5KLVE

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 37
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 5klvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5klvE02
1SJGA 3GL2A 3VMHD 4HJLA 2NVGA 5KKZC 1L0NE 4QUQA 3CWBE 4PD4E 2IBZE 2A06E 1NDOA 1O7PA 4H0LD 4QURA 4NBDD 1L0LE 1NTME 2BCCE 1BCCE 1UUVA 3L75E 4NBBD 4HM8A 4P1CH 3L70E 2HMLA 4HM1A 1Q90C 2YFLA 2NUMA 4HM6A 1NU1E 2GBXA 1VCKA 1RFSA 4NB9D 2NWFA 2YFJA 2YVJB 1SQPE 3FOUA 4NB8D 1PPJE 2HMJA 1BE3E 2NVEA 3GKEA 1JM1A 2HMOA 4AIVA 2E76D 2QJPC 4QDCA 4NBFD 3L74E 2NVFA 2QJKC 1UUWA 4HM7A 2JO6A 2E4PA 4NBGD 1SQXE 1O7HA 1VM9A 4HM5A 1SQVE 1EG9A 1NTZE 2JZAA 4P1BH 2QPZA 2DE7D 1O7NA 3N0QA 1ULIA 2E75D 3GL0A 4QDFA 3CX5E 4PV1D 1SQQE 2FYNC 2D2CD 4H44D 2E74D 1O7WA 1P84E 1O7GA 3GTEA 2XR8A 5AEUA 4HM2A 4AAYB 2XRXA 3GTSA 1RIEA 2HMMA 4NBHD 3BCCE 3GCEA 2HMKA 2HMNA 4NBED 1WQLA 4QUPA 2NUKA 1NTKE 2GBWA 3H1HE 2YIUC 3GZYA 4QDFB 3GZXA 3H1LE 4U3FE 3VMID 1BGYE 4QDDA 1NYKA 5HL4A 4NBCD 2YFIA 5KLIC 2B1XA 2QJYC 1KB9E 2DE5D 3CXHE 3H1KE 3L73E 3DQYA 1O7MA 3GOBA 1PP9E 2FYUE 4HM3A 2ZYLA 4D6TE 4QCKA 3VCPA 3H1IE 3TGUE 2DE6D 2BMOA 3C0DA 1G8JB 3GB4A 4H13D 5KLVE 1ULJA 4EMJB 3EQQA 4HKVA 3EN1A 3H1JE 1KYOE 2I7FA 3AZCA 2BMQA 3D89A 2ZT9D 2BMRA 1VF5D 4HM4A 1EZVE 2XSHA 2B24A 5AEWA 3VCAA 2CKFA 3L72E 2Q3WA 5BOKA 3L71E 1G8KB 1FQTA 3VMGD 4NBAD 4OGQD 5CXMA 1SQBE 2XSOA 4HM0A 1ZRTE 2E4QA
chains in the Genus database with same CATH superfamily
2AEMA 1PPJD 3GG2A 2QJYB 1BSHA 3H1JG 4GKGA 2KOGA 2IYOA 2E76B 2IBZD 1EDJA 2QSIA 2JKVA 4AIVA 1MUUA 2N1TB 1OX3A 2FXMA 4JQ0D 3ABVC 3CWBG 2IBZG 4H44B 1T2KC 3L74D 3CPWO 1KYOH 2V7QH 3PLNA 3N0QA 1PZQA 1SQQE 3E1IA 3TSIA 1LNQA 1SQPG 1W5CE 2R3SA 3H1KD 3L74G 1P84D 3CCVP 1YTZI 3VP8A 2HMKA 2HMNA 2GBWA 3CXHI 2YKOA 4QDFB 2QJPB 1KYOD 1URQB 1AVYA 3PRJA 4H13B 1KB9E 2DE5D 3B8EB 1PGQA 3CMAP 5AVYB 1G8JB 3SWFA 3BCCJ 4LGDE 1QLED 2KS1B 2P7JA 1NTKG 3H1HJ 2OARA 3C8VA 1KB9I 1WT6A 1PFIA 2FY8A 1YBKA 3BATA 2O01J 5BOKA 3L73G 5C39A 1PP9J 4NPFX 3VMGD 1ZN5A 1PV3A 2XZRA 4C7RA 2ZYAA 4IFFA 5APYA 2W6AA 1OVVA 1NTME 2YMYA 1BCCE 2WVRA 1UUVA 3AE6C 3LW5H 4PJ0H 4HM6A 1JY3O 3CCLP 1RFSA 2WT7B 1S5LH 3N7NA 1J1DC 4NBGD 2JDIH 1K04A 2KZIA 3HE5B 1NU1G 2R3CA 1A02F 2OTJP 1YYCA 5AEUA 5KJ7D 1FZGA 1VQ5P 1S5LX 1SQXJ 1HJBA 1UIIA 2G8YA 2NZ2A 1QVGO 4DT0A 1KTMA 4H0LB 2ZVNB 2KLVA 1AVOA 2WSFJ 2AXTE 3H1IE 2CPSA 1RQUA 2DE6D 4K3AA 3L74J 4XE5B 1HGVA 2OGUA 1J1EC 4WY4A 3CX5H 2B24A 3U1AA 1RH5B 1A02J 1SQXK 3H1KJ 2Q3WA 3L71E 1S2EA 4I2LC 2JP3A 2AXTH 5KTBA 3TGUG 2JWAA 4HM0A 4IL6X 4KT0J 5KLIB 1OVRA 2N1TA 4PD4E 1KD1Q 2V7QJ 5APSA 3OW2O 2G3AA 1Y8AA 2KNCB 1X0TA 2XKMA 2LR2A 1JTHB 2ZFCA 2GBXA 3HUSB 3Q5SA 3A2AA 1K73Q 1VQ7P 2E75B 2NVFA 4PD4H 1VM9A 1JMMA 1RE3C 1SQVE 4HM5A 1NAYA 1QL1A 4AYCA 1H0TB 2ZYDA 1VF5C 1R8EA 4QDFA 3CC2P 1NVOA 4PV1D 2FYNC 3NTNA 2PAJA 3CCMP 3OAKA 4OGQC 2POHA 1OVUA 5CCGC 1VQMP 3GTSA 4EIJA 2KZJA 3H32A 1M1KQ 3HE4A 1VQ4P 2KS1A 1BDCA 3EQ2A 2IZ0A 4PV1C 3MUDC 3T97B 1O7MA 1L0LK 4BRYA 4O9BA 3VCPA 3V2RA 4N78D 4D6TD 5CCHA 2OYHC 4ZKUA 1S1CX 3AE4C 1MFZA 1IK7A 4GOFA 3Q1MA 1VL2A 3RGUA 1ZLLA 2AEFA 4D6TG 2HODB 3V2PA 2WT7A 5AW6B 2XNDH 1S9KE 2C9NY 2FXPA 1IFMA 4I6MC 4P1CH 3KXDA 2RN0A 2KXPB 3RK2B 3E7KA 1KORA 2KI7B 5AVWB 4HM7A 1O7HA 1L0NG 3EWKA 3AEGC 3G9RA 1RE4C 1NTZE 3VTPC 3HTKB 1KILB 1LTTC 2YO3A 3MZWB 3AE9C 1U7MA 1JY3N 3VN0A 1BSNA 4AUWA 2OQQA 1M8OB 5APXA 2ZXEB 4NBED 4TLFA 1RF1C 3HD7D 1BDDA 2M5AA 2E5TA 4LC1A 3KYQA 1D7MA 1VQLP 2K88A 4L75A 1DH3A 3GHGC 1M1JC 3NFQA 5E79E 2QIWA 1K05A 1LTJB 3EN1A 3BVHA 4C7NA 3AZCA 2A06D 1BGYG 2A45G 2ZT9D 1M7LA 1T3UA 4RKUJ 3CC7P 3VCAA 1CI6A 3QWOC 2QA4P 2E74C 2KNCA 1FQTA 1EDKA 1EZVD 4UB6E 2IPPA 4A7PA 3HUSA 3RL0D 2E4QA 4HJGH 1RY3A 3CCQP 2NVGA 2HG5D 1N7SD 3B5ND 3FWNA 2BEZF 1JY3P 5B66E 1EZVG 3L70E 1JY2O 2IZ1A 3I56P 4BXLA 4XA4A 2O01N 3RL0C 3GKEA 2JJLA 2E76D 1GL2B 1Z56A 2E4PA 2JO6A 2D2CB 3M0DC 4W7YA 2BCCJ 1LT1A 1N7SC 1USEA 2Z4EA 5CHXA 3C9IA 1QX8A 3SWYA 2KP8A 3KZIH 1N73C 1NHLA 4H44D 1IFPA 4U7JA 1O7GA 2WQYC 4HM2A 2P10A 1YJWP 3P8CD 2W6BA 5KAIH 1G2CA 3P32A 3BCCD 1IFIA 3GLMA 3H1LE 4U3FE 5AVSB 4OWFA 2OYIC 2OTKE 4CPGA 1YJ9P 3PP5A 3L72D 3U1CA 1M57D 1URQD 3SSUA 2HODA 4H13D 3A7OA 1ZRTD 2B89A 3BCCG 5AVXB 3PJSK 3H1JE 1QVFO 3S4RA 2BMQA 3D89A 1WMKA 2JWDA 1PP9G 1EDLA 4HH2A 5CXMA 1IO4A 2RMZA 3TF5A 3H25A 1IJDB 3L37A 1NO4A 2NPSB 3CWBE 2N9BA 2IBZE 3V4QA 1EXIA 2R44A 1LP1B 4HM1A 1E79H 1L4AC 1SQPE 2IBZI 1ZW0A 5AVVB 2FFDC 2C9LY 2YXRB 3L74E 2KB7P 1NGMB 1UUWA 4I7ZB 1IFDA 2WSCJ 3U59A 4WY4B 2KSJA 5AVQB 1SQXD 1SFCB 5CCGA 1EQ7A 3QH9A 1PGOA 1FE6A 4OVNF 3KHUA 3WU2E 1P84E 1U7JA 5AW3B 1BE3J 1PPJG 3C1LA 3RK3C 2XR8A 4Z1MH 1JM0A 1SQXG 3MUDA 3GCEA 1NTKE 3M0AA 2H88C 3FGAD 1YQ4C 3E1RA 2IYPA 1P84I 1LTJA 1ZV8A 1N7LA 2E5YA 2QJKB 4QMAA 1FJPA 1VQ8P 3CXHE 3L73E 2PGDA 3VP9A 1KYOI 5GTIE 3TDKA 4B86A 1PL5A 1GD2E 2QVAA 4EYYQ 5CMZA 3CCUP 4R4MA 3SWKA 1JUNA 1ZXGA 3A5TA 3CXHH 3H1KG 1Q2NA 1Q86Q 3H32B 5CBNA 3HE4B 1GL2A 4QUQA 3A0BE 1PGJA 2Q9IA 3W67A 1DEBA 1SLQA 3AECC 1L0LD 1LGHB 2HMLA 3IAOA 3L72J 1KB9H 1NU1E 2FYZA 4BRYB 1HJ0A 5K5GB 1OMIA 4NB9D 1RE4A 1SQBJ 1IFJA 2WITA 1L0LG 2I1KA 4GDOA 2KSEA 1FZBA 2E75D 1RQVA 1H8AA 2N9YB 1JY2N 3TNUB 1DIPA 3IR9A 2FBWC 5EFWB 2IFMA 4RJTA 2KYVA 2WPQA 3LIDA 4TT3H 1WQLA 5HL4A 1SQBK 4QDDA 5AW0B 1M1JA 3M9HA 4EDFA 2L91A 3DQYA 3TGUE 3V4WA 2O3JA 2OTLP 4GT1A 2NPSA 2WWWA 2M3EA 1NTMD 1YTZT 1BCCD 1Y9BA 4ASWA 1LP1A 5AW8B 1GTWA 2WSSH 2FYUJ 2PRRA 1LWUC 5KJ7C 2XSOA 3GL2A 1KV4A 4HJLA 3L36A 2M5AB 2W6JH 4C46A 1FC2C 3AEEC 5APWA 2ZYGA 5AVRB 1SFCA 3M0DA 1FZCC 1RF0A 3GF3A 3V6IA 4HYTB 3RK2D 1N73A 4C7NB 3BRVB 1NJIQ 2FYUK 3VMZA 1ULIA 2ZXXA 4DOJA 1CI6B 2V4HA 4IFDK 5KLVK 4YXWH 4YPCA 3CX5D 1ZMEC 1KQLA 1KILD 3H1ID 3KPEA 1GZLA 2LXCB 2OYIA 2WPSA 2I8DA 1L0LJ 2YIUC 2W8ZA 1R5SA 3MIWA 1NYKA 1J1DB 1SQQJ 3ZDMA 3Q5PA 4N78E 3TYYA 3GOBA 3MTUE 4D6TE 3L71D 2W27A 1SS1A 2M0BA 1ZOYC 1KILC 2IFNA 1GU4A 1JO5A 4PD4D 1OFCX 3KDPB 2WTYA 1JCCA 1HUCA 3G6EP 4N6JA 2E43A 2BEQD 1FU1A 3L71G 2HPCA 3M91A 2WPRA 1DD4A 3P8MC 3AEFC 3FX0A 3F89A 5KKZC 1L0NE 1FDIA 1G2CB 1SQQK 1NKZB 1L4AA 3S1KA 4OH8B 3M9BA 2FFDA 3MD0A 3LW5J 2BCCD 4LLHA 2NUMA 3L75D 1J1EB 3NMDA 3TNUA 1JNMA 3MHVA 1NTMJ 2Q3IA 3USSA 1BCCJ 2BCCG 1H88A 2ITAA 3L75G 1Q7YQ 2D2CD 1KZUB 5APUA 5AVZB 1LJ2A 3M9QA 1NOHA 4W80A 3VMAA 1G1IA 3GZXA 3PH0A 1BGYE 2WPVB 1HF9A 4GOEA 4NPEA 3G3ZA 1LTAC 5B5EE 1ZP0C 5AW5B 1NTMK 1HH0A 1WRGA 1VF5B 2K3RA 4WWIA 2FYNB 3BASA 2A45I 4EMJB 1GU5A 3FXEA 1S9KD 4OGQB 4YTPC 2WMMA 2H89C 3TK1A 1EZVE 3Q5RA 5B5EH 4Y99C 3V2NA 3R4YA 2Y0CA 3H1IJ 3CCJP 4QCKA 3G4SP 1SJGA 4PV1B 2XU6A 4IOIH 1EZVI 1NDOA 3HD7C 1O7PA 1X22A 4NBBD 1FZFA 3Q3DA 1LTGC 2E42A 3L71J 2QEXP 2OYHB 1E5WA 4DCKA 1KMIZ 3O8ZA 3FOUA 4MN4C 2IDBA 1QL2A 1BE3D 5E79H 2A06G 1XTGB 4GODA 1FDMA 2P58A 4P1BH 3NXSA 3OA7A 1LT9C 2ZT9C 3AE1C 4WY4D 3V2QA 5AVUB 4UB6H 3P8CE 3GTEA 1BE3G 1K9MQ 2OYOA 3RL0g 4NBHD 3BCCE 2SPZA 1LTIC 1FBMA 3H1HE 3B5NC 3D6ZA 3L75J 3CMEP 5B66H 4IFMA 3IF4A 2N1TD 2QJYC 1Q90D 1KFNA 2NRGA 1VQ6P 1PP9E 3I5CA 4HM3A 1YHQP 2E76C 1AQTA 4L73A 1ZR4A 3C0DA 1FZEA 1ULJA 2JR8A 3M06A 3EQQA 2HR3A 2AEJA 4HKZH 3A0HE 2JO1A 4YXDC 1LWUA 5KJ7A 2N1TC 2O01H 3D71A 4H44C 1SQVK 1RF1B 3L70D 4L74A 1NH4A 2K9JB 1H89A 2KIKA 1CSBA 1T6AA 3AE3C 1SQBD 5BVZA 1HGZA 3AE7C 2J5UA 3GHGB 1HVVA 4JPZB 1M1JB 2H7HA 3L70G 1FZCA 4HM8A 1X79B 1N86A 3L72G 2GUSA 3RK3E 2CPBA 1KN7A 5APQA 1PPJE 2HMJA 3RBZA 1SQBG 2P67A 2NVEA 2QJPC 2YNYA 1URQC 4H13C 1SQXE 2KUBA 3CI9A 2E74B 1XTCC 4UB8E 4M3LA 1HWTC 2YMKA 1VQKP 5CCHD 3H1LD 3VOPA 1VQOP 3AEDC 1OIPA 1RE3A 1HTLC 1NWQA 4AAYB 3VMXA 1LTBC 1NTZJ 4UB8H 3N4XA 2YKQA 3H1LG 1GK4A 5DJUB 2IX7C 3RL0B 3AE5C 2XV5A 3H1JD 3CLQA 2KK7A 1DEEG 1S4XA 3H1KE 4Y28J 1N7SB 2WSFH 1IFNA 3JSVC 3FXDA 1U57A 2FYUD 1N73B 4JYCA 2ZAEB 1T2KD 1FS0E 4HKVA 1KYOE 5KLVD 3CWBD 1MKMA 3R2PA 3Q2YA 1KC8Q 4HM4A 1AV1A 2Q5UA 3WMM0 3CD6P 1NTZK 3WU2H 1P84H 2KLUA 2FYUG 2OYHA 3BRTB 1SQPD 1TU3F 5H2FE 5KLVG 2OYIB 1MV8A 1NAFA 3MP7B 4H0LD 2QE7H 4NBDD 1L0LE 1VQPP 5GTHE 2O1JA 2W83C 2J59M 2YVJB 1QGKB 2Z5IA 2P1JA 4NB8D 3MGNA 2R5BA 5H2FH 5GTIH 1KFMA 3CL3D 4H0LC 2B87B 2C0XA 3CCRP 5GTHH 1NTKD 2HPCB 3L70J 1IC2A 1JOCA 5BU5A 3D6YA 3WUVA 3VMYA 1SQQD 3CXHD 3L73D 1RIEA 3CC4P 1W2EA 4QUPA 1L4AB 1Y47A 3A0BH 3CCEP 2PFXA 3O6QA 2FXOA 2FFDB 1SQQG 2YFIA 3IFMA 5KLIC 4PJ0E 1T3JA 1G1JA 2W90A 2WSEH 2ZYLA 1EXJA 1RF1A 1KB9D 1S5LE 3SFDC 2K9JA 3KQGA 2VRSA 5TISE 3HUSC 4NPDA 3GF7A 3RK3B 2Y9ZA 3H1LJ 4U3FJ 1M90Q 1RHZB 2LKMA 2E75C 1GK6A 1JCDA 3GHGA 2XSHA 2K9YA 2CKFA 3HD7A 1NU1D 4NBAD 3H6PA 3AE2C 3S9OA 2YXQB 5TISH 3H1JJ 3L4FA 1LTSC 1S3JA 2HYNA 3JC22 2YO2A 1KQSO 1W2BO 2QM8A 4I1LA 1VCKA 2NWFA 5KAFE 2Y9YA 1AJYA 2HMOA 4IL6E 4QDCA 5M1BA 1LT9A 3V5BA 3FWLA 5KLVJ 3CWBJ 2YKPA 1NTMG 4WB4A 1BCCG 1M56D 3EFGA 2QPZA 2GUVA 2GM4A 2AXCA 1JY2P 3CX5E 3WUUA 5KAFH 1FAVA 1SQPJ 1KILE 4IL6H 1JEKA 1AA0A 1N7SA 3B5NA 4K35A 5BU8B 4RESB 3TGUD 3CX5I 2NUKA 3GZYA 4HB1A 1YI2P 4EI2A 1Q81Q 2XDJA 1PGPA 2O1KA 3PHLA 2QM7A 1OXZA 5AW7B 4JBZA 1N8RQ 2HLOA 3RK2C 1AQ5A 1NTKJ 3JCUE 2P2UA 1SQPK 3IN6A 3AEBC 1VF5D 4DJGA 4R4LA 2H43A 2C0WA 3L73J 1JB0J 4PD4I 3F5HA 1R5LA 1EC5A 4OGQD 3H1IG 5CCGD 3VMHD 2B9BA 3JCUH 4WVZA 5APVA 2BCCE 3SFEC 3G71P 1IK9A 3L75E 2B87A 2B88A 3CCSP 2YFLA 1URQA 5AW2B 2K1AA 1NTKK 1SP4A 1KQGB 1MZ9A 4NBFD 2R5DA 4DZOA 5AVTB 5AW4B 1Q82Q 2JZAA 1EDIA 1LWUB 1SQVD 1J2JB 3I55P 1NU1J 4KJMA 1K8AQ 1SVFA 1NKNA 1LTJC 2WSEJ 3RBXA 3WUTA 3VYIA 3B71A 1CW5A 1OW8A 1SQVG 3AEAC 1YQ3C 2Q7CA 1FZCB 1IZNB 2ZVOB 4NBCD 1FOSE 1GL2D 2B1XA 1FJKA 1VPCA 2GA1A 3L35A 4ZMDA 2I1JA 3GB4A 4L76A 2H8PD 1VQNP 1NU1K 1AFOA 1L0ND 2I7FA 1GL2C 2UWJE 1YITP 5AEWA 2D2CC 1G8KB 3HE5A 2DW3A 2FKWB 2YIUB 3TGUJ 3LIEA 2Q1KA 3A3YB 1L2PA 2J58A 1OZHA 2A06E 4RO0A 4QURA 1N2DC 3ITKA 2XNXA 3EFFK 5CJ4A 5AW1B 1USDA 2A45H 1CZQA 1MFTA 2YFJA 1BE3E 1S72P 1JM1A 1ZR2A 2WSCH 1GMJA 5APTA 1NTZD 5CBOA 3GL0A 5KKZB 1BGYD 2NPSD 2E74D 1O7WA 1DD3A 3HRNA 2CK3H 2LXBA 2HFED 1QEXA 2HMMA 1NTZG 3VMID 2NPSC 1GW3A 3B4SA 5CJ0A 1YIJP 2QRXA 1JTHA 5DJTB 3OJAB 4EOTA 2JEEA 2QG4A 1SFCD 4JF7A 1SQVJ 4N3YB 3AE8C 3GW6A 2BMRA 1H0TA 2PP6A 4I7ZC 3KZIE 3L72E 4WY4C 2MKVA 1OWAA 4D6TJ 4KHXA 1SQBE 1ZRTE 1SFCC 2Q6QA 4AQRD 1KQFB 3O6QB 5KAIE 2M8RA 1RF0C 3K5BA 4ZKPA 1FOSF 2Z5HA 1JMBA 1Q90C 3T97A 2K37A 2ZJSE 2BASA 1VDFA 3II6A 1PIXA 1OW6A 1T8ZA 2QJKC 1L0NJ 1EG9A 2RKLA 5TJHA 3A0HH 4Y99B 3GMAA 2R32A 4BWNA 1DX7A 1O7NA 2DE7D 1FZAA 2L5GB 2Q3EA 3H1HD 2Y0EA 4ASVA 1HBWA 4W7ZA 2WZ7A 2Y0DA 1X9VA 1UIXA 3HD7B 1NYHA 2XRXA 5L8RJ 1PP9D 1FDOA 4XFJA 3H1HG 4ZNCA 1X8YA 1OW7A 2M3BA 3P7KA 2MJZA 4WBAA 4U3FD 1L0NK 1L4AD 2FYUE 1LT9B 2ZT9B 2BMOA 3UIAA 5KLVE 3W68A 3D70A 4JYBA 3PTZA 4U3FG 1BGYJ 3HTKA 5CCHC 1KILA 1GDTA 5AW9B 4GIFA 2RH0A 1VQ9P 3B5NB 1GW4A 3RK3D 1YJNP
chains in the Genus database with same CATH topology
1SJGA 3GL2A 3VMHD 4HJLA 2NVGA 5KKZC 1L0NE 4QUQA 3CWBE 4PD4E 2IBZE 2A06E 1NDOA 1O7PA 4H0LD 4QURA 4NBDD 1L0LE 1NTME 2BCCE 1BCCE 1UUVA 3L75E 4NBBD 4HM8A 4P1CH 3L70E 2HMLA 4HM1A 1Q90C 2YFLA 2NUMA 4HM6A 1NU1E 2GBXA 1VCKA 1RFSA 4NB9D 2NWFA 2YFJA 2YVJB 1SQPE 3FOUA 4NB8D 1PPJE 2HMJA 1BE3E 2NVEA 3GKEA 1JM1A 2HMOA 4AIVA 2E76D 2QJPC 4QDCA 4NBFD 3L74E 2NVFA 2QJKC 1UUWA 4HM7A 2JO6A 2E4PA 4NBGD 1SQXE 1O7HA 1VM9A 4HM5A 1SQVE 1EG9A 1NTZE 2JZAA 4P1BH 2QPZA 2DE7D 1O7NA 3N0QA 1ULIA 2E75D 3GL0A 4QDFA 3CX5E 4PV1D 1SQQE 2FYNC 2D2CD 4H44D 2E74D 1O7WA 1P84E 1O7GA 3GTEA 2XR8A 5AEUA 4HM2A 4AAYB 2XRXA 3GTSA 1RIEA 2HMMA 4NBHD 3BCCE 3GCEA 2HMKA 2HMNA 4NBED 1WQLA 4QUPA 2NUKA 1NTKE 2GBWA 3H1HE 2YIUC 3GZYA 4QDFB 3GZXA 3H1LE 4U3FE 3VMID 1BGYE 4QDDA 1NYKA 5HL4A 4NBCD 2YFIA 5KLIC 2B1XA 2QJYC 1KB9E 2DE5D 3CXHE 3H1KE 3L73E 3DQYA 1O7MA 3GOBA 1PP9E 2FYUE 4HM3A 2ZYLA 4D6TE 4QCKA 3VCPA 3H1IE 3TGUE 2DE6D 2BMOA 3C0DA 1G8JB 3GB4A 4H13D 5KLVE 1ULJA 4EMJB 3EQQA 4HKVA 3EN1A 3H1JE 1KYOE 2I7FA 3AZCA 2BMQA 3D89A 2ZT9D 2BMRA 1VF5D 4HM4A 1EZVE 2XSHA 2B24A 5AEWA 3VCAA 2CKFA 3L72E 2Q3WA 5BOKA 3L71E 1G8KB 1FQTA 3VMGD 4NBAD 4OGQD 5CXMA 1SQBE 2XSOA 4HM0A 1ZRTE 2E4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJG A;  3GL2 A;  3VMH D;  4HJL A;  2NVG A;  5KKZ C;  1L0N E;  4QUQ A;  3CWB E;  4PD4 E;  2IBZ E;  2A06 E;  1NDO A;  1O7P A;  4H0L D;  4QUR A;  4NBD D;  1L0L E;  1NTM E;  2BCC E;  1BCC E;  1UUV A;  3L75 E;  4NBB D;  4HM8 A;  4P1C H;  3L70 E;  2HML A;  4HM1 A;  1Q90 C;  2YFL A;  2NUM A;  4HM6 A;  1NU1 E;  2GBX A;  1VCK A;  1RFS A;  4NB9 D;  2NWF A;  2YFJ A;  2YVJ B;  1SQP E;  3FOU A;  4NB8 D;  1PPJ E;  2HMJ A;  1BE3 E;  2NVE A;  3GKE A;  1JM1 A;  2HMO A;  4AIV A;  2E76 D;  2QJP C;  4QDC A;  4NBF D;  3L74 E;  2NVF A;  2QJK C;  1UUW A;  4HM7 A;  2JO6 A;  2E4P A;  4NBG D;  1SQX E;  1O7H A;  1VM9 A;  4HM5 A;  1SQV E;  1EG9 A;  1NTZ E;  2JZA A;  4P1B H;  2QPZ A;  2DE7 D;  1O7N A;  3N0Q A;  1ULI A;  2E75 D;  3GL0 A;  4QDF A;  3CX5 E;  4PV1 D;  1SQQ E;  2FYN C;  2D2C D;  4H44 D;  2E74 D;  1O7W A;  1P84 E;  1O7G A;  3GTE A;  2XR8 A;  5AEU A;  4HM2 A;  4AAY B;  2XRX A;  3GTS A;  1RIE A;  2HMM A;  4NBH D;  3BCC E;  3GCE A;  2HMK A;  2HMN A;  4NBE D;  1WQL A;  4QUP A;  2NUK A;  1NTK E;  2GBW A;  3H1H E;  2YIU C;  3GZY A;  4QDF B;  3GZX A;  3H1L E;  4U3F E;  3VMI D;  1BGY E;  4QDD A;  1NYK A;  5HL4 A;  4NBC D;  2YFI A;  5KLI C;  2B1X A;  2QJY C;  1KB9 E;  2DE5 D;  3CXH E;  3H1K E;  3L73 E;  3DQY A;  1O7M A;  3GOB A;  1PP9 E;  2FYU E;  4HM3 A;  2ZYL A;  4D6T E;  4QCK A;  3VCP A;  3H1I E;  3TGU E;  2DE6 D;  2BMO A;  3C0D A;  1G8J B;  3GB4 A;  4H13 D;  5KLV E;  1ULJ A;  4EMJ B;  3EQQ A;  4HKV A;  3EN1 A;  3H1J E;  1KYO E;  2I7F A;  3AZC A;  2BMQ A;  3D89 A;  2ZT9 D;  2BMR A;  1VF5 D;  4HM4 A;  1EZV E;  2XSH A;  2B24 A;  5AEW A;  3VCA A;  2CKF A;  3L72 E;  2Q3W A;  5BOK A;  3L71 E;  1G8K B;  1FQT A;  3VMG D;  4NBA D;  4OGQ D;  5CXM A;  1SQB E;  2XSO A;  4HM0 A;  1ZRT E;  2E4Q A; 
#chains in the Genus database with same CATH topology
 2AEM A;  1PPJ D;  3GG2 A;  2QJY B;  1BSH A;  3H1J G;  4GKG A;  2KOG A;  2IYO A;  2E76 B;  2IBZ D;  1EDJ A;  2QSI A;  2JKV A;  4AIV A;  1MUU A;  2N1T B;  1OX3 A;  2FXM A;  4JQ0 D;  3ABV C;  3CWB G;  2IBZ G;  4H44 B;  1T2K C;  3L74 D;  3CPW O;  1KYO H;  2V7Q H;  3PLN A;  3N0Q A;  1PZQ A;  1SQQ E;  3E1I A;  3TSI A;  1LNQ A;  1SQP G;  1W5C E;  2R3S A;  3H1K D;  3L74 G;  1P84 D;  3CCV P;  1YTZ I;  3VP8 A;  2HMK A;  2HMN A;  2GBW A;  3CXH I;  2YKO A;  4QDF B;  2QJP B;  1KYO D;  1URQ B;  1AVY A;  3PRJ A;  4H13 B;  1KB9 E;  2DE5 D;  3B8E B;  1PGQ A;  3CMA P;  5AVY B;  1G8J B;  3SWF A;  3BCC J;  4LGD E;  1QLE D;  2KS1 B;  2P7J A;  1NTK G;  3H1H J;  2OAR A;  3C8V A;  1KB9 I;  1WT6 A;  1PFI A;  2FY8 A;  1YBK A;  3BAT A;  2O01 J;  5BOK A;  3L73 G;  5C39 A;  1PP9 J;  4NPF X;  3VMG D;  1ZN5 A;  1PV3 A;  2XZR A;  4C7R A;  2ZYA A;  4IFF A;  5APY A;  2W6A A;  1OVV A;  1NTM E;  2YMY A;  1BCC E;  2WVR A;  1UUV A;  3AE6 C;  3LW5 H;  4PJ0 H;  4HM6 A;  1JY3 O;  3CCL P;  1RFS A;  2WT7 B;  1S5L H;  3N7N A;  1J1D C;  4NBG D;  2JDI H;  1K04 A;  2KZI A;  3HE5 B;  1NU1 G;  2R3C A;  1A02 F;  2OTJ P;  1YYC A;  5AEU A;  5KJ7 D;  1FZG A;  1VQ5 P;  1S5L X;  1SQX J;  1HJB A;  1UII A;  2G8Y A;  2NZ2 A;  1QVG O;  4DT0 A;  1KTM A;  4H0L B;  2ZVN B;  2KLV A;  1AVO A;  2WSF J;  2AXT E;  3H1I E;  2CPS A;  1RQU A;  2DE6 D;  4K3A A;  3L74 J;  4XE5 B;  1HGV A;  2OGU A;  1J1E C;  4WY4 A;  3CX5 H;  2B24 A;  3U1A A;  1RH5 B;  1A02 J;  1SQX K;  3H1K J;  2Q3W A;  3L71 E;  1S2E A;  4I2L C;  2JP3 A;  2AXT H;  5KTB A;  3TGU G;  2JWA A;  4HM0 A;  4IL6 X;  4KT0 J;  5KLI B;  1OVR A;  2N1T A;  4PD4 E;  1KD1 Q;  2V7Q J;  5APS A;  3OW2 O;  2G3A A;  1Y8A A;  2KNC B;  1X0T A;  2XKM A;  2LR2 A;  1JTH B;  2ZFC A;  2GBX A;  3HUS B;  3Q5S A;  3A2A A;  1K73 Q;  1VQ7 P;  2E75 B;  2NVF A;  4PD4 H;  1VM9 A;  1JMM A;  1RE3 C;  1SQV E;  4HM5 A;  1NAY A;  1QL1 A;  4AYC A;  1H0T B;  2ZYD A;  1VF5 C;  1R8E A;  4QDF A;  3CC2 P;  1NVO A;  4PV1 D;  2FYN C;  3NTN A;  2PAJ A;  3CCM P;  3OAK A;  4OGQ C;  2POH A;  1OVU A;  5CCG C;  1VQM P;  3GTS A;  4EIJ A;  2KZJ A;  3H32 A;  1M1K Q;  3HE4 A;  1VQ4 P;  2KS1 A;  1BDC A;  3EQ2 A;  2IZ0 A;  4PV1 C;  3MUD C;  3T97 B;  1O7M A;  1L0L K;  4BRY A;  4O9B A;  3VCP A;  3V2R A;  4N78 D;  4D6T D;  5CCH A;  2OYH C;  4ZKU A;  1S1C X;  3AE4 C;  1MFZ A;  1IK7 A;  4GOF A;  3Q1M A;  1VL2 A;  3RGU A;  1ZLL A;  2AEF A;  4D6T G;  2HOD B;  3V2P A;  2WT7 A;  5AW6 B;  2XND H;  1S9K E;  2C9N Y;  2FXP A;  1IFM A;  4I6M C;  4P1C H;  3KXD A;  2RN0 A;  2KXP B;  3RK2 B;  3E7K A;  1KOR A;  2KI7 B;  5AVW B;  4HM7 A;  1O7H A;  1L0N G;  3EWK A;  3AEG C;  3G9R A;  1RE4 C;  1NTZ E;  3VTP C;  3HTK B;  1KIL B;  1LTT C;  2YO3 A;  3MZW B;  3AE9 C;  1U7M A;  1JY3 N;  3VN0 A;  1BSN A;  4AUW A;  2OQQ A;  1M8O B;  5APX A;  2ZXE B;  4NBE D;  4TLF A;  1RF1 C;  3HD7 D;  1BDD A;  2M5A A;  2E5T A;  4LC1 A;  3KYQ A;  1D7M A;  1VQL P;  2K88 A;  4L75 A;  1DH3 A;  3GHG C;  1M1J C;  3NFQ A;  5E79 E;  2QIW A;  1K05 A;  1LTJ B;  3EN1 A;  3BVH A;  4C7N A;  3AZC A;  2A06 D;  1BGY G;  2A45 G;  2ZT9 D;  1M7L A;  1T3U A;  4RKU J;  3CC7 P;  3VCA A;  1CI6 A;  3QWO C;  2QA4 P;  2E74 C;  2KNC A;  1FQT A;  1EDK A;  1EZV D;  4UB6 E;  2IPP A;  4A7P A;  3HUS A;  3RL0 D;  2E4Q A;  4HJG H;  1RY3 A;  3CCQ P;  2NVG A;  2HG5 D;  1N7S D;  3B5N D;  3FWN A;  2BEZ F;  1JY3 P;  5B66 E;  1EZV G;  3L70 E;  1JY2 O;  2IZ1 A;  3I56 P;  4BXL A;  4XA4 A;  2O01 N;  3RL0 C;  3GKE A;  2JJL A;  2E76 D;  1GL2 B;  1Z56 A;  2E4P A;  2JO6 A;  2D2C B;  3M0D C;  4W7Y A;  2BCC J;  1LT1 A;  1N7S C;  1USE A;  2Z4E A;  5CHX A;  3C9I A;  1QX8 A;  3SWY A;  2KP8 A;  3KZI H;  1N73 C;  1NHL A;  4H44 D;  1IFP A;  4U7J A;  1O7G A;  2WQY C;  4HM2 A;  2P10 A;  1YJW P;  3P8C D;  2W6B A;  5KAI H;  1G2C A;  3P32 A;  3BCC D;  1IFI A;  3GLM A;  3H1L E;  4U3F E;  5AVS B;  4OWF A;  2OYI C;  2OTK E;  4CPG A;  1YJ9 P;  3PP5 A;  3L72 D;  3U1C A;  1M57 D;  1URQ D;  3SSU A;  2HOD A;  4H13 D;  3A7O A;  1ZRT D;  2B89 A;  3BCC G;  5AVX B;  3PJS K;  3H1J E;  1QVF O;  3S4R A;  2BMQ A;  3D89 A;  1WMK A;  2JWD A;  1PP9 G;  1EDL A;  4HH2 A;  5CXM A;  1IO4 A;  2RMZ A;  3TF5 A;  3H25 A;  1IJD B;  3L37 A;  1NO4 A;  2NPS B;  3CWB E;  2N9B A;  2IBZ E;  3V4Q A;  1EXI A;  2R44 A;  1LP1 B;  4HM1 A;  1E79 H;  1L4A C;  1SQP E;  2IBZ I;  1ZW0 A;  5AVV B;  2FFD C;  2C9L Y;  2YXR B;  3L74 E;  2KB7 P;  1NGM B;  1UUW A;  4I7Z B;  1IFD A;  2WSC J;  3U59 A;  4WY4 B;  2KSJ A;  5AVQ B;  1SQX D;  1SFC B;  5CCG A;  1EQ7 A;  3QH9 A;  1PGO A;  1FE6 A;  4OVN F;  3KHU A;  3WU2 E;  1P84 E;  1U7J A;  5AW3 B;  1BE3 J;  1PPJ G;  3C1L A;  3RK3 C;  2XR8 A;  4Z1M H;  1JM0 A;  1SQX G;  3MUD A;  3GCE A;  1NTK E;  3M0A A;  2H88 C;  3FGA D;  1YQ4 C;  3E1R A;  2IYP A;  1P84 I;  1LTJ A;  1ZV8 A;  1N7L A;  2E5Y A;  2QJK B;  4QMA A;  1FJP A;  1VQ8 P;  3CXH E;  3L73 E;  2PGD A;  3VP9 A;  1KYO I;  5GTI E;  3TDK A;  4B86 A;  1PL5 A;  1GD2 E;  2QVA A;  4EYY Q;  5CMZ A;  3CCU P;  4R4M A;  3SWK A;  1JUN A;  1ZXG A;  3A5T A;  3CXH H;  3H1K G;  1Q2N A;  1Q86 Q;  3H32 B;  5CBN A;  3HE4 B;  1GL2 A;  4QUQ A;  3A0B E;  1PGJ A;  2Q9I A;  3W67 A;  1DEB A;  1SLQ A;  3AEC C;  1L0L D;  1LGH B;  2HML A;  3IAO A;  3L72 J;  1KB9 H;  1NU1 E;  2FYZ A;  4BRY B;  1HJ0 A;  5K5G B;  1OMI A;  4NB9 D;  1RE4 A;  1SQB J;  1IFJ A;  2WIT A;  1L0L G;  2I1K A;  4GDO A;  2KSE A;  1FZB A;  2E75 D;  1RQV A;  1H8A A;  2N9Y B;  1JY2 N;  3TNU B;  1DIP A;  3IR9 A;  2FBW C;  5EFW B;  2IFM A;  4RJT A;  2KYV A;  2WPQ A;  3LID A;  4TT3 H;  1WQL A;  5HL4 A;  1SQB K;  4QDD A;  5AW0 B;  1M1J A;  3M9H A;  4EDF A;  2L91 A;  3DQY A;  3TGU E;  3V4W A;  2O3J A;  2OTL P;  4GT1 A;  2NPS A;  2WWW A;  2M3E A;  1NTM D;  1YTZ T;  1BCC D;  1Y9B A;  4ASW A;  1LP1 A;  5AW8 B;  1GTW A;  2WSS H;  2FYU J;  2PRR A;  1LWU C;  5KJ7 C;  2XSO A;  3GL2 A;  1KV4 A;  4HJL A;  3L36 A;  2M5A B;  2W6J H;  4C46 A;  1FC2 C;  3AEE C;  5APW A;  2ZYG A;  5AVR B;  1SFC A;  3M0D A;  1FZC C;  1RF0 A;  3GF3 A;  3V6I A;  4HYT B;  3RK2 D;  1N73 A;  4C7N B;  3BRV B;  1NJI Q;  2FYU K;  3VMZ A;  1ULI A;  2ZXX A;  4DOJ A;  1CI6 B;  2V4H A;  4IFD K;  5KLV K;  4YXW H;  4YPC A;  3CX5 D;  1ZME C;  1KQL A;  1KIL D;  3H1I D;  3KPE A;  1GZL A;  2LXC B;  2OYI A;  2WPS A;  2I8D A;  1L0L J;  2YIU C;  2W8Z A;  1R5S A;  3MIW A;  1NYK A;  1J1D B;  1SQQ J;  3ZDM A;  3Q5P A;  4N78 E;  3TYY A;  3GOB A;  3MTU E;  4D6T E;  3L71 D;  2W27 A;  1SS1 A;  2M0B A;  1ZOY C;  1KIL C;  2IFN A;  1GU4 A;  1JO5 A;  4PD4 D;  1OFC X;  3KDP B;  2WTY A;  1JCC A;  1HUC A;  3G6E P;  4N6J A;  2E43 A;  2BEQ D;  1FU1 A;  3L71 G;  2HPC A;  3M91 A;  2WPR A;  1DD4 A;  3P8M C;  3AEF C;  3FX0 A;  3F89 A;  5KKZ C;  1L0N E;  1FDI A;  1G2C B;  1SQQ K;  1NKZ B;  1L4A A;  3S1K A;  4OH8 B;  3M9B A;  2FFD A;  3MD0 A;  3LW5 J;  2BCC D;  4LLH A;  2NUM A;  3L75 D;  1J1E B;  3NMD A;  3TNU A;  1JNM A;  3MHV A;  1NTM J;  2Q3I A;  3USS A;  1BCC J;  2BCC G;  1H88 A;  2ITA A;  3L75 G;  1Q7Y Q;  2D2C D;  1KZU B;  5APU A;  5AVZ B;  1LJ2 A;  3M9Q A;  1NOH A;  4W80 A;  3VMA A;  1G1I A;  3GZX A;  3PH0 A;  1BGY E;  2WPV B;  1HF9 A;  4GOE A;  4NPE A;  3G3Z A;  1LTA C;  5B5E E;  1ZP0 C;  5AW5 B;  1NTM K;  1HH0 A;  1WRG A;  1VF5 B;  2K3R A;  4WWI A;  2FYN B;  3BAS A;  2A45 I;  4EMJ B;  1GU5 A;  3FXE A;  1S9K D;  4OGQ B;  4YTP C;  2WMM A;  2H89 C;  3TK1 A;  1EZV E;  3Q5R A;  5B5E H;  4Y99 C;  3V2N A;  3R4Y A;  2Y0C A;  3H1I J;  3CCJ P;  4QCK A;  3G4S P;  1SJG A;  4PV1 B;  2XU6 A;  4IOI H;  1EZV I;  1NDO A;  3HD7 C;  1O7P A;  1X22 A;  4NBB D;  1FZF A;  3Q3D A;  1LTG C;  2E42 A;  3L71 J;  2QEX P;  2OYH B;  1E5W A;  4DCK A;  1KMI Z;  3O8Z A;  3FOU A;  4MN4 C;  2IDB A;  1QL2 A;  1BE3 D;  5E79 H;  2A06 G;  1XTG B;  4GOD A;  1FDM A;  2P58 A;  4P1B H;  3NXS A;  3OA7 A;  1LT9 C;  2ZT9 C;  3AE1 C;  4WY4 D;  3V2Q A;  5AVU B;  4UB6 H;  3P8C E;  3GTE A;  1BE3 G;  1K9M Q;  2OYO A;  3RL0 g;  4NBH D;  3BCC E;  2SPZ A;  1LTI C;  1FBM A;  3H1H E;  3B5N C;  3D6Z A;  3L75 J;  3CME P;  5B66 H;  4IFM A;  3IF4 A;  2N1T D;  2QJY C;  1Q90 D;  1KFN A;  2NRG A;  1VQ6 P;  1PP9 E;  3I5C A;  4HM3 A;  1YHQ P;  2E76 C;  1AQT A;  4L73 A;  1ZR4 A;  3C0D A;  1FZE A;  1ULJ A;  2JR8 A;  3M06 A;  3EQQ A;  2HR3 A;  2AEJ A;  4HKZ H;  3A0H E;  2JO1 A;  4YXD C;  1LWU A;  5KJ7 A;  2N1T C;  2O01 H;  3D71 A;  4H44 C;  1SQV K;  1RF1 B;  3L70 D;  4L74 A;  1NH4 A;  2K9J B;  1H89 A;  2KIK A;  1CSB A;  1T6A A;  3AE3 C;  1SQB D;  5BVZ A;  1HGZ A;  3AE7 C;  2J5U A;  3GHG B;  1HVV A;  4JPZ B;  1M1J B;  2H7H A;  3L70 G;  1FZC A;  4HM8 A;  1X79 B;  1N86 A;  3L72 G;  2GUS A;  3RK3 E;  2CPB A;  1KN7 A;  5APQ A;  1PPJ E;  2HMJ A;  3RBZ A;  1SQB G;  2P67 A;  2NVE A;  2QJP C;  2YNY A;  1URQ C;  4H13 C;  1SQX E;  2KUB A;  3CI9 A;  2E74 B;  1XTC C;  4UB8 E;  4M3L A;  1HWT C;  2YMK A;  1VQK P;  5CCH D;  3H1L D;  3VOP A;  1VQO P;  3AED C;  1OIP A;  1RE3 A;  1HTL C;  1NWQ A;  4AAY B;  3VMX A;  1LTB C;  1NTZ J;  4UB8 H;  3N4X A;  2YKQ A;  3H1L G;  1GK4 A;  5DJU B;  2IX7 C;  3RL0 B;  3AE5 C;  2XV5 A;  3H1J D;  3CLQ A;  2KK7 A;  1DEE G;  1S4X A;  3H1K E;  4Y28 J;  1N7S B;  2WSF H;  1IFN A;  3JSV C;  3FXD A;  1U57 A;  2FYU D;  1N73 B;  4JYC A;  2ZAE B;  1T2K D;  1FS0 E;  4HKV A;  1KYO E;  5KLV D;  3CWB D;  1MKM A;  3R2P A;  3Q2Y A;  1KC8 Q;  4HM4 A;  1AV1 A;  2Q5U A;  3WMM 0;  3CD6 P;  1NTZ K;  3WU2 H;  1P84 H;  2KLU A;  2FYU G;  2OYH A;  3BRT B;  1SQP D;  1TU3 F;  5H2F E;  5KLV G;  2OYI B;  1MV8 A;  1NAF A;  3MP7 B;  4H0L D;  2QE7 H;  4NBD D;  1L0L E;  1VQP P;  5GTH E;  2O1J A;  2W83 C;  2J59 M;  2YVJ B;  1QGK B;  2Z5I A;  2P1J A;  4NB8 D;  3MGN A;  2R5B A;  5H2F H;  5GTI H;  1KFM A;  3CL3 D;  4H0L C;  2B87 B;  2C0X A;  3CCR P;  5GTH H;  1NTK D;  2HPC B;  3L70 J;  1IC2 A;  1JOC A;  5BU5 A;  3D6Y A;  3WUV A;  3VMY A;  1SQQ D;  3CXH D;  3L73 D;  1RIE A;  3CC4 P;  1W2E A;  4QUP A;  1L4A B;  1Y47 A;  3A0B H;  3CCE P;  2PFX A;  3O6Q A;  2FXO A;  2FFD B;  1SQQ G;  2YFI A;  3IFM A;  5KLI C;  4PJ0 E;  1T3J A;  1G1J A;  2W90 A;  2WSE H;  2ZYL A;  1EXJ A;  1RF1 A;  1KB9 D;  1S5L E;  3SFD C;  2K9J A;  3KQG A;  2VRS A;  5TIS E;  3HUS C;  4NPD A;  3GF7 A;  3RK3 B;  2Y9Z A;  3H1L J;  4U3F J;  1M90 Q;  1RHZ B;  2LKM A;  2E75 C;  1GK6 A;  1JCD A;  3GHG A;  2XSH A;  2K9Y A;  2CKF A;  3HD7 A;  1NU1 D;  4NBA D;  3H6P A;  3AE2 C;  3S9O A;  2YXQ B;  5TIS H;  3H1J J;  3L4F A;  1LTS C;  1S3J A;  2HYN A;  3JC2 2;  2YO2 A;  1KQS O;  1W2B O;  2QM8 A;  4I1L A;  1VCK A;  2NWF A;  5KAF E;  2Y9Y A;  1AJY A;  2HMO A;  4IL6 E;  4QDC A;  5M1B A;  1LT9 A;  3V5B A;  3FWL A;  5KLV J;  3CWB J;  2YKP A;  1NTM G;  4WB4 A;  1BCC G;  1M56 D;  3EFG A;  2QPZ A;  2GUV A;  2GM4 A;  2AXC A;  1JY2 P;  3CX5 E;  3WUU A;  5KAF H;  1FAV A;  1SQP J;  1KIL E;  4IL6 H;  1JEK A;  1AA0 A;  1N7S A;  3B5N A;  4K35 A;  5BU8 B;  4RES B;  3TGU D;  3CX5 I;  2NUK A;  3GZY A;  4HB1 A;  1YI2 P;  4EI2 A;  1Q81 Q;  2XDJ A;  1PGP A;  2O1K A;  3PHL A;  2QM7 A;  1OXZ A;  5AW7 B;  4JBZ A;  1N8R Q;  2HLO A;  3RK2 C;  1AQ5 A;  1NTK J;  3JCU E;  2P2U A;  1SQP K;  3IN6 A;  3AEB C;  1VF5 D;  4DJG A;  4R4L A;  2H43 A;  2C0W A;  3L73 J;  1JB0 J;  4PD4 I;  3F5H A;  1R5L A;  1EC5 A;  4OGQ D;  3H1I G;  5CCG D;  3VMH D;  2B9B A;  3JCU H;  4WVZ A;  5APV A;  2BCC E;  3SFE C;  3G71 P;  1IK9 A;  3L75 E;  2B87 A;  2B88 A;  3CCS P;  2YFL A;  1URQ A;  5AW2 B;  2K1A A;  1NTK K;  1SP4 A;  1KQG B;  1MZ9 A;  4NBF D;  2R5D A;  4DZO A;  5AVT B;  5AW4 B;  1Q82 Q;  2JZA A;  1EDI A;  1LWU B;  1SQV D;  1J2J B;  3I55 P;  1NU1 J;  4KJM A;  1K8A Q;  1SVF A;  1NKN A;  1LTJ C;  2WSE J;  3RBX A;  3WUT A;  3VYI A;  3B71 A;  1CW5 A;  1OW8 A;  1SQV G;  3AEA C;  1YQ3 C;  2Q7C A;  1FZC B;  1IZN B;  2ZVO B;  4NBC D;  1FOS E;  1GL2 D;  2B1X A;  1FJK A;  1VPC A;  2GA1 A;  3L35 A;  4ZMD A;  2I1J A;  3GB4 A;  4L76 A;  2H8P D;  1VQN P;  1NU1 K;  1AFO A;  1L0N D;  2I7F A;  1GL2 C;  2UWJ E;  1YIT P;  5AEW A;  2D2C C;  1G8K B;  3HE5 A;  2DW3 A;  2FKW B;  2YIU B;  3TGU J;  3LIE A;  2Q1K A;  3A3Y B;  1L2P A;  2J58 A;  1OZH A;  2A06 E;  4RO0 A;  4QUR A;  1N2D C;  3ITK A;  2XNX A;  3EFF K;  5CJ4 A;  5AW1 B;  1USD A;  2A45 H;  1CZQ A;  1MFT A;  2YFJ A;  1BE3 E;  1S72 P;  1JM1 A;  1ZR2 A;  2WSC H;  1GMJ A;  5APT A;  1NTZ D;  5CBO A;  3GL0 A;  5KKZ B;  1BGY D;  2NPS D;  2E74 D;  1O7W A;  1DD3 A;  3HRN A;  2CK3 H;  2LXB A;  2HFE D;  1QEX A;  2HMM A;  1NTZ G;  3VMI D;  2NPS C;  1GW3 A;  3B4S A;  5CJ0 A;  1YIJ P;  2QRX A;  1JTH A;  5DJT B;  3OJA B;  4EOT A;  2JEE A;  2QG4 A;  1SFC D;  4JF7 A;  1SQV J;  4N3Y B;  3AE8 C;  3GW6 A;  2BMR A;  1H0T A;  2PP6 A;  4I7Z C;  3KZI E;  3L72 E;  4WY4 C;  2MKV A;  1OWA A;  4D6T J;  4KHX A;  1SQB E;  1ZRT E;  1SFC C;  2Q6Q A;  4AQR D;  1KQF B;  3O6Q B;  5KAI E;  2M8R A;  1RF0 C;  3K5B A;  4ZKP A;  1FOS F;  2Z5H A;  1JMB A;  1Q90 C;  3T97 A;  2K37 A;  2ZJS E;  2BAS A;  1VDF A;  3II6 A;  1PIX A;  1OW6 A;  1T8Z A;  2QJK C;  1L0N J;  1EG9 A;  2RKL A;  5TJH A;  3A0H H;  4Y99 B;  3GMA A;  2R32 A;  4BWN A;  1DX7 A;  1O7N A;  2DE7 D;  1FZA A;  2L5G B;  2Q3E A;  3H1H D;  2Y0E A;  4ASV A;  1HBW A;  4W7Z A;  2WZ7 A;  2Y0D A;  1X9V A;  1UIX A;  3HD7 B;  1NYH A;  2XRX A;  5L8R J;  1PP9 D;  1FDO A;  4XFJ A;  3H1H G;  4ZNC A;  1X8Y A;  1OW7 A;  2M3B A;  3P7K A;  2MJZ A;  4WBA A;  4U3F D;  1L0N K;  1L4A D;  2FYU E;  1LT9 B;  2ZT9 B;  2BMO A;  3UIA A;  5KLV E;  3W68 A;  3D70 A;  4JYB A;  3PTZ A;  4U3F G;  1BGY J;  3HTK A;  5CCH C;  1KIL A;  1GDT A;  5AW9 B;  4GIF A;  2RH0 A;  1VQ9 P;  3B5N B;  1GW4 A;  3RK3 D;  1YJN P; 
#chains in the Genus database with same CATH homology
 1SJG A;  3GL2 A;  3VMH D;  4HJL A;  2NVG A;  5KKZ C;  1L0N E;  4QUQ A;  3CWB E;  4PD4 E;  2IBZ E;  2A06 E;  1NDO A;  1O7P A;  4H0L D;  4QUR A;  4NBD D;  1L0L E;  1NTM E;  2BCC E;  1BCC E;  1UUV A;  3L75 E;  4NBB D;  4HM8 A;  4P1C H;  3L70 E;  2HML A;  4HM1 A;  1Q90 C;  2YFL A;  2NUM A;  4HM6 A;  1NU1 E;  2GBX A;  1VCK A;  1RFS A;  4NB9 D;  2NWF A;  2YFJ A;  2YVJ B;  1SQP E;  3FOU A;  4NB8 D;  1PPJ E;  2HMJ A;  1BE3 E;  2NVE A;  3GKE A;  1JM1 A;  2HMO A;  4AIV A;  2E76 D;  2QJP C;  4QDC A;  4NBF D;  3L74 E;  2NVF A;  2QJK C;  1UUW A;  4HM7 A;  2JO6 A;  2E4P A;  4NBG D;  1SQX E;  1O7H A;  1VM9 A;  4HM5 A;  1SQV E;  1EG9 A;  1NTZ E;  2JZA A;  4P1B H;  2QPZ A;  2DE7 D;  1O7N A;  3N0Q A;  1ULI A;  2E75 D;  3GL0 A;  4QDF A;  3CX5 E;  4PV1 D;  1SQQ E;  2FYN C;  2D2C D;  4H44 D;  2E74 D;  1O7W A;  1P84 E;  1O7G A;  3GTE A;  2XR8 A;  5AEU A;  4HM2 A;  4AAY B;  2XRX A;  3GTS A;  1RIE A;  2HMM A;  4NBH D;  3BCC E;  3GCE A;  2HMK A;  2HMN A;  4NBE D;  1WQL A;  4QUP A;  2NUK A;  1NTK E;  2GBW A;  3H1H E;  2YIU C;  3GZY A;  4QDF B;  3GZX A;  3H1L E;  4U3F E;  3VMI D;  1BGY E;  4QDD A;  1NYK A;  5HL4 A;  4NBC D;  2YFI A;  5KLI C;  2B1X A;  2QJY C;  1KB9 E;  2DE5 D;  3CXH E;  3H1K E;  3L73 E;  3DQY A;  1O7M A;  3GOB A;  1PP9 E;  2FYU E;  4HM3 A;  2ZYL A;  4D6T E;  4QCK A;  3VCP A;  3H1I E;  3TGU E;  2DE6 D;  2BMO A;  3C0D A;  1G8J B;  3GB4 A;  4H13 D;  5KLV E;  1ULJ A;  4EMJ B;  3EQQ A;  4HKV A;  3EN1 A;  3H1J E;  1KYO E;  2I7F A;  3AZC A;  2BMQ A;  3D89 A;  2ZT9 D;  2BMR A;  1VF5 D;  4HM4 A;  1EZV E;  2XSH A;  2B24 A;  5AEW A;  3VCA A;  2CKF A;  3L72 E;  2Q3W A;  5BOK A;  3L71 E;  1G8K B;  1FQT A;  3VMG D;  4NBA D;  4OGQ D;  5CXM A;  1SQB E;  2XSO A;  4HM0 A;  1ZRT E;  2E4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...