5KLIB

Rhodobacter sphaeroides bc1 with stigmatellin and antimycin
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
256
structure length
256
Chain Sequence
AGGGHVEDVPFSFEGPFGTFDQHQLQRGLQVYTEVCAACHGMKFVPIRSLSEPGGPELPEDQVRAYATQFTVTDEETGEDREGKPTDHFPHSALENAPDLSLMAKARAGFHGPMGTGISQLFNGIGGPEYIYSVLTGFPEEPPKCAEGHEPDGFYYNRAFQNGSVPDTCKDANGVKTTAGSWIAMPPPLMDDLVEYADGHDASVHAMAEDVSAFLMWAAEPKLMARKQAGFTAVMFLTVLSVLLYLTNKRLWAGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 67
structure length 256
sequence length 256
chains with identical sequence F, L, P
ec nomenclature
pdb deposition date 2016-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02167 Cytochrom_C1 Cytochrome C1 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 5kliB01
1.20.5.100 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome c1, transmembrane anchor, C-terminal 5kliB02
4PW9B 5C0ZA 3L73D 1C6SA 1C75A 1N9CA 5E79V 1FI9A 1SQPD 4YE1A 5KAIV 2GIWA 1S5LV 2D0WA 1H33A 2MTAC 3DMIA 4EICA 1GKSA 1GDVA 1CYIA 4WQ7A 3HQ6A 3OCDB 1HJ3A 1RZ5A 2ZZS1 3ZOXA 1CXCA 1KX7A 2LIRA 1H31B 1I55A 2FYNB 5KLVD 3SWSA 4PJ0V 4RSZA 3L71D 3ZOOA 1MG3D 2AIUA 3VRDA 3ITKA 1H33B 3WC8A 155CA 5CICB 1CRGA 1HH7A 1YEBA 4FAVA 5B5EV 4EIDA 4U3FD 3WFCC 351CA 1CIGA 1JDLA 1CSUA 1CRCA 1PPJD 3L4MA 4PD4D 4WQ8A 1NTKD 1YICA 2BGVX 5B66V 5KAFV 3RN0A 2C1UA 3H1LD 2GB8B 2PACA 3H1JD 4XYDB 5DF5A 3PXSA 5DFSA 1QYZA 1P84D 2L91A 2CE1A 3CXHW 1DVVA 1QL4A 1COTA 1FHBA 5CIBB 2ZONG 1CTZA 4UB8V 2YK3A 3ZIYA 2FYUD 4N0KA 3NBSA 1U75B 3L72D 3DP5A 3X39A 1BL9A 1RAPA 4DY9A 3M97X 2Y0EA 1GIWA 4GEDB 2FRCA 3H1ID 3ZOYA 1MG2D 3L4OA 3RLMA 2B0ZB 2MHMA 1H32A 2I8FA 3CXHD 2BLFB 2N3YA 1HZUA 1KIBA 3A9FA 2Y0DA 4FA4A 2QJYB 3ZCFA 4LJIA 3L74D 3SJLA 2GC4D 2PCBB 1YFCA 2BH5X 1CRIA 3FWLA 2N9JA 1CEDA 3PTZA 1C52A 3WUIA 3RN1A 4O1QA 1RZ6A 1C6OA 1ZRTD 1IQCA 3PXTA 3O1YA 1L9JC 1YTCA 3JBTB 1N50A 4PWAA 1DW1A 3HQ8A 2OZ1B 5CIFB 3TF5A 3TGUD 3GG2A 3BCCD 3KHUA 1I6EA 1GJQA 2YQBA 1CO6A 1C2RA 1QKSA 3CX5W 1E8EA 1QN2A 5CIDB 2ZXYA 2VHDA 1OCDA 2HV4A 3WFDC 3VMAA 4H0KA 1A2SA 3O20A 4RJTA 2ORLA 5EXQA 1HROA 5C9MA 1LC2A 4EIFA 4QAOA 1CC5A 2RN0A 4IL6V 2ZBOA 1H9YA 4AALA 1KYOW 4FA9A 3OA8A 2QG4A 2C2CA 2O3JA 2ZOOA 1CNOA 3CX5D 2BCCD 1CCHA 4WQCA 1CRJA 3PHLA 4AANA 1IRVA 1DW3A 4L3HA 1DT1A 1A8CA 1FI3A 2V08A 1M70A 1KX2A 4XXLA 3PXWA 1KB9D 1KYOD 1IO3A 1CRYA 3KZIV 1BE3D 4KMGA 2GC7D 3NBTA 3TYIA 4Q5PA 3L70D 1RAQA 1W5CT 3NWVA 3C2CA 2Y0CA 1CHHA 3PLNA 2IBZD 2AXTV 4AAOA 3VYMA 1DIIC 2YCCA 5H2FV 1CSWA 4WQEA 4V2KA 1DW0A 1HJ4A 3O0RC 5CIEB 3A0BV 1A56A 1M6ZA 4P4QB 1I8OA 1YNRA 2RMZA 2BPBB 1SQQD 2BH4X 1EB7A 2C1VA 1I5TA 1LC1A 4FA5A 2N9IA 5TJHA 4WQ9A 1LMSA 3VNWA 4L1QA 2QJKB 2B11B 4A7PA 2N3BA 3SXTA 3PH2B 3MK7C 3RMZA 1KB0A 2QJPB 2CXBA 1F1CA 1LFMA 1CXAA 1E29A 5B6QA 4WQAA 1H32B 3MK7B 2B4ZA 1EZVD 4EIEA 1SQXD 2Q3EA 1J3SA 1CHJA 1IRWA 1HCMA 1PP9D 3CYTI 3A0HV 2EXVA 1CORA 1L0ND 2N18C 3H1HD 1NMLA 2C9XB 5KKZB 2CA4B 3WFEC 4EDFA 1C2NA 2D0SA 5KLIB 2N18B 1B7VA 4O1WA 4WQDA 1GQ1A 1H31A 2DVHA 5CYTR 1WVEC 5IY51 4D6TD 1I6DA 5DJQC 2N9YB 1GU2A 4GYDA 2PCCB 4AX3A 5CIHB 5DJQB 4WQBA 1NMIA 3WFBC 3OA8B 1LS9A 2B12B 1H9XA 1DIQC 1M60A 3WU2V 4J20A 1CCRA 1HJ5A 1I8PA 3O5CA 4MU8A 2CA3B 1AYGA 1NIRA 4Y5RA 3SVWA 2A06D 1N15A 2B10B 1AOQA 1CIHA 3CWBD 1MZ4A 2C1DA 3HQ7A 1CYJA 1ZZHA 4JCGA 4UB6V 3CU4A 3ZBMA 4L3GA 3HQ9A 3ZOWA 3SLEA 2JQRA 2AI5A 2CE0A 1IZL0 2KNCB 2BCNB 1AKKA 1C6RA 1HRCA 1CTJA 1WEJF 2C1DB 1FJ0A 2V07A 1L0LD 5CIGB 1YIQA 1NU1D 1N90A 451CA 3PRJA 2K9JB 1I54A 3CP5A 3L75D 4FB1A 1KV9A 1BGYD 1YEAA 1CIEA 1FOCA 1CHIA 4FA1A 1FCDC 1CSVA 1VYDA 1OAEA 3H1KD 1L9BC 1U74B 1BCCD 1DVHA 2L4DA 2JTIB 2YIUB 1W2LA 1SQBD 3GW6A 1CTYA 1H1OA 2LITA 5AURA 1C7MA 1HZVA 2C8SA 2KS1A 1K3GA 1NTZD 1CYCA 3TDKA 1NNOA 2OZ1A 1DW2A 5GTHV 1FI7A 1ETPA 1CIFA 2JWAA 4FANA 1YCCA 4NFGB 1SQVD 5GTIV 1R0QA 2DGEA 3DR0A 1S6VB 1CRHA 4K3IA 1CSXA 1QL3A 1K3HA 2XTSB 1F1FA 1NTMD 1AOFA 2FWLA 1E2RA 3OCDA 3ORVA 5TISV 4H0JA 4AAMA
chains in the Genus database with same CATH superfamily
5KLVG 1C75A 2FXOA 4KJMA 4IFFA 1KN7A 1SQPD 4YE1A 5KAIV 1S1CX 2D0WA 1M56D 2E5TA 1H33A 1KZUB 3IF4A 4WQ7A 3HQ6A 1HJ3A 1FOSE 1RZ5A 2K1AA 3AEFC 1WT6A 1QVFO 3GLMA 2IPPA 1NH4A 1PPJG 3SWSA 2FKWB 1BSHA 3L71D 4I2LC 1MG3D 3NFQA 2POHA 5AVYB 1RF1A 4H44C 3RBXA 4EIDA 3GHGA 5H2FH 2IYOA 3H1JG 3G71P 1JDLA 1EZVI 2J58A 1MFZA 1YTZT 3ZDMA 1SQQJ 3JCUH 1YICA 1MFTA 1LTJA 5B66V 5KAFV 2PRRA 1U7JA 3M9BA 4PV1D 5E79E 3CCEP 2WSSH 3PXSA 4H0LD 2CE1A 3EWKA 2ZONG 1XTGB 4PJ0E 1M1JB 4HKZH 2N1TC 3ZIYA 1DD4A 4N0KA 3S1KA 5B5EE 4GEDB 2FRCA 1GU5A 1N73A 1BDCA 1DEBA 2B0ZB 1H32A 1PP9J 1FAVA 2I8FA 2OYHA 3A0HH 3AEGC 2LKMA 3L74E 5AW6B 3BRTB 2P2UA 1NOHA 3SJLA 2KZJA 2H43A 2BH5X 1NHLA 1ZRTE 4PD4H 3A7OA 1PL5A 2P10A 1C6OA 3AE5C 2KB7P 1IQCA 3O1YA 1L9JC 1DW1A 3HQ8A 2OZ1B 5CIFB 1PP9E 1L4AB 3V2NA 1PGPA 3GG2A 1XTCC 1I6EA 1G2CA 1GJQA 2YQBA 3BASA 2M0BA 1OVVA 3Q3DA 3B5NC 3TNUA 2IZ1A 3F89A 1CW5A 2VHDA 1JCCA 2HV4A 2RH0A 3WFDC 1K8AQ 1A2SA 1CZQA 1SQBK 2ORLA 5C9MA 1P84I 2YKQA 3M0AA 3G9RA 5CCGC 5CCHC 1BDDA 2YO2A 2BCCE 3AE4C 5M1BA 1SP4A 1CNOA 2E5YA 1SVFA 2NZ2A 1OIPA 1BE3G 1Q81Q 3SWYA 4M3LA 2B88A 3V2RA 4L3HA 1K9MQ 1A8CA 2V08A 3TSIA 1M70A 1FE6A 4LC1A 3PXWA 1VQ6P 2IBZG 4CPGA 4N78E 2OTLP 2XU6A 1KYOD 1IO3A 5AVWB 1GL2A 3KZIV 3L70E 4KMGA 3NBTA 3TYIA 1RAQA 2HLOA 1DX7A 1OXZA 4UB8H 1ZW0A 4AYCA 1KORA 2AXTV 2WSEH 2E74B 2O01N 4EIJA 4I6MC 1BCCJ 1JTHB 4HJGH 1DW0A 1HJ4A 1SQBJ 2H88C 1NAYA 3H32B 1SQQD 1OFCX 3HTKA 4ASWA 1I5TA 1J1DC 1LC1A 2QJKC 3RL0g 3CPWO 5TJHA 2WWWA 4L1QA 4JF7A 1L4AD 5GTIH 1HUCA 1Q2NA 1VQMP 1LT9B 3SXTA 1YHQP 2O1JA 1KB0A 1EXJA 1H88A 1F1CA 5AVSB 2FFDB 1E29A 1KB9H 1SQXE 1L0NG 4WVZA 1EZVD 3RK2C 2Q3EA 3HRNA 5H2FE 4WY4D 4D6TJ 2FYZA 2W6JH 3CCJP 1JY2N 2IZ0A 1Q7YQ 1SFCB 1U57A 3RK3E 1SLQA 5KAIH 1PP9D 2QA4P 1W2BO 3CYTI 3JCUE 3NXSA 2AXCA 3V2PA 1KC8Q 1CORA 3USSA 2N18C 2C9XB 1NO4A 2W27A 4QMAA 3VMZA 1RE4A 4IL6H 1LGHB 3E7KA 5AVQB 2D0SA 2HG5D 4WQDA 4D6TE 1JUNA 4U3FJ 5IY51 3O6QB 3AE1C 3AEBC 1GU2A 3N7NA 1VQ5P 2E75C 3I55P 5CIHB 2E74D 3OA8B 5B66H 5KAFH 1W5CE 1H0TB 3CXHI 3H1LJ 1IFNA 3A0HE 4J20A 4N78D 4Y5RA 1RY3A 3SVWA 2KNCA 1KILE 5APYA 4DJGA 1PZQA 4PD4E 1LJ2A 3P32A 3CLQA 3CWBD 1AA0A 1BGYJ 2B9BA 3HQ7A 1ZZHA 3L72J 4JCGA 3A0BH 5KJ7C 5APQA 3H1IJ 3SLEA 1M1JA 2CE0A 3BRVB 2V7QH 4ZKPA 2D2CC 2FXPA 5AW3B 3VP8A 1N7SD 4Y99B 1OVRA 1L0LE 1CTJA 2GUSA 2C1DB 1S5LX 3MP7B 3KDPB 1FZAA 1USDA 1DEEG 3L75E 1BGYE 2K9JB 1VQ8P 1SFCD 1VQ9P 1LWUA 3D70A 1T8ZA 4XFJA 1KV9A 2YIUC 4JYBA 1ZOYC 1JY3P 3MTUE 3CX5I 1SQVG 1BCCD 2OYIB 2JTIB 4C7RA 1YTZI 3BCCJ 1EDLA 5BU8B 1SQBD 1KYOH 2R5DA 3AEDC 5APXA 4I1LA 1K3GA 1X0TA 2BEQD 2OZ1A 1MV8A 1DW2A 1ETPA 1L4AA 3M91A 1N8RQ 1HBWA 3L73G 1LNQA 2YXQB 5CJ4A 1S6VB 4K3IA 2XNXA 1GW3A 1FZBA 1F1FA 3BCCE 1VQ7P 2FWLA 5DJTB 1QL1A 2WQYC 2ZT9B 1SQPE 1R8EA 3M0DA 2YKPA 1DH3A 1G1JA 1FI9A 3PP5A 2OTJP 1S5LV 2MTAC 3CCRP 1GKSA 1FDIA 2J59M 3IR9A 3OCDB 1H89A 1JB0J 3EQ2A 2ZZS1 3ZOXA 3R4YA 3L71E 1M90Q 1H31B 5GTHE 3KZIH 3VMXA 2W6AA 5GTIE 2AIUA 3VRDA 3L35A 3EFGA 4TLFA 5DJUB 5CICB 3CCVP 4L73A 2AXTH 4UB6H 3LW5H 4U3FD 3QWOC 1FBMA 1URQA 1KB9E 1RF1C 2M3EA 1L2PA 3Q2YA 4PD4D 5EFWB 1QVGO 1NTKD 1LTAC 1GU4A 1USEA 1JTHA 4C7NB 5KAIE 3H1LD 1LTJC 3H32A 5DFSA 2WPQA 1QYZA 2G3AA 1COTA 1FHBA 1OWAA 2ZAEB 3GF7A 1R5SA 2NPSA 4OGQC 1CTZA 4UB8V 2O1KA 4HH2A 3SFDC 3NBSA 1LT9A 3R2PA 3CCSP 3L72D 3HE4A 2ZJSE 3X39A 3IFMA 3L74G 3D6ZA 3I5CA 2N1TB 3H1ID 2AEMA 2ZYGA 3KYQA 4YXDC 3ZOYA 2FFDA 3RLMA 1YJNP 2MHMA 2QJYC 3CXHD 3L36A 2N3YA 1N73C 3WMM0 2ZT9D 3MHVA 3A9FA 5KAFE 5B66E 2QIWA 3ZCFA 1SFCA 4LJIA 1Q86Q 2V7QJ 1PP9G 1ZV8A 3FWLA 1CEDA 3G4SP 3RN1A 1SQQK 4JYCA 1RZ6A 1IFIA 3CCMP 2C0XA 3JBTB 1N50A 4PWAA 2LXCB 1HGVA 3TF5A 2QEXP 3BCCD 2WTYA 1QKSA 1S9KD 1P84H 1QN2A 3C8VA 1M8OB 1OCDA 2HFED 4L75A 3O6QA 2BCCG 3CC7P 3HD7A 3CCUP 3B5NB 4B86A 4AQRD 1RQUA 2KSJA 1Q82Q 4H44D 4QAOA 4GDOA 2W6BA 3CL3D 2KLVA 4IL6V 3KPEA 1KYOW 1IC2A 3OA8A 2QG4A 1QEXA 1H0TA 1JMMA 3CX5D 4WBAA 4WQCA 1CRJA 5AW4B 3TK1A 1IRVA 1DW3A 3L70G 1FI3A 3NTNA 3WUTA 4XXLA 2JP3A 1KYOE 4TT3H 1KB9D 2WT7B 2RKLA 2PGDA 3AE3C 3CMEP 4GIFA 3V6IA 3NMDA 3T97B 2WITA 2N1TD 3VOPA 3NWVA 1GDTA 1GL2C 1YI2P 4YXWH 2O01J 5K5GB 2WVRA 1KILA 1CSWA 5KLVK 4WQEA 2K9JA 3W67A 3O0RC 1SQQE 1MUUA 3LIDA 3A0BV 2KYVA 1I8OA 3CC2P 2BH4X 1EB7A 2Q6QA 2C1VA 5AW1B 3P8CE 2OYIA 1KQGB 3LW5J 4I7ZC 2N9IA 1A02F 4WQ9A 1LMSA 3AE8C 1SQXG 2WPRA 1J1DB 2AEJA 2QJKB 3AE6C 2N3BA 1MKMA 3KZIE 3PH2B 1KQLA 3MK7C 2HODA 4H0LC 1SS1A 3E1RA 2QJPB 2CXBA 3UIAA 1EZVE 2IDBA 1LFMA 5AVUB 3B5ND 3H1HG 3Q5SA 1FU1A 2ZVOB 2AXTE 4H13C 1EDJA 3H25A 2K88A 2KLUA 3RK2B 1AVYA 1VF5C 5KKZC 1S5LH 2FBWC 2FYUK 1JY3O 2EXVA 5CCGD 2MJZA 4GOEA 5CCHD 1JM0A 4D6TG 4R4LA 2WMMA 3WFEC 5KLVJ 1LT1A 1RHZB 1KFMA 4EI2A 1GK4A 5APWA 2N18B 4O1WA 1RE4C 2ZXEB 4WY4B 1GQ1A 1QL2A 2VRSA 1H31A 2DVHA 3SWFA 2M3BA 1QX8A 1LTGC 5DJQC 2HYNA 2N9YB 3CWBJ 3CXHH 3V5BA 5AW0B 4GYDA 4NPFX 2K37A 1PGQA 5AW2B 4KHXA 4WQBA 5KLVE 1YIJP 2FY8A 1LS9A 2IFMA 3L37A 3BVHA 2CPBA 2V4HA 3H1JJ 1PGOA 1YBKA 2WSFH 1YQ3C 1NIRA 2IX7C 3TYYA 3CWBE 4C7NA 2A06D 1CIHA 4JPZB 2FYUJ 2GA1A 3Q1MA 3IN6A 3CC4P 1L0LG 1RQVA 3SFEC 1NU1G 4UB6V 2MKVA 3OAKA 3CU4A 3RL0C 1FJPA 3L75G 2BCNB 4W7YA 1BGYG 1N7LA 1N2DC 1KQFB 1AKKA 1C6RA 5AVZB 1HRCA 1P84E 5C39A 1FZCB 3H1KG 1WEJF 1M1JC 1M7LA 1FJ0A 2Q5UA 2ZYDA 2V07A 2D2CB 5CIGB 3OJAB 2JDIH 3CX5H 4YTPC 3P8CD 1NVOA 2FYUE 4U7JA 4FB1A 3RK2D 3S4RA 3KXDA 1CIEA 1NTKK 1BCCE 2N9BA 1FOCA 2W83C 1VQOP 2R3CA 1CHIA 1CSBA 1OAEA 1LWUC 1SQBE 1DVHA 1N7SB 2YIUB 1W2LA 3VP9A 5AW8B 4NPDA 3B4SA 1H1OA 2LITA 2QRXA 1C7MA 2KS1A 1VQ4P 1NTMG 1NTZD 1CYCA 1FI7A 2JWAA 2CPSA 4FANA 1HJ0A 1R0QA 3CD6P 2DGEA 2ZFCA 3AE2C 1L4AC 1FDMA 1SQPG 1CRHA 3EFFK 1CSXA 1QL3A 1K3HA 4XE5B 3ORVA 2QSIA 2YNYA 5TISV 2IBZI 2E75D 2OTKE 2AEFA 5AW5B 4PW9B 3VTPC 5C0ZA 1HGZA 1C6SA 2WSCH 3L71G 1N9CA 1UIIA 3HUSB 1Q90D 5CCHA 2KK7A 4O9BA 3M0DC 1GD2E 2H7HA 1CYIA 3Q5PA 3P8MC 1NTKJ 1KX7A 3C9IA 2PFXA 3SSUA 1BE3J 2FYNB 1I55A 5KLVD 4RSZA 1HH0A 1GMJA 3ZOOA 3AEAC 2WT7A 1FZGA 1H33B 1K04A 5KJ7D 4U3FE 1L0NK 1HH7A 3C1LA 1MZ9A 4FAVA 3T97A 3WFCC 2A45G 2D2CD 351CA 2QVAA 1CIGA 1T3JA 1CSUA 1PPJD 1NTKE 2I8DA 4WQ8A 1KMIZ 1URQC 3H1LE 1E5WA 2BGVX 2C1UA 1OW8A 1S5LE 2GB8B 3H1JD 5DF5A 3I56P 4IOIH 1P84D 4DCKA 4ASVA 3CXHW 3PJSK 1DVVA 4K35A 5CIBB 2PAJA 4MN4C 4DT0A 2GM4A 3L72E 2YK3A 4DOJA 3CCQP 2P67A 2PP6A 2FYUD 2NPSC 3H1IE 1U75B 3DP5A 4JBZA 1WMKA 4OGQB 4OVNF 4R4MA 2WSFJ 3M97X 1GIWA 4EYYQ 3CXHE 1MG2D 1LT9C 4IFDK 1FC2C 2BLFB 1L0NJ 1KIBA 2W8ZA 2K9YA 4FA4A 2QJYB 1OW7A 2GC4D 1N73B 3D6YA 1NAFA 2N9JA 3PTZA 4IFMA 3WUIA 1KV4A 3JC22 3QH9A 2W90A 3WUUA 4UB8E 1DD3A 5E79H 1S9KE 3FGAD 3KHUA 1S72P 1K73Q 1L0NE 4WY4A 3CX5W 1E8EA 3KQGA 2ZXYA 1VPCA 1E79H 3VMAA 4H0KA 1T3UA 3O20A 2O01H 2XZRA 1T2KD 4PJ0H 2WPVB 1NYHA 4LGDE 5AVVB 1G2CB 1CC5A 2OGUA 3HD7C 1RE3A 1H9YA 3RK3C 2E76C 4AALA 3CX5E 4FA9A 2C2CA 4GKGA 1OMIA 1S4XA 1SQVK 4OH8B 1CCHA 2I1KA 1AV1A 1PV3A 3PHLA 1OW6A 1AJYA 4AANA 3M9QA 2BASA 2HPCB 3MIWA 1DT1A 4LLHA 2QM7A 4H44B 3GHGC 2WSCJ 1VDFA 1BE3D 4OGQD 2GC7D 1NWQA 1JY3N 3S9OA 2Z4EA 4N6JA 5KJ7A 1W5CT 1SQQG 3C2CA 1IFPA 3FXDA 2Y0CA 1FZCA 1JY2O 3PLNA 3U1AA 2IBZD 4IL6E 4AAOA 1WRGA 3VYMA 1AQ5A 1DIIC 2YCCA 3H6PA 1GL2B 4V2KA 2Q3IA 5BU5A 5CIEB 5CBNA 4YPCA 1A56A 4W7ZA 1KILC 4P4QB 1PIXA 2C9NY 2RMZA 2YO3A 1OVUA 1N7SA 2UWJE 1FDOA 2JEEA 1GK6A 1EZVG 4GT1A 1SQVJ 3VNWA 2Q7CA 1JOCA 4I7ZB 4A7PA 5CHXA 3RMZA 3VYIA 3HTKB 2OYHC 1UIXA 1HWTC 3MK7B 5TISH 2KZIA 4EIEA 3L73J 1T6AA 1QLED 2B87B 1IRWA 3FWNA 1ZXGA 1X22A 4DZOA 1KQSO 1HCMA 3A0BE 3ABVC 4H13B 1L0ND 2HR3A 5KLIC 1ZN5A 1NMLA 3HUSA 5KKZB 4BXLA 1C2NA 3L73E 3OW2O 5KTBA 1FOSF 1NTZK 1R5LA 1S3JA 2KP8A 5APVA 2LXBA 5CYTR 2OYOA 1I6DA 2K3RA 1J1EC 1YJWP 1Y47A 4OWFA 4AX3A 3A5TA 5DJQB 3V4QA 5APSA 1NMIA 2SPZA 3GMAA 3CWBG 1GL2D 1DIQC 3WU2V 3RGUA 4Y28J 2M8RA 3AEEC 4MU8A 2A06E 1AYGA 2E43A 1AOQA 1OX3A 2YMYA 3MD0A 2C1DA 1HVVA 3B8EB 3ZBMA 3HQ9A 2CK3H 3ZOWA 4GOFA 2JQRA 2KNCB 1IZL0 2KOGA 2FYUG 3RL0B 1A02J 1NTZJ 1BCCG 3D0WA 3N4XA 1D7MA 1OZHA 1N90A 3AE9C 451CA 1SQBG 3L74J 4PV1C 3A2AA 1I54A 3VN0A 3IAOA 1YEAA 4H13D 4FA1A 1FCDC 1CSVA 2XNDH 1U74B 1VF5D 1VL2A 2Y9ZA 2C9LY 3TGUJ 2E42A 2OQQA 3GW6A 1CTYA 1NTZE 1G1IA 3SWKA 1LWUB 4UB6E 2BEZF 3AECC 2R44A 1JEKA 3TDKA 2YKOA 1NNOA 1CIFA 1YCCA 4NFGB 1SQVD 3AE7C 4XA4A 3HE5B 4K3AA 1RF0A 3MUDA 5CMZA 3TGUE 2XTSB 3G3ZA 1AOFA 2BCCJ 3FX0A 3OCDA 1GZLA 4H0JA 4BRYB 4C46A 3L73D 2I1JA 5E79V 3CMAP 1K05A 2WZ7A 1ZR2A 2GIWA 5APUA 3DMIA 4EICA 1GDVA 2Z5HA 5AW9B 1SQXK 4U3FG 1CXCA 2HPCA 1LTSC 2LIRA 1JY2P 2FXMA 3U1CA 2R32A 2E75B 4PJ0V 1CI6B 3L70J 3ITKA 1NTKG 1LP1B 3WC8A 155CA 3RL0D 2ZXXA 1CRGA 1YEBA 5B5EV 3H1LG 3LIEA 1PPJE 1FZFA 1N86A 3BATA 1CRCA 2ZVNB 5TISE 4AUWA 1S2EA 3L4MA 4NPEA 1FZEA 2G8YA 3RBZA 4WB4A 3RN0A 1QGKB 3H1JE 1URQB 1YQ4C 3GF3A 3L72G 2PACA 4XYDB 3H1IG 2L91A 2N1TA 4RKUJ 3CCLP 1QL4A 1X8YA 3P7KA 4L76A 1ZMEC 4BWNA 1KD1Q 1YITP 1SQXJ 1IK7A 2R3SA 4DY9A 1BL9A 1RAPA 2Y0EA 3L4OA 2NPSB 5GTHH 2Q9IA 2QJPC 1HZUA 2KI7B 3JSVC 3H1HJ 3HE4B 4EOTA 2R5BA 3FXEA 2B87A 2Y0DA 3BCCG 3L74D 2PCBB 3MZWB 1YFCA 1CRIA 1C52A 1LTTC 1X79B 4O1QA 3F5HA 1NJIQ 1ZRTD 3PXTA 1L0LK 1YTCA 1NU1K 3M06A 1LTBC 3B5NA 3CI9A 4ZNCA 3TGUD 2A45H 4PD4I 5AVXB 1CO6A 1C2RA 3H1HE 1EC5A 5CIDB 1IFMA 2ITAA 4WY4C 1IK9A 5CCGA 1KFNA 1BSNA 4RJTA 5EXQA 1HROA 1LC2A 3WU2H 4EIFA 2QE7H 1AFOA 2RN0A 2M5AB 2ZBOA 2O3JA 3B71A 3Q5RA 2ZOOA 2BCCD 1VQKP 3HD7B 1RE3C 3RK3B 1URQD 2E76B 2ZYAA 1AVOA 2XKMA 4KT0J 1M1KQ 4RESB 1NTMK 2P58A 1KX2A 2Y9YA 4ZKUA 3MGNA 1BE3E 4WWIA 1RF1B 1CRYA 1L0LJ 2GUVA 1NU1J 1EDKA 1SQPK 4GODA 3GHGB 2E74C 3V4WA 4Q5PA 3L70D 2IBZE 3L75J 2NPSD 2C0WA 1CHHA 2OARA 2JKVA 3H1KJ 1H8AA 5H2FV 1Y9BA 1LTJB 1FZCC 2XDJA 4N3YB 1NKNA 1NKZB 2Z5IA 1W2EA 3A3YB 1M6ZA 1YNRA 2BPBB 1NU1E 3M9HA 1FJKA 1LTIC 3E1IA 4FA5A 4JQ0D 1KILB 3PH0A 2H8PD 3II6A 1PFIA 4ZMDA 1ZR4A 1TU3F 2B11B 2FFDC 1N7SC 3H1KE 1HF9A 1NTMJ 1IFDA 2KIKA 2KUBA 1EQ7A 1CXAA 2QM8A 5B6QA 4WQAA 4L74A 1H32B 1SFCC 2WPSA 3HE5A 2B4ZA 1U7MA 2OYHB 1SQXD 1JMBA 3O8ZA 1VQLP 1J3SA 2WSEJ 1CHJA 1SQPJ 2HODB 1KB9I 1VQNP 2DW3A 1JCDA 2J5UA 3W68A 4BRYA 3A0HV 3HD7D 3RK3D 2E76D 1NTME 3H1HD 2CA4B 1HJBA 2A45I 3L71J 5APTA 4EDFA 2L5GB 5KLIB 1B7VA 3HUSC 5AW7B 1NGMB 2YXRB 2YMKA 4Z1MH 3D71A 3TNUB 3OA7A 1WVEC 2XV5A 5B5EH 4D6TD 1CI6A 3WUVA 1AQTA 1LP1A 2FYNC 1X9VA 1FS0E 2PCCB 1ZP0C 2A06G 1J1EB 2JWDA 3WFBC 2P1JA 2B12B 1H9XA 1M60A 2LR2A 5CJ0A 1J2JB 1CCRA 1HJ5A 1I8PA 3O5CA 1GW4A 1T2KC 2CA3B 1RH5B 3V2QA 2B10B 1N15A 2JJLA 1MZ4A 1KILD 1JO5A 1IO4A 1CYJA 1IJDB 4Y99C 1EXIA 4L3GA 2H89C 1IZNB 2AI5A 2JO1A 1M57D 1EDIA 2IYPA 1L0LD 1YIQA 1NU1D 2B89A 3L4FA 1DIPA 3U59A 3PRJA 1YYCA 1JNMA 4IL6X 3CP5A 3WU2E 1HTLC 1VQPP 3L75D 2OYIC 1IFJA 3G6EP 1NTZG 1BGYD 4W80A 1YJ9P 4PV1B 3H1KD 1VYDA 1KTMA 1L9BC 2L4DA 5AVRB 1Z56A 2KSEA 2P7JA 1ZLLA 4H0LB 5AURA 1HZVA 2C8SA 1GTWA 5AVTB 2IFNA 1SQVE 5BVZA 5GTHV 3TGUG 4RO0A 5GTIV 1KYOI 5CBOA 2Q1KA 3DR0A 1PGJA 3K5BA 1VF5B 2ZT9C 2KS1B 2KXPB 5L8RJ 1Y8AA 1NTMD 2NRGA 4HB1A 4HYTB 3VMYA 1E2RA 2JR8A 1RF0C 3MUDC 4AAMA 2M5AA
chains in the Genus database with same CATH topology
4PW9B 5C0ZA 3L73D 1C6SA 1C75A 1N9CA 5E79V 1FI9A 1SQPD 4YE1A 5KAIV 2GIWA 1S5LV 2D0WA 1H33A 2MTAC 3DMIA 4EICA 1GKSA 1GDVA 1CYIA 4WQ7A 3HQ6A 3OCDB 1HJ3A 1RZ5A 2ZZS1 3ZOXA 1CXCA 1KX7A 2LIRA 1H31B 1I55A 2FYNB 5KLVD 3SWSA 4PJ0V 4RSZA 3L71D 3ZOOA 1MG3D 2AIUA 3VRDA 3ITKA 1H33B 3WC8A 155CA 5CICB 1CRGA 1HH7A 1YEBA 4FAVA 5B5EV 4EIDA 4U3FD 3WFCC 351CA 1CIGA 1JDLA 1CSUA 1CRCA 1PPJD 3L4MA 4PD4D 4WQ8A 1NTKD 1YICA 2BGVX 5B66V 5KAFV 3RN0A 2C1UA 3H1LD 2GB8B 2PACA 3H1JD 4XYDB 5DF5A 3PXSA 5DFSA 1QYZA 1P84D 2L91A 2CE1A 3CXHW 1DVVA 1QL4A 1COTA 1FHBA 5CIBB 2ZONG 1CTZA 4UB8V 2YK3A 3ZIYA 2FYUD 4N0KA 3NBSA 1U75B 3L72D 3DP5A 3X39A 1BL9A 1RAPA 4DY9A 3M97X 2Y0EA 1GIWA 4GEDB 2FRCA 3H1ID 3ZOYA 1MG2D 3L4OA 3RLMA 2B0ZB 2MHMA 1H32A 2I8FA 3CXHD 2BLFB 2N3YA 1HZUA 1KIBA 3A9FA 2Y0DA 4FA4A 2QJYB 3ZCFA 4LJIA 3L74D 3SJLA 2GC4D 2PCBB 1YFCA 2BH5X 1CRIA 3FWLA 2N9JA 1CEDA 3PTZA 1C52A 3WUIA 3RN1A 4O1QA 1RZ6A 1C6OA 1ZRTD 1IQCA 3PXTA 3O1YA 1L9JC 1YTCA 3JBTB 1N50A 4PWAA 1DW1A 3HQ8A 2OZ1B 5CIFB 3TF5A 3TGUD 3GG2A 3BCCD 3KHUA 1I6EA 1GJQA 2YQBA 1CO6A 1C2RA 1QKSA 3CX5W 1E8EA 1QN2A 5CIDB 2ZXYA 2VHDA 1OCDA 2HV4A 3WFDC 3VMAA 4H0KA 1A2SA 3O20A 4RJTA 2ORLA 5EXQA 1HROA 5C9MA 1LC2A 4EIFA 4QAOA 1CC5A 2RN0A 4IL6V 2ZBOA 1H9YA 4AALA 1KYOW 4FA9A 3OA8A 2QG4A 2C2CA 2O3JA 2ZOOA 1CNOA 3CX5D 2BCCD 1CCHA 4WQCA 1CRJA 3PHLA 4AANA 1IRVA 1DW3A 4L3HA 1DT1A 1A8CA 1FI3A 2V08A 1M70A 1KX2A 4XXLA 3PXWA 1KB9D 1KYOD 1IO3A 1CRYA 3KZIV 1BE3D 4KMGA 2GC7D 3NBTA 3TYIA 4Q5PA 3L70D 1RAQA 1W5CT 3NWVA 3C2CA 2Y0CA 1CHHA 3PLNA 2IBZD 2AXTV 4AAOA 3VYMA 1DIIC 2YCCA 5H2FV 1CSWA 4WQEA 4V2KA 1DW0A 1HJ4A 3O0RC 5CIEB 3A0BV 1A56A 1M6ZA 4P4QB 1I8OA 1YNRA 2RMZA 2BPBB 1SQQD 2BH4X 1EB7A 2C1VA 1I5TA 1LC1A 4FA5A 2N9IA 5TJHA 4WQ9A 1LMSA 3VNWA 4L1QA 2QJKB 2B11B 4A7PA 2N3BA 3SXTA 3PH2B 3MK7C 3RMZA 1KB0A 2QJPB 2CXBA 1F1CA 1LFMA 1CXAA 1E29A 5B6QA 4WQAA 1H32B 3MK7B 2B4ZA 1EZVD 4EIEA 1SQXD 2Q3EA 1J3SA 1CHJA 1IRWA 1HCMA 1PP9D 3CYTI 3A0HV 2EXVA 1CORA 1L0ND 2N18C 3H1HD 1NMLA 2C9XB 5KKZB 2CA4B 3WFEC 4EDFA 1C2NA 2D0SA 5KLIB 2N18B 1B7VA 4O1WA 4WQDA 1GQ1A 1H31A 2DVHA 5CYTR 1WVEC 5IY51 4D6TD 1I6DA 5DJQC 2N9YB 1GU2A 4GYDA 2PCCB 4AX3A 5CIHB 5DJQB 4WQBA 1NMIA 3WFBC 3OA8B 1LS9A 2B12B 1H9XA 1DIQC 1M60A 3WU2V 4J20A 1CCRA 1HJ5A 1I8PA 3O5CA 4MU8A 2CA3B 1AYGA 1NIRA 4Y5RA 3SVWA 2A06D 1N15A 2B10B 1AOQA 1CIHA 3CWBD 1MZ4A 2C1DA 3HQ7A 1CYJA 1ZZHA 4JCGA 4UB6V 3CU4A 3ZBMA 4L3GA 3HQ9A 3ZOWA 3SLEA 2JQRA 2AI5A 2CE0A 1IZL0 2KNCB 2BCNB 1AKKA 1C6RA 1HRCA 1CTJA 1WEJF 2C1DB 1FJ0A 2V07A 1L0LD 5CIGB 1YIQA 1NU1D 1N90A 451CA 3PRJA 2K9JB 1I54A 3CP5A 3L75D 4FB1A 1KV9A 1BGYD 1YEAA 1CIEA 1FOCA 1CHIA 4FA1A 1FCDC 1CSVA 1VYDA 1OAEA 3H1KD 1L9BC 1U74B 1BCCD 1DVHA 2L4DA 2JTIB 2YIUB 1W2LA 1SQBD 3GW6A 1CTYA 1H1OA 2LITA 5AURA 1C7MA 1HZVA 2C8SA 2KS1A 1K3GA 1NTZD 1CYCA 3TDKA 1NNOA 2OZ1A 1DW2A 5GTHV 1FI7A 1ETPA 1CIFA 2JWAA 4FANA 1YCCA 4NFGB 1SQVD 5GTIV 1R0QA 2DGEA 3DR0A 1S6VB 1CRHA 4K3IA 1CSXA 1QL3A 1K3HA 2XTSB 1F1FA 1NTMD 1AOFA 2FWLA 1E2RA 3OCDA 3ORVA 5TISV 4H0JA 4AAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PW9 B;  5C0Z A;  3L73 D;  1C6S A;  1C75 A;  1N9C A;  5E79 V;  1FI9 A;  1SQP D;  4YE1 A;  5KAI V;  2GIW A;  1S5L V;  2D0W A;  1H33 A;  2MTA C;  3DMI A;  4EIC A;  1GKS A;  1GDV A;  1CYI A;  4WQ7 A;  3HQ6 A;  3OCD B;  1HJ3 A;  1RZ5 A;  2ZZS 1;  3ZOX A;  1CXC A;  1KX7 A;  2LIR A;  1H31 B;  1I55 A;  2FYN B;  5KLV D;  3SWS A;  4PJ0 V;  4RSZ A;  3L71 D;  3ZOO A;  1MG3 D;  2AIU A;  3VRD A;  3ITK A;  1H33 B;  3WC8 A;  155C A;  5CIC B;  1CRG A;  1HH7 A;  1YEB A;  4FAV A;  5B5E V;  4EID A;  4U3F D;  3WFC C;  351C A;  1CIG A;  1JDL A;  1CSU A;  1CRC A;  1PPJ D;  3L4M A;  4PD4 D;  4WQ8 A;  1NTK D;  1YIC A;  2BGV X;  5B66 V;  5KAF V;  3RN0 A;  2C1U A;  3H1L D;  2GB8 B;  2PAC A;  3H1J D;  4XYD B;  5DF5 A;  3PXS A;  5DFS A;  1QYZ A;  1P84 D;  2L91 A;  2CE1 A;  3CXH W;  1DVV A;  1QL4 A;  1COT A;  1FHB A;  5CIB B;  2ZON G;  1CTZ A;  4UB8 V;  2YK3 A;  3ZIY A;  2FYU D;  4N0K A;  3NBS A;  1U75 B;  3L72 D;  3DP5 A;  3X39 A;  1BL9 A;  1RAP A;  4DY9 A;  3M97 X;  2Y0E A;  1GIW A;  4GED B;  2FRC A;  3H1I D;  3ZOY A;  1MG2 D;  3L4O A;  3RLM A;  2B0Z B;  2MHM A;  1H32 A;  2I8F A;  3CXH D;  2BLF B;  2N3Y A;  1HZU A;  1KIB A;  3A9F A;  2Y0D A;  4FA4 A;  2QJY B;  3ZCF A;  4LJI A;  3L74 D;  3SJL A;  2GC4 D;  2PCB B;  1YFC A;  2BH5 X;  1CRI A;  3FWL A;  2N9J A;  1CED A;  3PTZ A;  1C52 A;  3WUI A;  3RN1 A;  4O1Q A;  1RZ6 A;  1C6O A;  1ZRT D;  1IQC A;  3PXT A;  3O1Y A;  1L9J C;  1YTC A;  3JBT B;  1N50 A;  4PWA A;  1DW1 A;  3HQ8 A;  2OZ1 B;  5CIF B;  3TF5 A;  3TGU D;  3GG2 A;  3BCC D;  3KHU A;  1I6E A;  1GJQ A;  2YQB A;  1CO6 A;  1C2R A;  1QKS A;  3CX5 W;  1E8E A;  1QN2 A;  5CID B;  2ZXY A;  2VHD A;  1OCD A;  2HV4 A;  3WFD C;  3VMA A;  4H0K A;  1A2S A;  3O20 A;  4RJT A;  2ORL A;  5EXQ A;  1HRO A;  5C9M A;  1LC2 A;  4EIF A;  4QAO A;  1CC5 A;  2RN0 A;  4IL6 V;  2ZBO A;  1H9Y A;  4AAL A;  1KYO W;  4FA9 A;  3OA8 A;  2QG4 A;  2C2C A;  2O3J A;  2ZOO A;  1CNO A;  3CX5 D;  2BCC D;  1CCH A;  4WQC A;  1CRJ A;  3PHL A;  4AAN A;  1IRV A;  1DW3 A;  4L3H A;  1DT1 A;  1A8C A;  1FI3 A;  2V08 A;  1M70 A;  1KX2 A;  4XXL A;  3PXW A;  1KB9 D;  1KYO D;  1IO3 A;  1CRY A;  3KZI V;  1BE3 D;  4KMG A;  2GC7 D;  3NBT A;  3TYI A;  4Q5P A;  3L70 D;  1RAQ A;  1W5C T;  3NWV A;  3C2C A;  2Y0C A;  1CHH A;  3PLN A;  2IBZ D;  2AXT V;  4AAO A;  3VYM A;  1DII C;  2YCC A;  5H2F V;  1CSW A;  4WQE A;  4V2K A;  1DW0 A;  1HJ4 A;  3O0R C;  5CIE B;  3A0B V;  1A56 A;  1M6Z A;  4P4Q B;  1I8O A;  1YNR A;  2RMZ A;  2BPB B;  1SQQ D;  2BH4 X;  1EB7 A;  2C1V A;  1I5T A;  1LC1 A;  4FA5 A;  2N9I A;  5TJH A;  4WQ9 A;  1LMS A;  3VNW A;  4L1Q A;  2QJK B;  2B11 B;  4A7P A;  2N3B A;  3SXT A;  3PH2 B;  3MK7 C;  3RMZ A;  1KB0 A;  2QJP B;  2CXB A;  1F1C A;  1LFM A;  1CXA A;  1E29 A;  5B6Q A;  4WQA A;  1H32 B;  3MK7 B;  2B4Z A;  1EZV D;  4EIE A;  1SQX D;  2Q3E A;  1J3S A;  1CHJ A;  1IRW A;  1HCM A;  1PP9 D;  3CYT I;  3A0H V;  2EXV A;  1COR A;  1L0N D;  2N18 C;  3H1H D;  1NML A;  2C9X B;  5KKZ B;  2CA4 B;  3WFE C;  4EDF A;  1C2N A;  2D0S A;  5KLI B;  2N18 B;  1B7V A;  4O1W A;  4WQD A;  1GQ1 A;  1H31 A;  2DVH A;  5CYT R;  1WVE C;  5IY5 1;  4D6T D;  1I6D A;  5DJQ C;  2N9Y B;  1GU2 A;  4GYD A;  2PCC B;  4AX3 A;  5CIH B;  5DJQ B;  4WQB A;  1NMI A;  3WFB C;  3OA8 B;  1LS9 A;  2B12 B;  1H9X A;  1DIQ C;  1M60 A;  3WU2 V;  4J20 A;  1CCR A;  1HJ5 A;  1I8P A;  3O5C A;  4MU8 A;  2CA3 B;  1AYG A;  1NIR A;  4Y5R A;  3SVW A;  2A06 D;  1N15 A;  2B10 B;  1AOQ A;  1CIH A;  3CWB D;  1MZ4 A;  2C1D A;  3HQ7 A;  1CYJ A;  1ZZH A;  4JCG A;  4UB6 V;  3CU4 A;  3ZBM A;  4L3G A;  3HQ9 A;  3ZOW A;  3SLE A;  2JQR A;  2AI5 A;  2CE0 A;  1IZL 0;  2KNC B;  2BCN B;  1AKK A;  1C6R A;  1HRC A;  1CTJ A;  1WEJ F;  2C1D B;  1FJ0 A;  2V07 A;  1L0L D;  5CIG B;  1YIQ A;  1NU1 D;  1N90 A;  451C A;  3PRJ A;  2K9J B;  1I54 A;  3CP5 A;  3L75 D;  4FB1 A;  1KV9 A;  1BGY D;  1YEA A;  1CIE A;  1FOC A;  1CHI A;  4FA1 A;  1FCD C;  1CSV A;  1VYD A;  1OAE A;  3H1K D;  1L9B C;  1U74 B;  1BCC D;  1DVH A;  2L4D A;  2JTI B;  2YIU B;  1W2L A;  1SQB D;  3GW6 A;  1CTY A;  1H1O A;  2LIT A;  5AUR A;  1C7M A;  1HZV A;  2C8S A;  2KS1 A;  1K3G A;  1NTZ D;  1CYC A;  3TDK A;  1NNO A;  2OZ1 A;  1DW2 A;  5GTH V;  1FI7 A;  1ETP A;  1CIF A;  2JWA A;  4FAN A;  1YCC A;  4NFG B;  1SQV D;  5GTI V;  1R0Q A;  2DGE A;  3DR0 A;  1S6V B;  1CRH A;  4K3I A;  1CSX A;  1QL3 A;  1K3H A;  2XTS B;  1F1F A;  1NTM D;  1AOF A;  2FWL A;  1E2R A;  3OCD A;  3ORV A;  5TIS V;  4H0J A;  4AAM A; 
#chains in the Genus database with same CATH topology
 5KLV G;  1C75 A;  2FXO A;  4KJM A;  4IFF A;  1KN7 A;  1SQP D;  4YE1 A;  5KAI V;  1S1C X;  2D0W A;  1M56 D;  2E5T A;  1H33 A;  1KZU B;  3IF4 A;  4WQ7 A;  3HQ6 A;  1HJ3 A;  1FOS E;  1RZ5 A;  2K1A A;  3AEF C;  1WT6 A;  1QVF O;  3GLM A;  2IPP A;  1NH4 A;  1PPJ G;  3SWS A;  2FKW B;  1BSH A;  3L71 D;  4I2L C;  1MG3 D;  3NFQ A;  2POH A;  5AVY B;  1RF1 A;  4H44 C;  3RBX A;  4EID A;  3GHG A;  5H2F H;  2IYO A;  3H1J G;  3G71 P;  1JDL A;  1EZV I;  2J58 A;  1MFZ A;  1YTZ T;  3ZDM A;  1SQQ J;  3JCU H;  1YIC A;  1MFT A;  1LTJ A;  5B66 V;  5KAF V;  2PRR A;  1U7J A;  3M9B A;  4PV1 D;  5E79 E;  3CCE P;  2WSS H;  3PXS A;  4H0L D;  2CE1 A;  3EWK A;  2ZON G;  1XTG B;  4PJ0 E;  1M1J B;  4HKZ H;  2N1T C;  3ZIY A;  1DD4 A;  4N0K A;  3S1K A;  5B5E E;  4GED B;  2FRC A;  1GU5 A;  1N73 A;  1BDC A;  1DEB A;  2B0Z B;  1H32 A;  1PP9 J;  1FAV A;  2I8F A;  2OYH A;  3A0H H;  3AEG C;  2LKM A;  3L74 E;  5AW6 B;  3BRT B;  2P2U A;  1NOH A;  3SJL A;  2KZJ A;  2H43 A;  2BH5 X;  1NHL A;  1ZRT E;  4PD4 H;  3A7O A;  1PL5 A;  2P10 A;  1C6O A;  3AE5 C;  2KB7 P;  1IQC A;  3O1Y A;  1L9J C;  1DW1 A;  3HQ8 A;  2OZ1 B;  5CIF B;  1PP9 E;  1L4A B;  3V2N A;  1PGP A;  3GG2 A;  1XTC C;  1I6E A;  1G2C A;  1GJQ A;  2YQB A;  3BAS A;  2M0B A;  1OVV A;  3Q3D A;  3B5N C;  3TNU A;  2IZ1 A;  3F89 A;  1CW5 A;  2VHD A;  1JCC A;  2HV4 A;  2RH0 A;  3WFD C;  1K8A Q;  1A2S A;  1CZQ A;  1SQB K;  2ORL A;  5C9M A;  1P84 I;  2YKQ A;  3M0A A;  3G9R A;  5CCG C;  5CCH C;  1BDD A;  2YO2 A;  2BCC E;  3AE4 C;  5M1B A;  1SP4 A;  1CNO A;  2E5Y A;  1SVF A;  2NZ2 A;  1OIP A;  1BE3 G;  1Q81 Q;  3SWY A;  4M3L A;  2B88 A;  3V2R A;  4L3H A;  1K9M Q;  1A8C A;  2V08 A;  3TSI A;  1M70 A;  1FE6 A;  4LC1 A;  3PXW A;  1VQ6 P;  2IBZ G;  4CPG A;  4N78 E;  2OTL P;  2XU6 A;  1KYO D;  1IO3 A;  5AVW B;  1GL2 A;  3KZI V;  3L70 E;  4KMG A;  3NBT A;  3TYI A;  1RAQ A;  2HLO A;  1DX7 A;  1OXZ A;  4UB8 H;  1ZW0 A;  4AYC A;  1KOR A;  2AXT V;  2WSE H;  2E74 B;  2O01 N;  4EIJ A;  4I6M C;  1BCC J;  1JTH B;  4HJG H;  1DW0 A;  1HJ4 A;  1SQB J;  2H88 C;  1NAY A;  3H32 B;  1SQQ D;  1OFC X;  3HTK A;  4ASW A;  1I5T A;  1J1D C;  1LC1 A;  2QJK C;  3RL0 g;  3CPW O;  5TJH A;  2WWW A;  4L1Q A;  4JF7 A;  1L4A D;  5GTI H;  1HUC A;  1Q2N A;  1VQM P;  1LT9 B;  3SXT A;  1YHQ P;  2O1J A;  1KB0 A;  1EXJ A;  1H88 A;  1F1C A;  5AVS B;  2FFD B;  1E29 A;  1KB9 H;  1SQX E;  1L0N G;  4WVZ A;  1EZV D;  3RK2 C;  2Q3E A;  3HRN A;  5H2F E;  4WY4 D;  4D6T J;  2FYZ A;  2W6J H;  3CCJ P;  1JY2 N;  2IZ0 A;  1Q7Y Q;  1SFC B;  1U57 A;  3RK3 E;  1SLQ A;  5KAI H;  1PP9 D;  2QA4 P;  1W2B O;  3CYT I;  3JCU E;  3NXS A;  2AXC A;  3V2P A;  1KC8 Q;  1COR A;  3USS A;  2N18 C;  2C9X B;  1NO4 A;  2W27 A;  4QMA A;  3VMZ A;  1RE4 A;  4IL6 H;  1LGH B;  3E7K A;  5AVQ B;  2D0S A;  2HG5 D;  4WQD A;  4D6T E;  1JUN A;  4U3F J;  5IY5 1;  3O6Q B;  3AE1 C;  3AEB C;  1GU2 A;  3N7N A;  1VQ5 P;  2E75 C;  3I55 P;  5CIH B;  2E74 D;  3OA8 B;  5B66 H;  5KAF H;  1W5C E;  1H0T B;  3CXH I;  3H1L J;  1IFN A;  3A0H E;  4J20 A;  4N78 D;  4Y5R A;  1RY3 A;  3SVW A;  2KNC A;  1KIL E;  5APY A;  4DJG A;  1PZQ A;  4PD4 E;  1LJ2 A;  3P32 A;  3CLQ A;  3CWB D;  1AA0 A;  1BGY J;  2B9B A;  3HQ7 A;  1ZZH A;  3L72 J;  4JCG A;  3A0B H;  5KJ7 C;  5APQ A;  3H1I J;  3SLE A;  1M1J A;  2CE0 A;  3BRV B;  2V7Q H;  4ZKP A;  2D2C C;  2FXP A;  5AW3 B;  3VP8 A;  1N7S D;  4Y99 B;  1OVR A;  1L0L E;  1CTJ A;  2GUS A;  2C1D B;  1S5L X;  3MP7 B;  3KDP B;  1FZA A;  1USD A;  1DEE G;  3L75 E;  1BGY E;  2K9J B;  1VQ8 P;  1SFC D;  1VQ9 P;  1LWU A;  3D70 A;  1T8Z A;  4XFJ A;  1KV9 A;  2YIU C;  4JYB A;  1ZOY C;  1JY3 P;  3MTU E;  3CX5 I;  1SQV G;  1BCC D;  2OYI B;  2JTI B;  4C7R A;  1YTZ I;  3BCC J;  1EDL A;  5BU8 B;  1SQB D;  1KYO H;  2R5D A;  3AED C;  5APX A;  4I1L A;  1K3G A;  1X0T A;  2BEQ D;  2OZ1 A;  1MV8 A;  1DW2 A;  1ETP A;  1L4A A;  3M91 A;  1N8R Q;  1HBW A;  3L73 G;  1LNQ A;  2YXQ B;  5CJ4 A;  1S6V B;  4K3I A;  2XNX A;  1GW3 A;  1FZB A;  1F1F A;  3BCC E;  1VQ7 P;  2FWL A;  5DJT B;  1QL1 A;  2WQY C;  2ZT9 B;  1SQP E;  1R8E A;  3M0D A;  2YKP A;  1DH3 A;  1G1J A;  1FI9 A;  3PP5 A;  2OTJ P;  1S5L V;  2MTA C;  3CCR P;  1GKS A;  1FDI A;  2J59 M;  3IR9 A;  3OCD B;  1H89 A;  1JB0 J;  3EQ2 A;  2ZZS 1;  3ZOX A;  3R4Y A;  3L71 E;  1M90 Q;  1H31 B;  5GTH E;  3KZI H;  3VMX A;  2W6A A;  5GTI E;  2AIU A;  3VRD A;  3L35 A;  3EFG A;  4TLF A;  5DJU B;  5CIC B;  3CCV P;  4L73 A;  2AXT H;  4UB6 H;  3LW5 H;  4U3F D;  3QWO C;  1FBM A;  1URQ A;  1KB9 E;  1RF1 C;  2M3E A;  1L2P A;  3Q2Y A;  4PD4 D;  5EFW B;  1QVG O;  1NTK D;  1LTA C;  1GU4 A;  1USE A;  1JTH A;  4C7N B;  5KAI E;  3H1L D;  1LTJ C;  3H32 A;  5DFS A;  2WPQ A;  1QYZ A;  2G3A A;  1COT A;  1FHB A;  1OWA A;  2ZAE B;  3GF7 A;  1R5S A;  2NPS A;  4OGQ C;  1CTZ A;  4UB8 V;  2O1K A;  4HH2 A;  3SFD C;  3NBS A;  1LT9 A;  3R2P A;  3CCS P;  3L72 D;  3HE4 A;  2ZJS E;  3X39 A;  3IFM A;  3L74 G;  3D6Z A;  3I5C A;  2N1T B;  3H1I D;  2AEM A;  2ZYG A;  3KYQ A;  4YXD C;  3ZOY A;  2FFD A;  3RLM A;  1YJN P;  2MHM A;  2QJY C;  3CXH D;  3L36 A;  2N3Y A;  1N73 C;  3WMM 0;  2ZT9 D;  3MHV A;  3A9F A;  5KAF E;  5B66 E;  2QIW A;  3ZCF A;  1SFC A;  4LJI A;  1Q86 Q;  2V7Q J;  1PP9 G;  1ZV8 A;  3FWL A;  1CED A;  3G4S P;  3RN1 A;  1SQQ K;  4JYC A;  1RZ6 A;  1IFI A;  3CCM P;  2C0X A;  3JBT B;  1N50 A;  4PWA A;  2LXC B;  1HGV A;  3TF5 A;  2QEX P;  3BCC D;  2WTY A;  1QKS A;  1S9K D;  1P84 H;  1QN2 A;  3C8V A;  1M8O B;  1OCD A;  2HFE D;  4L75 A;  3O6Q A;  2BCC G;  3CC7 P;  3HD7 A;  3CCU P;  3B5N B;  4B86 A;  4AQR D;  1RQU A;  2KSJ A;  1Q82 Q;  4H44 D;  4QAO A;  4GDO A;  2W6B A;  3CL3 D;  2KLV A;  4IL6 V;  3KPE A;  1KYO W;  1IC2 A;  3OA8 A;  2QG4 A;  1QEX A;  1H0T A;  1JMM A;  3CX5 D;  4WBA A;  4WQC A;  1CRJ A;  5AW4 B;  3TK1 A;  1IRV A;  1DW3 A;  3L70 G;  1FI3 A;  3NTN A;  3WUT A;  4XXL A;  2JP3 A;  1KYO E;  4TT3 H;  1KB9 D;  2WT7 B;  2RKL A;  2PGD A;  3AE3 C;  3CME P;  4GIF A;  3V6I A;  3NMD A;  3T97 B;  2WIT A;  2N1T D;  3VOP A;  3NWV A;  1GDT A;  1GL2 C;  1YI2 P;  4YXW H;  2O01 J;  5K5G B;  2WVR A;  1KIL A;  1CSW A;  5KLV K;  4WQE A;  2K9J A;  3W67 A;  3O0R C;  1SQQ E;  1MUU A;  3LID A;  3A0B V;  2KYV A;  1I8O A;  3CC2 P;  2BH4 X;  1EB7 A;  2Q6Q A;  2C1V A;  5AW1 B;  3P8C E;  2OYI A;  1KQG B;  3LW5 J;  4I7Z C;  2N9I A;  1A02 F;  4WQ9 A;  1LMS A;  3AE8 C;  1SQX G;  2WPR A;  1J1D B;  2AEJ A;  2QJK B;  3AE6 C;  2N3B A;  1MKM A;  3KZI E;  3PH2 B;  1KQL A;  3MK7 C;  2HOD A;  4H0L C;  1SS1 A;  3E1R A;  2QJP B;  2CXB A;  3UIA A;  1EZV E;  2IDB A;  1LFM A;  5AVU B;  3B5N D;  3H1H G;  3Q5S A;  1FU1 A;  2ZVO B;  2AXT E;  4H13 C;  1EDJ A;  3H25 A;  2K88 A;  2KLU A;  3RK2 B;  1AVY A;  1VF5 C;  5KKZ C;  1S5L H;  2FBW C;  2FYU K;  1JY3 O;  2EXV A;  5CCG D;  2MJZ A;  4GOE A;  5CCH D;  1JM0 A;  4D6T G;  4R4L A;  2WMM A;  3WFE C;  5KLV J;  1LT1 A;  1RHZ B;  1KFM A;  4EI2 A;  1GK4 A;  5APW A;  2N18 B;  4O1W A;  1RE4 C;  2ZXE B;  4WY4 B;  1GQ1 A;  1QL2 A;  2VRS A;  1H31 A;  2DVH A;  3SWF A;  2M3B A;  1QX8 A;  1LTG C;  5DJQ C;  2HYN A;  2N9Y B;  3CWB J;  3CXH H;  3V5B A;  5AW0 B;  4GYD A;  4NPF X;  2K37 A;  1PGQ A;  5AW2 B;  4KHX A;  4WQB A;  5KLV E;  1YIJ P;  2FY8 A;  1LS9 A;  2IFM A;  3L37 A;  3BVH A;  2CPB A;  2V4H A;  3H1J J;  1PGO A;  1YBK A;  2WSF H;  1YQ3 C;  1NIR A;  2IX7 C;  3TYY A;  3CWB E;  4C7N A;  2A06 D;  1CIH A;  4JPZ B;  2FYU J;  2GA1 A;  3Q1M A;  3IN6 A;  3CC4 P;  1L0L G;  1RQV A;  3SFE C;  1NU1 G;  4UB6 V;  2MKV A;  3OAK A;  3CU4 A;  3RL0 C;  1FJP A;  3L75 G;  2BCN B;  4W7Y A;  1BGY G;  1N7L A;  1N2D C;  1KQF B;  1AKK A;  1C6R A;  5AVZ B;  1HRC A;  1P84 E;  5C39 A;  1FZC B;  3H1K G;  1WEJ F;  1M1J C;  1M7L A;  1FJ0 A;  2Q5U A;  2ZYD A;  2V07 A;  2D2C B;  5CIG B;  3OJA B;  2JDI H;  3CX5 H;  4YTP C;  3P8C D;  1NVO A;  2FYU E;  4U7J A;  4FB1 A;  3RK2 D;  3S4R A;  3KXD A;  1CIE A;  1NTK K;  1BCC E;  2N9B A;  1FOC A;  2W83 C;  1VQO P;  2R3C A;  1CHI A;  1CSB A;  1OAE A;  1LWU C;  1SQB E;  1DVH A;  1N7S B;  2YIU B;  1W2L A;  3VP9 A;  5AW8 B;  4NPD A;  3B4S A;  1H1O A;  2LIT A;  2QRX A;  1C7M A;  2KS1 A;  1VQ4 P;  1NTM G;  1NTZ D;  1CYC A;  1FI7 A;  2JWA A;  2CPS A;  4FAN A;  1HJ0 A;  1R0Q A;  3CD6 P;  2DGE A;  2ZFC A;  3AE2 C;  1L4A C;  1FDM A;  1SQP G;  1CRH A;  3EFF K;  1CSX A;  1QL3 A;  1K3H A;  4XE5 B;  3ORV A;  2QSI A;  2YNY A;  5TIS V;  2IBZ I;  2E75 D;  2OTK E;  2AEF A;  5AW5 B;  4PW9 B;  3VTP C;  5C0Z A;  1HGZ A;  1C6S A;  2WSC H;  3L71 G;  1N9C A;  1UII A;  3HUS B;  1Q90 D;  5CCH A;  2KK7 A;  4O9B A;  3M0D C;  1GD2 E;  2H7H A;  1CYI A;  3Q5P A;  3P8M C;  1NTK J;  1KX7 A;  3C9I A;  2PFX A;  3SSU A;  1BE3 J;  2FYN B;  1I55 A;  5KLV D;  4RSZ A;  1HH0 A;  1GMJ A;  3ZOO A;  3AEA C;  2WT7 A;  1FZG A;  1H33 B;  1K04 A;  5KJ7 D;  4U3F E;  1L0N K;  1HH7 A;  3C1L A;  1MZ9 A;  4FAV A;  3T97 A;  3WFC C;  2A45 G;  2D2C D;  351C A;  2QVA A;  1CIG A;  1T3J A;  1CSU A;  1PPJ D;  1NTK E;  2I8D A;  4WQ8 A;  1KMI Z;  1URQ C;  3H1L E;  1E5W A;  2BGV X;  2C1U A;  1OW8 A;  1S5L E;  2GB8 B;  3H1J D;  5DF5 A;  3I56 P;  4IOI H;  1P84 D;  4DCK A;  4ASV A;  3CXH W;  3PJS K;  1DVV A;  4K35 A;  5CIB B;  2PAJ A;  4MN4 C;  4DT0 A;  2GM4 A;  3L72 E;  2YK3 A;  4DOJ A;  3CCQ P;  2P67 A;  2PP6 A;  2FYU D;  2NPS C;  3H1I E;  1U75 B;  3DP5 A;  4JBZ A;  1WMK A;  4OGQ B;  4OVN F;  4R4M A;  2WSF J;  3M97 X;  1GIW A;  4EYY Q;  3CXH E;  1MG2 D;  1LT9 C;  4IFD K;  1FC2 C;  2BLF B;  1L0N J;  1KIB A;  2W8Z A;  2K9Y A;  4FA4 A;  2QJY B;  1OW7 A;  2GC4 D;  1N73 B;  3D6Y A;  1NAF A;  2N9J A;  3PTZ A;  4IFM A;  3WUI A;  1KV4 A;  3JC2 2;  3QH9 A;  2W90 A;  3WUU A;  4UB8 E;  1DD3 A;  5E79 H;  1S9K E;  3FGA D;  3KHU A;  1S72 P;  1K73 Q;  1L0N E;  4WY4 A;  3CX5 W;  1E8E A;  3KQG A;  2ZXY A;  1VPC A;  1E79 H;  3VMA A;  4H0K A;  1T3U A;  3O20 A;  2O01 H;  2XZR A;  1T2K D;  4PJ0 H;  2WPV B;  1NYH A;  4LGD E;  5AVV B;  1G2C B;  1CC5 A;  2OGU A;  3HD7 C;  1RE3 A;  1H9Y A;  3RK3 C;  2E76 C;  4AAL A;  3CX5 E;  4FA9 A;  2C2C A;  4GKG A;  1OMI A;  1S4X A;  1SQV K;  4OH8 B;  1CCH A;  2I1K A;  1AV1 A;  1PV3 A;  3PHL A;  1OW6 A;  1AJY A;  4AAN A;  3M9Q A;  2BAS A;  2HPC B;  3MIW A;  1DT1 A;  4LLH A;  2QM7 A;  4H44 B;  3GHG C;  2WSC J;  1VDF A;  1BE3 D;  4OGQ D;  2GC7 D;  1NWQ A;  1JY3 N;  3S9O A;  2Z4E A;  4N6J A;  5KJ7 A;  1W5C T;  1SQQ G;  3C2C A;  1IFP A;  3FXD A;  2Y0C A;  1FZC A;  1JY2 O;  3PLN A;  3U1A A;  2IBZ D;  4IL6 E;  4AAO A;  1WRG A;  3VYM A;  1AQ5 A;  1DII C;  2YCC A;  3H6P A;  1GL2 B;  4V2K A;  2Q3I A;  5BU5 A;  5CIE B;  5CBN A;  4YPC A;  1A56 A;  4W7Z A;  1KIL C;  4P4Q B;  1PIX A;  2C9N Y;  2RMZ A;  2YO3 A;  1OVU A;  1N7S A;  2UWJ E;  1FDO A;  2JEE A;  1GK6 A;  1EZV G;  4GT1 A;  1SQV J;  3VNW A;  2Q7C A;  1JOC A;  4I7Z B;  4A7P A;  5CHX A;  3RMZ A;  3VYI A;  3HTK B;  2OYH C;  1UIX A;  1HWT C;  3MK7 B;  5TIS H;  2KZI A;  4EIE A;  3L73 J;  1T6A A;  1QLE D;  2B87 B;  1IRW A;  3FWN A;  1ZXG A;  1X22 A;  4DZO A;  1KQS O;  1HCM A;  3A0B E;  3ABV C;  4H13 B;  1L0N D;  2HR3 A;  5KLI C;  1ZN5 A;  1NML A;  3HUS A;  5KKZ B;  4BXL A;  1C2N A;  3L73 E;  3OW2 O;  5KTB A;  1FOS F;  1NTZ K;  1R5L A;  1S3J A;  2KP8 A;  5APV A;  2LXB A;  5CYT R;  2OYO A;  1I6D A;  2K3R A;  1J1E C;  1YJW P;  1Y47 A;  4OWF A;  4AX3 A;  3A5T A;  5DJQ B;  3V4Q A;  5APS A;  1NMI A;  2SPZ A;  3GMA A;  3CWB G;  1GL2 D;  1DIQ C;  3WU2 V;  3RGU A;  4Y28 J;  2M8R A;  3AEE C;  4MU8 A;  2A06 E;  1AYG A;  2E43 A;  1AOQ A;  1OX3 A;  2YMY A;  3MD0 A;  2C1D A;  1HVV A;  3B8E B;  3ZBM A;  3HQ9 A;  2CK3 H;  3ZOW A;  4GOF A;  2JQR A;  2KNC B;  1IZL 0;  2KOG A;  2FYU G;  3RL0 B;  1A02 J;  1NTZ J;  1BCC G;  3D0W A;  3N4X A;  1D7M A;  1OZH A;  1N90 A;  3AE9 C;  451C A;  1SQB G;  3L74 J;  4PV1 C;  3A2A A;  1I54 A;  3VN0 A;  3IAO A;  1YEA A;  4H13 D;  4FA1 A;  1FCD C;  1CSV A;  2XND H;  1U74 B;  1VF5 D;  1VL2 A;  2Y9Z A;  2C9L Y;  3TGU J;  2E42 A;  2OQQ A;  3GW6 A;  1CTY A;  1NTZ E;  1G1I A;  3SWK A;  1LWU B;  4UB6 E;  2BEZ F;  3AEC C;  2R44 A;  1JEK A;  3TDK A;  2YKO A;  1NNO A;  1CIF A;  1YCC A;  4NFG B;  1SQV D;  3AE7 C;  4XA4 A;  3HE5 B;  4K3A A;  1RF0 A;  3MUD A;  5CMZ A;  3TGU E;  2XTS B;  3G3Z A;  1AOF A;  2BCC J;  3FX0 A;  3OCD A;  1GZL A;  4H0J A;  4BRY B;  4C46 A;  3L73 D;  2I1J A;  5E79 V;  3CMA P;  1K05 A;  2WZ7 A;  1ZR2 A;  2GIW A;  5APU A;  3DMI A;  4EIC A;  1GDV A;  2Z5H A;  5AW9 B;  1SQX K;  4U3F G;  1CXC A;  2HPC A;  1LTS C;  2LIR A;  1JY2 P;  2FXM A;  3U1C A;  2R32 A;  2E75 B;  4PJ0 V;  1CI6 B;  3L70 J;  3ITK A;  1NTK G;  1LP1 B;  3WC8 A;  155C A;  3RL0 D;  2ZXX A;  1CRG A;  1YEB A;  5B5E V;  3H1L G;  3LIE A;  1PPJ E;  1FZF A;  1N86 A;  3BAT A;  1CRC A;  2ZVN B;  5TIS E;  4AUW A;  1S2E A;  3L4M A;  4NPE A;  1FZE A;  2G8Y A;  3RBZ A;  4WB4 A;  3RN0 A;  1QGK B;  3H1J E;  1URQ B;  1YQ4 C;  3GF3 A;  3L72 G;  2PAC A;  4XYD B;  3H1I G;  2L91 A;  2N1T A;  4RKU J;  3CCL P;  1QL4 A;  1X8Y A;  3P7K A;  4L76 A;  1ZME C;  4BWN A;  1KD1 Q;  1YIT P;  1SQX J;  1IK7 A;  2R3S A;  4DY9 A;  1BL9 A;  1RAP A;  2Y0E A;  3L4O A;  2NPS B;  5GTH H;  2Q9I A;  2QJP C;  1HZU A;  2KI7 B;  3JSV C;  3H1H J;  3HE4 B;  4EOT A;  2R5B A;  3FXE A;  2B87 A;  2Y0D A;  3BCC G;  3L74 D;  2PCB B;  3MZW B;  1YFC A;  1CRI A;  1C52 A;  1LTT C;  1X79 B;  4O1Q A;  3F5H A;  1NJI Q;  1ZRT D;  3PXT A;  1L0L K;  1YTC A;  1NU1 K;  3M06 A;  1LTB C;  3B5N A;  3CI9 A;  4ZNC A;  3TGU D;  2A45 H;  4PD4 I;  5AVX B;  1CO6 A;  1C2R A;  3H1H E;  1EC5 A;  5CID B;  1IFM A;  2ITA A;  4WY4 C;  1IK9 A;  5CCG A;  1KFN A;  1BSN A;  4RJT A;  5EXQ A;  1HRO A;  1LC2 A;  3WU2 H;  4EIF A;  2QE7 H;  1AFO A;  2RN0 A;  2M5A B;  2ZBO A;  2O3J A;  3B71 A;  3Q5R A;  2ZOO A;  2BCC D;  1VQK P;  3HD7 B;  1RE3 C;  3RK3 B;  1URQ D;  2E76 B;  2ZYA A;  1AVO A;  2XKM A;  4KT0 J;  1M1K Q;  4RES B;  1NTM K;  2P58 A;  1KX2 A;  2Y9Y A;  4ZKU A;  3MGN A;  1BE3 E;  4WWI A;  1RF1 B;  1CRY A;  1L0L J;  2GUV A;  1NU1 J;  1EDK A;  1SQP K;  4GOD A;  3GHG B;  2E74 C;  3V4W A;  4Q5P A;  3L70 D;  2IBZ E;  3L75 J;  2NPS D;  2C0W A;  1CHH A;  2OAR A;  2JKV A;  3H1K J;  1H8A A;  5H2F V;  1Y9B A;  1LTJ B;  1FZC C;  2XDJ A;  4N3Y B;  1NKN A;  1NKZ B;  2Z5I A;  1W2E A;  3A3Y B;  1M6Z A;  1YNR A;  2BPB B;  1NU1 E;  3M9H A;  1FJK A;  1LTI C;  3E1I A;  4FA5 A;  4JQ0 D;  1KIL B;  3PH0 A;  2H8P D;  3II6 A;  1PFI A;  4ZMD A;  1ZR4 A;  1TU3 F;  2B11 B;  2FFD C;  1N7S C;  3H1K E;  1HF9 A;  1NTM J;  1IFD A;  2KIK A;  2KUB A;  1EQ7 A;  1CXA A;  2QM8 A;  5B6Q A;  4WQA A;  4L74 A;  1H32 B;  1SFC C;  2WPS A;  3HE5 A;  2B4Z A;  1U7M A;  2OYH B;  1SQX D;  1JMB A;  3O8Z A;  1VQL P;  1J3S A;  2WSE J;  1CHJ A;  1SQP J;  2HOD B;  1KB9 I;  1VQN P;  2DW3 A;  1JCD A;  2J5U A;  3W68 A;  4BRY A;  3A0H V;  3HD7 D;  3RK3 D;  2E76 D;  1NTM E;  3H1H D;  2CA4 B;  1HJB A;  2A45 I;  3L71 J;  5APT A;  4EDF A;  2L5G B;  5KLI B;  1B7V A;  3HUS C;  5AW7 B;  1NGM B;  2YXR B;  2YMK A;  4Z1M H;  3D71 A;  3TNU B;  3OA7 A;  1WVE C;  2XV5 A;  5B5E H;  4D6T D;  1CI6 A;  3WUV A;  1AQT A;  1LP1 A;  2FYN C;  1X9V A;  1FS0 E;  2PCC B;  1ZP0 C;  2A06 G;  1J1E B;  2JWD A;  3WFB C;  2P1J A;  2B12 B;  1H9X A;  1M60 A;  2LR2 A;  5CJ0 A;  1J2J B;  1CCR A;  1HJ5 A;  1I8P A;  3O5C A;  1GW4 A;  1T2K C;  2CA3 B;  1RH5 B;  3V2Q A;  2B10 B;  1N15 A;  2JJL A;  1MZ4 A;  1KIL D;  1JO5 A;  1IO4 A;  1CYJ A;  1IJD B;  4Y99 C;  1EXI A;  4L3G A;  2H89 C;  1IZN B;  2AI5 A;  2JO1 A;  1M57 D;  1EDI A;  2IYP A;  1L0L D;  1YIQ A;  1NU1 D;  2B89 A;  3L4F A;  1DIP A;  3U59 A;  3PRJ A;  1YYC A;  1JNM A;  4IL6 X;  3CP5 A;  3WU2 E;  1HTL C;  1VQP P;  3L75 D;  2OYI C;  1IFJ A;  3G6E P;  1NTZ G;  1BGY D;  4W80 A;  1YJ9 P;  4PV1 B;  3H1K D;  1VYD A;  1KTM A;  1L9B C;  2L4D A;  5AVR B;  1Z56 A;  2KSE A;  2P7J A;  1ZLL A;  4H0L B;  5AUR A;  1HZV A;  2C8S A;  1GTW A;  5AVT B;  2IFN A;  1SQV E;  5BVZ A;  5GTH V;  3TGU G;  4RO0 A;  5GTI V;  1KYO I;  5CBO A;  2Q1K A;  3DR0 A;  1PGJ A;  3K5B A;  1VF5 B;  2ZT9 C;  2KS1 B;  2KXP B;  5L8R J;  1Y8A A;  1NTM D;  2NRG A;  4HB1 A;  4HYT B;  3VMY A;  1E2R A;  2JR8 A;  1RF0 C;  3MUD C;  4AAM A;  2M5A A; 
#chains in the Genus database with same CATH homology
 4PW9 B;  5C0Z A;  3L73 D;  1C6S A;  1C75 A;  1N9C A;  5E79 V;  1FI9 A;  1SQP D;  4YE1 A;  5KAI V;  2GIW A;  1S5L V;  2D0W A;  1H33 A;  2MTA C;  3DMI A;  4EIC A;  1GKS A;  1GDV A;  1CYI A;  4WQ7 A;  3HQ6 A;  3OCD B;  1HJ3 A;  1RZ5 A;  2ZZS 1;  3ZOX A;  1CXC A;  1KX7 A;  2LIR A;  1H31 B;  1I55 A;  2FYN B;  5KLV D;  3SWS A;  4PJ0 V;  4RSZ A;  3L71 D;  3ZOO A;  1MG3 D;  2AIU A;  3VRD A;  3ITK A;  1H33 B;  3WC8 A;  155C A;  5CIC B;  1CRG A;  1HH7 A;  1YEB A;  4FAV A;  5B5E V;  4EID A;  4U3F D;  3WFC C;  351C A;  1CIG A;  1JDL A;  1CSU A;  1CRC A;  1PPJ D;  3L4M A;  4PD4 D;  4WQ8 A;  1NTK D;  1YIC A;  2BGV X;  5B66 V;  5KAF V;  3RN0 A;  2C1U A;  3H1L D;  2GB8 B;  2PAC A;  3H1J D;  4XYD B;  5DF5 A;  3PXS A;  5DFS A;  1QYZ A;  1P84 D;  2L91 A;  2CE1 A;  3CXH W;  1DVV A;  1QL4 A;  1COT A;  1FHB A;  5CIB B;  2ZON G;  1CTZ A;  4UB8 V;  2YK3 A;  3ZIY A;  2FYU D;  4N0K A;  3NBS A;  1U75 B;  3L72 D;  3DP5 A;  3X39 A;  1BL9 A;  1RAP A;  4DY9 A;  3M97 X;  2Y0E A;  1GIW A;  4GED B;  2FRC A;  3H1I D;  3ZOY A;  1MG2 D;  3L4O A;  3RLM A;  2B0Z B;  2MHM A;  1H32 A;  2I8F A;  3CXH D;  2BLF B;  2N3Y A;  1HZU A;  1KIB A;  3A9F A;  2Y0D A;  4FA4 A;  2QJY B;  3ZCF A;  4LJI A;  3L74 D;  3SJL A;  2GC4 D;  2PCB B;  1YFC A;  2BH5 X;  1CRI A;  3FWL A;  2N9J A;  1CED A;  3PTZ A;  1C52 A;  3WUI A;  3RN1 A;  4O1Q A;  1RZ6 A;  1C6O A;  1ZRT D;  1IQC A;  3PXT A;  3O1Y A;  1L9J C;  1YTC A;  3JBT B;  1N50 A;  4PWA A;  1DW1 A;  3HQ8 A;  2OZ1 B;  5CIF B;  3TF5 A;  3TGU D;  3GG2 A;  3BCC D;  3KHU A;  1I6E A;  1GJQ A;  2YQB A;  1CO6 A;  1C2R A;  1QKS A;  3CX5 W;  1E8E A;  1QN2 A;  5CID B;  2ZXY A;  2VHD A;  1OCD A;  2HV4 A;  3WFD C;  3VMA A;  4H0K A;  1A2S A;  3O20 A;  4RJT A;  2ORL A;  5EXQ A;  1HRO A;  5C9M A;  1LC2 A;  4EIF A;  4QAO A;  1CC5 A;  2RN0 A;  4IL6 V;  2ZBO A;  1H9Y A;  4AAL A;  1KYO W;  4FA9 A;  3OA8 A;  2QG4 A;  2C2C A;  2O3J A;  2ZOO A;  1CNO A;  3CX5 D;  2BCC D;  1CCH A;  4WQC A;  1CRJ A;  3PHL A;  4AAN A;  1IRV A;  1DW3 A;  4L3H A;  1DT1 A;  1A8C A;  1FI3 A;  2V08 A;  1M70 A;  1KX2 A;  4XXL A;  3PXW A;  1KB9 D;  1KYO D;  1IO3 A;  1CRY A;  3KZI V;  1BE3 D;  4KMG A;  2GC7 D;  3NBT A;  3TYI A;  4Q5P A;  3L70 D;  1RAQ A;  1W5C T;  3NWV A;  3C2C A;  2Y0C A;  1CHH A;  3PLN A;  2IBZ D;  2AXT V;  4AAO A;  3VYM A;  1DII C;  2YCC A;  5H2F V;  1CSW A;  4WQE A;  4V2K A;  1DW0 A;  1HJ4 A;  3O0R C;  5CIE B;  3A0B V;  1A56 A;  1M6Z A;  4P4Q B;  1I8O A;  1YNR A;  2RMZ A;  2BPB B;  1SQQ D;  2BH4 X;  1EB7 A;  2C1V A;  1I5T A;  1LC1 A;  4FA5 A;  2N9I A;  5TJH A;  4WQ9 A;  1LMS A;  3VNW A;  4L1Q A;  2QJK B;  2B11 B;  4A7P A;  2N3B A;  3SXT A;  3PH2 B;  3MK7 C;  3RMZ A;  1KB0 A;  2QJP B;  2CXB A;  1F1C A;  1LFM A;  1CXA A;  1E29 A;  5B6Q A;  4WQA A;  1H32 B;  3MK7 B;  2B4Z A;  1EZV D;  4EIE A;  1SQX D;  2Q3E A;  1J3S A;  1CHJ A;  1IRW A;  1HCM A;  1PP9 D;  3CYT I;  3A0H V;  2EXV A;  1COR A;  1L0N D;  2N18 C;  3H1H D;  1NML A;  2C9X B;  5KKZ B;  2CA4 B;  3WFE C;  4EDF A;  1C2N A;  2D0S A;  5KLI B;  2N18 B;  1B7V A;  4O1W A;  4WQD A;  1GQ1 A;  1H31 A;  2DVH A;  5CYT R;  1WVE C;  5IY5 1;  4D6T D;  1I6D A;  5DJQ C;  2N9Y B;  1GU2 A;  4GYD A;  2PCC B;  4AX3 A;  5CIH B;  5DJQ B;  4WQB A;  1NMI A;  3WFB C;  3OA8 B;  1LS9 A;  2B12 B;  1H9X A;  1DIQ C;  1M60 A;  3WU2 V;  4J20 A;  1CCR A;  1HJ5 A;  1I8P A;  3O5C A;  4MU8 A;  2CA3 B;  1AYG A;  1NIR A;  4Y5R A;  3SVW A;  2A06 D;  1N15 A;  2B10 B;  1AOQ A;  1CIH A;  3CWB D;  1MZ4 A;  2C1D A;  3HQ7 A;  1CYJ A;  1ZZH A;  4JCG A;  4UB6 V;  3CU4 A;  3ZBM A;  4L3G A;  3HQ9 A;  3ZOW A;  3SLE A;  2JQR A;  2AI5 A;  2CE0 A;  1IZL 0;  2KNC B;  2BCN B;  1AKK A;  1C6R A;  1HRC A;  1CTJ A;  1WEJ F;  2C1D B;  1FJ0 A;  2V07 A;  1L0L D;  5CIG B;  1YIQ A;  1NU1 D;  1N90 A;  451C A;  3PRJ A;  2K9J B;  1I54 A;  3CP5 A;  3L75 D;  4FB1 A;  1KV9 A;  1BGY D;  1YEA A;  1CIE A;  1FOC A;  1CHI A;  4FA1 A;  1FCD C;  1CSV A;  1VYD A;  1OAE A;  3H1K D;  1L9B C;  1U74 B;  1BCC D;  1DVH A;  2L4D A;  2JTI B;  2YIU B;  1W2L A;  1SQB D;  3GW6 A;  1CTY A;  1H1O A;  2LIT A;  5AUR A;  1C7M A;  1HZV A;  2C8S A;  2KS1 A;  1K3G A;  1NTZ D;  1CYC A;  3TDK A;  1NNO A;  2OZ1 A;  1DW2 A;  5GTH V;  1FI7 A;  1ETP A;  1CIF A;  2JWA A;  4FAN A;  1YCC A;  4NFG B;  1SQV D;  5GTI V;  1R0Q A;  2DGE A;  3DR0 A;  1S6V B;  1CRH A;  4K3I A;  1CSX A;  1QL3 A;  1K3H A;  2XTS B;  1F1F A;  1NTM D;  1AOF A;  2FWL A;  1E2R A;  3OCD A;  3ORV A;  5TIS V;  4H0J A;  4AAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...