5KLVE

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 37
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 5klvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5klvE02
1O7WA 4NBCD 2BMOA 2YVJB 1NTZE 2GBWA 3L73E 1RFSA 2HMMA 1Q90C 2DE5D 1L0NE 3H1JE 2QJYC 4HM8A 5KKZC 1KB9E 1NU1E 1O7PA 4QCKA 3EN1A 3CX5E 1PPJE 3L71E 3GOBA 3VCAA 4QURA 2DE7D 4EMJB 4NB8D 3GL2A 4QDFA 1SQBE 3H1HE 2JZAA 3GZXA 5KLIC 4PV1D 3L72E 4HM7A 1VF5D 3D89A 2B24A 4H13D 1SQPE 2E76D 2QPZA 2NWFA 4D6TE 4H0LD 1EZVE 4AAYB 2NVGA 4NBDD 1EG9A 1O7HA 2HMJA 3BCCE 3GB4A 2D2CD 3H1KE 3L74E 4P1BH 4QUQA 1UUVA 4HM5A 1P84E 2DE6D 2QJKC 2HMKA 2NUMA 1O7NA 1BCCE 1SQXE 2IBZE 2E4QA 3VMGD 5BOKA 2E75D 2YFJA 3EQQA 4HM4A 2XSOA 4QDFB 2HMOA 4H44D 3GCEA 2E74D 1BGYE 5KLVE 3DQYA 1VM9A 4HM1A 2BMQA 2JO6A 4QDCA 1G8KB 1JM1A 3VMID 1L0LE 3H1LE 1O7GA 1ULIA 3CWBE 2NVFA 2NVEA 2Q3WA 1NYKA 1O7MA 4PD4E 3FOUA 1SQQE 1G8JB 1RIEA 2FYNC 2ZT9D 2E4PA 4P1CH 4QUPA 1NTME 4HJLA 2XR8A 2ZYLA 1WQLA 5HL4A 3L75E 2YFIA 2YIUC 3L70E 2BMRA 3C0DA 4NBAD 5AEUA 3AZCA 3GTEA 1KYOE 4OGQD 4NBHD 2CKFA 1PP9E 1SQVE 4QDDA 4NBFD 2BCCE 3N0QA 1VCKA 2HMLA 2XSHA 2YFLA 2FYUE 1NDOA 2GBXA 1NTKE 4HM2A 4AIVA 2NUKA 3TGUE 3H1IE 5AEWA 1SJGA 4NBBD 2HMNA 3GKEA 3GL0A 1ULJA 4NBED 2B1XA 1ZRTE 3GZYA 4NBGD 2QJPC 4U3FE 3CXHE 4NB9D 3VCPA 1BE3E 4HM6A 5CXMA 4HKVA 2A06E 1UUWA 3VMHD 1FQTA 3GTSA 4HM3A 4HM0A 2I7FA 2XRXA
chains in the Genus database with same CATH superfamily
3H32B 3JCUH 1PP9G 3SWFA 1FS0E 1OWAA 4I7ZB 1A02J 3VCAA 2HLOA 2DE7D 4AYCA 1DEEG 1G2CB 2OGUA 2WT7B 2WITA 2WPVB 2H7HA 1J1EB 2RMZA 3HTKB 1SQPE 4PD4I 1FJKA 3MZWB 2E76C 2KZJA 1PGOA 1SQBK 3V5BA 2QA4P 1UUVA 2IBZI 5AW8B 3VTPC 3GF3A 3H1KD 1JM0A 2GUVA 1JY2N 2Q9IA 1KILB 2NRGA 1SQXD 2O01H 5CCGD 1JM1A 5KTBA 2M8RA 3FX0A 3L35A 4YTPC 1NYKA 2Q3WA 1NTKD 2E5TA 4HKZH 5CJ0A 4N78E 4L74A 1L0LK 1N7SA 2K9JA 2KS1A 3Q5PA 5CBOA 5DJTB 1SJGA 5AW5B 3GHGA 4NB9D 2PRRA 3VMAA 1NU1D 4HKVA 1EDJA 1EDLA 3AE7C 1N73A 4U3FD 3HUSA 4YXDC 1O7WA 1YJNP 1PL5A 2IX7C 2NZ2A 2JR8A 1FBMA 1EC5A 2QJYC 2QVAA 1DH3A 1NAFA 1QVFO 3TGUG 1YQ3C 4GIFA 1RE4A 2J59M 2OYHB 3BCCD 5B66E 2OQQA 1U7MA 4PV1C 5KLIB 1BCCD 4K35A 1VF5C 2VRSA 2JWAA 2Q7CA 2NVGA 2AXTE 3E1RA 1BSHA 2D2CD 3L74E 1OVVA 5CMZA 1L4AB 3CL3D 2QJKC 1N8RQ 1MFTA 1KC8Q 3VMGD 3V2QA 3KPEA 1J1DC 1KILD 2YFJA 1PZQA 1S9KE 1NYHA 3S9OA 1NTMK 1N2DC 1PP9D 2MJZA 3RL0C 2P1JA 2XDJA 2O01N 2HPCB 3E1IA 1LGHB 1RIEA 1NVOA 2FYUK 2KIKA 1NKNA 3BVHA 1SFCD 2M5AB 3AE8C 4ASWA 4JQ0D 3TK1A 4QDDA 1WRGA 3N4XA 2XSHA 1S1CX 2BCCJ 1W2EA 3TSIA 3PLNA 1UIIA 2SPZA 5BVZA 1R5SA 1LWUB 3OW2O 1EDIA 1NWQA 1OVRA 1N86A 3RGUA 1LJ2A 1ZN5A 1JY3P 1E5WA 1HF9A 5B66H 1X0TA 3MP7B 3EN1A 1ZOYC 1L0ND 5AW3B 3WMM0 2JZAA 2PGDA 1D7MA 1E79H 3HD7B 1FZCC 3V2RA 1USEA 4IFDK 3CC4P 3AE5C 3KZIE 3H1LJ 1L4AD 2NPSA 4ZNCA 5CJ4A 3H1KE 1LTJC 1FDMA 1SQXE 2I1JA 4WY4C 2ZYAA 3MD0A 2XSOA 2XZRA 2W6AA 1T8ZA 1S4XA 3RBZA 4KHXA 1KQGB 2J5UA 2P7JA 5APVA 2FFDC 1JTHA 1M1JC 4P1CH 2QJPB 4JYCA 1QVGO 1KYOE 2B9BA 1BDDA 4OGQC 2P67A 1OVUA 4UB8E 2WSSH 2G3AA 1R5LA 4U3FE 2YMYA 1IC2A 1JMMA 4DT0A 5KJ7D 1IFDA 5AW9B 2LXBA 1RY3A 2I7FA 2YVJB 1X79B 2A06D 2GBWA 1N7SB 1EXJA 2W6JH 3VN0A 3O8ZA 5KKZC 2K9JB 2KS1B 4IFMA 3KZIH 1SLQA 3GHGB 3HD7D 3JSVC 1KB9H 3GZXA 1GZLA 2B87A 1IJDB 4GOFA 2CK3H 1N73B 4NPDA 3HUSB 1URQC 4H13C 1QGKB 2BASA 3FWLA 2I1KA 1JMBA 1ZR2A 1EZVE 1SQPJ 4AAYB 1GU5A 4AUWA 4P1BH 5DJUB 2HMKA 3CMAP 4PD4D 3I55P 2HFED 1HWTC 2E75D 2OTKE 3L71G 3G3ZA 4EOTA 4H44C 3D6YA 4GDOA 4KT0J 1KYOH 2IBZD 2YKPA 3VMID 4PJ0H 3NFQA 4UB8H 2HYNA 4LLHA 2WSEJ 3H1ID 1IFPA 2ZJSE 2Y0EA 3B5NA 2RN0A 1SVFA 2CPBA 1NHLA 3AE2C 4B86A 2NUKA 2A45H 2W90A 1OFCX 3OAKA 1X8YA 3GKEA 3GL0A 4NBED 3W68A 5EFWB 5AW2B 3KHUA 2JEEA 1JY2O 2N1TC 5APXA 3GF7A 2UWJE 3CCUP 1SQQG 1ZP0C 4HM3A 3G9RA 3CXHH 1N7SD 1HVVA 1Q90C 3L72D 1L0NE 1YTZI 4L73A 1Q82Q 3S1KA 3SWKA 3A3YB 5E79H 3CX5H 3M0AA 3F89A 1ZV8A 1DIPA 4CPGA 3TNUA 1GL2C 3FWNA 3G71P 3CD6P 1G1IA 1BDCA 4W80A 3L74J 3JC22 1GU4A 1GK4A 1SQVJ 2DW3A 2B88A 2FKWB 1VM9A 2JO6A 5CCHC 3H1LE 1G1JA 1GTWA 3M91A 1NAYA 1NH4A 1LT9C 2ZT9C 3A2AA 3WU2E 3M0DC 2JKVA 1USDA 3EQ2A 2YIUB 4NBHD 2Z5IA 4EYYQ 2KK7A 1SQQK 3L70D 2XKMA 1DD4A 4Y99C 3G6EP 3M9BA 1K73Q 1AVOA 1JTHB 5AVVB 4WY4A 3P32A 2A06E 1GMJA 3VYIA 1FE6A 3D71A 2BMOA 3CCLP 2LXCB 2A45G 5KAIH 4HM8A 2E5YA 3F5HA 1JY2P 1MV8A 1NTZD 2FY8A 3RBXA 1IFJA 3D70A 2P2UA 3IR9A 4YPCA 1Y9BA 2PFXA 2W6BA 5C39A 1N7LA 4JYBA 3KYQA 3L73G 3T97A 2V4HA 1J2JB 2NUMA 1Y8AA 3H1KJ 4D6TD 4GT1A 2IBZE 4HB1A 3PP5A 1SQXJ 5AW0B 1KORA 3B8EB 2HMOA 3WU2H 1P84H 2KUBA 2E74D 4QMAA 2B87B 3H1HG 5CCGC 1NTKJ 1AVYA 3PTZA 4EDFA 1CW5A 5KLVD 4QUPA 1NO4A 2KI7B 2YKQA 4OH8B 2BMRA 3GMAA 3L36A 1RF0C 3HE4A 3IF4A 1SS1A 3Q5SA 1URQA 1HBWA 3IAOA 1OMIA 4AIVA 3RK2D 5AVYB 1NU1J 4ZKPA 1GK6A 3MUDC 3VCPA 4U3FJ 1ZRTD 3B5NB 1KFMA 1RF1A 1NTMG 1BE3D 1HTLC 3L75G 4PV1B 2KLVA 5AVZB 1GW4A 3U59A 1FZBA 1UIXA 2BCCG 2H88C 2FXPA 2Y0DA 4I7ZC 2FYUG 1O7PA 1VQMP 1ZW0A 3BCCJ 1ZLLA 2QJKB 1LTAC 1FDOA 1BCCJ 1YHQP 2OYIA 5AW7B 1A02F 3Q2YA 1SQBD 3RK3B 2QPZA 3O6QA 1O7HA 2HMJA 3H1JG 2D2CC 3WUVA 4WVZA 3FGAD 1PP9J 1KILC 2XNDH 3PHLA 4R4LA 3CI9A 1YJ9P 2XNXA 4W7YA 2HG5D 3P8MC 2KSEA 4WWIA 1BGYD 1R8EA 3CCVP 3S4RA 3TNUB 1HUCA 1L0LD 2FYNB 3C1LA 1MKMA 3L70E 3CWBD 1RHZB 1SFCC 3P8CD 2WSEH 3Q3DA 3A5TA 1SQVE 2WSCJ 4N3YB 3Q5RA 3IN6A 3L73D 5BU8B 3H25A 4BWNA 3V2NA 3B5ND 2QEXP 1PV3A 4HM0A 3AE1C 3R4YA 5CCHA 1NTZE 3H1HD 4IFFA 5KAFE 1KMIZ 1S5LE 1VQOP 1L0NJ 4I6MC 2R3SA 1KFNA 3M0DA 3CCSP 1PPJE 2KP8A 2OYHC 1YTZT 2R5BA 1PIXA 1JEKA 5KLIC 4WY4B 3AE9C 3RK3D 1T2KD 1JCDA 3SSUA 2Y9ZA 3CCQP 4D6TE 1L4AC 2ZVOB 1T6AA 1IFIA 3AE4C 2AXTH 1FZEA 1NTMD 2ZXXA 5GTIE 2H8PD 3L75D 2FBWC 2G8YA 3AECC 5KLVE 2E43A 1K9MQ 1VQ4P 2NVEA 2FYUD 2V7QJ 2Q3EA 1SQPG 3NTNA 1LT1A 1W2BO 3T97B 2HMLA 3ABVC 2GBXA 1NTKE 4DOJA 5KKZB 1ZRTE 3USSA 2QM7A 3H1JD 3TGUD 5KAFH 1OX3A 3H6PA 1BE3E 2WVRA 1AQ5A 5KJ7C 2C9LY 2Q1KA 2C9NY 3HE4B 4K3AA 3MHVA 2ITAA 2LR2A 2HMMA 1KB9I 3RL0g 2ZVNB 2DE5D 1URQB 1NU1E 1K8AQ 4XE5B 5GTHE 4QURA 2ZYDA 2JP3A 3GL2A 1SQBE 3HD7C 4BRYA 1FZAA 3A0HE 1S5LX 2PAJA 1RF1B 1VQ9P 3D89A 3M9HA 1LTSC 3ITKA 2IZ1A 5GTIH 1M1KQ 4EI2A 3BCCE 3L4FA 1KYOI 3GG2A 2IYOA 1BCCE 1SQPK 2E4QA 3LIDA 3CMEP 2WTYA 2E75C 2WQYC 1BGYE 2OYIB 2FXOA 2KZIA 5B5EE 1L0LE 2OTLP 4JBZA 1O7GA 3H1IJ 3CWBE 3C8VA 2O3JA 3P8CE 4KJMA 4H0LC 1RH5B 5AVTB 2E4PA 3O6QB 2AXCA 1KILE 2M0BA 1PGJA 2ZXEB 2A45I 3C0DA 2GA1A 5AEUA 3AZCA 3GTEA 1PP9E 1HH0A 4HYTB 1VQ8P 3L74G 2OARA 2JDIH 4C7RA 1YIJP 3CC7P 5AEWA 2Y0CA 1L2PA 3CXHI 2K1AA 3GZYA 4C7NA 3TF5A 3CCMP 3VMXA 1X22A 1NGMB 1IO4A 4NBFD 4LGDE 1GDTA 2YMKA 3L72J 1N7SC 4Y28J 1EZVI 2KYVA 5K5GB 3N7NA 1QLED 5AW1B 3R2PA 2H43A 3CX5I 4TLFA 2W27A 4A7PA 1SFCA 3RK3E 4HM7A 1N73C 2R3CA 1NOHA 2RH0A 5TISE 3V4WA 1KTMA 4L75A 2R44A 2AEMA 2N9BA 2E42A 1EG9A 4QUQA 4HM5A 5AVQB 5B5EH 2DE6D 4L76A 1RE4C 3B4SA 4RKUJ 1CSBA 1G8KB 2JJLA 1YBKA 2BEQD 1M8OB 2QM8A 3U1CA 3A0BE 3FXEA 2YO3A 3WUUA 1EDKA 2IDBA 3L70J 3H1KG 3E7KA 1EXIA 2Z4EA 2YFLA 1SQXG 2WSCH 3TGUE 1LTGC 3OJAB 1BSNA 4NBGD 1OW6A 1S72P 3NMDA 2NPSB 1FOSE 3QH9A 1FZCA 3HRNA 1S2EA 2O1KA 4NBCD 2AEFA 1WT6A 1NTZJ 4IOIH 1FZFA 1ZR4A 5TISH 1QL2A 1LTJA 4QCKA 3AEFC 2I8DA 1CI6A 4QDFA 2WSFJ 4U3FG 3L71D 3PJSK 3D6ZA 2IYPA 5CCHD 3VP8A 1Y47A 5AW4B 2FFDA 4N6JA 1KZUB 1M1JA 2E76B 1P84I 4D6TJ 3GB4A 1AFOA 4GODA 1T3UA 2GUSA 1CZQA 3BATA 4IL6E 1FU1A 3AEDC 3A0BH 1S3JA 1PFIA 3CC2P 4JPZB 2GM4A 4BRYB 1BCCG 5AVXB 2E74C 1HJBA 3V4QA 5KLVJ 1M56D 1SQXK 1JUNA 3AEAC 4PD4E 5APUA 4UB6E 3BASA 3AEEC 1NTKK 5HL4A 2FXMA 2YIUC 1EZVG 2V7QH 1VL2A 1Q81Q 1SQQD 2CKFA 2IZ0A 3N0QA 4RO0A 1KD1Q 3H1IE 3RK2C 1AA0A 2Q6QA 2NPSD 3CLQA 1PGPA 5CXMA 1YYCA 1BE3J 1NU1K 3VP9A 3GTSA 1U57A 1NKZB 1RFSA 2J58A 4RJTA 3M06A 2JWDA 3GW6A 1YITP 2QJYB 1LNQA 2R5DA 1MUUA 3GOBA 1Q2NA 2D2CB 1KB9D 4C7NB 2AEJA 2POHA 2QSIA 3L72E 3HE5A 1SQBJ 4R4MA 1K04A 5AVUB 4C46A 2M3EA 1FC2C 2XU6A 4IL6H 2C0WA 2E76D 1VF5B 1JOCA 1Q7YQ 2ZFCA 1L0NG 1VQKP 1YJWP 4PD4H 1SFCB 4I1LA 2O1JA 4UB6H 1J1DB 1J1EC 1PGQA 1KYOD 1JY3O 2BMQA 3G4SP 1IK7A 1BGYJ 3KDPB 5AVWB 5CHXA 3RL0B 1LP1A 1L0LJ 1O7MA 3V2PA 2W83C 3CWBJ 4IL6X 2N1TA 3SWYA 4HJLA 3LW5H 1VQ6P 1WQLA 2YFIA 4NPEA 3WUTA 4LC1A 1RQUA 2QG4A 1OZHA 1H0TA 2KNCA 1VQ7P 3L73J 4NBBD 4GOEA 2OYOA 2B1XA 4U7JA 3H1LG 3B5NC 5APYA 1W5CE 3CXHD 3H1HJ 1IFMA 1XTCC 4NPFX 2IPPA 1ZMEC 1GL2A 3PRJA 3II6A 3L71E 3V6IA 4GKGA 1EZVD 2Y9YA 1QX8A 1L0NK 2IFNA 2KSJA 1H88A 4PV1D 3MTUE 3CX5D 3ZDMA 1FZCB 4ZKUA 1VF5D 2A06G 3RK3C 1T2KC 2Q3IA 2IFMA 4BXLA 2P58A 3B71A 1LT9A 1KN7A 1JB0J 3UIAA 1LTJB 1T3JA 2FYZA 2N9YB 1NTMJ 2ZYGA 5AVRB 2HR3A 2LKMA 3L75J 1H8AA 2B89A 5BOKA 2WPQA 1KQFB 1CI6B 4QDFB 1VDFA 2PP6A 3DQYA 3RL0D 3KQGA 3EFGA 2FYUJ 4RESB 2FFDB 1SQQE 1M90Q 2FYNC 2BEZF 3VMYA 1M1JB 4DJGA 4TT3H 1M7LA 1VCKA 4OGQB 3P7KA 5L8RJ 4OVNF 1H89A 2IBZG 2BCCD 2ZAEB 3H1JJ 3TGUJ 1ULJA 4WB4A 2HODA 2XV5A 2YNYA 3H1IG 3BRTB 1TU3F 2CPSA 1FQTA 1OW7A 3I56P 4OWFA 2K9YA 2RKLA 1LTIC 3SFEC 1KB9E 1FZGA 4M3LA 1LWUC 1VQPP 1RE3C 3SFDC 2W8ZA 4O9BA 1S5LH 4NB8D 2YO2A 2L5GB 5H2FE 4EIJA 1FJPA 2E75B 2WSFH 5CCGA 1JCCA 1OW8A 3L72G 1KV4A 2WPSA 3C9IA 4XA4A 4H13B 3L37A 4NBDD 4HH2A 1JY3N 3MIWA 4H0LB 3H1LD 4JF7A 3A7OA 1LTTC 3VMZA 1RF0A 4WY4D 5AVSB 2O01J 4PJ0E 3PH0A 1P84D 2MKVA 2QIWA 4ASVA 3CCJP 4HM1A 3HE5B 2QRXA 4H44B 4ZMDA 4YXWH 1FDIA 3MUDA 2KXPB 2YXQB 1U7JA 2XR8A 1AQTA 4OGQD 3H32A 2WZ7A 2OTJP 4AQRD 4HM2A 3AE3C 1FOSF 3LW5J 3CPWO 2QJPC 4MN4C 1G2CA 3CXHE 1LP1B 2WT7A 2WPRA 4HM6A 1YI2P 2N1TB 5TJHA 3TDKA 3HTKA 2XRXA 3L70G 3L73E 1SQVG 1AV1A 5H2FH 1H0TB 2KNCB 1M57D 3IFMA 5E79E 4WBAA 1SP4A 3CX5E 1VQLP 4EMJB 3H1HE 1KILA 3I5CA 3FXDA 3KXDA 1RF1C 5GTHH 1AJYA 3GLMA 1URQD 3CCEP 2KLUA 2KB7P 4H13D 1VPCA 3AEBC 5APQA 3A0HH 4H0LD 1NTZG 2K3RA 1DEBA 1GL2B 1SQPD 3GHGC 5AW6B 4DZOA 1O7NA 2WWWA 1Q86Q 5CBNA 3BRVB 4HJGH 3EQQA 4HM4A 1PPJG 4H44D 2OYIC 1DX7A 3GCEA 3HUSC 2K37A 4QDCA 2Z5HA 3MGNA 2WMMA 2P10A 2L91A 5BU5A 4DCKA 3OA7A 1OIPA 1NTME 2QE7H 2ZYLA 1LT9B 3L75E 4D6TG 2ZT9B 4NBAD 1ZXGA 2BCCE 4N78D 2FYUE 1HGZA 2HMNA 4Y99B 3CCRP 2Q5UA 1SQVK 5KLVG 2KOGA 3VOPA 2OYHA 2N1TD 3M9QA 1IK9A 3VMHD 5KAIE 3AE6C 1HJ0A 1XTGB 1MZ9A 1KQLA 1HGVA 1Q90D 3H1JE 1VQ5P 1WMKA 1L4AA 2M3BA 1K05A 1JO5A 3Q1MA 1NTKG 2C0XA 1NTZK 2HODB 3L71J 1MFZA 3JCUE 1Z56A 1OXZA 1YQ4C 4Z1MH 1BE3G 3LIEA 2B24A 2HPCA 2E74B 1GL2D 2NWFA 1KQSO 1EQ7A 1VQNP 1IZNB 5APTA 2M5AA 1P84E 1NJIQ 2YKOA 1NU1G 1GW3A 2JO1A 3L74D 3TYYA 5M1BA 5APSA 1SQBG 1SQVD 1X9VA 1LWUA 1S9KD 2K88A 1ULIA 3RK2B 2NVFA 3QWOC 2R32A 3FOUA 3K5BA 1RE3A 1G8JB 2ZT9D 3NXSA 1IFNA 1QEXA 1SQQJ 5KJ7A 5KLVK 1DD3A 3BCCG 2YXRB 5APWA 3EWKA 1NDOA 1QL1A 1LTBC 1JNMA 4I2LC 1GD2E 1RQVA 3U1AA 4XFJA 1BGYG 4W7ZA 3EFFK 2NPSC 2H89C 3AEGC 1L0LG 1FAVA 3W67A 3CWBG 3HD7A 1UUWA 1PPJD
chains in the Genus database with same CATH topology
1O7WA 4NBCD 2BMOA 2YVJB 1NTZE 2GBWA 3L73E 1RFSA 2HMMA 1Q90C 2DE5D 1L0NE 3H1JE 2QJYC 4HM8A 5KKZC 1KB9E 1NU1E 1O7PA 4QCKA 3EN1A 3CX5E 1PPJE 3L71E 3GOBA 3VCAA 4QURA 2DE7D 4EMJB 4NB8D 3GL2A 4QDFA 1SQBE 3H1HE 2JZAA 3GZXA 5KLIC 4PV1D 3L72E 4HM7A 1VF5D 3D89A 2B24A 4H13D 1SQPE 2E76D 2QPZA 2NWFA 4D6TE 4H0LD 1EZVE 4AAYB 2NVGA 4NBDD 1EG9A 1O7HA 2HMJA 3BCCE 3GB4A 2D2CD 3H1KE 3L74E 4P1BH 4QUQA 1UUVA 4HM5A 1P84E 2DE6D 2QJKC 2HMKA 2NUMA 1O7NA 1BCCE 1SQXE 2IBZE 2E4QA 3VMGD 5BOKA 2E75D 2YFJA 3EQQA 4HM4A 2XSOA 4QDFB 2HMOA 4H44D 3GCEA 2E74D 1BGYE 5KLVE 3DQYA 1VM9A 4HM1A 2BMQA 2JO6A 4QDCA 1G8KB 1JM1A 3VMID 1L0LE 3H1LE 1O7GA 1ULIA 3CWBE 2NVFA 2NVEA 2Q3WA 1NYKA 1O7MA 4PD4E 3FOUA 1SQQE 1G8JB 1RIEA 2FYNC 2ZT9D 2E4PA 4P1CH 4QUPA 1NTME 4HJLA 2XR8A 2ZYLA 1WQLA 5HL4A 3L75E 2YFIA 2YIUC 3L70E 2BMRA 3C0DA 4NBAD 5AEUA 3AZCA 3GTEA 1KYOE 4OGQD 4NBHD 2CKFA 1PP9E 1SQVE 4QDDA 4NBFD 2BCCE 3N0QA 1VCKA 2HMLA 2XSHA 2YFLA 2FYUE 1NDOA 2GBXA 1NTKE 4HM2A 4AIVA 2NUKA 3TGUE 3H1IE 5AEWA 1SJGA 4NBBD 2HMNA 3GKEA 3GL0A 1ULJA 4NBED 2B1XA 1ZRTE 3GZYA 4NBGD 2QJPC 4U3FE 3CXHE 4NB9D 3VCPA 1BE3E 4HM6A 5CXMA 4HKVA 2A06E 1UUWA 3VMHD 1FQTA 3GTSA 4HM3A 4HM0A 2I7FA 2XRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7W A;  4NBC D;  2BMO A;  2YVJ B;  1NTZ E;  2GBW A;  3L73 E;  1RFS A;  2HMM A;  1Q90 C;  2DE5 D;  1L0N E;  3H1J E;  2QJY C;  4HM8 A;  5KKZ C;  1KB9 E;  1NU1 E;  1O7P A;  4QCK A;  3EN1 A;  3CX5 E;  1PPJ E;  3L71 E;  3GOB A;  3VCA A;  4QUR A;  2DE7 D;  4EMJ B;  4NB8 D;  3GL2 A;  4QDF A;  1SQB E;  3H1H E;  2JZA A;  3GZX A;  5KLI C;  4PV1 D;  3L72 E;  4HM7 A;  1VF5 D;  3D89 A;  2B24 A;  4H13 D;  1SQP E;  2E76 D;  2QPZ A;  2NWF A;  4D6T E;  4H0L D;  1EZV E;  4AAY B;  2NVG A;  4NBD D;  1EG9 A;  1O7H A;  2HMJ A;  3BCC E;  3GB4 A;  2D2C D;  3H1K E;  3L74 E;  4P1B H;  4QUQ A;  1UUV A;  4HM5 A;  1P84 E;  2DE6 D;  2QJK C;  2HMK A;  2NUM A;  1O7N A;  1BCC E;  1SQX E;  2IBZ E;  2E4Q A;  3VMG D;  5BOK A;  2E75 D;  2YFJ A;  3EQQ A;  4HM4 A;  2XSO A;  4QDF B;  2HMO A;  4H44 D;  3GCE A;  2E74 D;  1BGY E;  5KLV E;  3DQY A;  1VM9 A;  4HM1 A;  2BMQ A;  2JO6 A;  4QDC A;  1G8K B;  1JM1 A;  3VMI D;  1L0L E;  3H1L E;  1O7G A;  1ULI A;  3CWB E;  2NVF A;  2NVE A;  2Q3W A;  1NYK A;  1O7M A;  4PD4 E;  3FOU A;  1SQQ E;  1G8J B;  1RIE A;  2FYN C;  2ZT9 D;  2E4P A;  4P1C H;  4QUP A;  1NTM E;  4HJL A;  2XR8 A;  2ZYL A;  1WQL A;  5HL4 A;  3L75 E;  2YFI A;  2YIU C;  3L70 E;  2BMR A;  3C0D A;  4NBA D;  5AEU A;  3AZC A;  3GTE A;  1KYO E;  4OGQ D;  4NBH D;  2CKF A;  1PP9 E;  1SQV E;  4QDD A;  4NBF D;  2BCC E;  3N0Q A;  1VCK A;  2HML A;  2XSH A;  2YFL A;  2FYU E;  1NDO A;  2GBX A;  1NTK E;  4HM2 A;  4AIV A;  2NUK A;  3TGU E;  3H1I E;  5AEW A;  1SJG A;  4NBB D;  2HMN A;  3GKE A;  3GL0 A;  1ULJ A;  4NBE D;  2B1X A;  1ZRT E;  3GZY A;  4NBG D;  2QJP C;  4U3F E;  3CXH E;  4NB9 D;  3VCP A;  1BE3 E;  4HM6 A;  5CXM A;  4HKV A;  2A06 E;  1UUW A;  3VMH D;  1FQT A;  3GTS A;  4HM3 A;  4HM0 A;  2I7F A;  2XRX A; 
#chains in the Genus database with same CATH topology
 3H32 B;  3JCU H;  1PP9 G;  3SWF A;  1FS0 E;  1OWA A;  4I7Z B;  1A02 J;  3VCA A;  2HLO A;  2DE7 D;  4AYC A;  1DEE G;  1G2C B;  2OGU A;  2WT7 B;  2WIT A;  2WPV B;  2H7H A;  1J1E B;  2RMZ A;  3HTK B;  1SQP E;  4PD4 I;  1FJK A;  3MZW B;  2E76 C;  2KZJ A;  1PGO A;  1SQB K;  3V5B A;  2QA4 P;  1UUV A;  2IBZ I;  5AW8 B;  3VTP C;  3GF3 A;  3H1K D;  1JM0 A;  2GUV A;  1JY2 N;  2Q9I A;  1KIL B;  2NRG A;  1SQX D;  2O01 H;  5CCG D;  1JM1 A;  5KTB A;  2M8R A;  3FX0 A;  3L35 A;  4YTP C;  1NYK A;  2Q3W A;  1NTK D;  2E5T A;  4HKZ H;  5CJ0 A;  4N78 E;  4L74 A;  1L0L K;  1N7S A;  2K9J A;  2KS1 A;  3Q5P A;  5CBO A;  5DJT B;  1SJG A;  5AW5 B;  3GHG A;  4NB9 D;  2PRR A;  3VMA A;  1NU1 D;  4HKV A;  1EDJ A;  1EDL A;  3AE7 C;  1N73 A;  4U3F D;  3HUS A;  4YXD C;  1O7W A;  1YJN P;  1PL5 A;  2IX7 C;  2NZ2 A;  2JR8 A;  1FBM A;  1EC5 A;  2QJY C;  2QVA A;  1DH3 A;  1NAF A;  1QVF O;  3TGU G;  1YQ3 C;  4GIF A;  1RE4 A;  2J59 M;  2OYH B;  3BCC D;  5B66 E;  2OQQ A;  1U7M A;  4PV1 C;  5KLI B;  1BCC D;  4K35 A;  1VF5 C;  2VRS A;  2JWA A;  2Q7C A;  2NVG A;  2AXT E;  3E1R A;  1BSH A;  2D2C D;  3L74 E;  1OVV A;  5CMZ A;  1L4A B;  3CL3 D;  2QJK C;  1N8R Q;  1MFT A;  1KC8 Q;  3VMG D;  3V2Q A;  3KPE A;  1J1D C;  1KIL D;  2YFJ A;  1PZQ A;  1S9K E;  1NYH A;  3S9O A;  1NTM K;  1N2D C;  1PP9 D;  2MJZ A;  3RL0 C;  2P1J A;  2XDJ A;  2O01 N;  2HPC B;  3E1I A;  1LGH B;  1RIE A;  1NVO A;  2FYU K;  2KIK A;  1NKN A;  3BVH A;  1SFC D;  2M5A B;  3AE8 C;  4ASW A;  4JQ0 D;  3TK1 A;  4QDD A;  1WRG A;  3N4X A;  2XSH A;  1S1C X;  2BCC J;  1W2E A;  3TSI A;  3PLN A;  1UII A;  2SPZ A;  5BVZ A;  1R5S A;  1LWU B;  3OW2 O;  1EDI A;  1NWQ A;  1OVR A;  1N86 A;  3RGU A;  1LJ2 A;  1ZN5 A;  1JY3 P;  1E5W A;  1HF9 A;  5B66 H;  1X0T A;  3MP7 B;  3EN1 A;  1ZOY C;  1L0N D;  5AW3 B;  3WMM 0;  2JZA A;  2PGD A;  1D7M A;  1E79 H;  3HD7 B;  1FZC C;  3V2R A;  1USE A;  4IFD K;  3CC4 P;  3AE5 C;  3KZI E;  3H1L J;  1L4A D;  2NPS A;  4ZNC A;  5CJ4 A;  3H1K E;  1LTJ C;  1FDM A;  1SQX E;  2I1J A;  4WY4 C;  2ZYA A;  3MD0 A;  2XSO A;  2XZR A;  2W6A A;  1T8Z A;  1S4X A;  3RBZ A;  4KHX A;  1KQG B;  2J5U A;  2P7J A;  5APV A;  2FFD C;  1JTH A;  1M1J C;  4P1C H;  2QJP B;  4JYC A;  1QVG O;  1KYO E;  2B9B A;  1BDD A;  4OGQ C;  2P67 A;  1OVU A;  4UB8 E;  2WSS H;  2G3A A;  1R5L A;  4U3F E;  2YMY A;  1IC2 A;  1JMM A;  4DT0 A;  5KJ7 D;  1IFD A;  5AW9 B;  2LXB A;  1RY3 A;  2I7F A;  2YVJ B;  1X79 B;  2A06 D;  2GBW A;  1N7S B;  1EXJ A;  2W6J H;  3VN0 A;  3O8Z A;  5KKZ C;  2K9J B;  2KS1 B;  4IFM A;  3KZI H;  1SLQ A;  3GHG B;  3HD7 D;  3JSV C;  1KB9 H;  3GZX A;  1GZL A;  2B87 A;  1IJD B;  4GOF A;  2CK3 H;  1N73 B;  4NPD A;  3HUS B;  1URQ C;  4H13 C;  1QGK B;  2BAS A;  3FWL A;  2I1K A;  1JMB A;  1ZR2 A;  1EZV E;  1SQP J;  4AAY B;  1GU5 A;  4AUW A;  4P1B H;  5DJU B;  2HMK A;  3CMA P;  4PD4 D;  3I55 P;  2HFE D;  1HWT C;  2E75 D;  2OTK E;  3L71 G;  3G3Z A;  4EOT A;  4H44 C;  3D6Y A;  4GDO A;  4KT0 J;  1KYO H;  2IBZ D;  2YKP A;  3VMI D;  4PJ0 H;  3NFQ A;  4UB8 H;  2HYN A;  4LLH A;  2WSE J;  3H1I D;  1IFP A;  2ZJS E;  2Y0E A;  3B5N A;  2RN0 A;  1SVF A;  2CPB A;  1NHL A;  3AE2 C;  4B86 A;  2NUK A;  2A45 H;  2W90 A;  1OFC X;  3OAK A;  1X8Y A;  3GKE A;  3GL0 A;  4NBE D;  3W68 A;  5EFW B;  5AW2 B;  3KHU A;  2JEE A;  1JY2 O;  2N1T C;  5APX A;  3GF7 A;  2UWJ E;  3CCU P;  1SQQ G;  1ZP0 C;  4HM3 A;  3G9R A;  3CXH H;  1N7S D;  1HVV A;  1Q90 C;  3L72 D;  1L0N E;  1YTZ I;  4L73 A;  1Q82 Q;  3S1K A;  3SWK A;  3A3Y B;  5E79 H;  3CX5 H;  3M0A A;  3F89 A;  1ZV8 A;  1DIP A;  4CPG A;  3TNU A;  1GL2 C;  3FWN A;  3G71 P;  3CD6 P;  1G1I A;  1BDC A;  4W80 A;  3L74 J;  3JC2 2;  1GU4 A;  1GK4 A;  1SQV J;  2DW3 A;  2B88 A;  2FKW B;  1VM9 A;  2JO6 A;  5CCH C;  3H1L E;  1G1J A;  1GTW A;  3M91 A;  1NAY A;  1NH4 A;  1LT9 C;  2ZT9 C;  3A2A A;  3WU2 E;  3M0D C;  2JKV A;  1USD A;  3EQ2 A;  2YIU B;  4NBH D;  2Z5I A;  4EYY Q;  2KK7 A;  1SQQ K;  3L70 D;  2XKM A;  1DD4 A;  4Y99 C;  3G6E P;  3M9B A;  1K73 Q;  1AVO A;  1JTH B;  5AVV B;  4WY4 A;  3P32 A;  2A06 E;  1GMJ A;  3VYI A;  1FE6 A;  3D71 A;  2BMO A;  3CCL P;  2LXC B;  2A45 G;  5KAI H;  4HM8 A;  2E5Y A;  3F5H A;  1JY2 P;  1MV8 A;  1NTZ D;  2FY8 A;  3RBX A;  1IFJ A;  3D70 A;  2P2U A;  3IR9 A;  4YPC A;  1Y9B A;  2PFX A;  2W6B A;  5C39 A;  1N7L A;  4JYB A;  3KYQ A;  3L73 G;  3T97 A;  2V4H A;  1J2J B;  2NUM A;  1Y8A A;  3H1K J;  4D6T D;  4GT1 A;  2IBZ E;  4HB1 A;  3PP5 A;  1SQX J;  5AW0 B;  1KOR A;  3B8E B;  2HMO A;  3WU2 H;  1P84 H;  2KUB A;  2E74 D;  4QMA A;  2B87 B;  3H1H G;  5CCG C;  1NTK J;  1AVY A;  3PTZ A;  4EDF A;  1CW5 A;  5KLV D;  4QUP A;  1NO4 A;  2KI7 B;  2YKQ A;  4OH8 B;  2BMR A;  3GMA A;  3L36 A;  1RF0 C;  3HE4 A;  3IF4 A;  1SS1 A;  3Q5S A;  1URQ A;  1HBW A;  3IAO A;  1OMI A;  4AIV A;  3RK2 D;  5AVY B;  1NU1 J;  4ZKP A;  1GK6 A;  3MUD C;  3VCP A;  4U3F J;  1ZRT D;  3B5N B;  1KFM A;  1RF1 A;  1NTM G;  1BE3 D;  1HTL C;  3L75 G;  4PV1 B;  2KLV A;  5AVZ B;  1GW4 A;  3U59 A;  1FZB A;  1UIX A;  2BCC G;  2H88 C;  2FXP A;  2Y0D A;  4I7Z C;  2FYU G;  1O7P A;  1VQM P;  1ZW0 A;  3BCC J;  1ZLL A;  2QJK B;  1LTA C;  1FDO A;  1BCC J;  1YHQ P;  2OYI A;  5AW7 B;  1A02 F;  3Q2Y A;  1SQB D;  3RK3 B;  2QPZ A;  3O6Q A;  1O7H A;  2HMJ A;  3H1J G;  2D2C C;  3WUV A;  4WVZ A;  3FGA D;  1PP9 J;  1KIL C;  2XND H;  3PHL A;  4R4L A;  3CI9 A;  1YJ9 P;  2XNX A;  4W7Y A;  2HG5 D;  3P8M C;  2KSE A;  4WWI A;  1BGY D;  1R8E A;  3CCV P;  3S4R A;  3TNU B;  1HUC A;  1L0L D;  2FYN B;  3C1L A;  1MKM A;  3L70 E;  3CWB D;  1RHZ B;  1SFC C;  3P8C D;  2WSE H;  3Q3D A;  3A5T A;  1SQV E;  2WSC J;  4N3Y B;  3Q5R A;  3IN6 A;  3L73 D;  5BU8 B;  3H25 A;  4BWN A;  3V2N A;  3B5N D;  2QEX P;  1PV3 A;  4HM0 A;  3AE1 C;  3R4Y A;  5CCH A;  1NTZ E;  3H1H D;  4IFF A;  5KAF E;  1KMI Z;  1S5L E;  1VQO P;  1L0N J;  4I6M C;  2R3S A;  1KFN A;  3M0D A;  3CCS P;  1PPJ E;  2KP8 A;  2OYH C;  1YTZ T;  2R5B A;  1PIX A;  1JEK A;  5KLI C;  4WY4 B;  3AE9 C;  3RK3 D;  1T2K D;  1JCD A;  3SSU A;  2Y9Z A;  3CCQ P;  4D6T E;  1L4A C;  2ZVO B;  1T6A A;  1IFI A;  3AE4 C;  2AXT H;  1FZE A;  1NTM D;  2ZXX A;  5GTI E;  2H8P D;  3L75 D;  2FBW C;  2G8Y A;  3AEC C;  5KLV E;  2E43 A;  1K9M Q;  1VQ4 P;  2NVE A;  2FYU D;  2V7Q J;  2Q3E A;  1SQP G;  3NTN A;  1LT1 A;  1W2B O;  3T97 B;  2HML A;  3ABV C;  2GBX A;  1NTK E;  4DOJ A;  5KKZ B;  1ZRT E;  3USS A;  2QM7 A;  3H1J D;  3TGU D;  5KAF H;  1OX3 A;  3H6P A;  1BE3 E;  2WVR A;  1AQ5 A;  5KJ7 C;  2C9L Y;  2Q1K A;  2C9N Y;  3HE4 B;  4K3A A;  3MHV A;  2ITA A;  2LR2 A;  2HMM A;  1KB9 I;  3RL0 g;  2ZVN B;  2DE5 D;  1URQ B;  1NU1 E;  1K8A Q;  4XE5 B;  5GTH E;  4QUR A;  2ZYD A;  2JP3 A;  3GL2 A;  1SQB E;  3HD7 C;  4BRY A;  1FZA A;  3A0H E;  1S5L X;  2PAJ A;  1RF1 B;  1VQ9 P;  3D89 A;  3M9H A;  1LTS C;  3ITK A;  2IZ1 A;  5GTI H;  1M1K Q;  4EI2 A;  3BCC E;  3L4F A;  1KYO I;  3GG2 A;  2IYO A;  1BCC E;  1SQP K;  2E4Q A;  3LID A;  3CME P;  2WTY A;  2E75 C;  2WQY C;  1BGY E;  2OYI B;  2FXO A;  2KZI A;  5B5E E;  1L0L E;  2OTL P;  4JBZ A;  1O7G A;  3H1I J;  3CWB E;  3C8V A;  2O3J A;  3P8C E;  4KJM A;  4H0L C;  1RH5 B;  5AVT B;  2E4P A;  3O6Q B;  2AXC A;  1KIL E;  2M0B A;  1PGJ A;  2ZXE B;  2A45 I;  3C0D A;  2GA1 A;  5AEU A;  3AZC A;  3GTE A;  1PP9 E;  1HH0 A;  4HYT B;  1VQ8 P;  3L74 G;  2OAR A;  2JDI H;  4C7R A;  1YIJ P;  3CC7 P;  5AEW A;  2Y0C A;  1L2P A;  3CXH I;  2K1A A;  3GZY A;  4C7N A;  3TF5 A;  3CCM P;  3VMX A;  1X22 A;  1NGM B;  1IO4 A;  4NBF D;  4LGD E;  1GDT A;  2YMK A;  3L72 J;  1N7S C;  4Y28 J;  1EZV I;  2KYV A;  5K5G B;  3N7N A;  1QLE D;  5AW1 B;  3R2P A;  2H43 A;  3CX5 I;  4TLF A;  2W27 A;  4A7P A;  1SFC A;  3RK3 E;  4HM7 A;  1N73 C;  2R3C A;  1NOH A;  2RH0 A;  5TIS E;  3V4W A;  1KTM A;  4L75 A;  2R44 A;  2AEM A;  2N9B A;  2E42 A;  1EG9 A;  4QUQ A;  4HM5 A;  5AVQ B;  5B5E H;  2DE6 D;  4L76 A;  1RE4 C;  3B4S A;  4RKU J;  1CSB A;  1G8K B;  2JJL A;  1YBK A;  2BEQ D;  1M8O B;  2QM8 A;  3U1C A;  3A0B E;  3FXE A;  2YO3 A;  3WUU A;  1EDK A;  2IDB A;  3L70 J;  3H1K G;  3E7K A;  1EXI A;  2Z4E A;  2YFL A;  1SQX G;  2WSC H;  3TGU E;  1LTG C;  3OJA B;  1BSN A;  4NBG D;  1OW6 A;  1S72 P;  3NMD A;  2NPS B;  1FOS E;  3QH9 A;  1FZC A;  3HRN A;  1S2E A;  2O1K A;  4NBC D;  2AEF A;  1WT6 A;  1NTZ J;  4IOI H;  1FZF A;  1ZR4 A;  5TIS H;  1QL2 A;  1LTJ A;  4QCK A;  3AEF C;  2I8D A;  1CI6 A;  4QDF A;  2WSF J;  4U3F G;  3L71 D;  3PJS K;  3D6Z A;  2IYP A;  5CCH D;  3VP8 A;  1Y47 A;  5AW4 B;  2FFD A;  4N6J A;  1KZU B;  1M1J A;  2E76 B;  1P84 I;  4D6T J;  3GB4 A;  1AFO A;  4GOD A;  1T3U A;  2GUS A;  1CZQ A;  3BAT A;  4IL6 E;  1FU1 A;  3AED C;  3A0B H;  1S3J A;  1PFI A;  3CC2 P;  4JPZ B;  2GM4 A;  4BRY B;  1BCC G;  5AVX B;  2E74 C;  1HJB A;  3V4Q A;  5KLV J;  1M56 D;  1SQX K;  1JUN A;  3AEA C;  4PD4 E;  5APU A;  4UB6 E;  3BAS A;  3AEE C;  1NTK K;  5HL4 A;  2FXM A;  2YIU C;  1EZV G;  2V7Q H;  1VL2 A;  1Q81 Q;  1SQQ D;  2CKF A;  2IZ0 A;  3N0Q A;  4RO0 A;  1KD1 Q;  3H1I E;  3RK2 C;  1AA0 A;  2Q6Q A;  2NPS D;  3CLQ A;  1PGP A;  5CXM A;  1YYC A;  1BE3 J;  1NU1 K;  3VP9 A;  3GTS A;  1U57 A;  1NKZ B;  1RFS A;  2J58 A;  4RJT A;  3M06 A;  2JWD A;  3GW6 A;  1YIT P;  2QJY B;  1LNQ A;  2R5D A;  1MUU A;  3GOB A;  1Q2N A;  2D2C B;  1KB9 D;  4C7N B;  2AEJ A;  2POH A;  2QSI A;  3L72 E;  3HE5 A;  1SQB J;  4R4M A;  1K04 A;  5AVU B;  4C46 A;  2M3E A;  1FC2 C;  2XU6 A;  4IL6 H;  2C0W A;  2E76 D;  1VF5 B;  1JOC A;  1Q7Y Q;  2ZFC A;  1L0N G;  1VQK P;  1YJW P;  4PD4 H;  1SFC B;  4I1L A;  2O1J A;  4UB6 H;  1J1D B;  1J1E C;  1PGQ A;  1KYO D;  1JY3 O;  2BMQ A;  3G4S P;  1IK7 A;  1BGY J;  3KDP B;  5AVW B;  5CHX A;  3RL0 B;  1LP1 A;  1L0L J;  1O7M A;  3V2P A;  2W83 C;  3CWB J;  4IL6 X;  2N1T A;  3SWY A;  4HJL A;  3LW5 H;  1VQ6 P;  1WQL A;  2YFI A;  4NPE A;  3WUT A;  4LC1 A;  1RQU A;  2QG4 A;  1OZH A;  1H0T A;  2KNC A;  1VQ7 P;  3L73 J;  4NBB D;  4GOE A;  2OYO A;  2B1X A;  4U7J A;  3H1L G;  3B5N C;  5APY A;  1W5C E;  3CXH D;  3H1H J;  1IFM A;  1XTC C;  4NPF X;  2IPP A;  1ZME C;  1GL2 A;  3PRJ A;  3II6 A;  3L71 E;  3V6I A;  4GKG A;  1EZV D;  2Y9Y A;  1QX8 A;  1L0N K;  2IFN A;  2KSJ A;  1H88 A;  4PV1 D;  3MTU E;  3CX5 D;  3ZDM A;  1FZC B;  4ZKU A;  1VF5 D;  2A06 G;  3RK3 C;  1T2K C;  2Q3I A;  2IFM A;  4BXL A;  2P58 A;  3B71 A;  1LT9 A;  1KN7 A;  1JB0 J;  3UIA A;  1LTJ B;  1T3J A;  2FYZ A;  2N9Y B;  1NTM J;  2ZYG A;  5AVR B;  2HR3 A;  2LKM A;  3L75 J;  1H8A A;  2B89 A;  5BOK A;  2WPQ A;  1KQF B;  1CI6 B;  4QDF B;  1VDF A;  2PP6 A;  3DQY A;  3RL0 D;  3KQG A;  3EFG A;  2FYU J;  4RES B;  2FFD B;  1SQQ E;  1M90 Q;  2FYN C;  2BEZ F;  3VMY A;  1M1J B;  4DJG A;  4TT3 H;  1M7L A;  1VCK A;  4OGQ B;  3P7K A;  5L8R J;  4OVN F;  1H89 A;  2IBZ G;  2BCC D;  2ZAE B;  3H1J J;  3TGU J;  1ULJ A;  4WB4 A;  2HOD A;  2XV5 A;  2YNY A;  3H1I G;  3BRT B;  1TU3 F;  2CPS A;  1FQT A;  1OW7 A;  3I56 P;  4OWF A;  2K9Y A;  2RKL A;  1LTI C;  3SFE C;  1KB9 E;  1FZG A;  4M3L A;  1LWU C;  1VQP P;  1RE3 C;  3SFD C;  2W8Z A;  4O9B A;  1S5L H;  4NB8 D;  2YO2 A;  2L5G B;  5H2F E;  4EIJ A;  1FJP A;  2E75 B;  2WSF H;  5CCG A;  1JCC A;  1OW8 A;  3L72 G;  1KV4 A;  2WPS A;  3C9I A;  4XA4 A;  4H13 B;  3L37 A;  4NBD D;  4HH2 A;  1JY3 N;  3MIW A;  4H0L B;  3H1L D;  4JF7 A;  3A7O A;  1LTT C;  3VMZ A;  1RF0 A;  4WY4 D;  5AVS B;  2O01 J;  4PJ0 E;  3PH0 A;  1P84 D;  2MKV A;  2QIW A;  4ASV A;  3CCJ P;  4HM1 A;  3HE5 B;  2QRX A;  4H44 B;  4ZMD A;  4YXW H;  1FDI A;  3MUD A;  2KXP B;  2YXQ B;  1U7J A;  2XR8 A;  1AQT A;  4OGQ D;  3H32 A;  2WZ7 A;  2OTJ P;  4AQR D;  4HM2 A;  3AE3 C;  1FOS F;  3LW5 J;  3CPW O;  2QJP C;  4MN4 C;  1G2C A;  3CXH E;  1LP1 B;  2WT7 A;  2WPR A;  4HM6 A;  1YI2 P;  2N1T B;  5TJH A;  3TDK A;  3HTK A;  2XRX A;  3L70 G;  3L73 E;  1SQV G;  1AV1 A;  5H2F H;  1H0T B;  2KNC B;  1M57 D;  3IFM A;  5E79 E;  4WBA A;  1SP4 A;  3CX5 E;  1VQL P;  4EMJ B;  3H1H E;  1KIL A;  3I5C A;  3FXD A;  3KXD A;  1RF1 C;  5GTH H;  1AJY A;  3GLM A;  1URQ D;  3CCE P;  2KLU A;  2KB7 P;  4H13 D;  1VPC A;  3AEB C;  5APQ A;  3A0H H;  4H0L D;  1NTZ G;  2K3R A;  1DEB A;  1GL2 B;  1SQP D;  3GHG C;  5AW6 B;  4DZO A;  1O7N A;  2WWW A;  1Q86 Q;  5CBN A;  3BRV B;  4HJG H;  3EQQ A;  4HM4 A;  1PPJ G;  4H44 D;  2OYI C;  1DX7 A;  3GCE A;  3HUS C;  2K37 A;  4QDC A;  2Z5H A;  3MGN A;  2WMM A;  2P10 A;  2L91 A;  5BU5 A;  4DCK A;  3OA7 A;  1OIP A;  1NTM E;  2QE7 H;  2ZYL A;  1LT9 B;  3L75 E;  4D6T G;  2ZT9 B;  4NBA D;  1ZXG A;  2BCC E;  4N78 D;  2FYU E;  1HGZ A;  2HMN A;  4Y99 B;  3CCR P;  2Q5U A;  1SQV K;  5KLV G;  2KOG A;  3VOP A;  2OYH A;  2N1T D;  3M9Q A;  1IK9 A;  3VMH D;  5KAI E;  3AE6 C;  1HJ0 A;  1XTG B;  1MZ9 A;  1KQL A;  1HGV A;  1Q90 D;  3H1J E;  1VQ5 P;  1WMK A;  1L4A A;  2M3B A;  1K05 A;  1JO5 A;  3Q1M A;  1NTK G;  2C0X A;  1NTZ K;  2HOD B;  3L71 J;  1MFZ A;  3JCU E;  1Z56 A;  1OXZ A;  1YQ4 C;  4Z1M H;  1BE3 G;  3LIE A;  2B24 A;  2HPC A;  2E74 B;  1GL2 D;  2NWF A;  1KQS O;  1EQ7 A;  1VQN P;  1IZN B;  5APT A;  2M5A A;  1P84 E;  1NJI Q;  2YKO A;  1NU1 G;  1GW3 A;  2JO1 A;  3L74 D;  3TYY A;  5M1B A;  5APS A;  1SQB G;  1SQV D;  1X9V A;  1LWU A;  1S9K D;  2K88 A;  1ULI A;  3RK2 B;  2NVF A;  3QWO C;  2R32 A;  3FOU A;  3K5B A;  1RE3 A;  1G8J B;  2ZT9 D;  3NXS A;  1IFN A;  1QEX A;  1SQQ J;  5KJ7 A;  5KLV K;  1DD3 A;  3BCC G;  2YXR B;  5APW A;  3EWK A;  1NDO A;  1QL1 A;  1LTB C;  1JNM A;  4I2L C;  1GD2 E;  1RQV A;  3U1A A;  4XFJ A;  1BGY G;  4W7Z A;  3EFF K;  2NPS C;  2H89 C;  3AEG C;  1L0L G;  1FAV A;  3W67 A;  3CWB G;  3HD7 A;  1UUW A;  1PPJ D; 
#chains in the Genus database with same CATH homology
 1O7W A;  4NBC D;  2BMO A;  2YVJ B;  1NTZ E;  2GBW A;  3L73 E;  1RFS A;  2HMM A;  1Q90 C;  2DE5 D;  1L0N E;  3H1J E;  2QJY C;  4HM8 A;  5KKZ C;  1KB9 E;  1NU1 E;  1O7P A;  4QCK A;  3EN1 A;  3CX5 E;  1PPJ E;  3L71 E;  3GOB A;  3VCA A;  4QUR A;  2DE7 D;  4EMJ B;  4NB8 D;  3GL2 A;  4QDF A;  1SQB E;  3H1H E;  2JZA A;  3GZX A;  5KLI C;  4PV1 D;  3L72 E;  4HM7 A;  1VF5 D;  3D89 A;  2B24 A;  4H13 D;  1SQP E;  2E76 D;  2QPZ A;  2NWF A;  4D6T E;  4H0L D;  1EZV E;  4AAY B;  2NVG A;  4NBD D;  1EG9 A;  1O7H A;  2HMJ A;  3BCC E;  3GB4 A;  2D2C D;  3H1K E;  3L74 E;  4P1B H;  4QUQ A;  1UUV A;  4HM5 A;  1P84 E;  2DE6 D;  2QJK C;  2HMK A;  2NUM A;  1O7N A;  1BCC E;  1SQX E;  2IBZ E;  2E4Q A;  3VMG D;  5BOK A;  2E75 D;  2YFJ A;  3EQQ A;  4HM4 A;  2XSO A;  4QDF B;  2HMO A;  4H44 D;  3GCE A;  2E74 D;  1BGY E;  5KLV E;  3DQY A;  1VM9 A;  4HM1 A;  2BMQ A;  2JO6 A;  4QDC A;  1G8K B;  1JM1 A;  3VMI D;  1L0L E;  3H1L E;  1O7G A;  1ULI A;  3CWB E;  2NVF A;  2NVE A;  2Q3W A;  1NYK A;  1O7M A;  4PD4 E;  3FOU A;  1SQQ E;  1G8J B;  1RIE A;  2FYN C;  2ZT9 D;  2E4P A;  4P1C H;  4QUP A;  1NTM E;  4HJL A;  2XR8 A;  2ZYL A;  1WQL A;  5HL4 A;  3L75 E;  2YFI A;  2YIU C;  3L70 E;  2BMR A;  3C0D A;  4NBA D;  5AEU A;  3AZC A;  3GTE A;  1KYO E;  4OGQ D;  4NBH D;  2CKF A;  1PP9 E;  1SQV E;  4QDD A;  4NBF D;  2BCC E;  3N0Q A;  1VCK A;  2HML A;  2XSH A;  2YFL A;  2FYU E;  1NDO A;  2GBX A;  1NTK E;  4HM2 A;  4AIV A;  2NUK A;  3TGU E;  3H1I E;  5AEW A;  1SJG A;  4NBB D;  2HMN A;  3GKE A;  3GL0 A;  1ULJ A;  4NBE D;  2B1X A;  1ZRT E;  3GZY A;  4NBG D;  2QJP C;  4U3F E;  3CXH E;  4NB9 D;  3VCP A;  1BE3 E;  4HM6 A;  5CXM A;  4HKV A;  2A06 E;  1UUW A;  3VMH D;  1FQT A;  3GTS A;  4HM3 A;  4HM0 A;  2I7F A;  2XRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...