A;  3CCJ P;  1I6E A;  5KAF V;  1ZN5 A;  3L72 D;  1PP9 E;  1CRJ A;  1D7M A;  1CED A;  1N2D C;  3NBT A;  3F89 A;  3MK7 B;  2C1U A;  4AAN A;  2OYH C;  2FYU J;  2N9I A;  4H0K A;  1M1J C;  3CCE P;  2FRC A;  3D6Y A;  1RY3 A;  3Q5P A;  1M8O B;  1L9B C;  1M57 D;  2KS1 B;  3L74 J;  1OFC X;  3L74 D;  1NTM G;  4WQD A;  4FA1 A;  3M9B A;  2HG5 D;  3A0B V;  2WSF H;  3HTK A;  3C8V A;  1IZN B;  1AVO A;  4Y28 J;  4U3F E;  1GW3 A;  2YIU C;  2BAS A;  5KTB A;  4UB6 E;  1MFT A;  1Q90 D;  1ZOY C;  3OW2 O;  5KLV J;  3DP5 A;  2LIR A;  1FOS F;  2KXP B;  1HJ5 A;  1C52 A;  1RQU A;  3L70 J;  3BVH A;  4N78 D;  3V2P A;  1VF5 C;  1HVV A;  2RMZ A;  3CWB J;  5CIF B;  1JDL A;  1L4A A;  1FZA A;  1JUN A;  3VYM A;  1EZV D;  4C7N B;  2MKV A;  2B10 B;  1ZV8 A;  2A45 G;  2CPB A;  1RHZ B;  5EFW B;  1YJN P;  4W80 A;  1R5S A;  1CRC A;  2BCC D;  1N8R Q;  4KT0 J;  3LIE A;  3VNW A;  1L4A D;  3KPE A;  4IL6 V;  2H89 C;  3U1C A;  1SS1 A;  2HPC A;  1LTG C;  2B87 B;  3USS A;  3BCC J;  2W6J H;  2FFD C;  1YBK A;  1GDT A;  1COR A;  1HRO A;  1N7S B;  1HZV A;  1HWT C;  1SQB K;  1SQQ D;  1GK4 A;  1GQ1 A;  1EQ7 A;  1QN2 A;  4WVZ A;  4EIJ A;  1K73 Q;  2QA4 P;  2R3C A;  1CIG A;  2N18 C;  2SPZ A;  4HKZ H;  3FX0 A;  3I55 P;  3L37 A;  1URQ B;  2JDI H;  2FY8 A;  2R3S A;  3H1J E;  4GKG A;  4AUW A;  2Y9Y A;  3JCU E;  3WFB C;  2WWW A;  2ZT9 D;  5AVU B;  4EID A;  2KB7 P;  4ZNC A;  3CXH E;  5CID B;  3RN1 A;  3G71 P;  1H89 A;  2B88 A;  5M1B A;  1LT1 A;  4R4L A;  2XU6 A;  3CD6 P;  1S5L V;  3HQ8 A;  2B9B A;  5C9M A;  4XFJ A;  2C8S A;  4DY9 A;  4UB6 H;  1NVO A;  1CYJ A;  3SLE A;  1U74 B;  4PD4 E;  1GW4 A;  1CXC A;  2BGV X;  4NPE A;  1GD2 E;  2E74 D;  2Y9Z A;  4JYC A;  2J59 M;  2H88 C;  3SJL A;  1MG3 D;  1IFI A;  1FI7 A;  1QKS A;  2B89 A;  3BAT A;  4HB1 A;  2CE0 A;  3W67 A;  1LJ2 A;  1LWU A;  4ZKU A;  3IF4 A;  4PWA A;  3RK2 C;  1SQV G;  2NPS D;  1CRI A;  1YTZ I;  1CIF A;  1X9V A;  3O5C A;  5CMZ A;  1M90 Q;  3S9O A;  1S1C X;  3G4S P;  3TK1 A;  3H1H G;  4P4Q B;  3W68 A;  3L4O A;  3AEC C;  3P8C E;  5AW2 B;  1NTK E;  4FA4 A;  3E1I A;  3KXD A;  4QAO A;  2P10 A;  2P2U A;  2CA3 B;  2MHM A;  1XTG B;  1Y47 A;  3WU2 E;  1DVV A;  2QJP C;  1SQP D;  1IK9 A;  3H6P A;  4EIE A;  1Q7Y Q;  2C1D A;  1EDL A;  1GL2 A;  2I8D A;  3H25 A;  4WWI A;  1IJD B;  1RE4 A;  2JQR A;  2WSF J;  2HR3 A;  5B5E V;  2AXT V;  2JR8 A;  4O1Q A;  1I54 A;  5DJQ C;  2WSC J;  1GL2 D;  1BCC D;  3TNU B;  3JBT B;  3D71 A;  3JCU H;  5CYT R;  3M0D C;  2QJY C;  4H0L D;  1IO3 A;  5KKZ C;  3C1L A;  3IFM A;  3CL3 D;  1NTZ K;  5CJ0 A;  3H1K D;  2ZXX A;  1BE3 D;  1NU1 E;  3OA8 A;  351C A;  1HGZ A;  4WBA A;  5KAI E;  4PD4 H;  3S1K A;  3BAS A;  1KYO D;  1PFI A;  3L71 G;  1HTL C;  1L0L G;  3L72 E;  2OYH A;  2KZI A;  3HUS C;  3N7N A;  1I8P A;  1M1J A;  4BRY A;  1RZ5 A;  2QJK C;  2IYO A;  1IRW A;  1HRC A;  3VRD A;  2FYZ A;  1T2K C;  2P7J A;  3R2P A;  3SSU A;  1PP9 G;  3ZBM A;  1DIQ C;  1LTJ C;  2LR2 A;  3ZOX A;  3RK3 C;  5AVX B;  1L0L K;  5AW3 B;  1OAE A;  3QH9 A;  2UWJ E;  1NTM E;  4EIF A;  1JTH A;  2L91 A;  3T97 A;  1LGH B;  3RL0 C;  2KLU A;  5B6Q A;  3VMZ A;  1YNR A;  3H32 A;  3CX5 D;  4DT0 A;  4IL6 X;  2PCC B;  1RH5 B;  1KQG B;  1HH7 A;  2KZJ A;  3L4F A;  3B5N C;  2HV4 A;  1E29 A;  1W5C T;  1M1K Q;  2Q7C A;  4U3F G;  4N78 E;  1QL1 A;  4WQ9 A;  1ZXG A;  1DD3 A;  2CPS A;  2C2C A;  2KYV A;  2KP8 A;  3D6Z A;  4DCK A;  1N15 A;  2YQB A;  3L35 A;  1FDM A;  1LTA C;  1VF5 D;  1EZV E;  2E42 A;  1FI3 A;  1IFD A;  1SFC C;  3IR9 A;  2K88 A;  2L4D A;  1CC5 A;  4H0J A;  2L5G B;  2BCC E;  1M56 D;  1R0Q A;  5AVT B;  2ZJS E;  1M6Z A;  1LT9 B;  1NYH A;  5C0Z A;  2IZ1 A;  2H8P D;  2FFD A;  5APW A;  4H13 B;  3L36 A;  3H1I J;  4WQE A;  3MUD C;  3DR0 A;  1DX7 A;  3H1I D;  1AA0 A;  4JQ0 D;  1FS0 E;  3MHV A;  1S5L X;  5CIG B;  2KSE A;  4TT3 H;  1YQ3 C;  5KAI H;  1SQQ E;  2KIK A;  1NKN A;  5AVQ B;  1JY3 O;  2BH4 X;  2HPC B;  1NMI A;  3HD7 C;  1WVE C;  5GTH H;  4PV1 C;  2AI5 A;  3P7K A;  2Y0C A;  1WEJ F;  1H31 A;  1L0N J;  1EDK A;  1IFN A;  3A0H V;  5DJT B;  4OGQ C;  1VQK P;  1OVV A;  2ZT9 B;  2HFE D;  1EDI A;  1T3J A;  1LTT C;  3HQ9 A;  1KV9 A;  2YNY A;  2RKL A;  2ORL A;  2POH A;  3PRJ A;  1N90 A;  2N1T C;  2JKV A;  1Q86 Q;  1NH4 A;  2E74 B;  3VMY A;  1AOQ A;  3GG2 A;  3PJS K;  3VN0 A;  1CTJ A;  1OVU A;  2BEQ D;  2RN0 A;  1FZB A;  1CRG A;  1RF0 C;  1R8E A;  1QVG O;  3VMA A;  1QGK B;  3PTZ A;  1SQV E;  1DEE G;  1QLE D;  2W6A A;  2A45 H;  1FZG A;  2V7Q H;  3RK2 D;  1KV4 A;  4PD4 I;  1LWU B;  3V6I A;  3ITK A;  1F1C A;  1G1J A;  4UB8 H;  1IFM A;  1N86 A;  2OYO A;  3CC7 P;  1CNO A;  1DII C;  2FWL A;  2M5A B;  1SQP E;  4I1L A;  2B4Z A;  5AW8 B;  3II6 A;  5L8R J;  4JPZ B;  4GED B;  2ZYG A;  4WQB A;  2QRX A;  5AW6 B;  2GB8 B;  3ZCF A;  5AVV B;  1OMI A;  2FXP A;  1MUU A;  3G3Z A;  1NTK K;  3TGU J;  1BGY J;  4IFD K;  2H7H A;  2C1D B;  1PL5 A;  3M0D A;  1GL2 B;  1BCC E;  1JOC A;  1KFM A;  2YMK A;  4H0L B;  1CXA A;  3KZI H;  1JY2 O;  1KB9 H;  2N9J A;  1SP4 A;  2WPS A;  3H1K E;  1BE3 E;  2M3B A;  5CIC B;  5TIS H;  1FJ0 A;  2GIW A;  1MFZ A;  2GC7 D;  2OTK E;  3EWK A;  3HUS A;  2LIT A;  1VPC A;  1KYO E;  1PV3 A;  4AQR D;  3R4Y A;  1C2N A;  3L71 E;  2WPV B;  1WT6 A;  4I7Z B;  2ZVN B;  2O01 H;  1NU1 G;  1Q82 Q;  2BLF B;  5KAF E;  1SVF A;  1X22 A;  1LTJ A;  451C A;  3FWN A;  3L73 J;  1FZC C;  1AOF A;  3OA8 B;  3L73 D;  5DF5 A;  1IRV A;  3PH0 A;  3CCU P;  3AEB C;  3CC4 P;  3L72 G;  2OYI C;  2OYH B;  5AW9 B;  4BRY B;  3CMA P;  1T2K D;  1K3H A;  4PJ0 V;  1USE A;  1NU1 K;  1WMK A;  3P32 A;  2H43 A;  2FYU D;  4KMG A;  3RK3 D;  4YE1 A;  1GIW A;  1QL2 A;  3CX5 E;  2B11 B;  4ASW A;  3L74 G;  2XTS B;  1TU3 F;  3RL0 D;  3B5N A;  3A0B E;  4IOI H;  3TYY A;  1CIH A;  3WUI A;  1JTH B;  3T97 B;  3AE3 C;  2YIU B;  1LFM A;  4A7P A;  1KQF B;  2YO2 A;  3V2N A;  3H32 B;  5CCG C;  4HJG H;  1NML A;  1E5W A;  1UII A;  3B5N D;  1KTM A;  3LW5 H;  1NTM K;  3TYI A;  1FAV A;  5KLV D;  1SFC A;  3MZW B;  1GDV A;  3V5B A;  4K35 A;  1NNO A;  1YIT P;  3ORV A;  4AAM A;  5CBO A;  2R5B A;  3L70 D;  4JF7 A;  1YEB A;  4L74 A;  3L4M A;  2IX7 C;  1VQO P;  1IFJ A;  3CWB D;  3MUD A;  1EZV G;  1SFC D;  1GU4 A;  4JYB A;  4UB6 V;  1LTS C;  2W83 C;  5DJU B;  1S72 P;  4DOJ A;  4TLF A;  2BCC G;  1ZZH A;  4QMA A;  1GJQ A;  1KQS O;  1KYO H;  3WFE C;  1DW0 A;  1PGQ A;  2FFD B;  2E76 C;  3TDK A;  3AEF C;  2A45 I;  1HZU A;  2CE1 A;  3RBX A;  2K9J A;  3FXE A;  3BCC D;  1YQ4 C;  3ZOW A;  5KAF H;  2FXM A;  1CTY A;  3DMI A;  4WQA A;  1SQQ G;  4D6T J;  1SQB J;  3SVW A;  4I6M C;  4D6T D;  1SQB D;  1OZH A;  4PV1 D;  5KJ7 C;  2N18 B;  2G3A A;  1LNQ A;  1FHB A;  3HE4 A;  1CSU A;  5CIE B;  3L75 J;  4OGQ D;  1H31 B;  1SQQ K;  3L75 D;  1EDJ A;  1RE3 C;  2V08 A;  3E1R A;  2N1T A;  1IZL 0;  3A0B H;  2E5Y A;  4GOD A;  3HE5 A;  2JP3 A;  1E2R A;  4W7Y A;  1S5L E;  3CCL P;  4L76 A;  3N4X A;  4WQ8 A;  2V4H A;  4XYD B;  2ZBO A;  1X8Y A;  3I56 P;  2BH5 X;  1RF0 A;  2HLO A;  2N1T D;  4JCG A;  1PZQ A;  4W7Z A;  1ZRT D;  1URQ C;  4RES B;  2NPS A;  2D0W A;  4OH8 B;  2WQY C;  1KB9 I;  2ZAE B;  4WY4 C;  4I2L C;  3TSI A;  4N6J A;  3NXS A;  2AEM A;  3FGA D;  2Q3I A;  4NPF X;  2C1V A;  5APT A;  1N73 A;  2PGD A;  4RSZ A;  1KZU B;  1EB7 A;  1JY3 N;  3MGN A;  1UIX A;  4GOF A;  4BWN A;  2JO1 A;  1CI6 B;  3A3Y B;  4EDF A;  1CHJ A;  1W2L A;  1W5C E;  2Q6Q A;  4IFM A;  1KQL A;  1Q2N A;  4NPD A;  4V2K A;  1M7L A;  1SQV K;  1QVF O;  1GTW A;  2R44 A;  3HQ7 A;  1LP1 A;  4GDO A;  4Y99 B;  1SQP G;  2QM7 A;  3GF3 A;  4EOT A;  2B12 B;  3H1H J;  3CI9 A;  5GTI E;  1RF1 B;  2WT7 B;  4ASV A;  1J1D C;  5B5E E;  1HGV A;  1BSN A;  1SQP K;  2ITA A;  3SXT A;  4IFF A;  5DJQ B;  1G2C B;  4FA5 A;  3O8Z A;  4M3L A;  2A06 D;  3OAK A;  2ZXE B;  3V2R A;  1X79 B;  1BCC G;  3GW6 A;  1T8Z A;  2D2C C;  2KUB A;  1VL2 A;  3MP7 B;  1C2R A;  5KKZ B;  3ZOY A;  2IYP A;  1H9X A;  1J1E C;  1JM0 A;  3CXH H;  1S5L H;  4B86 A;  1KC8 Q;  3H1K G;  5AVR B;  4EIC A;  4ZMD A;  3CME P;  1FZC A;  1BE3 G;  1NTZ J;  1FJP A;  1L2P A;  1T3U A;  3PXS A;  2OYI A;  3G6E P;  5H2F V;  2VHD A;  3HUS B;  3O6Q A;  3L73 E;  2FYN C;  1SQX J;  1WRG A;  2IFM A;  1SQX D;  3NBS A;  2WPR A;  2QJK B;  4KHX A;  1KIL C;  155C A;  1LTJ B;  2FYU E;  3AED C;  3RK3 E;  1FBM A;  3RK3 B;  2BPB B;  1KYO I;  1YIC A;  1BDC A;  2KLV A;  4FA9 A;  4C46 A;  1HJ4 A;  1HH0 A;  2LKM A;  3L74 E;  1K05 A;  2O1K A;  5KAI V;  4O1W A;  1I8O A;  4YXD C;  1MV8 A;  1BL9 A;  5CCG A;  1OW8 A;  3KHU A;  2K3R A;  5GTH V;  1PP9 J;  1QYZ A;  5AW7 B;  3B5N B;  2N9Y B;  3U59 A;  1VDF A;  3F5H A;  5KLV E;  3WU2 H;  1OCD A;  5CCG D;  3HTK B;  3CLQ A;  1NO4 A;  5GTI H;  2Y0D A;  3L70 E;  2PCB B;  3SWK A;  1NAF A;  3D0W A;  3VP8 A;  2I1K A;  1LMS A;  1DW2 A;  5DFS A;  5APS A;  3CWB E;  2I1J A;  2C0W A;  5BU5 A;  2KNC A;  1K8A Q;  4U3F J;  1CW5 A;  1PPJ D;  5E79 V;  4L73 A;  1I6D A;  2YMY A;  5BVZ A;  2LXB A;  1LTB C;  3MTU E;  1L4A B;  3RL0 g;  3B4S A;  3HRN A;  4C7N A;  3H1I G;  5AVZ B;  3BCC E;  2C9N Y;  1YYC A;  2ZYA A;  1C6S A;  2G8Y A;  5KJ7 A;  2E76 D;  3AE5 C;  1NWQ A;  2FKW B;  4PV1 B;  1YIJ P;  1AQT A;  1LT9 C;  1PGJ A;  2IPP A;  2K9J B;  3A0H E;  2AIU A;  1FZE A;  4H13 C;  2MJZ A;  1RE3 A;  4UB8 V;  5KLI C;  1CTZ A;  4OGQ B;  1FDI A;  5KJ7 D;  1ZR4 A;  1W2B O;  4Q5P A;  3V4Q A;  1L0N D;  1JMB A;  2MTA C;  3RGU A;  1PGP A;  2KK7 A;  3KYQ A;  4JBZ A;  1OVR A;  1KN7 A;  4U7J A;  1IC2 A;  1OW7 A;  1OXZ A;  5AW5 B;  4YTP C;  2ZYD A;  4XE5 B;  1URQ A;  4RKU J;  2N1T B;  5IY5 1;  3H1L J;  4WY4 A;  1ZRT E;  3H1L D;  3HE5 B;  1VQM P;  1CSX A;  5AW0 B;  4BXL A;  4AX3 A;  1JCC A;  2JEE A;  3CC2 P;  1URQ D;  5B66 V;  1HF9 A;  3H1J J;  3KZI V;  3H1J D;  4WY4 D;  4WQ7 A;  3CXH I;  5TIS V;  2NPS B;  2Y0E A;  5CHX A;  2FBW C;  5BU8 B;  4NFG B;  3GHG C;  1NIR A;  3S4R A;  4CPG A;  2J58 A;  2PP6 A;  4PD4 D;  1N73 B;  1S6V B;  1GKS A;  2KSJ A;  1JO5 A;  1HCM A;  3HQ6 A;  3B8E B;  3WFC C;  3I5C A;  2NZ2 A;  1LP1 B;  3G9R A;  3Q2Y A;  5C39 A;  2XNX A;  1DT1 A;  3M0A A;  3M91 A;  2E75 C;  1CRY A;  2CA4 B;  2D0S A;  1YTC A;  1NTK J;  2A06 E;  1FCD C;  1NTK D;  3TGU D;  1IFP A;  1BGY D;  3PHL A;  4OWF A;  2OZ1 A;  1FU1 A;  1KFN A;  2C0X A;  2ZZS 1;  2D2C D;  1CCH A;  2CXB A;  3SFD C;  1NOH A;  1H32 A;  4WQC A;  2IBZ G;  1R5L A;  2GUS A;  2J5U A;  2IBZ D;  3ZDM A;  3O20 A;  1LC1 A;  3NTN A;  1EC5 A;  1KIL A;  1S9K D;  2QVA A;  1F1F A;  3WUU A;  1SQX E;  1Y9B A;  3CCS P;  3SWF A;  1FZC B;  2XKM A;  2XV5 A;  4H44 C;  2HOD A;  2IFN A;  3CXH W;  2OYI B;  1ZP0 C;  3L73 G;  2WIT A;  1CO6 A;  3O6Q B;  1P84 D;  1KIL D;  1CHI A;  4PJ0 E;  1KD1 Q;  1M1J B;  2ZVO B;  4GIF A;  2C9X B;  3M9Q A;  3GMA A;  3BRV B;  2P67 A;  2YXQ B;  1NU1 J;  2FYU G;  1VQN P;  3RBZ A;  1HUC A;  2M3E A;  4MN4 C;  3L72 J;  1AJY A;  2K9Y A;  1FOS E;  3WC8 A;  2YKP A;  1GK6 A;  4O9B A;  2BEZ F;  1YTZ T;  2FYU K;  3MK7 C;  4DZO A;  1MKM A;  1C6R A;  1U75 B;  2P58 A;  1CZQ A;  1NTM J;  2O01 N;  1J2J B;  5KLV G;  1NTM D;  2GC4 D;  1VF5 B;  3A7O A;  2M8R A;  1YHQ P;  1G1I A;  3L70 G;  1BSH A;  4FAV A;  1PPJ E;  1QEX A;  1L9J C;  3PH2 B;  2WSC H;  3CWB G;  5KLV K;  1CIE A;  2JJL A;  2K37 A;  2KNC B;  2B0Z B;  3H1I E;  2WSE H;  4IL6 E;  2FXO A;  1EXJ A;  2AXC A;  2E76 B;  3HD7 A;  1LT9 A;  4PW9 B;  1EZV I;  2YO3 A;  3VOP A;  2N9B A;  1ZME C;  1NAY A;  1FOC A;  3BCC G;  2BCC J;  1IQC A;  2V7Q J;  3K5B A;  1YFC A;  2R32 A;  1KIB A;  2WZ7 A;  2W6B A;  1DW3 A;  1E8E A;  4LC1 A;  3HD7 D;  3GF7 A;  4D6T G;  1SQB G;  3RN0 A;  1L0N E;  2GA1 A;  4PJ0 H;  4Z1M H;  1AFO A;  4N3Y B;  4H13 D;  2YCC A;  3QWO C;  1J3S A;  3NMD A;  3ZOO A;  1VQP P;  3L75 G;  1SQQ J;  4Y5R A;  3CCV P;  2WSS H;  3CYT I;  2JWA A;  2HYN A;  3CX5 H;  3AE4 C;  3PXW A;  1N7S C;  3Q1M A;  1LC2 A;  4C7R A;  3H1L E;  1DIP A;  4DJG A;  2WPQ A;  3ABV C;  3AE1 C;  2OTJ P;  3OCD A;  2Q9I A;  3CCQ P;  3O1Y A;  5CBN A;  2O3J A;  1KMI Z;  2QEX P;  5AW4 B;  5CIB B;  4WY4 B;  3JSV C;  4HH2 A;  3GHG A;  1VQ7 P;  1KB9 D;  4GOE A;  2R5D A;  1PGO A;  3OJA B;  5APV A;  3V2Q A;  2YK3 A;  3RK2 B;  1I5T A;  1C7M A;  1JMM A;  1HJB A;  2QG4 A;  2PFX A;  1BDD A;  3U1A A;  1A02 F;  4L1Q A;  1VQ9 P;  2O01 J;  3X39 A;  3A2A A;  2ZOO A;  1H33 A;  5CCH C;  1JNM A;  1PIX A;  3Q5R A;  1CRH A;  4IL6 H;  2OTL P;  1KB0 A;  1YJW P;  1H8A A;  3CU4 A;  5CIH B;  1KX7 A;  1A56 A;  1SQV J;  1HJ0 A;  5AW1 B;  3C2C A;  2QJP B;  1SQV D;  4YPC A;  1AVY A;  1KX2 A;  3WFD C;  3VP9 A;  2M5A A;  3CCM P;  3VYI A;  2N3Y A;  1J1D B;  3AE2 C;  3Q5S A;  3H1H D;  3TGU E;  2PRR A;  1BGY E;  2OGU A;  1XTC C;  1LTI C;  2E75 D;  1K04 A;  2AXT E;  2BCN B;  1SQP J;  3AE9 C;  4N0K A;  2D2C B;  2A06 G;  4Y99 C;  2OQQ A;  1VQ5 P;  1W2E A;  1H88 A;  3WU2 V;  3PP5 A;  3LW5 J;  2QJY B;  1ETP A;  1J1E B;  1QX8 A;  1ZW0 A;  1RF1 C;  5GTI V;  1C75 A;  2AEJ A;  2E5T A;  4LGD E;  2IBZ E;  1DW1 A;  2OZ1 B;  2W8Z A;  1H0T A;  3UIA A;  1S9K E;  3SFE C;  2WVR A;  2XND H;  2XDJ A;  2KI7 B;  1Q81 Q;  5H2F E;  1NTZ G;  3EFG A;  1NTZ D;  1BCC J;  2FYN B;  1H32 B;  3TF5 A;  2E43 A;  2JWD A;  3P8M C;  3WMM 0;  1P84 E;  1SQX G;  4LLH A;  1KIL E;  1KIL B;  3AE7 C;  4H44 D;  2P1J A;  4KJM A;  3ZIY A;  2WSE J;  3H1K J;  1M70 A;  1BE3 J;  2HOD B;  1VQ6 P;  1VQ4 P;  1CCR A;  4YXW H;  5CJ4 A;  4MU8 A;  2OAR A;  4RO0 A;  1S2E A;  1SQX K;  1NKZ B;  3L71 J;  1L0L J;  2Q5U A;  1AKK A;  3RL0 B;  3L71 D;  5AVW B;  1L0L D;  3AEG C;  3PXT A;  3VMX A;  5GTH E;  4GYD A;  2Z4E A;  4L75 A;  4WB4 A;  2WTY A;  3EQ2 A;  2Q1K A;  1Y8A A;  1RAQ A;  3RMZ A;  2KS1 A;  1DVH A;  1PP9 D;  1E79 H;  3VTP C;  1C6O A;  1RQV A;  2GM4 A;  1JY2 N;  1AYG A;  1YI2 P;  5AUR A;  3M06 A;  1LS9 A;  2LXC B;  3CX5 I;  2XZR A;  1COT A;  4XA4 A;  3CPW O;  5B5E H;  2Z5I A;  4HYT B;  2QE7 H;  2AXT H;  1SFC B;  3PLN A;  5E79 E;  1NHL A;  1K3G A;  1PPJ G;  2DVH A;  3RLM A;  3A9F A;  4U3F D;  2M0B A;  2PAJ A;  1NGM B;  3E7K A;  2ZFC A;  1H1O A;  4L3H A;  1A2S A;  2PAC A;  3CCR P;  3WUT A;  3CP5 A;  5H2F H;  1RZ6 A;  1N9C A;  1AV1 A;  2YXR B;  2KOG A;  1QL3 A;  3AEE C;  1YEA A;  3HD7 B;  1MZ9 A;  1P84 H;  1ZR2 A;  2GUV A;  4D6T E;  1SQB E;  2JTI B;  1CSB A;  1L4A C;  1OIP A;  4UB8 E;  2B87 A;  5KLI B;  5APU A;  1KYO W;  1H9Y A;  5APX A;  1MZ4 A;  1N7S A;  1OW6 A;  1L0N G;  3L75 E;  4EYY Q;  3B71 A;  1CYC A;  1GZL A;  1RAP A;  1X0T A;  1YCC A;  4K3I A;  3FWL A;  3HE4 B;  1N7L A;  3EFF K;  1MG2 D;  4R4M A;  1NJI Q;  1N7S D;  2YKO A;  1VYD A;  1DEB A;  1L0N K;  1GMJ A;  1HJ3 A;  1CSV A;  1FC2 C;  2V07 A;  1JY3 P;  1AQ5 A;  3H1L G;  3CX5 W;  1M60 A;  5B66 E;  4FAN A;  2QM8 A;  1USD A;  3KZI E;  2C9L Y;  2ZT9 C;  1CYI A;  1VQ8 P;  2I8F A;  3OCD B;  1KB9 E;  2IZ0 A;  2VRS A;  1A02 J;  3H1J G;  1CHH A;  5TIS E;  3KQG A;  4GT1 A;  3OA7 A;  1DD4 A;  5CCH A;  5E79 H;  3CXH D;  3GHG B; 
#chains in the Genus database with same CATH homology
 4EIF A;  2L91 A;  1FI9 A;  4FB1 A;  3MK7 C;  5B6Q A;  1C6R A;  1U75 B;  4AAL A;  1YNR A;  3CX5 D;  2PCC B;  5EXQ A;  2C1V A;  4RSZ A;  3NWV A;  1EB7 A;  2ZXY A;  1NTM D;  1HH7 A;  1A8C A;  2DGE A;  4EDF A;  2GC4 D;  4XXL A;  2HV4 A;  1CHJ A;  1E29 A;  1H33 B;  1W2L A;  1W5C T;  4FAV A;  4WQ9 A;  2ZON G;  1L9J C;  4LJI A;  2C2C A;  3PH2 B;  4V2K A;  1QL4 A;  2EXV A;  1N15 A;  2YQB A;  3O0R C;  1CSW A;  1CIE A;  3HQ7 A;  2KNC B;  1FI3 A;  2B0Z B;  2B12 B;  2L4D A;  1CC5 A;  4H0J A;  1N50 A;  3SWS A;  4RJT A;  1R0Q A;  1M6Z A;  4J20 A;  4PW9 B;  5C0Z A;  4AAO A;  1I55 A;  4WQE A;  3DR0 A;  1FOC A;  3SXT A;  3H1I D;  3M97 X;  1IQC A;  5DJQ B;  1YFC A;  4FA5 A;  1KIB A;  1B7V A;  2A06 D;  5CIG B;  1DW3 A;  1E8E A;  3GW6 A;  1GU2 A;  3RN0 A;  1C2R A;  5KKZ B;  3ZOY A;  1H9X A;  2BH4 X;  2YCC A;  1NMI A;  1J3S A;  1WVE C;  3ZOO A;  2AI5 A;  4EIC A;  2Q3E A;  1WEJ F;  2Y0C A;  1H31 A;  4Y5R A;  3PXS A;  3CYT I;  2JWA A;  3A0H V;  5H2F V;  3PXW A;  2VHD A;  5TJH A;  1LC2 A;  1SQX D;  3NBS A;  2N3B A;  2QJK B;  1YIQ A;  3OCD A;  3HQ9 A;  155C A;  1KV9 A;  1NU1 D;  4L3G A;  2BPB B;  3O1Y A;  1YIC A;  1I6E A;  2ORL A;  2O3J A;  4FA9 A;  5KAF V;  5CIB B;  1HJ4 A;  3PRJ A;  3L72 D;  1CRJ A;  1N90 A;  1CED A;  3NBT A;  3MK7 B;  2C1U A;  4O1W A;  1I8O A;  5KAI V;  4AAN A;  1AOQ A;  1KB9 D;  1BL9 A;  3GG2 A;  2N9I A;  4H0K A;  2FRC A;  1CTJ A;  3KHU A;  2RN0 A;  2YK3 A;  5GTH V;  1L9B C;  1I5T A;  1QYZ A;  1C7M A;  1CRG A;  2QG4 A;  3L74 D;  2N9Y B;  4WQD A;  4FA1 A;  3VMA A;  4L1Q A;  3PTZ A;  3X39 A;  1OCD A;  2ZOO A;  3A0B V;  1H33 A;  2Y0D A;  1CRH A;  2PCB B;  1KB0 A;  3CU4 A;  5CIH B;  1LMS A;  1KX7 A;  1A56 A;  1DW2 A;  3ITK A;  1F1C A;  5DFS A;  3DP5 A;  3C2C A;  2QJP B;  1SQV D;  2LIR A;  1KX2 A;  1HJ5 A;  1C52 A;  3WFD C;  1CNO A;  1DII C;  2FWL A;  1PPJ D;  2N3Y A;  5E79 V;  2B4Z A;  1I6D A;  3H1H D;  2RMZ A;  4GED B;  5CIF B;  1JDL A;  4WQB A;  3VYM A;  1EZV D;  2B10 B;  2BCN B;  2GB8 B;  3ZCF A;  4N0K A;  1CRC A;  2BCC D;  3VNW A;  3WU2 V;  2C1D B;  1C6S A;  2QJY B;  1ETP A;  5GTI V;  1C75 A;  4IL6 V;  1DW1 A;  2OZ1 B;  1CXA A;  2K9J B;  2N9J A;  2AIU A;  1COR A;  1HRO A;  4UB8 V;  1NTZ D;  1CTZ A;  1HZV A;  2FYN B;  5CIC B;  4Q5P A;  1FJ0 A;  1H32 B;  1SQQ D;  2GIW A;  3TF5 A;  2GC7 D;  1L0N D;  2MTA C;  1GQ1 A;  2LIT A;  1QN2 A;  1C2N A;  3ZIY A;  1CIG A;  2N18 C;  1M70 A;  2BLF B;  1CCR A;  451C A;  1AOF A;  3OA8 B;  4MU8 A;  3L73 D;  5DF5 A;  1IRV A;  5IY5 1;  3WFB C;  1AKK A;  3H1L D;  4EID A;  3L71 D;  1L0L D;  3PXT A;  1CSX A;  5CID B;  3RN1 A;  1K3H A;  4PJ0 V;  4AX3 A;  4GYD A;  2FYU D;  4KMG A;  4YE1 A;  5B66 V;  1S5L V;  3HQ8 A;  5C9M A;  1GIW A;  3KZI V;  1RAQ A;  2C8S A;  4DY9 A;  3RMZ A;  3H1J D;  2KS1 A;  1CYJ A;  3SLE A;  1DVH A;  2B11 B;  4WQ7 A;  1PP9 D;  1U74 B;  2XTS B;  1CXC A;  2BGV X;  5TIS V;  1CIH A;  3WUI A;  3SJL A;  1MG3 D;  2Y0E A;  1C6O A;  1FI7 A;  1QKS A;  2YIU B;  1AYG A;  1LFM A;  4NFG B;  1NIR A;  4A7P A;  5AUR A;  2CE0 A;  1LS9 A;  1COT A;  1NML A;  4PD4 D;  4PWA A;  1S6V B;  1GKS A;  3TYI A;  1CRI A;  5KLV D;  1HCM A;  3PLN A;  3HQ6 A;  1CIF A;  1GDV A;  3WFC C;  3O5C A;  1NNO A;  1K3G A;  2DVH A;  3RLM A;  3ORV A;  4AAM A;  3L70 D;  3A9F A;  4U3F D;  1YEB A;  4P4Q B;  3L4O A;  3L4M A;  4FA4 A;  3CWB D;  4QAO A;  1H1O A;  4L3H A;  1A2S A;  2PAC A;  2CA3 B;  2MHM A;  4UB6 V;  1DT1 A;  3CP5 A;  1DVV A;  1CRY A;  1SQP D;  2CA4 B;  2D0S A;  1RZ6 A;  1YTC A;  1N9C A;  4EIE A;  1FCD C;  1ZZH A;  1NTK D;  2C1D A;  3TGU D;  1BGY D;  1GJQ A;  1QL3 A;  1YEA A;  3PHL A;  3WFE C;  1DW0 A;  2JTI B;  2OZ1 A;  3TDK A;  2JQR A;  5KLI B;  1HZU A;  2CE1 A;  1KYO W;  2ZZS 1;  1CCH A;  1H9Y A;  5B5E V;  2CXB A;  3BCC D;  3ZOW A;  1MZ4 A;  2AXT V;  4O1Q A;  1CTY A;  1I54 A;  3DMI A;  4WQA A;  5DJQ C;  1H32 A;  1CYC A;  3SVW A;  1BCC D;  4WQC A;  2IBZ D;  1SQB D;  3JBT B;  3O20 A;  4D6T D;  1RAP A;  1YCC A;  1LC1 A;  4K3I A;  5CYT R;  2N18 B;  3FWL A;  1F1F A;  1IO3 A;  1FHB A;  1CSU A;  1MG2 D;  5CIE B;  3H1K D;  1H31 B;  1BE3 D;  1VYD A;  3L75 D;  3CXH W;  3OA8 A;  1HJ3 A;  351C A;  1CO6 A;  1CSV A;  2V08 A;  1IZL 0;  1KYO D;  1P84 D;  2V07 A;  1CHI A;  1I8P A;  3CX5 W;  1E2R A;  1M60 A;  2C9X B;  4FAN A;  1CYI A;  4WQ8 A;  2I8F A;  3OCD B;  1RZ5 A;  4XYD B;  2ZBO A;  1IRW A;  1HRC A;  3VRD A;  2BH5 X;  1CHH A;  4JCG A;  3ZBM A;  1DIQ C;  1ZRT D;  3ZOX A;  1OAE A;  3WC8 A;  2D0W A;  3CXH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...