5KLIB

Rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
b'AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
molecule tags Oxidoreductase
source organism Rhodobacter sphaeroides
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
total genus 67
structure length 256
sequence length 256
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5kliB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 5kliB02
5E79V 4Q5PA 2OZ1A 4EICA 1COTA 5DF5A 1E8EA 1EZVD 1L0ND 2AXTV 4FA5A 1F1FA 1HH7A 2QJYB 4A7PA 4EIEA 2I8FA 1KB9D 1GJQA 1NTMD 4O1WA 1S5LV 1C2RA 3CU4A 2QG4A 3CYTI 4U3FD 2RMZA 1CYIA 1L9BC 2AI5A 2D0SA 4Y5RA 2PCBB 3SJLA 2BCNB 4RJTA 4AANA 1A8CA 1P84D 1HJ5A 3SWSA 1FI3A 5AURA 4WQBA 3PXWA 1DW1A 2BH5X 3CXHD 3HQ6A 1W2LA 1CIGA 2V08A 5CICB 5CIDB 2A06D 4J20A 1RAQA 1B7VA 1I8OA 2KS1A 1F1CA 1H33B 4FANA 5CIEB 4UB8V 1IZL0 3CWBD 3L74D 2N9JA 1QKSA 1NMLA 4WQ8A 4AAMA 5TJHA 4WQCA 3CX5W 2CA4B 3L73D 5CIBB 1K3GA 3TDKA 3OA8B 1SQBD 3RLMA 4FB1A 3ORVA 5EXQA 1CXAA 1YCCA 1KX7A 1I6EA 5CIHB 3MK7B 3CX5D 1I5TA 1GU2A 5B66V 1DW0A 1HJ3A 3O1YA 3RMZA 4N0KA 1YEAA 155CA 4K3IA 1IRWA 3NBTA 2B0ZB 2YQBA 3ZOXA 3HQ8A 1ZRTD 2CE1A 3L70D 1W5CT 1CCRA 2EXVA 4L3GA 3O0RC 1LC1A 2RN0A 2Y0DA 3HQ7A 2FYNB 4JCGA 1A2SA 1CHJA 1DIQC 3NWVA 3VYMA 1CSXA 4FA4A 1H31A 1GDVA 4O1QA 2ZZS1 1AOFA 1NNOA 1DT1A 1J3SA 1LFMA 2N9YB 2LITA 3HQ9A 4V2KA 4WQDA 2V07A 1C7MA 1CRCA 3ITKA 2N9IA 1CCHA 3A0HV 1E29A 3L4MA 2XTSB 3MK7C 1M70A 1DVVA 4WQ9A 1AKKA 351CA 5CIGB 3GG2A 2YIUB 2B11B 1BGYD 3DMIA 1I8PA 3JBTB 1CRYA 3PTZA 1CC5A 1CO6A 5CIFB 5KLIB 1OCDA 1CSWA 3OCDA 3O20A 2C1VA 4UB6V 1CYCA 2K9JB 1CRIA 3H1HD 5B5EV 2OZ1B 2ZXYA 3CP5A 451CA 3O5CA 5CYTR 1DIIC 2L4DA 1YIQA 1I55A 1IQCA 2AIUA 1GKSA 1HZUA 2YCCA 3WFBC 1A56A 2YK3A 1YFCA 1CHIA 2ZOOA 2C1UA 1H9YA 2B4ZA 1NTZD 2BLFB 1I54A 3KHUA 4IL6V 1SQXD 3RN0A 2BCCD 4FAVA 3PH2B 3OA8A 2FRCA 2JTIB 2FWLA 3RN1A 4WQAA 2GC7D 1RAPA 3VNWA 2N18C 2CXBA 4FA9A 1C52A 5DJQC 4H0KA 3L4OA 1FHBA 1M60A 1CSVA 1CYJA 1DW2A 3PHLA 2QJKB 3H1KD 5C0ZA 1BE3D 1N90A 1PPJD 1R0QA 1CSUA 4L3HA 3OCDB 3SXTA 2BH4X 2N3YA 1YNRA 1S6VB 5TISV 1WVEC 4KMGA 1MG2D 1KIBA 2O3JA 2N18B 1QYZA 1HRCA 1SQQD 3ZOOA 1KYOW 3KZIV 1M6ZA 1L9JC 1NIRA 1PP9D 3DP5A 4PD4D 2BGVX 1CTYA 1H9XA 1CEDA 3L75D 3TF5A 1YICA 3H1LD 2FYUD 1FOCA 3L71D 5DJQB 1H32A 1LMSA 1BCCD 1N50A 3ZOWA 1LC2A 3PXSA 1SQPD 1IRVA 4H0JA 3SVWA 2Q3EA 5C9MA 4QAOA 5GTHV 3TYIA 5B6QA 4LJIA 1HROA 5KLVD 1QL4A 1CXCA 2Y0EA 3NBSA 3FWLA 4FA1A 5GTIV 1E2RA 1CIFA 2LIRA 1CRGA 1C6SA 3ZCFA 2GC4D 1JDLA 1C75A 4XXLA 1GIWA 1MZ4A 4AX3A 2BPBB 2N3BA 3VMAA 1HJ4A 4EDFA 1C2NA 4GYDA 2B10B 3PXTA 5H2FV 1CNOA 2JWAA 2VHDA 4NFGB 1CTJA 1YEBA 3WC8A 2Y0CA 3SLEA 1BL9A 1H33A 4EIDA 1HZVA 1AYGA 3X39A 1H32B 3H1JD 3ZIYA 4AAOA 2ZBOA 4PWAA 2CA3B 4WQEA 2IBZD 4EIFA 1MG3D 1U75B 2D0WA 2C2CA 2GIWA 1CORA 1OAEA 1VYDA 4PJ0V 1IO3A 3WFDC 4DY9A 1DW3A 4L1QA 1RZ6A 3WFEC 2L91A 3GW6A 5IY51 3CXHW 1CTZA 1FI9A 1FCDC 4AALA 1KB0A 2CE0A 3DR0A 3M97X 3VRDA 3WFCC 1HCMA 1DVHA 1N9CA 2MTAC 1CHHA 3ZOYA 2KNCB 1I6DA 1C6OA 4MU8A 4XYDB 1KX2A 1N15A 3C2CA 1AOQA 1SQVD 1CRJA 3TGUD 3WU2V 1EB7A 1QN2A 2MHMA 1K3HA 3PLNA 1C6RA 3H1ID 1KV9A 2PCCB 1CRHA 1NU1D 3WUIA 1ZZHA 1CIEA 3BCCD 1CIHA 1FJ0A 5KAIV 5KAFV 3A9FA 3L72D 1LS9A 4GEDB 2C8SA 4P4QB 2QJPB 5DFSA 1GQ1A 2C1DA 1L0LD 1U74B 3PRJA 1FI7A 2HV4A 2JQRA 1KYOD 3ZBMA 1RZ5A 2PACA 1H1OA 2GB8B 1NTKD 1H31B 1WEJF 2DVHA 3A0BV 2ORLA 2ZONG 1YTCA 1NMIA 4YE1A 2B12B 2C9XB 2DGEA 4RSZA 5KKZB 4WQ7A 2C1DB 4D6TD 1QL3A 1ETPA 4PW9B
chains in the Genus database with same CATH superfamily
3MD0A 4I1LA 2GUVA 1ZOYC 4DJGA 2R44A 2OYIC 4Q5PA 2KB7P 3L71E 2OZ1A 2K9YA 3L75J 1COTA 4H0LB 5DF5A 1MFTA 1E8EA 5B66E 4I6MC 4FA5A 1F1FA 3CCUP 1HH7A 2QJYB 1NTMJ 4A7PA 1VQPP 1PPJE 2W6AA 3V2RA 1GJQA 3CU4A 1IK9A 1LGHB 4HJGH 3L35A 3O6QB 1M1JA 2AI5A 4Y5RA 2PCBB 1A02J 4AANA 3H6PA 2SPZA 1P84D 3SWSA 2E43A 2E74C 2BH5X 1W2LA 2H43A 4JYCA 4W80A 2ZVOB 2V08A 1FDIA 2HLOA 2YIUC 5CIDB 4J20A 3CCVP 3P8CE 5APUA 4UB8V 1OMIA 4WQ8A 1NMLA 2KOGA 4AAMA 1IFJA 4WQCA 1URQA 3BCCG 3L73D 1K3GA 2VRSA 3OA8B 1SQBD 4NPDA 5C39A 1DH3A 2V7QH 4FB1A 1Q90D 1CXAA 3CX5D 1I5TA 1LTJB 2WSCH 1DW0A 155CA 1YQ4C 1AVOA 2FFDC 3L73G 2CE1A 3CWBJ 2CPBA 1YI2P 2QJKC 3L74G 1QL1A 3BCCE 2RN0A 2Y0DA 2LR2A 4JCGA 2K9JA 2KXPB 2OYHC 3VYMA 1CSXA 3RK3D 1H31A 1OVUA 4YXWH 1GDVA 1IC2A 2IDBA 2AEFA 1KD1Q 2Z4EA 1NNOA 2LXBA 4U3FG 2R5DA 1LT9C 3L72J 2LITA 4V2KA 2NZ2A 3ITKA 1R5LA 2N9IA 1X8YA 2FBWC 1AKKA 5EFWB 1KILE 1BGYG 3KZIH 3RK2D 1WMKA 2ZT9B 4ZMDA 1NTZJ 2QSIA 3WUTA 2P58A 2PP6A 1CSWA 1SQPE 3O20A 1DD3A 4UB6V 1CYCA 3H1HD 5AVTB 3RK3E 3KDPB 1ZR4A 4GOFA 2L4DA 1L4AD 1YIQA 1LTBC 1L0NJ 3IAOA 1P84H 2AIUA 2OYHA 1N86A 2QM8A 2YCCA 1A56A 2H7HA 2O01J 1YFCA 2WPRA 1NAYA 1SQPK 1H9YA 3BVHA 1NTZD 3M9BA 3M9QA 1I54A 2ZYGA 3W67A 1LNQA 4IL6V 3CX5E 4AYCA 1RF1A 1PGPA 1SQVJ 3RN1A 1HF9A 2J59M 1RAPA 2N18C 4FA9A 2WVRA 3LW5J 4JPZB 4N6JA 1JY3P 1M60A 4XFJA 2A45I 3HRNA 1CYJA 2NPSB 1DW2A 3PHLA 5C0ZA 1AJYA 2JWDA 3LW5H 1S9KD 2P1JA 1S1CX 1LT9B 1CSUA 1FJKA 2N3YA 4GDOA 2E42A 3M0DA 1EZVG 2Z5HA 3V5BA 4KMGA 3HUSC 3L75G 1H0TB 4NPEA 2O01N 3CXHI 2RH0A 3MGNA 3FGAD 4H13C 1M6ZA 1PP9D 4I7ZB 1FZCC 3D71A 1GW4A 3L73E 3N7NA 2BGVX 1VQ6P 3U1AA 1DD4A 1LTGC 3P32A 2YMYA 1CEDA 3L75D 3H1LD 1W5CE 2FYUD 3L71D 1H32A 2ITAA 3HD7B 4OH8B 3CXHE 1LC2A 1OXZA 1N7LA 1QEXA 1FJPA 2BEZF 1SQPD 4H0JA 3SVWA 2Q3EA 3EFFK 5GTHV 1L0LK 3C8VA 1URQD 3NBSA 1SQXG 2OYOA 3P8MC 3H1IE 1ZP0C 4U3FE 2GC4D 1JDLA 4PJ0E 1GIWA 4ZKUA 4O9BA 2BPBB 1Y47A 1KQFB 1JB0J 4EDFA 1C2NA 5AW0B 3K5BA 4PV1D 2HPCA 1RF0A 5H2FV 2R3CA 1OW8A 2VHDA 1KB9H 1YEBA 3V4QA 2B87B 2IFMA 4IL6E 3VTPC 3SLEA 1QVFO 1LTAC 1SQXK 3L73J 3CWBG 1H32B 2NRGA 4PWAA 2IBZD 1MG3D 1SVFA 2GIWA 1CORA 2XDJA 1S5LH 4PJ0V 1OW6A 3RK3C 4DY9A 1BDDA 4L1QA 3T97A 3HE4A 4K3AA 1FI9A 2LXCB 3JCUH 3SSUA 5KJ7C 1VF5C 3M97X 3VMXA 3VRDA 1DVHA 1N9CA 2KNCB 1CHHA 1OVRA 4MU8A 2IX7C 1CRJA 2KSJA 1T3JA 1QL2A 1K3HA 2B89A 2QEXP 3H1ID 1DX7A 1SQQG 1GL2A 1NU1D 1IFIA 3WUIA 2YXQB 2E5TA 1CIEA 2NPSA 3AEEC 5KAFV 1KILB 1W2BO 3CCJP 3L72D 1RQUA 3H1HE 3V2QA 5KKZC 1JOCA 3CPWO 2FYUE 1IFMA 1U74B 4MN4C 1LWUA 1Q86Q 3PRJA 2B88A 1FI7A 1AVYA 2JQRA 1T8ZA 1Z56A 3NFQA 3HTKA 3CCEP 1KYOD 3ZBMA 1RZ5A 2PACA 2M8RA 2W6JH 1E79H 1H1OA 4KJMA 2QVAA 3FX0A 3H1IJ 1GTWA 1KMIZ 3L70G 5AVYB 3L37A 3NTNA 1L0NK 2C9XB 2DGEA 4OGQD 4WQ7A 3KPEA 2C1DB 1QL3A 2KUBA 2YKPA 3AEBC 3CX5I 4EICA 4H44B 1NTMK 4CPGA 1ZMEC 1TU3F 2W27A 4EIEA 3CX5H 1KB9D 4O1WA 1T3UA 3OAKA 1MUUA 5AVSB 2M0BA 1PP9G 2D0SA 2AXTH 4RJTA 3B5NC 4UB6E 1JM0A 1DW1A 1M7LA 3AE7C 1MKMA 1CIGA 4K35A 1HWTC 2NPSD 4TLFA 2A06D 3G3ZA 3OJAB 4AQRD 1B7VA 2KS1A 4RESB 5CIEB 1EDLA 1PIXA 1NTZE 4L75A 2N9JA 1SQQK 5CCGC 5TJHA 3CX5W 3H1KE 3I5CA 1SQBJ 2Q7CA 2K88A 1S72P 2JKVA 3KZIE 4OWFA 3L74E 2E5YA 3HTKB 3CCRP 3BASA 3O8ZA 1KX7A 3HUSB 1FE6A 1I6EA 5B66V 5APWA 2KS1B 3O1YA 4UB8E 4N0KA 3RGUA 2YQBA 3ZOXA 2LKMA 4B86A 1CCRA 1HTLC 1URQC 2PAJA 1SFCC 4UB8H 2EXVA 1LC1A 1NKZB 3HQ7A 4JBZA 1KQGB 1NVOA 3A0BE 1VQ9P 4D6TG 5CBNA 4KHXA 2YO3A 3B5NA 5CCHC 3NWVA 2YKOA 1SQPJ 2YKQA 2B9BA 4PV1B 3CCQP 1LTIC 1GK4A 3HQ9A 4WQDA 2ZT9D 3H1LE 1LT1A 1YQ3C 3MTUE 1CRCA 2M5AB 1M57D 2FYUG 3FXDA 3CCSP 2WSFJ 1NU1E 2R32A 351CA 5CIGB 4R4LA 3Q1MA 4EOTA 3M0AA 1G1IA 2B87A 5CIFB 1EZVE 1OX3A 1Y8AA 3OCDA 2MJZA 2C1VA 2PGDA 5B5EV 2FXOA 3G71P 2OZ1B 3RL0D 2FXMA 2ZXYA 3CI9A 3A5TA 2A45G 3O5CA 5KJ7A 1IQCA 2QM7A 1HZUA 2XNXA 2KLUA 3VN0A 3USSA 1CHIA 2WT7A 2ZOOA 2HODA 3FWNA 3JCUE 2BCCJ 3MUDA 3HD7A 1FAVA 3KHUA 5AW3B 3GLMA 3TSIA 3RN0A 1VQ5P 3H1HG 2JTIB 2WMMA 5APYA 3L71G 1SQVK 1RE3C 2GC7D 3CL3D 1M1JC 4L74A 1QVGO 2CXBA 3D0WA 3T97B 4H0KA 3BRTB 5KLIC 1CSVA 3KYQA 2FY8A 2WPVB 2OTKE 2QJKB 1RQVA 2IZ0A 1BE3D 1N90A 2ZAEB 3G4SP 1USDA 4L3HA 5TISH 4M3LA 2D2CD 3HD7D 1Y9BA 5TISV 3Q5SA 4GT1A 1MZ9A 1P84I 2P10A 4GKGA 1BE3E 2N1TD 2A06G 2C9NY 1SFCD 2O01H 1SQQD 1KILC 3KZIV 3AE9C 2KYVA 3PP5A 4PD4D 2Q3IA 2O1JA 3A2AA 4KT0J 3V6IA 3RL0B 4H44D 2HYNA 1M1KQ 5AW9B 1U57A 3TF5A 1YICA 2J58A 3L4FA 4TT3H 1FOCA 1LMSA 4L73A 1N50A 1RF0C 3PXSA 5TISE 4W7YA 5AVQB 3TYIA 5GTIH 1VPCA 4LJIA 1IFPA 1JTHB 1HROA 1N7SD 5KLVD 1CXCA 2Y0EA 1W2EA 3RL0g 1JNMA 1E2RA 3MZWB 2FYNC 1H88A 3CD6P 3TNUA 3ZCFA 4XXLA 4YTPC 1FBMA 5GTHH 3GHGB 3VMAA 4IOIH 5BU8B 3PXTA 3B5ND 1CNOA 2JWAA 4NFGB 2E75D 5AVZB 1DEBA 3WC8A 3SWYA 1FZBA 5H2FH 1OVVA 1BL9A 4AUWA 3RL0C 2GUSA 1CI6A 3H1JD 3AEDC 3ZIYA 2ZBOA 1YJWP 5CCGD 4WQEA 1L2PA 4EIFA 4H44C 3N4XA 1WT6A 4GOEA 3II6A 5AVXB 2GA1A 1OAEA 1Q82Q 2CK3H 3WU2E 4HYTB 1NWQA 1GL2B 1HVVA 3GF7A 1JMBA 1IO4A 1CI6B 1NYHA 2CE0A 1L0LE 2ZXEB 3L72E 1L0LJ 2W6BA 3ZOYA 1C6OA 4XYDB 1KILD 3C2CA 1AOQA 2FXPA 3D70A 3WU2V 1EB7A 3CMAP 2MHMA 3PLNA 1C6RA 1NTKK 4N78D 1OW7A 3TGUJ 4C7NA 1CRHA 4GIFA 1MFZA 3H1JE 2ZVNB 5KAIV 1T6AA 4H13B 2E75C 1UIIA 3A9FA 3KXDA 4IL6H 2C8SA 4OGQB 5DFSA 2HG5D 2A45H 1JY2N 3VOPA 1L0LD 3GMAA 2HV4A 3HE5B 2Q1KA 3LIEA 4D6TE 2GB8B 4ASWA 1NTKD 5KAFH 1GL2C 1WEJF 1FZAA 3JC22 2DVHA 1G2CA 2C9LY 3A0BV 2ORLA 2ZONG 1YTCA 2WSFH 4YPCA 1NMIA 2KLVA 1PP9E 5AW8B 1LTTC 3A3YB 3U59A 1M90Q 1SFCB 2KSEA 1FOSF 4RKUJ 2BCCG 5E79V 1U7JA 3D6ZA 1BCCE 1EZVD 1L0ND 2AXTV 3O6QA 1SQBE 1NKNA 1VQOP 1EZVI 4WY4C 1NTMD 2GM4A 1BCCG 3IN6A 3SFEC 2JO1A 3H1JJ 1EQ7A 1PV3A 1RE3A 1NTZG 2QG4A 4ZKPA 4EIJA 3UIAA 4IL6X 1L9BC 2QIWA 3P8CD 3PJSK 4LLHA 3SJLA 4LGDE 1A8CA 2KIKA 3FXEA 5APQA 1HJ5A 4EI2A 1FI3A 3MHVA 4WQBA 3PXWA 5CHXA 1ZR2A 4BRYA 5BVZA 5GTHE 3HQ6A 3H1LG 5DJTB 3EQ2A 2CPSA 1P84E 1RAQA 3F5HA 2FFDB 1I8OA 2BEQD 1F1CA 3KQGA 1H33B 4PD4I 1KC8Q 4ZNCA 1IZL0 1QKSA 1KV4A 2IPPA 1KN7A 5CIBB 3TDKA 3I55P 2C0XA 4OVNF 1SQBK 5M1BA 3A0BH 5CBOA 1KYOE 3ORVA 3PH0A 1GU4A 5CIHB 3L36A 1GU2A 1CSBA 1N8RQ 1J2JB 1HJ3A 3RMZA 4K3IA 3AECC 1IRWA 3NBTA 1PGJA 1NAFA 1NJIQ 5AVVB 3RK3B 4LC1A 1N7SA 3L70D 5CCHD 3TNUB 1W5CT 5B5EH 1N73A 3QH9A 2L5GB 4Z1MH 4Y28J 1N7SB 2FYNB 1JTHA 4XE5B 1NTKJ 2XU6A 5AVWB 1A2SA 4WBAA 1CHJA 2IBZI 4DOJA 1HJBA 3C9IA 2QJYC 4QMAA 4O1QA 2ZZS1 5GTIE 4HKZH 1JY3O 3S9OA 2V07A 3OW2O 3E7KA 1FZEA 2IFNA 1S9KE 3A0HV 1E29A 1BGYE 3L4MA 2R3SA 4PJ0H 2XTSB 2IBZE 1DVVA 4WQ9A 2OYIA 1JUNA 1BGYD 1I8PA 3JBTB 1RE4C 3AE3C 5KLIB 1VF5D 2K9JB 3CCMP 1CRIA 5KLVJ 4XA4A 2Z5IA 1SQXJ 3VYIA 3VMYA 3CP5A 451CA 2ZYDA 3M91A 1T2KC 1I55A 1YIJP 2XKMA 3RK2B 1GKSA 2IZ1A 3TGUG 2XNDH 2YK3A 3D6YA 4IFFA 2KI7B 1JO5A 3E1RA 2C1UA 2B4ZA 2K37A 3AE4C 4H0LD 1DIPA 2E76B 4H13D 2P67A 2M3BA 2HODB 3V2NA 2WT7B 3OA8A 2FRCA 1YJ9P 2K3RA 1X79B 1BSNA 1NTMG 1NU1J 1H89A 5KJ7D 2WTYA 1FHBA 3L70J 2G8YA 2C0WA 3HE5A 1J1EB 4OGQC 4L76A 1M8OB 3L74J 3H32A 1KB9I 1EC5A 2V4HA 1PPJD 1R0QA 3H1KJ 1RF1B 3OCDB 3U1CA 2E74B 2KZJA 1XTCC 2R5BA 5E79E 3R4YA 1WVEC 2Q6QA 3C1LA 1KIBA 1JCCA 1SQQJ 2I1KA 1LJ2A 1FS0E 1QLED 2N18B 2WWWA 4PV1C 1HRCA 2H8PD 4JQ0D 1EXJA 2Q5UA 1L9JC 2M5AA 3IF4A 1N73B 1NIRA 1S5LE 3F89A 3DP5A 5KAFE 1LWUB 3S1KA 2IBZG 1CTYA 4H0LC 3M9HA 2FYZA 1Q2NA 1EDIA 2AXCA 5DJQB 1X9VA 2A06E 3H1LJ 3ZOWA 3TYYA 1IRVA 1HJ0A 5C9MA 4QAOA 1J1EC 1NOHA 2O1KA 1VQLP 1FDMA 1U7MA 2JP3A 3P7KA 2E76D 5CCHA 1LP1B 3FWLA 4C46A 1X22A 2LIRA 1C6SA 3EFGA 1AQ5A 1K8AQ 1YYCA 1MZ4A 1L0NG 1YBKA 1SQVE 1GL2D 2BASA 1HJ4A 5K5GB 3LIDA 3B8EB 2JR8A 2AXTE 2OARA 1HBWA 3L72G 3S4RA 1H33A 1LWUC 1HZVA 3X39A 4C7RA 1FOSE 3Q2YA 3H1HJ 1FZCA 1K73Q 3W68A 4BRYB 1EDJA 1ZW0A 1U75B 4WY4D 2D0WA 3SWFA 2W90A 3WMM0 1VYDA 2I1JA 1PZQA 1IO3A 1JCDA 3WFDC 1DW3A 1RZ6A 5AVRB 1K05A 3B71A 3GW6A 1FCDC 2D2CB 2XV5A 4AALA 1HUCA 1MV8A 1ZXGA 2JDIH 2MTAC 1I6DA 2P7JA 1KX2A 2IYPA 1N15A 2V7QJ 1SQVD 3TGUD 2OTLP 1NU1K 1L4AA 1KZUB 1JEKA 1ZN5A 1JMMA 3A0HH 3MUDC 1KV9A 2PCCB 1EDKA 3GF3A 3BCCD 3TK1A 4ASVA 2FKWB 4I2LC 2E75B 4GEDB 2N1TC 2QJPB 3G9RA 1GQ1A 1VDFA 1SQVG 3AE1C 2C1DA 3SWKA 1NGMB 2ZYAA 1M1JB 1VQNP 2P2UA 1AV1A 1OFCX 1H31B 1RH5B 2WPSA 3CCLP 1YTZT 2OTJP 1S5LX 3B4SA 1IZNB 1A02F 3CWBE 2B12B 4RSZA 1SP4A 1GMJA 4RO0A 1KQLA 3L70E 4U3FJ 1ZRTE 5KLVE 1IK7A 1ZV8A 2W8ZA 4C7NB 2JEEA 5CJ0A 1KQSO 3JSVC 1VQ4P 1KILA 1PGQA 5APTA 1KTMA 3AE2C 4R4MA 2OGUA 4DCKA 2FYUJ 3AE8C 3AEFC 3A0HE 3CLQA 1NU1G 2I8FA 3OA7A 1VQKP 1S5LV 4EYYQ 1C2RA 1BGYJ 2Y9ZA 1J1DB 1CW5A 1J1DC 3RBZA 1JY3N 1SQQE 2NPSC 3Q5RA 3CYTI 4U3FD 2UWJE 2OYIB 2RMZA 1KB9E 1CYIA 4PD4H 2BCNB 1S4XA 5AURA 5APVA 3CXHD 1LP1A 1SLQA 1G1JA 2WSCJ 1K9MQ 5CICB 3VP8A 3GHGC 5AW1B 5APXA 3A7OA 4FANA 1KFNA 3V2PA 3CWBD 3L74D 1K04A 1CZQA 3EWKA 1YITP 1N73C 2CA4B 3CC2P 3RLMA 1IFNA 1GU5A 3CC7P 5EXQA 1YCCA 5KTBA 2YNYA 4YXDC 4JYBA 3MK7B 4W7ZA 2HPCB 1NO4A 1YEAA 1BDCA 2B0ZB 3H32B 1KFMA 3E1IA 3HQ8A 1ZRTD 2DW3A 2KP8A 4L3GA 3O0RC 1L4AB 4DZOA 1SS1A 3B5NB 1NTKE 3H1IG 1DIQC 3MIWA 4FA4A 1GD2E 1VQ8P 1AOFA 1RE4A 2POHA 1VF5B 3AEAC 1DT1A 1J3SA 1LFMA 1UIXA 2N9YB 2FFDA 1ZLLA 1C7MA 5AW5B 1R8EA 1YHQP 1S3JA 5CCGA 2E76C 1VQMP 1AQTA 1CCHA 1VQ7P 3AEGC 3MK7C 1M70A 3WU2H 3M06A 3GG2A 1JY2O 4WY4B 2YIUB 2B11B 1DEEG 1H0TA 3DMIA 4WVZA 1BCCJ 1CRYA 3PTZA 1CC5A 1CO6A 3H1JG 3ZDMA 1JY2P 2YMKA 3VMZA 1BE3G 1OCDA 2PRRA 3SFDC 4WWIA 1NTZK 2WZ7A 1D7MA 1R5SA 4Y99C 1XTGB 4IFMA 5H2FE 1RF1C 1X0TA 2WSEJ 3R2PA 1GZLA 1Q7YQ 2AEJA 4IFDK 5CYTR 1DIIC 1NH4A 5AW6B 1HGVA 1LTJA 1RY3A 5B66H 4N78E 4PD4E 5CMZA 1PFIA 3WFBC 4N3YB 2KZIA 1EXIA 2BLFB 1L4AC 2M3EA 4I7ZC 5KAIH 5AW7B 1KYOI 1SQXD 2BCCD 4FAVA 3PH2B 4UB6H 3AE5C 2FWLA 5L8RJ 2HFED 4WQAA 2AEMA 3CMEP 2N1TA 3VNWA 2OYHB 1C52A 5DJQC 1KYOH 3L4OA 1H8AA 1QGKB 2N1TB 1PP9J 3H1KD 2N9BA 1L0NE 3CXHH 2KK7A 3SXTA 2BH4X 1HH0A 1T2KD 1L0LG 1YNRA 2K1AA 1BSHA 2Q9IA 1USEA 2MKVA 1S6VB 2QA4P 3IR9A 2IYOA 1MG2D 5KAIE 2ZXXA 1LTJC 1N2DC 2O3JA 2OQQA 2Y9YA 4BXLA 2FYUK 1QYZA 1QX8A 3ZOOA 1KYOW 2W83C 2WITA 3BCCJ 2QJPC 2HR3A 4DT0A 3TGUE 2J5UA 1H9XA 1GDTA 2ZFCA 3M0DC 3HE4B 1N7SC 1Q81Q 1IFDA 1WRGA 3WUUA 1M56D 1BCCD 3HUSA 1NHLA 2H89C 1OZHA 3BRVB 1LTSC 1FZGA 3L75E 1HGZA 2QRXA 5B6QA 3V4WA 2WQYC 1QL4A 5KLVG 4FA1A 5GTIV 2D2CC 5CJ4A 4Y99B 3GHGA 1CIFA 1CRGA 4D6TJ 3VP9A 3I56P 1C75A 4AX3A 1S2EA 3NMDA 4U7JA 2N3BA 3H25A 4GYDA 3RK2C 2B10B 4NPFX 1OWAA 3WUVA 1E5WA 1CTJA 1YTZI 1AA0A 1GK6A 2Y0CA 1SQXE 1PPJG 4EIDA 1FU1A 5AW2B 1AYGA 1IJDB 4BWNA 1URQB 4AAOA 2RKLA 1PL5A 5APSA 2CA3B 5AVUB 1PGOA 3CC4P 2G3AA 3AE6C 3HD7C 1RHZB 2C2CA 4JF7A 1NTME 5AW4B 2ZJSE 4WB4A 1SFCA 4HB1A 3WFEC 3Q3DA 2L91A 5IY51 1G2CB 5KLVK 3CXHW 1CTZA 5B5EE 2E74D 1KB0A 3H1KG 3DR0A 3WFCC 1HCMA 1AFOA 2QE7H 4HH2A 1OIPA 1SQBG 5BU5A 5DJUB 3G6EP 4GODA 1QN2A 2PFXA 3QWOC 4WY4A 1VL2A 2JJLA 1ZZHA 2XZRA 2I8DA 1CIHA 1FJ0A 2WSEH 2YXRB 2H88C 1FDOA 1LS9A 4P4QB 1FZCB 1GW3A 1BE3J 3ABVC 2BCCE 3NXSA 1FZFA 3MP7B 1YJNP 1KORA 3L71J 5E79H 1NTKG 3BATA 1LT9A 4YE1A 2ZT9C 2YO2A 3RBXA 1SQPG 2KNCA 2WSSH 5KKZB 1FC2C 2WPQA 3Q5PA 3IFMA 4D6TD 1ETPA 4PW9B
chains in the Genus database with same CATH topology
5E79V 4Q5PA 2OZ1A 4EICA 1COTA 5DF5A 1E8EA 1EZVD 1L0ND 2AXTV 4FA5A 1F1FA 1HH7A 2QJYB 4A7PA 4EIEA 2I8FA 1KB9D 1GJQA 1NTMD 4O1WA 1S5LV 1C2RA 3CU4A 2QG4A 3CYTI 4U3FD 2RMZA 1CYIA 1L9BC 2AI5A 2D0SA 4Y5RA 2PCBB 3SJLA 2BCNB 4RJTA 4AANA 1A8CA 1P84D 1HJ5A 3SWSA 1FI3A 5AURA 4WQBA 3PXWA 1DW1A 2BH5X 3CXHD 3HQ6A 1W2LA 1CIGA 2V08A 5CICB 5CIDB 2A06D 4J20A 1RAQA 1B7VA 1I8OA 2KS1A 1F1CA 1H33B 4FANA 5CIEB 4UB8V 1IZL0 3CWBD 3L74D 2N9JA 1QKSA 1NMLA 4WQ8A 4AAMA 5TJHA 4WQCA 3CX5W 2CA4B 3L73D 5CIBB 1K3GA 3TDKA 3OA8B 1SQBD 3RLMA 4FB1A 3ORVA 5EXQA 1CXAA 1YCCA 1KX7A 1I6EA 5CIHB 3MK7B 3CX5D 1I5TA 1GU2A 5B66V 1DW0A 1HJ3A 3O1YA 3RMZA 4N0KA 1YEAA 155CA 4K3IA 1IRWA 3NBTA 2B0ZB 2YQBA 3ZOXA 3HQ8A 1ZRTD 2CE1A 3L70D 1W5CT 1CCRA 2EXVA 4L3GA 3O0RC 1LC1A 2RN0A 2Y0DA 3HQ7A 2FYNB 4JCGA 1A2SA 1CHJA 1DIQC 3NWVA 3VYMA 1CSXA 4FA4A 1H31A 1GDVA 4O1QA 2ZZS1 1AOFA 1NNOA 1DT1A 1J3SA 1LFMA 2N9YB 2LITA 3HQ9A 4V2KA 4WQDA 2V07A 1C7MA 1CRCA 3ITKA 2N9IA 1CCHA 3A0HV 1E29A 3L4MA 2XTSB 3MK7C 1M70A 1DVVA 4WQ9A 1AKKA 351CA 5CIGB 3GG2A 2YIUB 2B11B 1BGYD 3DMIA 1I8PA 3JBTB 1CRYA 3PTZA 1CC5A 1CO6A 5CIFB 5KLIB 1OCDA 1CSWA 3OCDA 3O20A 2C1VA 4UB6V 1CYCA 2K9JB 1CRIA 3H1HD 5B5EV 2OZ1B 2ZXYA 3CP5A 451CA 3O5CA 5CYTR 1DIIC 2L4DA 1YIQA 1I55A 1IQCA 2AIUA 1GKSA 1HZUA 2YCCA 3WFBC 1A56A 2YK3A 1YFCA 1CHIA 2ZOOA 2C1UA 1H9YA 2B4ZA 1NTZD 2BLFB 1I54A 3KHUA 4IL6V 1SQXD 3RN0A 2BCCD 4FAVA 3PH2B 3OA8A 2FRCA 2JTIB 2FWLA 3RN1A 4WQAA 2GC7D 1RAPA 3VNWA 2N18C 2CXBA 4FA9A 1C52A 5DJQC 4H0KA 3L4OA 1FHBA 1M60A 1CSVA 1CYJA 1DW2A 3PHLA 2QJKB 3H1KD 5C0ZA 1BE3D 1N90A 1PPJD 1R0QA 1CSUA 4L3HA 3OCDB 3SXTA 2BH4X 2N3YA 1YNRA 1S6VB 5TISV 1WVEC 4KMGA 1MG2D 1KIBA 2O3JA 2N18B 1QYZA 1HRCA 1SQQD 3ZOOA 1KYOW 3KZIV 1M6ZA 1L9JC 1NIRA 1PP9D 3DP5A 4PD4D 2BGVX 1CTYA 1H9XA 1CEDA 3L75D 3TF5A 1YICA 3H1LD 2FYUD 1FOCA 3L71D 5DJQB 1H32A 1LMSA 1BCCD 1N50A 3ZOWA 1LC2A 3PXSA 1SQPD 1IRVA 4H0JA 3SVWA 2Q3EA 5C9MA 4QAOA 5GTHV 3TYIA 5B6QA 4LJIA 1HROA 5KLVD 1QL4A 1CXCA 2Y0EA 3NBSA 3FWLA 4FA1A 5GTIV 1E2RA 1CIFA 2LIRA 1CRGA 1C6SA 3ZCFA 2GC4D 1JDLA 1C75A 4XXLA 1GIWA 1MZ4A 4AX3A 2BPBB 2N3BA 3VMAA 1HJ4A 4EDFA 1C2NA 4GYDA 2B10B 3PXTA 5H2FV 1CNOA 2JWAA 2VHDA 4NFGB 1CTJA 1YEBA 3WC8A 2Y0CA 3SLEA 1BL9A 1H33A 4EIDA 1HZVA 1AYGA 3X39A 1H32B 3H1JD 3ZIYA 4AAOA 2ZBOA 4PWAA 2CA3B 4WQEA 2IBZD 4EIFA 1MG3D 1U75B 2D0WA 2C2CA 2GIWA 1CORA 1OAEA 1VYDA 4PJ0V 1IO3A 3WFDC 4DY9A 1DW3A 4L1QA 1RZ6A 3WFEC 2L91A 3GW6A 5IY51 3CXHW 1CTZA 1FI9A 1FCDC 4AALA 1KB0A 2CE0A 3DR0A 3M97X 3VRDA 3WFCC 1HCMA 1DVHA 1N9CA 2MTAC 1CHHA 3ZOYA 2KNCB 1I6DA 1C6OA 4MU8A 4XYDB 1KX2A 1N15A 3C2CA 1AOQA 1SQVD 1CRJA 3TGUD 3WU2V 1EB7A 1QN2A 2MHMA 1K3HA 3PLNA 1C6RA 3H1ID 1KV9A 2PCCB 1CRHA 1NU1D 3WUIA 1ZZHA 1CIEA 3BCCD 1CIHA 1FJ0A 5KAIV 5KAFV 3A9FA 3L72D 1LS9A 4GEDB 2C8SA 4P4QB 2QJPB 5DFSA 1GQ1A 2C1DA 1L0LD 1U74B 3PRJA 1FI7A 2HV4A 2JQRA 1KYOD 3ZBMA 1RZ5A 2PACA 1H1OA 2GB8B 1NTKD 1H31B 1WEJF 2DVHA 3A0BV 2ORLA 2ZONG 1YTCA 1NMIA 4YE1A 2B12B 2C9XB 2DGEA 4RSZA 5KKZB 4WQ7A 2C1DB 4D6TD 1QL3A 1ETPA 4PW9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E79 V;  4Q5P A;  2OZ1 A;  4EIC A;  1COT A;  5DF5 A;  1E8E A;  1EZV D;  1L0N D;  2AXT V;  4FA5 A;  1F1F A;  1HH7 A;  2QJY B;  4A7P A;  4EIE A;  2I8F A;  1KB9 D;  1GJQ A;  1NTM D;  4O1W A;  1S5L V;  1C2R A;  3CU4 A;  2QG4 A;  3CYT I;  4U3F D;  2RMZ A;  1CYI A;  1L9B C;  2AI5 A;  2D0S A;  4Y5R A;  2PCB B;  3SJL A;  2BCN B;  4RJT A;  4AAN A;  1A8C A;  1P84 D;  1HJ5 A;  3SWS A;  1FI3 A;  5AUR A;  4WQB A;  3PXW A;  1DW1 A;  2BH5 X;  3CXH D;  3HQ6 A;  1W2L A;  1CIG A;  2V08 A;  5CIC B;  5CID B;  2A06 D;  4J20 A;  1RAQ A;  1B7V A;  1I8O A;  2KS1 A;  1F1C A;  1H33 B;  4FAN A;  5CIE B;  4UB8 V;  1IZL 0;  3CWB D;  3L74 D;  2N9J A;  1QKS A;  1NML A;  4WQ8 A;  4AAM A;  5TJH A;  4WQC A;  3CX5 W;  2CA4 B;  3L73 D;  5CIB B;  1K3G A;  3TDK A;  3OA8 B;  1SQB D;  3RLM A;  4FB1 A;  3ORV A;  5EXQ A;  1CXA A;  1YCC A;  1KX7 A;  1I6E A;  5CIH B;  3MK7 B;  3CX5 D;  1I5T A;  1GU2 A;  5B66 V;  1DW0 A;  1HJ3 A;  3O1Y A;  3RMZ A;  4N0K A;  1YEA A;  155C A;  4K3I A;  1IRW A;  3NBT A;  2B0Z B;  2YQB A;  3ZOX A;  3HQ8 A;  1ZRT D;  2CE1 A;  3L70 D;  1W5C T;  1CCR A;  2EXV A;  4L3G A;  3O0R C;  1LC1 A;  2RN0 A;  2Y0D A;  3HQ7 A;  2FYN B;  4JCG A;  1A2S A;  1CHJ A;  1DIQ C;  3NWV A;  3VYM A;  1CSX A;  4FA4 A;  1H31 A;  1GDV A;  4O1Q A;  2ZZS 1;  1AOF A;  1NNO A;  1DT1 A;  1J3S A;  1LFM A;  2N9Y B;  2LIT A;  3HQ9 A;  4V2K A;  4WQD A;  2V07 A;  1C7M A;  1CRC A;  3ITK A;  2N9I A;  1CCH A;  3A0H V;  1E29 A;  3L4M A;  2XTS B;  3MK7 C;  1M70 A;  1DVV A;  4WQ9 A;  1AKK A;  351C A;  5CIG B;  3GG2 A;  2YIU B;  2B11 B;  1BGY D;  3DMI A;  1I8P A;  3JBT B;  1CRY A;  3PTZ A;  1CC5 A;  1CO6 A;  5CIF B;  5KLI B;  1OCD A;  1CSW A;  3OCD A;  3O20 A;  2C1V A;  4UB6 V;  1CYC A;  2K9J B;  1CRI A;  3H1H D;  5B5E V;  2OZ1 B;  2ZXY A;  3CP5 A;  451C A;  3O5C A;  5CYT R;  1DII C;  2L4D A;  1YIQ A;  1I55 A;  1IQC A;  2AIU A;  1GKS A;  1HZU A;  2YCC A;  3WFB C;  1A56 A;  2YK3 A;  1YFC A;  1CHI A;  2ZOO A;  2C1U A;  1H9Y A;  2B4Z A;  1NTZ D;  2BLF B;  1I54 A;  3KHU A;  4IL6 V;  1SQX D;  3RN0 A;  2BCC D;  4FAV A;  3PH2 B;  3OA8 A;  2FRC A;  2JTI B;  2FWL A;  3RN1 A;  4WQA A;  2GC7 D;  1RAP A;  3VNW A;  2N18 C;  2CXB A;  4FA9 A;  1C52 A;  5DJQ C;  4H0K A;  3L4O A;  1FHB A;  1M60 A;  1CSV A;  1CYJ A;  1DW2 A;  3PHL A;  2QJK B;  3H1K D;  5C0Z A;  1BE3 D;  1N90 A;  1PPJ D;  1R0Q A;  1CSU A;  4L3H A;  3OCD B;  3SXT A;  2BH4 X;  2N3Y A;  1YNR A;  1S6V B;  5TIS V;  1WVE C;  4KMG A;  1MG2 D;  1KIB A;  2O3J A;  2N18 B;  1QYZ A;  1HRC A;  1SQQ D;  3ZOO A;  1KYO W;  3KZI V;  1M6Z A;  1L9J C;  1NIR A;  1PP9 D;  3DP5 A;  4PD4 D;  2BGV X;  1CTY A;  1H9X A;  1CED A;  3L75 D;  3TF5 A;  1YIC A;  3H1L D;  2FYU D;  1FOC A;  3L71 D;  5DJQ B;  1H32 A;  1LMS A;  1BCC D;  1N50 A;  3ZOW A;  1LC2 A;  3PXS A;  1SQP D;  1IRV A;  4H0J A;  3SVW A;  2Q3E A;  5C9M A;  4QAO A;  5GTH V;  3TYI A;  5B6Q A;  4LJI A;  1HRO A;  5KLV D;  1QL4 A;  1CXC A;  2Y0E A;  3NBS A;  3FWL A;  4FA1 A;  5GTI V;  1E2R A;  1CIF A;  2LIR A;  1CRG A;  1C6S A;  3ZCF A;  2GC4 D;  1JDL A;  1C75 A;  4XXL A;  1GIW A;  1MZ4 A;  4AX3 A;  2BPB B;  2N3B A;  3VMA A;  1HJ4 A;  4EDF A;  1C2N A;  4GYD A;  2B10 B;  3PXT A;  5H2F V;  1CNO A;  2JWA A;  2VHD A;  4NFG B;  1CTJ A;  1YEB A;  3WC8 A;  2Y0C A;  3SLE A;  1BL9 A;  1H33 A;  4EID A;  1HZV A;  1AYG A;  3X39 A;  1H32 B;  3H1J D;  3ZIY A;  4AAO A;  2ZBO A;  4PWA A;  2CA3 B;  4WQE A;  2IBZ D;  4EIF A;  1MG3 D;  1U75 B;  2D0W A;  2C2C A;  2GIW A;  1COR A;  1OAE A;  1VYD A;  4PJ0 V;  1IO3 A;  3WFD C;  4DY9 A;  1DW3 A;  4L1Q A;  1RZ6 A;  3WFE C;  2L91 A;  3GW6 A;  5IY5 1;  3CXH W;  1CTZ A;  1FI9 A;  1FCD C;  4AAL A;  1KB0 A;  2CE0 A;  3DR0 A;  3M97 X;  3VRD A;  3WFC C;  1HCM A;  1DVH A;  1N9C A;  2MTA C;  1CHH A;  3ZOY A;  2KNC B;  1I6D A;  1C6O A;  4MU8 A;  4XYD B;  1KX2 A;  1N15 A;  3C2C A;  1AOQ A;  1SQV D;  1CRJ A;  3TGU D;  3WU2 V;  1EB7 A;  1QN2 A;  2MHM A;  1K3H A;  3PLN A;  1C6R A;  3H1I D;  1KV9 A;  2PCC B;  1CRH A;  1NU1 D;  3WUI A;  1ZZH A;  1CIE A;  3BCC D;  1CIH A;  1FJ0 A;  5KAI V;  5KAF V;  3A9F A;  3L72 D;  1LS9 A;  4GED B;  2C8S A;  4P4Q B;  2QJP B;  5DFS A;  1GQ1 A;  2C1D A;  1L0L D;  1U74 B;  3PRJ A;  1FI7 A;  2HV4 A;  2JQR A;  1KYO D;  3ZBM A;  1RZ5 A;  2PAC A;  1H1O A;  2GB8 B;  1NTK D;  1H31 B;  1WEJ F;  2DVH A;  3A0B V;  2ORL A;  2ZON G;  1YTC A;  1NMI A;  4YE1 A;  2B12 B;  2C9X B;  2DGE A;  4RSZ A;  5KKZ B;  4WQ7 A;  2C1D B;  4D6T D;  1QL3 A;  1ETP A;  4PW9 B; 
#chains in the Genus database with same CATH topology
 3MD0 A;  4I1L A;  2GUV A;  1ZOY C;  4DJG A;  2R44 A;  2OYI C;  4Q5P A;  2KB7 P;  3L71 E;  2OZ1 A;  2K9Y A;  3L75 J;  1COT A;  4H0L B;  5DF5 A;  1MFT A;  1E8E A;  5B66 E;  4I6M C;  4FA5 A;  1F1F A;  3CCU P;  1HH7 A;  2QJY B;  1NTM J;  4A7P A;  1VQP P;  1PPJ E;  2W6A A;  3V2R A;  1GJQ A;  3CU4 A;  1IK9 A;  1LGH B;  4HJG H;  3L35 A;  3O6Q B;  1M1J A;  2AI5 A;  4Y5R A;  2PCB B;  1A02 J;  4AAN A;  3H6P A;  2SPZ A;  1P84 D;  3SWS A;  2E43 A;  2E74 C;  2BH5 X;  1W2L A;  2H43 A;  4JYC A;  4W80 A;  2ZVO B;  2V08 A;  1FDI A;  2HLO A;  2YIU C;  5CID B;  4J20 A;  3CCV P;  3P8C E;  5APU A;  4UB8 V;  1OMI A;  4WQ8 A;  1NML A;  2KOG A;  4AAM A;  1IFJ A;  4WQC A;  1URQ A;  3BCC G;  3L73 D;  1K3G A;  2VRS A;  3OA8 B;  1SQB D;  4NPD A;  5C39 A;  1DH3 A;  2V7Q H;  4FB1 A;  1Q90 D;  1CXA A;  3CX5 D;  1I5T A;  1LTJ B;  2WSC H;  1DW0 A;  155C A;  1YQ4 C;  1AVO A;  2FFD C;  3L73 G;  2CE1 A;  3CWB J;  2CPB A;  1YI2 P;  2QJK C;  3L74 G;  1QL1 A;  3BCC E;  2RN0 A;  2Y0D A;  2LR2 A;  4JCG A;  2K9J A;  2KXP B;  2OYH C;  3VYM A;  1CSX A;  3RK3 D;  1H31 A;  1OVU A;  4YXW H;  1GDV A;  1IC2 A;  2IDB A;  2AEF A;  1KD1 Q;  2Z4E A;  1NNO A;  2LXB A;  4U3F G;  2R5D A;  1LT9 C;  3L72 J;  2LIT A;  4V2K A;  2NZ2 A;  3ITK A;  1R5L A;  2N9I A;  1X8Y A;  2FBW C;  1AKK A;  5EFW B;  1KIL E;  1BGY G;  3KZI H;  3RK2 D;  1WMK A;  2ZT9 B;  4ZMD A;  1NTZ J;  2QSI A;  3WUT A;  2P58 A;  2PP6 A;  1CSW A;  1SQP E;  3O20 A;  1DD3 A;  4UB6 V;  1CYC A;  3H1H D;  5AVT B;  3RK3 E;  3KDP B;  1ZR4 A;  4GOF A;  2L4D A;  1L4A D;  1YIQ A;  1LTB C;  1L0N J;  3IAO A;  1P84 H;  2AIU A;  2OYH A;  1N86 A;  2QM8 A;  2YCC A;  1A56 A;  2H7H A;  2O01 J;  1YFC A;  2WPR A;  1NAY A;  1SQP K;  1H9Y A;  3BVH A;  1NTZ D;  3M9B A;  3M9Q A;  1I54 A;  2ZYG A;  3W67 A;  1LNQ A;  4IL6 V;  3CX5 E;  4AYC A;  1RF1 A;  1PGP A;  1SQV J;  3RN1 A;  1HF9 A;  2J59 M;  1RAP A;  2N18 C;  4FA9 A;  2WVR A;  3LW5 J;  4JPZ B;  4N6J A;  1JY3 P;  1M60 A;  4XFJ A;  2A45 I;  3HRN A;  1CYJ A;  2NPS B;  1DW2 A;  3PHL A;  5C0Z A;  1AJY A;  2JWD A;  3LW5 H;  1S9K D;  2P1J A;  1S1C X;  1LT9 B;  1CSU A;  1FJK A;  2N3Y A;  4GDO A;  2E42 A;  3M0D A;  1EZV G;  2Z5H A;  3V5B A;  4KMG A;  3HUS C;  3L75 G;  1H0T B;  4NPE A;  2O01 N;  3CXH I;  2RH0 A;  3MGN A;  3FGA D;  4H13 C;  1M6Z A;  1PP9 D;  4I7Z B;  1FZC C;  3D71 A;  1GW4 A;  3L73 E;  3N7N A;  2BGV X;  1VQ6 P;  3U1A A;  1DD4 A;  1LTG C;  3P32 A;  2YMY A;  1CED A;  3L75 D;  3H1L D;  1W5C E;  2FYU D;  3L71 D;  1H32 A;  2ITA A;  3HD7 B;  4OH8 B;  3CXH E;  1LC2 A;  1OXZ A;  1N7L A;  1QEX A;  1FJP A;  2BEZ F;  1SQP D;  4H0J A;  3SVW A;  2Q3E A;  3EFF K;  5GTH V;  1L0L K;  3C8V A;  1URQ D;  3NBS A;  1SQX G;  2OYO A;  3P8M C;  3H1I E;  1ZP0 C;  4U3F E;  2GC4 D;  1JDL A;  4PJ0 E;  1GIW A;  4ZKU A;  4O9B A;  2BPB B;  1Y47 A;  1KQF B;  1JB0 J;  4EDF A;  1C2N A;  5AW0 B;  3K5B A;  4PV1 D;  2HPC A;  1RF0 A;  5H2F V;  2R3C A;  1OW8 A;  2VHD A;  1KB9 H;  1YEB A;  3V4Q A;  2B87 B;  2IFM A;  4IL6 E;  3VTP C;  3SLE A;  1QVF O;  1LTA C;  1SQX K;  3L73 J;  3CWB G;  1H32 B;  2NRG A;  4PWA A;  2IBZ D;  1MG3 D;  1SVF A;  2GIW A;  1COR A;  2XDJ A;  1S5L H;  4PJ0 V;  1OW6 A;  3RK3 C;  4DY9 A;  1BDD A;  4L1Q A;  3T97 A;  3HE4 A;  4K3A A;  1FI9 A;  2LXC B;  3JCU H;  3SSU A;  5KJ7 C;  1VF5 C;  3M97 X;  3VMX A;  3VRD A;  1DVH A;  1N9C A;  2KNC B;  1CHH A;  1OVR A;  4MU8 A;  2IX7 C;  1CRJ A;  2KSJ A;  1T3J A;  1QL2 A;  1K3H A;  2B89 A;  2QEX P;  3H1I D;  1DX7 A;  1SQQ G;  1GL2 A;  1NU1 D;  1IFI A;  3WUI A;  2YXQ B;  2E5T A;  1CIE A;  2NPS A;  3AEE C;  5KAF V;  1KIL B;  1W2B O;  3CCJ P;  3L72 D;  1RQU A;  3H1H E;  3V2Q A;  5KKZ C;  1JOC A;  3CPW O;  2FYU E;  1IFM A;  1U74 B;  4MN4 C;  1LWU A;  1Q86 Q;  3PRJ A;  2B88 A;  1FI7 A;  1AVY A;  2JQR A;  1T8Z A;  1Z56 A;  3NFQ A;  3HTK A;  3CCE P;  1KYO D;  3ZBM A;  1RZ5 A;  2PAC A;  2M8R A;  2W6J H;  1E79 H;  1H1O A;  4KJM A;  2QVA A;  3FX0 A;  3H1I J;  1GTW A;  1KMI Z;  3L70 G;  5AVY B;  3L37 A;  3NTN A;  1L0N K;  2C9X B;  2DGE A;  4OGQ D;  4WQ7 A;  3KPE A;  2C1D B;  1QL3 A;  2KUB A;  2YKP A;  3AEB C;  3CX5 I;  4EIC A;  4H44 B;  1NTM K;  4CPG A;  1ZME C;  1TU3 F;  2W27 A;  4EIE A;  3CX5 H;  1KB9 D;  4O1W A;  1T3U A;  3OAK A;  1MUU A;  5AVS B;  2M0B A;  1PP9 G;  2D0S A;  2AXT H;  4RJT A;  3B5N C;  4UB6 E;  1JM0 A;  1DW1 A;  1M7L A;  3AE7 C;  1MKM A;  1CIG A;  4K35 A;  1HWT C;  2NPS D;  4TLF A;  2A06 D;  3G3Z A;  3OJA B;  4AQR D;  1B7V A;  2KS1 A;  4RES B;  5CIE B;  1EDL A;  1PIX A;  1NTZ E;  4L75 A;  2N9J A;  1SQQ K;  5CCG C;  5TJH A;  3CX5 W;  3H1K E;  3I5C A;  1SQB J;  2Q7C A;  2K88 A;  1S72 P;  2JKV A;  3KZI E;  4OWF A;  3L74 E;  2E5Y A;  3HTK B;  3CCR P;  3BAS A;  3O8Z A;  1KX7 A;  3HUS B;  1FE6 A;  1I6E A;  5B66 V;  5APW A;  2KS1 B;  3O1Y A;  4UB8 E;  4N0K A;  3RGU A;  2YQB A;  3ZOX A;  2LKM A;  4B86 A;  1CCR A;  1HTL C;  1URQ C;  2PAJ A;  1SFC C;  4UB8 H;  2EXV A;  1LC1 A;  1NKZ B;  3HQ7 A;  4JBZ A;  1KQG B;  1NVO A;  3A0B E;  1VQ9 P;  4D6T G;  5CBN A;  4KHX A;  2YO3 A;  3B5N A;  5CCH C;  3NWV A;  2YKO A;  1SQP J;  2YKQ A;  2B9B A;  4PV1 B;  3CCQ P;  1LTI C;  1GK4 A;  3HQ9 A;  4WQD A;  2ZT9 D;  3H1L E;  1LT1 A;  1YQ3 C;  3MTU E;  1CRC A;  2M5A B;  1M57 D;  2FYU G;  3FXD A;  3CCS P;  2WSF J;  1NU1 E;  2R32 A;  351C A;  5CIG B;  4R4L A;  3Q1M A;  4EOT A;  3M0A A;  1G1I A;  2B87 A;  5CIF B;  1EZV E;  1OX3 A;  1Y8A A;  3OCD A;  2MJZ A;  2C1V A;  2PGD A;  5B5E V;  2FXO A;  3G71 P;  2OZ1 B;  3RL0 D;  2FXM A;  2ZXY A;  3CI9 A;  3A5T A;  2A45 G;  3O5C A;  5KJ7 A;  1IQC A;  2QM7 A;  1HZU A;  2XNX A;  2KLU A;  3VN0 A;  3USS A;  1CHI A;  2WT7 A;  2ZOO A;  2HOD A;  3FWN A;  3JCU E;  2BCC J;  3MUD A;  3HD7 A;  1FAV A;  3KHU A;  5AW3 B;  3GLM A;  3TSI A;  3RN0 A;  1VQ5 P;  3H1H G;  2JTI B;  2WMM A;  5APY A;  3L71 G;  1SQV K;  1RE3 C;  2GC7 D;  3CL3 D;  1M1J C;  4L74 A;  1QVG O;  2CXB A;  3D0W A;  3T97 B;  4H0K A;  3BRT B;  5KLI C;  1CSV A;  3KYQ A;  2FY8 A;  2WPV B;  2OTK E;  2QJK B;  1RQV A;  2IZ0 A;  1BE3 D;  1N90 A;  2ZAE B;  3G4S P;  1USD A;  4L3H A;  5TIS H;  4M3L A;  2D2C D;  3HD7 D;  1Y9B A;  5TIS V;  3Q5S A;  4GT1 A;  1MZ9 A;  1P84 I;  2P10 A;  4GKG A;  1BE3 E;  2N1T D;  2A06 G;  2C9N Y;  1SFC D;  2O01 H;  1SQQ D;  1KIL C;  3KZI V;  3AE9 C;  2KYV A;  3PP5 A;  4PD4 D;  2Q3I A;  2O1J A;  3A2A A;  4KT0 J;  3V6I A;  3RL0 B;  4H44 D;  2HYN A;  1M1K Q;  5AW9 B;  1U57 A;  3TF5 A;  1YIC A;  2J58 A;  3L4F A;  4TT3 H;  1FOC A;  1LMS A;  4L73 A;  1N50 A;  1RF0 C;  3PXS A;  5TIS E;  4W7Y A;  5AVQ B;  3TYI A;  5GTI H;  1VPC A;  4LJI A;  1IFP A;  1JTH B;  1HRO A;  1N7S D;  5KLV D;  1CXC A;  2Y0E A;  1W2E A;  3RL0 g;  1JNM A;  1E2R A;  3MZW B;  2FYN C;  1H88 A;  3CD6 P;  3TNU A;  3ZCF A;  4XXL A;  4YTP C;  1FBM A;  5GTH H;  3GHG B;  3VMA A;  4IOI H;  5BU8 B;  3PXT A;  3B5N D;  1CNO A;  2JWA A;  4NFG B;  2E75 D;  5AVZ B;  1DEB A;  3WC8 A;  3SWY A;  1FZB A;  5H2F H;  1OVV A;  1BL9 A;  4AUW A;  3RL0 C;  2GUS A;  1CI6 A;  3H1J D;  3AED C;  3ZIY A;  2ZBO A;  1YJW P;  5CCG D;  4WQE A;  1L2P A;  4EIF A;  4H44 C;  3N4X A;  1WT6 A;  4GOE A;  3II6 A;  5AVX B;  2GA1 A;  1OAE A;  1Q82 Q;  2CK3 H;  3WU2 E;  4HYT B;  1NWQ A;  1GL2 B;  1HVV A;  3GF7 A;  1JMB A;  1IO4 A;  1CI6 B;  1NYH A;  2CE0 A;  1L0L E;  2ZXE B;  3L72 E;  1L0L J;  2W6B A;  3ZOY A;  1C6O A;  4XYD B;  1KIL D;  3C2C A;  1AOQ A;  2FXP A;  3D70 A;  3WU2 V;  1EB7 A;  3CMA P;  2MHM A;  3PLN A;  1C6R A;  1NTK K;  4N78 D;  1OW7 A;  3TGU J;  4C7N A;  1CRH A;  4GIF A;  1MFZ A;  3H1J E;  2ZVN B;  5KAI V;  1T6A A;  4H13 B;  2E75 C;  1UII A;  3A9F A;  3KXD A;  4IL6 H;  2C8S A;  4OGQ B;  5DFS A;  2HG5 D;  2A45 H;  1JY2 N;  3VOP A;  1L0L D;  3GMA A;  2HV4 A;  3HE5 B;  2Q1K A;  3LIE A;  4D6T E;  2GB8 B;  4ASW A;  1NTK D;  5KAF H;  1GL2 C;  1WEJ F;  1FZA A;  3JC2 2;  2DVH A;  1G2C A;  2C9L Y;  3A0B V;  2ORL A;  2ZON G;  1YTC A;  2WSF H;  4YPC A;  1NMI A;  2KLV A;  1PP9 E;  5AW8 B;  1LTT C;  3A3Y B;  3U59 A;  1M90 Q;  1SFC B;  2KSE A;  1FOS F;  4RKU J;  2BCC G;  5E79 V;  1U7J A;  3D6Z A;  1BCC E;  1EZV D;  1L0N D;  2AXT V;  3O6Q A;  1SQB E;  1NKN A;  1VQO P;  1EZV I;  4WY4 C;  1NTM D;  2GM4 A;  1BCC G;  3IN6 A;  3SFE C;  2JO1 A;  3H1J J;  1EQ7 A;  1PV3 A;  1RE3 A;  1NTZ G;  2QG4 A;  4ZKP A;  4EIJ A;  3UIA A;  4IL6 X;  1L9B C;  2QIW A;  3P8C D;  3PJS K;  4LLH A;  3SJL A;  4LGD E;  1A8C A;  2KIK A;  3FXE A;  5APQ A;  1HJ5 A;  4EI2 A;  1FI3 A;  3MHV A;  4WQB A;  3PXW A;  5CHX A;  1ZR2 A;  4BRY A;  5BVZ A;  5GTH E;  3HQ6 A;  3H1L G;  5DJT B;  3EQ2 A;  2CPS A;  1P84 E;  1RAQ A;  3F5H A;  2FFD B;  1I8O A;  2BEQ D;  1F1C A;  3KQG A;  1H33 B;  4PD4 I;  1KC8 Q;  4ZNC A;  1IZL 0;  1QKS A;  1KV4 A;  2IPP A;  1KN7 A;  5CIB B;  3TDK A;  3I55 P;  2C0X A;  4OVN F;  1SQB K;  5M1B A;  3A0B H;  5CBO A;  1KYO E;  3ORV A;  3PH0 A;  1GU4 A;  5CIH B;  3L36 A;  1GU2 A;  1CSB A;  1N8R Q;  1J2J B;  1HJ3 A;  3RMZ A;  4K3I A;  3AEC C;  1IRW A;  3NBT A;  1PGJ A;  1NAF A;  1NJI Q;  5AVV B;  3RK3 B;  4LC1 A;  1N7S A;  3L70 D;  5CCH D;  3TNU B;  1W5C T;  5B5E H;  1N73 A;  3QH9 A;  2L5G B;  4Z1M H;  4Y28 J;  1N7S B;  2FYN B;  1JTH A;  4XE5 B;  1NTK J;  2XU6 A;  5AVW B;  1A2S A;  4WBA A;  1CHJ A;  2IBZ I;  4DOJ A;  1HJB A;  3C9I A;  2QJY C;  4QMA A;  4O1Q A;  2ZZS 1;  5GTI E;  4HKZ H;  1JY3 O;  3S9O A;  2V07 A;  3OW2 O;  3E7K A;  1FZE A;  2IFN A;  1S9K E;  3A0H V;  1E29 A;  1BGY E;  3L4M A;  2R3S A;  4PJ0 H;  2XTS B;  2IBZ E;  1DVV A;  4WQ9 A;  2OYI A;  1JUN A;  1BGY D;  1I8P A;  3JBT B;  1RE4 C;  3AE3 C;  5KLI B;  1VF5 D;  2K9J B;  3CCM P;  1CRI A;  5KLV J;  4XA4 A;  2Z5I A;  1SQX J;  3VYI A;  3VMY A;  3CP5 A;  451C A;  2ZYD A;  3M91 A;  1T2K C;  1I55 A;  1YIJ P;  2XKM A;  3RK2 B;  1GKS A;  2IZ1 A;  3TGU G;  2XND H;  2YK3 A;  3D6Y A;  4IFF A;  2KI7 B;  1JO5 A;  3E1R A;  2C1U A;  2B4Z A;  2K37 A;  3AE4 C;  4H0L D;  1DIP A;  2E76 B;  4H13 D;  2P67 A;  2M3B A;  2HOD B;  3V2N A;  2WT7 B;  3OA8 A;  2FRC A;  1YJ9 P;  2K3R A;  1X79 B;  1BSN A;  1NTM G;  1NU1 J;  1H89 A;  5KJ7 D;  2WTY A;  1FHB A;  3L70 J;  2G8Y A;  2C0W A;  3HE5 A;  1J1E B;  4OGQ C;  4L76 A;  1M8O B;  3L74 J;  3H32 A;  1KB9 I;  1EC5 A;  2V4H A;  1PPJ D;  1R0Q A;  3H1K J;  1RF1 B;  3OCD B;  3U1C A;  2E74 B;  2KZJ A;  1XTC C;  2R5B A;  5E79 E;  3R4Y A;  1WVE C;  2Q6Q A;  3C1L A;  1KIB A;  1JCC A;  1SQQ J;  2I1K A;  1LJ2 A;  1FS0 E;  1QLE D;  2N18 B;  2WWW A;  4PV1 C;  1HRC A;  2H8P D;  4JQ0 D;  1EXJ A;  2Q5U A;  1L9J C;  2M5A A;  3IF4 A;  1N73 B;  1NIR A;  1S5L E;  3F89 A;  3DP5 A;  5KAF E;  1LWU B;  3S1K A;  2IBZ G;  1CTY A;  4H0L C;  3M9H A;  2FYZ A;  1Q2N A;  1EDI A;  2AXC A;  5DJQ B;  1X9V A;  2A06 E;  3H1L J;  3ZOW A;  3TYY A;  1IRV A;  1HJ0 A;  5C9M A;  4QAO A;  1J1E C;  1NOH A;  2O1K A;  1VQL P;  1FDM A;  1U7M A;  2JP3 A;  3P7K A;  2E76 D;  5CCH A;  1LP1 B;  3FWL A;  4C46 A;  1X22 A;  2LIR A;  1C6S A;  3EFG A;  1AQ5 A;  1K8A Q;  1YYC A;  1MZ4 A;  1L0N G;  1YBK A;  1SQV E;  1GL2 D;  2BAS A;  1HJ4 A;  5K5G B;  3LID A;  3B8E B;  2JR8 A;  2AXT E;  2OAR A;  1HBW A;  3L72 G;  3S4R A;  1H33 A;  1LWU C;  1HZV A;  3X39 A;  4C7R A;  1FOS E;  3Q2Y A;  3H1H J;  1FZC A;  1K73 Q;  3W68 A;  4BRY B;  1EDJ A;  1ZW0 A;  1U75 B;  4WY4 D;  2D0W A;  3SWF A;  2W90 A;  3WMM 0;  1VYD A;  2I1J A;  1PZQ A;  1IO3 A;  1JCD A;  3WFD C;  1DW3 A;  1RZ6 A;  5AVR B;  1K05 A;  3B71 A;  3GW6 A;  1FCD C;  2D2C B;  2XV5 A;  4AAL A;  1HUC A;  1MV8 A;  1ZXG A;  2JDI H;  2MTA C;  1I6D A;  2P7J A;  1KX2 A;  2IYP A;  1N15 A;  2V7Q J;  1SQV D;  3TGU D;  2OTL P;  1NU1 K;  1L4A A;  1KZU B;  1JEK A;  1ZN5 A;  1JMM A;  3A0H H;  3MUD C;  1KV9 A;  2PCC B;  1EDK A;  3GF3 A;  3BCC D;  3TK1 A;  4ASV A;  2FKW B;  4I2L C;  2E75 B;  4GED B;  2N1T C;  2QJP B;  3G9R A;  1GQ1 A;  1VDF A;  1SQV G;  3AE1 C;  2C1D A;  3SWK A;  1NGM B;  2ZYA A;  1M1J B;  1VQN P;  2P2U A;  1AV1 A;  1OFC X;  1H31 B;  1RH5 B;  2WPS A;  3CCL P;  1YTZ T;  2OTJ P;  1S5L X;  3B4S A;  1IZN B;  1A02 F;  3CWB E;  2B12 B;  4RSZ A;  1SP4 A;  1GMJ A;  4RO0 A;  1KQL A;  3L70 E;  4U3F J;  1ZRT E;  5KLV E;  1IK7 A;  1ZV8 A;  2W8Z A;  4C7N B;  2JEE A;  5CJ0 A;  1KQS O;  3JSV C;  1VQ4 P;  1KIL A;  1PGQ A;  5APT A;  1KTM A;  3AE2 C;  4R4M A;  2OGU A;  4DCK A;  2FYU J;  3AE8 C;  3AEF C;  3A0H E;  3CLQ A;  1NU1 G;  2I8F A;  3OA7 A;  1VQK P;  1S5L V;  4EYY Q;  1C2R A;  1BGY J;  2Y9Z A;  1J1D B;  1CW5 A;  1J1D C;  3RBZ A;  1JY3 N;  1SQQ E;  2NPS C;  3Q5R A;  3CYT I;  4U3F D;  2UWJ E;  2OYI B;  2RMZ A;  1KB9 E;  1CYI A;  4PD4 H;  2BCN B;  1S4X A;  5AUR A;  5APV A;  3CXH D;  1LP1 A;  1SLQ A;  1G1J A;  2WSC J;  1K9M Q;  5CIC B;  3VP8 A;  3GHG C;  5AW1 B;  5APX A;  3A7O A;  4FAN A;  1KFN A;  3V2P A;  3CWB D;  3L74 D;  1K04 A;  1CZQ A;  3EWK A;  1YIT P;  1N73 C;  2CA4 B;  3CC2 P;  3RLM A;  1IFN A;  1GU5 A;  3CC7 P;  5EXQ A;  1YCC A;  5KTB A;  2YNY A;  4YXD C;  4JYB A;  3MK7 B;  4W7Z A;  2HPC B;  1NO4 A;  1YEA A;  1BDC A;  2B0Z B;  3H32 B;  1KFM A;  3E1I A;  3HQ8 A;  1ZRT D;  2DW3 A;  2KP8 A;  4L3G A;  3O0R C;  1L4A B;  4DZO A;  1SS1 A;  3B5N B;  1NTK E;  3H1I G;  1DIQ C;  3MIW A;  4FA4 A;  1GD2 E;  1VQ8 P;  1AOF A;  1RE4 A;  2POH A;  1VF5 B;  3AEA C;  1DT1 A;  1J3S A;  1LFM A;  1UIX A;  2N9Y B;  2FFD A;  1ZLL A;  1C7M A;  5AW5 B;  1R8E A;  1YHQ P;  1S3J A;  5CCG A;  2E76 C;  1VQM P;  1AQT A;  1CCH A;  1VQ7 P;  3AEG C;  3MK7 C;  1M70 A;  3WU2 H;  3M06 A;  3GG2 A;  1JY2 O;  4WY4 B;  2YIU B;  2B11 B;  1DEE G;  1H0T A;  3DMI A;  4WVZ A;  1BCC J;  1CRY A;  3PTZ A;  1CC5 A;  1CO6 A;  3H1J G;  3ZDM A;  1JY2 P;  2YMK A;  3VMZ A;  1BE3 G;  1OCD A;  2PRR A;  3SFD C;  4WWI A;  1NTZ K;  2WZ7 A;  1D7M A;  1R5S A;  4Y99 C;  1XTG B;  4IFM A;  5H2F E;  1RF1 C;  1X0T A;  2WSE J;  3R2P A;  1GZL A;  1Q7Y Q;  2AEJ A;  4IFD K;  5CYT R;  1DII C;  1NH4 A;  5AW6 B;  1HGV A;  1LTJ A;  1RY3 A;  5B66 H;  4N78 E;  4PD4 E;  5CMZ A;  1PFI A;  3WFB C;  4N3Y B;  2KZI A;  1EXI A;  2BLF B;  1L4A C;  2M3E A;  4I7Z C;  5KAI H;  5AW7 B;  1KYO I;  1SQX D;  2BCC D;  4FAV A;  3PH2 B;  4UB6 H;  3AE5 C;  2FWL A;  5L8R J;  2HFE D;  4WQA A;  2AEM A;  3CME P;  2N1T A;  3VNW A;  2OYH B;  1C52 A;  5DJQ C;  1KYO H;  3L4O A;  1H8A A;  1QGK B;  2N1T B;  1PP9 J;  3H1K D;  2N9B A;  1L0N E;  3CXH H;  2KK7 A;  3SXT A;  2BH4 X;  1HH0 A;  1T2K D;  1L0L G;  1YNR A;  2K1A A;  1BSH A;  2Q9I A;  1USE A;  2MKV A;  1S6V B;  2QA4 P;  3IR9 A;  2IYO A;  1MG2 D;  5KAI E;  2ZXX A;  1LTJ C;  1N2D C;  2O3J A;  2OQQ A;  2Y9Y A;  4BXL A;  2FYU K;  1QYZ A;  1QX8 A;  3ZOO A;  1KYO W;  2W83 C;  2WIT A;  3BCC J;  2QJP C;  2HR3 A;  4DT0 A;  3TGU E;  2J5U A;  1H9X A;  1GDT A;  2ZFC A;  3M0D C;  3HE4 B;  1N7S C;  1Q81 Q;  1IFD A;  1WRG A;  3WUU A;  1M56 D;  1BCC D;  3HUS A;  1NHL A;  2H89 C;  1OZH A;  3BRV B;  1LTS C;  1FZG A;  3L75 E;  1HGZ A;  2QRX A;  5B6Q A;  3V4W A;  2WQY C;  1QL4 A;  5KLV G;  4FA1 A;  5GTI V;  2D2C C;  5CJ4 A;  4Y99 B;  3GHG A;  1CIF A;  1CRG A;  4D6T J;  3VP9 A;  3I56 P;  1C75 A;  4AX3 A;  1S2E A;  3NMD A;  4U7J A;  2N3B A;  3H25 A;  4GYD A;  3RK2 C;  2B10 B;  4NPF X;  1OWA A;  3WUV A;  1E5W A;  1CTJ A;  1YTZ I;  1AA0 A;  1GK6 A;  2Y0C A;  1SQX E;  1PPJ G;  4EID A;  1FU1 A;  5AW2 B;  1AYG A;  1IJD B;  4BWN A;  1URQ B;  4AAO A;  2RKL A;  1PL5 A;  5APS A;  2CA3 B;  5AVU B;  1PGO A;  3CC4 P;  2G3A A;  3AE6 C;  3HD7 C;  1RHZ B;  2C2C A;  4JF7 A;  1NTM E;  5AW4 B;  2ZJS E;  4WB4 A;  1SFC A;  4HB1 A;  3WFE C;  3Q3D A;  2L91 A;  5IY5 1;  1G2C B;  5KLV K;  3CXH W;  1CTZ A;  5B5E E;  2E74 D;  1KB0 A;  3H1K G;  3DR0 A;  3WFC C;  1HCM A;  1AFO A;  2QE7 H;  4HH2 A;  1OIP A;  1SQB G;  5BU5 A;  5DJU B;  3G6E P;  4GOD A;  1QN2 A;  2PFX A;  3QWO C;  4WY4 A;  1VL2 A;  2JJL A;  1ZZH A;  2XZR A;  2I8D A;  1CIH A;  1FJ0 A;  2WSE H;  2YXR B;  2H88 C;  1FDO A;  1LS9 A;  4P4Q B;  1FZC B;  1GW3 A;  1BE3 J;  3ABV C;  2BCC E;  3NXS A;  1FZF A;  3MP7 B;  1YJN P;  1KOR A;  3L71 J;  5E79 H;  1NTK G;  3BAT A;  1LT9 A;  4YE1 A;  2ZT9 C;  2YO2 A;  3RBX A;  1SQP G;  2KNC A;  2WSS H;  5KKZ B;  1FC2 C;  2WPQ A;  3Q5P A;  3IFM A;  4D6T D;  1ETP A;  4PW9 B; 
#chains in the Genus database with same CATH homology
 5E79 V;  4Q5P A;  2OZ1 A;  4EIC A;  1COT A;  5DF5 A;  1E8E A;  1EZV D;  1L0N D;  2AXT V;  4FA5 A;  1F1F A;  1HH7 A;  2QJY B;  4A7P A;  4EIE A;  2I8F A;  1KB9 D;  1GJQ A;  1NTM D;  4O1W A;  1S5L V;  1C2R A;  3CU4 A;  2QG4 A;  3CYT I;  4U3F D;  2RMZ A;  1CYI A;  1L9B C;  2AI5 A;  2D0S A;  4Y5R A;  2PCB B;  3SJL A;  2BCN B;  4RJT A;  4AAN A;  1A8C A;  1P84 D;  1HJ5 A;  3SWS A;  1FI3 A;  5AUR A;  4WQB A;  3PXW A;  1DW1 A;  2BH5 X;  3CXH D;  3HQ6 A;  1W2L A;  1CIG A;  2V08 A;  5CIC B;  5CID B;  2A06 D;  4J20 A;  1RAQ A;  1B7V A;  1I8O A;  2KS1 A;  1F1C A;  1H33 B;  4FAN A;  5CIE B;  4UB8 V;  1IZL 0;  3CWB D;  3L74 D;  2N9J A;  1QKS A;  1NML A;  4WQ8 A;  4AAM A;  5TJH A;  4WQC A;  3CX5 W;  2CA4 B;  3L73 D;  5CIB B;  1K3G A;  3TDK A;  3OA8 B;  1SQB D;  3RLM A;  4FB1 A;  3ORV A;  5EXQ A;  1CXA A;  1YCC A;  1KX7 A;  1I6E A;  5CIH B;  3MK7 B;  3CX5 D;  1I5T A;  1GU2 A;  5B66 V;  1DW0 A;  1HJ3 A;  3O1Y A;  3RMZ A;  4N0K A;  1YEA A;  155C A;  4K3I A;  1IRW A;  3NBT A;  2B0Z B;  2YQB A;  3ZOX A;  3HQ8 A;  1ZRT D;  2CE1 A;  3L70 D;  1W5C T;  1CCR A;  2EXV A;  4L3G A;  3O0R C;  1LC1 A;  2RN0 A;  2Y0D A;  3HQ7 A;  2FYN B;  4JCG A;  1A2S A;  1CHJ A;  1DIQ C;  3NWV A;  3VYM A;  1CSX A;  4FA4 A;  1H31 A;  1GDV A;  4O1Q A;  2ZZS 1;  1AOF A;  1NNO A;  1DT1 A;  1J3S A;  1LFM A;  2N9Y B;  2LIT A;  3HQ9 A;  4V2K A;  4WQD A;  2V07 A;  1C7M A;  1CRC A;  3ITK A;  2N9I A;  1CCH A;  3A0H V;  1E29 A;  3L4M A;  2XTS B;  3MK7 C;  1M70 A;  1DVV A;  4WQ9 A;  1AKK A;  351C A;  5CIG B;  3GG2 A;  2YIU B;  2B11 B;  1BGY D;  3DMI A;  1I8P A;  3JBT B;  1CRY A;  3PTZ A;  1CC5 A;  1CO6 A;  5CIF B;  5KLI B;  1OCD A;  1CSW A;  3OCD A;  3O20 A;  2C1V A;  4UB6 V;  1CYC A;  2K9J B;  1CRI A;  3H1H D;  5B5E V;  2OZ1 B;  2ZXY A;  3CP5 A;  451C A;  3O5C A;  5CYT R;  1DII C;  2L4D A;  1YIQ A;  1I55 A;  1IQC A;  2AIU A;  1GKS A;  1HZU A;  2YCC A;  3WFB C;  1A56 A;  2YK3 A;  1YFC A;  1CHI A;  2ZOO A;  2C1U A;  1H9Y A;  2B4Z A;  1NTZ D;  2BLF B;  1I54 A;  3KHU A;  4IL6 V;  1SQX D;  3RN0 A;  2BCC D;  4FAV A;  3PH2 B;  3OA8 A;  2FRC A;  2JTI B;  2FWL A;  3RN1 A;  4WQA A;  2GC7 D;  1RAP A;  3VNW A;  2N18 C;  2CXB A;  4FA9 A;  1C52 A;  5DJQ C;  4H0K A;  3L4O A;  1FHB A;  1M60 A;  1CSV A;  1CYJ A;  1DW2 A;  3PHL A;  2QJK B;  3H1K D;  5C0Z A;  1BE3 D;  1N90 A;  1PPJ D;  1R0Q A;  1CSU A;  4L3H A;  3OCD B;  3SXT A;  2BH4 X;  2N3Y A;  1YNR A;  1S6V B;  5TIS V;  1WVE C;  4KMG A;  1MG2 D;  1KIB A;  2O3J A;  2N18 B;  1QYZ A;  1HRC A;  1SQQ D;  3ZOO A;  1KYO W;  3KZI V;  1M6Z A;  1L9J C;  1NIR A;  1PP9 D;  3DP5 A;  4PD4 D;  2BGV X;  1CTY A;  1H9X A;  1CED A;  3L75 D;  3TF5 A;  1YIC A;  3H1L D;  2FYU D;  1FOC A;  3L71 D;  5DJQ B;  1H32 A;  1LMS A;  1BCC D;  1N50 A;  3ZOW A;  1LC2 A;  3PXS A;  1SQP D;  1IRV A;  4H0J A;  3SVW A;  2Q3E A;  5C9M A;  4QAO A;  5GTH V;  3TYI A;  5B6Q A;  4LJI A;  1HRO A;  5KLV D;  1QL4 A;  1CXC A;  2Y0E A;  3NBS A;  3FWL A;  4FA1 A;  5GTI V;  1E2R A;  1CIF A;  2LIR A;  1CRG A;  1C6S A;  3ZCF A;  2GC4 D;  1JDL A;  1C75 A;  4XXL A;  1GIW A;  1MZ4 A;  4AX3 A;  2BPB B;  2N3B A;  3VMA A;  1HJ4 A;  4EDF A;  1C2N A;  4GYD A;  2B10 B;  3PXT A;  5H2F V;  1CNO A;  2JWA A;  2VHD A;  4NFG B;  1CTJ A;  1YEB A;  3WC8 A;  2Y0C A;  3SLE A;  1BL9 A;  1H33 A;  4EID A;  1HZV A;  1AYG A;  3X39 A;  1H32 B;  3H1J D;  3ZIY A;  4AAO A;  2ZBO A;  4PWA A;  2CA3 B;  4WQE A;  2IBZ D;  4EIF A;  1MG3 D;  1U75 B;  2D0W A;  2C2C A;  2GIW A;  1COR A;  1OAE A;  1VYD A;  4PJ0 V;  1IO3 A;  3WFD C;  4DY9 A;  1DW3 A;  4L1Q A;  1RZ6 A;  3WFE C;  2L91 A;  3GW6 A;  5IY5 1;  3CXH W;  1CTZ A;  1FI9 A;  1FCD C;  4AAL A;  1KB0 A;  2CE0 A;  3DR0 A;  3M97 X;  3VRD A;  3WFC C;  1HCM A;  1DVH A;  1N9C A;  2MTA C;  1CHH A;  3ZOY A;  2KNC B;  1I6D A;  1C6O A;  4MU8 A;  4XYD B;  1KX2 A;  1N15 A;  3C2C A;  1AOQ A;  1SQV D;  1CRJ A;  3TGU D;  3WU2 V;  1EB7 A;  1QN2 A;  2MHM A;  1K3H A;  3PLN A;  1C6R A;  3H1I D;  1KV9 A;  2PCC B;  1CRH A;  1NU1 D;  3WUI A;  1ZZH A;  1CIE A;  3BCC D;  1CIH A;  1FJ0 A;  5KAI V;  5KAF V;  3A9F A;  3L72 D;  1LS9 A;  4GED B;  2C8S A;  4P4Q B;  2QJP B;  5DFS A;  1GQ1 A;  2C1D A;  1L0L D;  1U74 B;  3PRJ A;  1FI7 A;  2HV4 A;  2JQR A;  1KYO D;  3ZBM A;  1RZ5 A;  2PAC A;  1H1O A;  2GB8 B;  1NTK D;  1H31 B;  1WEJ F;  2DVH A;  3A0B V;  2ORL A;  2ZON G;  1YTC A;  1NMI A;  4YE1 A;  2B12 B;  2C9X B;  2DGE A;  4RSZ A;  5KKZ B;  4WQ7 A;  2C1D B;  4D6T D;  1QL3 A;  1ETP A;  4PW9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...