5KLVE

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 37
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 5klvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5klvE02
4EMJB 1O7MA 4H13D 2NVEA 3GZXA 3N0QA 4NBFD 3VMID 2GBXA 4HM1A 4AIVA 2NVGA 2I7FA 1SQVE 1PP9E 2QJPC 1L0LE 2BCCE 2HMLA 5KLVE 3H1IE 2YIUC 1WQLA 1KYOE 1O7HA 5CXMA 2B1XA 2BMQA 3AZCA 2NWFA 2YFJA 1FQTA 1SQXE 2NUMA 2ZYLA 2HMJA 3H1HE 2NUKA 3EN1A 4QDDA 4HJLA 4AAYB 2XRXA 4HM2A 5AEUA 3CWBE 1Q90C 1ULIA 1RFSA 4QCKA 1BCCE 1NU1E 1G8KB 4HM4A 4QDCA 4P1CH 1EG9A 2HMKA 2E76D 2FYNC 3FOUA 4NBCD 4NBED 3DQYA 3GTSA 3VMGD 1P84E 1NTME 5BOKA 1BGYE 2FYUE 1RIEA 3VCAA 3L70E 2XR8A 4NBDD 5KLIC 2XSHA 3GL2A 1UUVA 3GCEA 2BMRA 1O7NA 2GBWA 2IBZE 2YFLA 4HM7A 3EQQA 1KB9E 3L71E 3D89A 3GL0A 2JZAA 2HMMA 3C0DA 2DE5D 1ZRTE 2HMNA 1L0NE 1UUWA 4QUQA 2YVJB 5KKZC 3GZYA 1SJGA 1VCKA 4H44D 1O7GA 1EZVE 2YFIA 2CKFA 3VMHD 3L72E 1SQQE 2E4PA 3L74E 4HM0A 3CX5E 2A06E 2BMOA 4P1BH 2ZT9D 1PPJE 2Q3WA 4NBGD 4H0LD 4HM6A 2JO6A 3CXHE 4PV1D 4NB9D 5AEWA 4PD4E 4HKVA 1NYKA 4QUPA 3VCPA 3L75E 4NB8D 4QDFB 3GTEA 4HM5A 3H1LE 4QURA 2QJKC 2XSOA 4OGQD 3H1KE 4QDFA 1VF5D 2D2CD 3H1JE 1SQPE 1O7PA 1BE3E 1SQBE 5HL4A 4U3FE 3GB4A 1JM1A 2QJYC 1NDOA 1NTKE 2DE6D 1VM9A 2E4QA 4NBAD 1NTZE 2QPZA 3GKEA 2NVFA 2E74D 4NBBD 1ULJA 4NBHD 3L73E 2E75D 3TGUE 2HMOA 2DE7D 2B24A 3BCCE 4D6TE 3GOBA 4HM3A 1O7WA 4HM8A 1G8JB
chains in the Genus database with same CATH superfamily
1JY3O 1VF5B 1SQVE 1ZW0A 3CXHI 2QJPC 1YTZI 3KYQA 3V4QA 2M3EA 2Y0CA 2XDJA 4W7ZA 3D6YA 1VQNP 1GU5A 1EZVD 1JY3N 3RK3E 3L73G 3OW2O 1S2EA 4ZKUA 1SVFA 2IYPA 3BCCD 3H1IJ 4WB4A 2POHA 2K1AA 2FYNC 3VMZA 4ASVA 4BRYA 3CC2P 3H1JG 3A0BH 1RF1C 5AW4B 4LGDE 1IFMA 1M1JB 2R3CA 4I2LC 3P8CE 5KAFH 2B87B 3HD7D 3FWLA 2XV5A 2QG4A 1USDA 4I7ZB 3L75G 2HMNA 3AE4C 3AE9C 4I6MC 1VF5C 1YI2P 1IFIA 2E75C 1URQC 4ZKPA 2H89C 1JNMA 3JSVC 3FGAD 1JMMA 1NAFA 1N2DC 1BDDA 1KZUB 3TNUB 3OAKA 2Z4EA 1VQLP 2OQQA 2IFNA 2I8DA 3CI9A 1N73C 1FZGA 2FYUJ 2D2CB 3H32B 5K5GB 1S3JA 3L71J 4PD4H 2WVRA 2ZFCA 2QSIA 1X22A 5CBOA 4N6JA 2XKMA 3N0QA 3M9BA 2JKVA 1M57D 1Q86Q 4LLHA 2BMQA 3ABVC 3AE6C 4WY4D 3C1LA 4EYYQ 1RF0C 2E42A 1GK4A 1AA0A 3L70D 1NTKD 2OYIC 5AW2B 1M90Q 3CCRP 3B5NC 1Q90C 1JCCA 4P1CH 5KLVJ 3DQYA 1HH0A 1A02F 5CCHC 1KORA 1LTAC 1K9MQ 3PRJA 1T3UA 3B71A 3NFQA 1SQPD 1MFZA 2ZVOB 2Q5UA 3KZIE 2HPCB 3H1LG 2JZAA 3VMXA 2FKWB 1FC2C 1VQ8P 1LNQA 1YTZT 5KKZC 3P32A 5AVXB 4DCKA 1Q7YQ 2M0BA 1JY2P 1SQQE 1HVVA 3M0DA 5B5EH 4CPGA 2BCCD 3NXSA 2Q3WA 5CJ0A 3O6QB 3PHLA 2B87A 1LT9C 1ZR4A 4ZNCA 2JP3A 4QUPA 1SQPG 2FFDA 1FDOA 1NTMJ 4IFFA 1K05A 1LTJC 2KNCB 1YITP 2GM4A 2M5AB 4KJMA 1RY3A 1HF9A 2ZAEB 1Q90D 2I1JA 3GZXA 3CXHD 1VQMP 3CX5H 1U7JA 1PIXA 2ZXXA 1PPJD 3L72G 2DW3A 1L0LJ 2WPVB 3VP9A 4AYCA 1FJPA 2B9BA 3V4WA 1SQXG 1J2JB 2E76B 3PTZA 4TLFA 1GK6A 3BRVB 1KN7A 4JYCA 2FYUE 2WSCJ 1FOSF 3CPWO 1KTMA 2GBWA 5GTIE 3USSA 3HD7B 4RJTA 1KYOD 4N3YB 1SQVD 1YIJP 1SJGA 3D6ZA 2PP6A 1JUNA 3UIAA 1PZQA 3VMHD 4L73A 3MIWA 3B4SA 3CX5E 2NPSB 1AQTA 1PPJE 2C0WA 2JO6A 2QIWA 2QRXA 1ZRTD 1Y9BA 3VCPA 4NB8D 3B5NB 3H1KE 1YJ9P 3R4YA 3PLNA 1NTZG 1URQD 5AVUB 1KV4A 3BCCG 1RF1B 4JBZA 2OYIA 2AEJA 3EFGA 2NZ2A 1KQFB 3OA7A 4NPFX 2FFDB 3TGUJ 4H13D 1G1IA 2IDBA 1LTJA 2BEZF 1JTHA 3LW5J 4Y28J 2N1TD 2B1XA 2YFJA 5KLIB 1S72P 2IPPA 1SFCB 1P84D 1HTLC 1RFSA 2NRGA 2Y0DA 3RK3B 5APSA 1SQVG 1FDIA 3G4SP 4DOJA 1LTIC 1M7LA 1NTME 5AVVB 1DX7A 4JPZB 1K73Q 5CJ4A 1ZN5A 5KLIC 1VQ7P 3GCEA 1O7NA 2FXOA 1DEBA 1LTGC 4XFJA 3D89A 3GL0A 1NWQA 1JM0A 1ZRTE 2R5DA 2O01N 1G2CB 4H44D 2KS1A 3N7NA 3L72J 1KILA 2A06E 3HD7A 4P1BH 3F5HA 3EFFK 2W83C 2H88C 4AQRD 3CCJP 1X0TA 3O8ZA 5AW1B 1EDIA 4QDFB 4HM5A 3HTKB 4IFMA 1NHLA 1RQUA 1L0LK 1E79H 3BVHA 2L91A 3TYYA 1BCCJ 1YJWP 1BE3D 2ZXEB 3TGUG 3CWBJ 2KSEA 3GOBA 1NU1G 1WT6A 4HM8A 1S9KD 3H1ID 3BCCJ 2NVEA 1NOHA 2O1KA 2V4HA 4NBFD 1NTZJ 1L4AB 2C9NY 4C7NB 3IN6A 1BDCA 4EI2A 3L73D 4EDFA 1SQXJ 1SQPK 3GLMA 3CWBG 1KFMA 1JO5A 4GIFA 2A45G 4Y99B 5KAFE 5AEUA 2YKPA 4K35A 1T2KC 1NU1E 2FBWC 3H1JD 1EG9A 2E76D 2GUSA 3WUTA 1NU1D 1IFDA 3A0BE 3VMGD 2XNXA 2NPSA 3VCAA 1H89A 2JEEA 1UIIA 1BCCD 1OMIA 2D2CC 1KQGB 1X9VA 2HODA 5KAIE 1LTBC 3F89A 1EZVE 2N1TA 2FFDC 1U57A 1NTMG 1DH3A 1SQQD 1T6AA 1FZFA 1OW7A 2AEFA 3JC22 2WPSA 2E5TA 5APWA 4PV1B 2GUVA 3TF5A 2MJZA 1YQ3C 4QURA 4GOEA 3H1JE 2JO1A 3D71A 2WSEH 5AVWB 2OYIB 3V2QA 2KIKA 3AEGC 1ZR2A 4NBHD 3L73E 1LTJB 4B86A 1JCDA 1G8JB 1IO4A 3L73J 3VMID 3A2AA 4LC1A 2BEQD 2HMLA 1AJYA 2ZVNB 2JWDA 4GODA 2OGUA 2A06G 3G71P 3AE3C 2KNCA 1L0LD 4H44B 1HBWA 3LIDA 2E74C 2RKLA 1PGQA 4WBAA 5TISH 4C7RA 1S5LH 1NTMD 1Y47A 3CWBE 4QCKA 1GD2E 1VQPP 3V5BA 4HM4A 1DEEG 1FZCC 1NTKK 4NBCD 1IK9A 1KILC 1LP1A 3FWNA 3GTSA 1MUUA 1SP4A 2C9LY 2CK3H 3TDKA 4IFDK 5BOKA 3AE1C 3Q1MA 4D6TJ 3AE7C 1NKNA 2BMRA 2ZT9B 3GF3A 2KUBA 4JYBA 3RGUA 1NTKJ 3MTUE 1EZVG 2ZYGA 3L71G 5C39A 3HTKA 3CMEP 1VCKA 1K8AQ 5APTA 3L74E 2Z5HA 4C46A 2JR8A 3SWYA 1EDKA 5BVZA 4PV1D 2ZYAA 3Q5RA 4BXLA 2OTJP 1EQ7A 5AW3B 1VPCA 1KQSO 2QM7A 2V7QH 1CI6B 3L70J 5BU5A 4Y99C 3MHVA 5GTHH 1IZNB 1W2EA 4HB1A 2QJYC 2L5GB 3S1KA 2WT7A 2OYHB 1NTKE 1NDOA 1NTMK 4YPCA 1NTZE 2P58A 2E74D 3Q5SA 1NAYA 4D6TE 2N9BA 2P1JA 4KHXA 3MUDC 3H25A 5AW8B 3CC7P 1RQVA 1AV1A 1PFIA 2I7FA 1QEXA 3PJSK 2QVAA 2IBZI 2P2UA 2YIUC 1VQ6P 1HGVA 1DD4A 2P67A 2RH0A 3H1LJ 1FQTA 4GT1A 1L0ND 1KB9H 1N7SD 1PGOA 5AVRB 3P7KA 1PP9G 1SQBJ 3MD0A 5B66E 3Q5PA 2WSEJ 2WWWA 1CZQA 1SQPJ 2FYZA 4WY4B 2WPQA 1RIEA 1WMKA 2KLUA 3M9HA 2QJYB 3H1KJ 3HE5B 3L75J 1KILE 1ZXGA 3A0HE 4I1LA 1EZVI 2FYNB 1GU4A 1AFOA 1YBKA 1S1CX 1L0NE 1RH5B 4IL6X 3L74J 4K3AA 3Q2YA 1KYOH 3GZYA 2K9JB 3GF7A 4N78D 3IR9A 1L2PA 2OARA 3GW6A 3SFEC 3HUSA 3M9QA 3BASA 1YHQP 3P8CD 4JF7A 3ZDMA 4NB9D 1YQ4C 1LWUC 2FYUD 2KP8A 5EFWB 2YMYA 4OWFA 3H1LD 1TU3F 4U3FE 3CCUP 1ZLLA 3RL0D 4WY4C 3H6PA 1PP9J 1SQBG 2FXMA 1NGMB 4H0LC 2QE7H 1N7SC 2RN0A 3R2PA 5CCHD 3AE5C 4AIVA 1DD3A 2QM8A 1MFTA 1L0LE 2R32A 2H7HA 1WQLA 2YO3A 3KXDA 4IL6E 4HKZH 2JDIH 3GG2A 1PP9D 1SQXE 2NUMA 3E1IA 2YKQA 4AAYB 1GTWA 1SQBD 3HRNA 3AE2C 3H1KG 2N1TB 1UIXA 3P8MC 3FX0A 4NBED 2YNYA 3H1JJ 3SSUA 1P84E 1OZHA 4U3FD 3A5TA 1N7SA 4HJGH 2OTLP 1G1JA 3V2PA 1FE6A 2YFLA 3U1CA 1GL2D 1MZ9A 3M91A 3GHGB 2KYVA 1QL2A 5KKZB 4PJ0E 2YVJB 3B5NA 2YO2A 1R5LA 1EDLA 3N4XA 4H13B 3ITKA 3LW5H 1Y8AA 1QGKB 3CX5I 2AXTE 2W8ZA 3QWOC 2M8RA 4HM6A 2R5BA 5TJHA 2K9JA 2Q9IA 1YJNP 1NYKA 1KB9D 2B89A 2FYUK 1LWUB 2YXRB 4IOIH 1VF5D 5HL4A 3H1IG 3W67A 4NBAD 4HH2A 2NVFA 2HLOA 3M0DC 2OYHC 3H1KD 5H2FH 4XA4A 2B24A 2P10A 1O7WA 1VQ9P 1NTZK 1SFCA 4EMJB 3WU2E 4R4LA 4JQ0D 4UB6E 1JB0J 4PV1C 2KI7B 3C9IA 5KLVE 1H88A 4NPEA 4WY4A 1FZEA 2ZYDA 5KTBA 1IFPA 1NTKG 1HJBA 1L4AD 2HMJA 4WWIA 3EN1A 1Z56A 2M3BA 1ULIA 1RE4C 3H1HG 1BCCE 2Y9YA 1N73B 1EDJA 1URQA 3E7KA 3PH0A 2IFMA 2WTYA 1SQQG 2KZJA 2J59M 1UUVA 1HJ0A 3AEAC 4YTPC 3LIEA 3T97A 1SQBK 2H43A 1L4AA 1CI6A 2W6JH 3RBXA 4DJGA 3K5BA 1FJKA 3AEDC 1ZMEC 3QH9A 3HUSB 1BCCG 2Q6QA 4UB6H 2R44A 2BMOA 1SS1A 4H13C 3WU2H 1QX8A 3V6IA 3CXHE 3G3ZA 3GTEA 3GHGC 2BCCG 4QDFA 3S9OA 1BE3E 3T97B 4BWNA 3GB4A 1IFJA 1QL1A 2IZ0A 3RL0B 1OVRA 2SPZA 3CCVP 4D6TG 2NVGA 3VTPC 3G6EP 2VRSA 2WZ7A 3SWFA 4Z1MH 3L74G 3AE8C 1S4XA 1FZAA 2W6AA 2YXQB 3CC4P 1P84I 1GDTA 5E79H 3JCUH 2HMKA 3EWKA 3FOUA 1LT1A 1Q82Q 3KHUA 1E5WA 4U3FG 2PAJA 3L70E 5M1BA 1OFCX 3GL2A 1J1EB 1WRGA 1M1JC 1JTHB 3VOPA 1UUWA 3WMM0 3VP8A 2HPCA 2WSSH 3RK2D 1ZV8A 2YMKA 4NBGD 3CLQA 2RMZA 2R3SA 1LWUA 5AW0B 4HKVA 3L75E 3RL0g 5CCGA 2FXPA 3H1LE 4TT3H 4OGQD 5AVYB 3CWBD 5KJ7A 2WQYC 3L36A 3C8VA 3MGNA 1SQVJ 2QPZA 1W2BO 4RESB 1J1DB 2KXPB 1N7LA 2DE7D 4UB8E 1S5LX 2E76C 1JEKA 3I55P 3CCSP 2B88A 2E74B 2IZ1A 3MP7B 1GL2C 1USEA 5CXMA 2KOGA 2W90A 1NO4A 2BASA 1S9KE 2N9YB 1OWAA 2V7QJ 5AW5B 5KJ7C 1IJDB 2XU6A 5DJUB 1BE3J 3PP5A 4DZOA 1Q2NA 3CCQP 4NBDD 1VDFA 2J5UA 2NPSD 2H8PD 3MUDA 1GW4A 4HM7A 1T3JA 3EQQA 3L71E 1L4AC 2HODB 3C0DA 3CCEP 1MKMA 5KLVD 1OXZA 3VYIA 4QUQA 1OX3A 1AVOA 1H0TA 4DT0A 4HM0A 2HFED 2KK7A 4UB8H 1KC8Q 1KILD 4GOFA 1XTCC 2UWJE 5APQA 1T8ZA 2E5YA 2Q3EA 2XSOA 5AVSB 1N7SB 1GZLA 1RE3A 3A3YB 2O01H 5GTHE 3S4RA 1FZCA 1BGYD 3SFDC 2KS1B 1PL5A 1O7MA 3TNUA 2E43A 3H1HD 4HM1A 5DJTB 5APVA 2BCCE 3L70G 1R5SA 5CMZA 3H1IE 1FS0E 2CPSA 2NWFA 2NPSC 1OVVA 3HE5A 5APYA 3H1HE 1SQXK 4HJLA 3KPEA 4W7YA 1CSBA 1BGYE 1RHZB 2ZT9C 3JCUE 4OGQB 1NVOA 2XR8A 3L35A 2K88A 4MN4C 1M56D 5AW6B 5E79E 2IBZE 2WSFH 1L0NG 4O9BA 1FU1A 2M5AA 1O7GA 1HGZA 3CX5D 3CCLP 5AVTB 2IX7C 2IBZD 2Y9ZA 1NU1J 1URQB 3MZWB 4XE5B 2JWAA 3WUVA 4NPDA 1N73A 2P7JA 3KDPB 3L37A 5CCHA 3RK3C 1KB9I 3TK1A 3EQ2A 1EXIA 1QVGO 1BSHA 1D7MA 3A7OA 1JY2N 1KQLA 3O6QA 1FAVA 1XTGB 5L8RJ 3RK2C 2I1KA 2HMOA 3CXHH 3BCCE 4WVZA 3NTNA 5KLVK 1FZCB 2GBXA 3RBZA 2Z5IA 1JMBA 3TSIA 3Q3DA 5KAIH 4N78E 4OGQC 1KYOI 2FY8A 2LR2A 2K37A 3AEBC 2OYHA 5AVZB 5BU8B 3I56P 4HM2A 1FBMA 2J58A 4BRYB 1KILB 1X79B 1JY2O 3FXDA 4U3FJ 1PPJG 1ZP0C 1M1KQ 5KLVG 2XSHA 4YXDC 2KZIA 3L75D 1NYHA 5AVQB 3CMAP 2K9YA 5CCGC 4W80A 1LJ2A 4KT0J 3L71D 1NKZB 2HYNA 1VQ4P 1L0NJ 4H0LD 5KJ7D 3L4FA 1GL2B 1HWTC 5H2FE 2O3JA 2KSJA 3NMDA 4D6TD 1SFCC 4GKGA 1SQPE 1MV8A 3IAOA 2DE6D 2E4QA 1IFNA 2Q7CA 2WSFJ 4OH8B 4U7JA 3TGUE 3HUSC 1NJIQ 2E75B 3L74D 2AXTH 1T2KD 2QJKB 1A02J 3HE4B 3VMYA 1RE4A 4ASWA 2WSCH 2WMMA 2OYOA 2JJLA 3L72D 4PJ0H 2YKOA 1GMJA 1SQVK 3B8EB 1G2CA 2ZYLA 2PFXA 3OJAB 2XRXA 1H0TB 2WPRA 1PGPA 1P84H 5CBNA 3G9RA 4HYTB 3U59A 3HE4A 3E1RA 4C7NA 4IL6H 1SLQA 1BSNA 1NH4A 1SQQK 1FOSE 1KFNA 3H32A 2C0XA 2E4PA 2FYUG 2ZT9D 4H0LB 1K04A 1EC5A 3WUUA 4ZMDA 4YXWH 2QJPB 3AEFC 1BE3G 4PD4I 3TGUD 2QJKC 2N1TC 1CW5A 3AEEC 1DIPA 1O7PA 3GHGA 1NU1K 1VQOP 4H44C 4R4MA 2E75D 1U7MA 1M8OB 3W68A 1OW6A 2WT7B 1KMIZ 1L0LG 1AVYA 4L75A 5AW9B 4AUWA 3RK3D 3HD7C 1KYOE 1LGHB 1FZBA 2A45H 1OW8A 3AZCA 3H1HJ 3V2NA 3U1AA 3AECC 2LXCB 3A0HH 5GTIH 1VQ5P 2QEXP 3CD6P 4QDDA 1OIPA 1G8KB 4OVNF 4GDOA 1LTSC 3D70A 4L74A 3M0AA 5B66H 1HUCA 2CPBA 1GL2A 2IYOA 1KB9E 2HG5D 3VN0A 1LT9A 1M1JA 2G3AA 3GMAA 1KD1Q 4EOTA 1SQQJ 2XZRA 2YFIA 2CKFA 1N8RQ 1BGYJ 3IFMA 1J1DC 1BGYG 3B5ND 1IC2A 1RF1A 4L76A 3KQGA 1IK7A 3M06A 1Q81Q 1LP1B 2PRRA 3IF4A 5AEWA 1PGJA 3RK2B 2D2CD 2Q1KA 1NTZD 2Q3IA 1VQKP 1JM1A 2BCCJ 1YYCA 3VMAA 5APXA 4EIJA 1H8AA 4A7PA 4M3LA 4HM3A 2WITA 2O1JA 3I5CA 2W6BA 5B5EE 1QLED 1PP9E 1SFCD 1R8EA 1PV3A 3V2RA 2A06D 1O7HA 1RE3C 2KB7P 3FXEA 3KZIH 2NUKA 1LTTC 2OTKE 5CCGD 1OVUA 4QDCA 3CCMP 4PD4D 2O01J 1ZOYC 1L0NK 1VL2A 1W5CE 2KLVA 2ZJSE 1S5LE 5TISE 1GW3A 2G8YA 3BATA 2W27A 2MKVA 4RO0A 2HMMA 2DE5D 2XNDH 3BRTB 2LKMA 2LXBA 3L72E 2PGDA 1J1EC 3RL0C 1LT9B 1EXJA 2ITAA 2QA4P 1AQ5A 1JY3P 3SWKA 1X8YA 1QVFO 1N86A 2GA1A 4PD4E 4I7ZC 2AEMA 2K3RA 2A45I 3II6A 1SQBE 2Y0EA 2AXCA 1FDMA 3CL3D 4QMAA 1VM9A 1SQXD 2HR3A 3GKEA 2YIUB 5CHXA 5APUA 2IBZG 4NBBD 1ULJA 5AW7B 1RF0A 4RKUJ 1JOCA
chains in the Genus database with same CATH topology
4EMJB 1O7MA 4H13D 2NVEA 3GZXA 3N0QA 4NBFD 3VMID 2GBXA 4HM1A 4AIVA 2NVGA 2I7FA 1SQVE 1PP9E 2QJPC 1L0LE 2BCCE 2HMLA 5KLVE 3H1IE 2YIUC 1WQLA 1KYOE 1O7HA 5CXMA 2B1XA 2BMQA 3AZCA 2NWFA 2YFJA 1FQTA 1SQXE 2NUMA 2ZYLA 2HMJA 3H1HE 2NUKA 3EN1A 4QDDA 4HJLA 4AAYB 2XRXA 4HM2A 5AEUA 3CWBE 1Q90C 1ULIA 1RFSA 4QCKA 1BCCE 1NU1E 1G8KB 4HM4A 4QDCA 4P1CH 1EG9A 2HMKA 2E76D 2FYNC 3FOUA 4NBCD 4NBED 3DQYA 3GTSA 3VMGD 1P84E 1NTME 5BOKA 1BGYE 2FYUE 1RIEA 3VCAA 3L70E 2XR8A 4NBDD 5KLIC 2XSHA 3GL2A 1UUVA 3GCEA 2BMRA 1O7NA 2GBWA 2IBZE 2YFLA 4HM7A 3EQQA 1KB9E 3L71E 3D89A 3GL0A 2JZAA 2HMMA 3C0DA 2DE5D 1ZRTE 2HMNA 1L0NE 1UUWA 4QUQA 2YVJB 5KKZC 3GZYA 1SJGA 1VCKA 4H44D 1O7GA 1EZVE 2YFIA 2CKFA 3VMHD 3L72E 1SQQE 2E4PA 3L74E 4HM0A 3CX5E 2A06E 2BMOA 4P1BH 2ZT9D 1PPJE 2Q3WA 4NBGD 4H0LD 4HM6A 2JO6A 3CXHE 4PV1D 4NB9D 5AEWA 4PD4E 4HKVA 1NYKA 4QUPA 3VCPA 3L75E 4NB8D 4QDFB 3GTEA 4HM5A 3H1LE 4QURA 2QJKC 2XSOA 4OGQD 3H1KE 4QDFA 1VF5D 2D2CD 3H1JE 1SQPE 1O7PA 1BE3E 1SQBE 5HL4A 4U3FE 3GB4A 1JM1A 2QJYC 1NDOA 1NTKE 2DE6D 1VM9A 2E4QA 4NBAD 1NTZE 2QPZA 3GKEA 2NVFA 2E74D 4NBBD 1ULJA 4NBHD 3L73E 2E75D 3TGUE 2HMOA 2DE7D 2B24A 3BCCE 4D6TE 3GOBA 4HM3A 1O7WA 4HM8A 1G8JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EMJ B;  1O7M A;  4H13 D;  2NVE A;  3GZX A;  3N0Q A;  4NBF D;  3VMI D;  2GBX A;  4HM1 A;  4AIV A;  2NVG A;  2I7F A;  1SQV E;  1PP9 E;  2QJP C;  1L0L E;  2BCC E;  2HML A;  5KLV E;  3H1I E;  2YIU C;  1WQL A;  1KYO E;  1O7H A;  5CXM A;  2B1X A;  2BMQ A;  3AZC A;  2NWF A;  2YFJ A;  1FQT A;  1SQX E;  2NUM A;  2ZYL A;  2HMJ A;  3H1H E;  2NUK A;  3EN1 A;  4QDD A;  4HJL A;  4AAY B;  2XRX A;  4HM2 A;  5AEU A;  3CWB E;  1Q90 C;  1ULI A;  1RFS A;  4QCK A;  1BCC E;  1NU1 E;  1G8K B;  4HM4 A;  4QDC A;  4P1C H;  1EG9 A;  2HMK A;  2E76 D;  2FYN C;  3FOU A;  4NBC D;  4NBE D;  3DQY A;  3GTS A;  3VMG D;  1P84 E;  1NTM E;  5BOK A;  1BGY E;  2FYU E;  1RIE A;  3VCA A;  3L70 E;  2XR8 A;  4NBD D;  5KLI C;  2XSH A;  3GL2 A;  1UUV A;  3GCE A;  2BMR A;  1O7N A;  2GBW A;  2IBZ E;  2YFL A;  4HM7 A;  3EQQ A;  1KB9 E;  3L71 E;  3D89 A;  3GL0 A;  2JZA A;  2HMM A;  3C0D A;  2DE5 D;  1ZRT E;  2HMN A;  1L0N E;  1UUW A;  4QUQ A;  2YVJ B;  5KKZ C;  3GZY A;  1SJG A;  1VCK A;  4H44 D;  1O7G A;  1EZV E;  2YFI A;  2CKF A;  3VMH D;  3L72 E;  1SQQ E;  2E4P A;  3L74 E;  4HM0 A;  3CX5 E;  2A06 E;  2BMO A;  4P1B H;  2ZT9 D;  1PPJ E;  2Q3W A;  4NBG D;  4H0L D;  4HM6 A;  2JO6 A;  3CXH E;  4PV1 D;  4NB9 D;  5AEW A;  4PD4 E;  4HKV A;  1NYK A;  4QUP A;  3VCP A;  3L75 E;  4NB8 D;  4QDF B;  3GTE A;  4HM5 A;  3H1L E;  4QUR A;  2QJK C;  2XSO A;  4OGQ D;  3H1K E;  4QDF A;  1VF5 D;  2D2C D;  3H1J E;  1SQP E;  1O7P A;  1BE3 E;  1SQB E;  5HL4 A;  4U3F E;  3GB4 A;  1JM1 A;  2QJY C;  1NDO A;  1NTK E;  2DE6 D;  1VM9 A;  2E4Q A;  4NBA D;  1NTZ E;  2QPZ A;  3GKE A;  2NVF A;  2E74 D;  4NBB D;  1ULJ A;  4NBH D;  3L73 E;  2E75 D;  3TGU E;  2HMO A;  2DE7 D;  2B24 A;  3BCC E;  4D6T E;  3GOB A;  4HM3 A;  1O7W A;  4HM8 A;  1G8J B; 
#chains in the Genus database with same CATH topology
 1JY3 O;  1VF5 B;  1SQV E;  1ZW0 A;  3CXH I;  2QJP C;  1YTZ I;  3KYQ A;  3V4Q A;  2M3E A;  2Y0C A;  2XDJ A;  4W7Z A;  3D6Y A;  1VQN P;  1GU5 A;  1EZV D;  1JY3 N;  3RK3 E;  3L73 G;  3OW2 O;  1S2E A;  4ZKU A;  1SVF A;  2IYP A;  3BCC D;  3H1I J;  4WB4 A;  2POH A;  2K1A A;  2FYN C;  3VMZ A;  4ASV A;  4BRY A;  3CC2 P;  3H1J G;  3A0B H;  1RF1 C;  5AW4 B;  4LGD E;  1IFM A;  1M1J B;  2R3C A;  4I2L C;  3P8C E;  5KAF H;  2B87 B;  3HD7 D;  3FWL A;  2XV5 A;  2QG4 A;  1USD A;  4I7Z B;  3L75 G;  2HMN A;  3AE4 C;  3AE9 C;  4I6M C;  1VF5 C;  1YI2 P;  1IFI A;  2E75 C;  1URQ C;  4ZKP A;  2H89 C;  1JNM A;  3JSV C;  3FGA D;  1JMM A;  1NAF A;  1N2D C;  1BDD A;  1KZU B;  3TNU B;  3OAK A;  2Z4E A;  1VQL P;  2OQQ A;  2IFN A;  2I8D A;  3CI9 A;  1N73 C;  1FZG A;  2FYU J;  2D2C B;  3H32 B;  5K5G B;  1S3J A;  3L71 J;  4PD4 H;  2WVR A;  2ZFC A;  2QSI A;  1X22 A;  5CBO A;  4N6J A;  2XKM A;  3N0Q A;  3M9B A;  2JKV A;  1M57 D;  1Q86 Q;  4LLH A;  2BMQ A;  3ABV C;  3AE6 C;  4WY4 D;  3C1L A;  4EYY Q;  1RF0 C;  2E42 A;  1GK4 A;  1AA0 A;  3L70 D;  1NTK D;  2OYI C;  5AW2 B;  1M90 Q;  3CCR P;  3B5N C;  1Q90 C;  1JCC A;  4P1C H;  5KLV J;  3DQY A;  1HH0 A;  1A02 F;  5CCH C;  1KOR A;  1LTA C;  1K9M Q;  3PRJ A;  1T3U A;  3B71 A;  3NFQ A;  1SQP D;  1MFZ A;  2ZVO B;  2Q5U A;  3KZI E;  2HPC B;  3H1L G;  2JZA A;  3VMX A;  2FKW B;  1FC2 C;  1VQ8 P;  1LNQ A;  1YTZ T;  5KKZ C;  3P32 A;  5AVX B;  4DCK A;  1Q7Y Q;  2M0B A;  1JY2 P;  1SQQ E;  1HVV A;  3M0D A;  5B5E H;  4CPG A;  2BCC D;  3NXS A;  2Q3W A;  5CJ0 A;  3O6Q B;  3PHL A;  2B87 A;  1LT9 C;  1ZR4 A;  4ZNC A;  2JP3 A;  4QUP A;  1SQP G;  2FFD A;  1FDO A;  1NTM J;  4IFF A;  1K05 A;  1LTJ C;  2KNC B;  1YIT P;  2GM4 A;  2M5A B;  4KJM A;  1RY3 A;  1HF9 A;  2ZAE B;  1Q90 D;  2I1J A;  3GZX A;  3CXH D;  1VQM P;  3CX5 H;  1U7J A;  1PIX A;  2ZXX A;  1PPJ D;  3L72 G;  2DW3 A;  1L0L J;  2WPV B;  3VP9 A;  4AYC A;  1FJP A;  2B9B A;  3V4W A;  1SQX G;  1J2J B;  2E76 B;  3PTZ A;  4TLF A;  1GK6 A;  3BRV B;  1KN7 A;  4JYC A;  2FYU E;  2WSC J;  1FOS F;  3CPW O;  1KTM A;  2GBW A;  5GTI E;  3USS A;  3HD7 B;  4RJT A;  1KYO D;  4N3Y B;  1SQV D;  1YIJ P;  1SJG A;  3D6Z A;  2PP6 A;  1JUN A;  3UIA A;  1PZQ A;  3VMH D;  4L73 A;  3MIW A;  3B4S A;  3CX5 E;  2NPS B;  1AQT A;  1PPJ E;  2C0W A;  2JO6 A;  2QIW A;  2QRX A;  1ZRT D;  1Y9B A;  3VCP A;  4NB8 D;  3B5N B;  3H1K E;  1YJ9 P;  3R4Y A;  3PLN A;  1NTZ G;  1URQ D;  5AVU B;  1KV4 A;  3BCC G;  1RF1 B;  4JBZ A;  2OYI A;  2AEJ A;  3EFG A;  2NZ2 A;  1KQF B;  3OA7 A;  4NPF X;  2FFD B;  3TGU J;  4H13 D;  1G1I A;  2IDB A;  1LTJ A;  2BEZ F;  1JTH A;  3LW5 J;  4Y28 J;  2N1T D;  2B1X A;  2YFJ A;  5KLI B;  1S72 P;  2IPP A;  1SFC B;  1P84 D;  1HTL C;  1RFS A;  2NRG A;  2Y0D A;  3RK3 B;  5APS A;  1SQV G;  1FDI A;  3G4S P;  4DOJ A;  1LTI C;  1M7L A;  1NTM E;  5AVV B;  1DX7 A;  4JPZ B;  1K73 Q;  5CJ4 A;  1ZN5 A;  5KLI C;  1VQ7 P;  3GCE A;  1O7N A;  2FXO A;  1DEB A;  1LTG C;  4XFJ A;  3D89 A;  3GL0 A;  1NWQ A;  1JM0 A;  1ZRT E;  2R5D A;  2O01 N;  1G2C B;  4H44 D;  2KS1 A;  3N7N A;  3L72 J;  1KIL A;  2A06 E;  3HD7 A;  4P1B H;  3F5H A;  3EFF K;  2W83 C;  2H88 C;  4AQR D;  3CCJ P;  1X0T A;  3O8Z A;  5AW1 B;  1EDI A;  4QDF B;  4HM5 A;  3HTK B;  4IFM A;  1NHL A;  1RQU A;  1L0L K;  1E79 H;  3BVH A;  2L91 A;  3TYY A;  1BCC J;  1YJW P;  1BE3 D;  2ZXE B;  3TGU G;  3CWB J;  2KSE A;  3GOB A;  1NU1 G;  1WT6 A;  4HM8 A;  1S9K D;  3H1I D;  3BCC J;  2NVE A;  1NOH A;  2O1K A;  2V4H A;  4NBF D;  1NTZ J;  1L4A B;  2C9N Y;  4C7N B;  3IN6 A;  1BDC A;  4EI2 A;  3L73 D;  4EDF A;  1SQX J;  1SQP K;  3GLM A;  3CWB G;  1KFM A;  1JO5 A;  4GIF A;  2A45 G;  4Y99 B;  5KAF E;  5AEU A;  2YKP A;  4K35 A;  1T2K C;  1NU1 E;  2FBW C;  3H1J D;  1EG9 A;  2E76 D;  2GUS A;  3WUT A;  1NU1 D;  1IFD A;  3A0B E;  3VMG D;  2XNX A;  2NPS A;  3VCA A;  1H89 A;  2JEE A;  1UII A;  1BCC D;  1OMI A;  2D2C C;  1KQG B;  1X9V A;  2HOD A;  5KAI E;  1LTB C;  3F89 A;  1EZV E;  2N1T A;  2FFD C;  1U57 A;  1NTM G;  1DH3 A;  1SQQ D;  1T6A A;  1FZF A;  1OW7 A;  2AEF A;  3JC2 2;  2WPS A;  2E5T A;  5APW A;  4PV1 B;  2GUV A;  3TF5 A;  2MJZ A;  1YQ3 C;  4QUR A;  4GOE A;  3H1J E;  2JO1 A;  3D71 A;  2WSE H;  5AVW B;  2OYI B;  3V2Q A;  2KIK A;  3AEG C;  1ZR2 A;  4NBH D;  3L73 E;  1LTJ B;  4B86 A;  1JCD A;  1G8J B;  1IO4 A;  3L73 J;  3VMI D;  3A2A A;  4LC1 A;  2BEQ D;  2HML A;  1AJY A;  2ZVN B;  2JWD A;  4GOD A;  2OGU A;  2A06 G;  3G71 P;  3AE3 C;  2KNC A;  1L0L D;  4H44 B;  1HBW A;  3LID A;  2E74 C;  2RKL A;  1PGQ A;  4WBA A;  5TIS H;  4C7R A;  1S5L H;  1NTM D;  1Y47 A;  3CWB E;  4QCK A;  1GD2 E;  1VQP P;  3V5B A;  4HM4 A;  1DEE G;  1FZC C;  1NTK K;  4NBC D;  1IK9 A;  1KIL C;  1LP1 A;  3FWN A;  3GTS A;  1MUU A;  1SP4 A;  2C9L Y;  2CK3 H;  3TDK A;  4IFD K;  5BOK A;  3AE1 C;  3Q1M A;  4D6T J;  3AE7 C;  1NKN A;  2BMR A;  2ZT9 B;  3GF3 A;  2KUB A;  4JYB A;  3RGU A;  1NTK J;  3MTU E;  1EZV G;  2ZYG A;  3L71 G;  5C39 A;  3HTK A;  3CME P;  1VCK A;  1K8A Q;  5APT A;  3L74 E;  2Z5H A;  4C46 A;  2JR8 A;  3SWY A;  1EDK A;  5BVZ A;  4PV1 D;  2ZYA A;  3Q5R A;  4BXL A;  2OTJ P;  1EQ7 A;  5AW3 B;  1VPC A;  1KQS O;  2QM7 A;  2V7Q H;  1CI6 B;  3L70 J;  5BU5 A;  4Y99 C;  3MHV A;  5GTH H;  1IZN B;  1W2E A;  4HB1 A;  2QJY C;  2L5G B;  3S1K A;  2WT7 A;  2OYH B;  1NTK E;  1NDO A;  1NTM K;  4YPC A;  1NTZ E;  2P58 A;  2E74 D;  3Q5S A;  1NAY A;  4D6T E;  2N9B A;  2P1J A;  4KHX A;  3MUD C;  3H25 A;  5AW8 B;  3CC7 P;  1RQV A;  1AV1 A;  1PFI A;  2I7F A;  1QEX A;  3PJS K;  2QVA A;  2IBZ I;  2P2U A;  2YIU C;  1VQ6 P;  1HGV A;  1DD4 A;  2P67 A;  2RH0 A;  3H1L J;  1FQT A;  4GT1 A;  1L0N D;  1KB9 H;  1N7S D;  1PGO A;  5AVR B;  3P7K A;  1PP9 G;  1SQB J;  3MD0 A;  5B66 E;  3Q5P A;  2WSE J;  2WWW A;  1CZQ A;  1SQP J;  2FYZ A;  4WY4 B;  2WPQ A;  1RIE A;  1WMK A;  2KLU A;  3M9H A;  2QJY B;  3H1K J;  3HE5 B;  3L75 J;  1KIL E;  1ZXG A;  3A0H E;  4I1L A;  1EZV I;  2FYN B;  1GU4 A;  1AFO A;  1YBK A;  1S1C X;  1L0N E;  1RH5 B;  4IL6 X;  3L74 J;  4K3A A;  3Q2Y A;  1KYO H;  3GZY A;  2K9J B;  3GF7 A;  4N78 D;  3IR9 A;  1L2P A;  2OAR A;  3GW6 A;  3SFE C;  3HUS A;  3M9Q A;  3BAS A;  1YHQ P;  3P8C D;  4JF7 A;  3ZDM A;  4NB9 D;  1YQ4 C;  1LWU C;  2FYU D;  2KP8 A;  5EFW B;  2YMY A;  4OWF A;  3H1L D;  1TU3 F;  4U3F E;  3CCU P;  1ZLL A;  3RL0 D;  4WY4 C;  3H6P A;  1PP9 J;  1SQB G;  2FXM A;  1NGM B;  4H0L C;  2QE7 H;  1N7S C;  2RN0 A;  3R2P A;  5CCH D;  3AE5 C;  4AIV A;  1DD3 A;  2QM8 A;  1MFT A;  1L0L E;  2R32 A;  2H7H A;  1WQL A;  2YO3 A;  3KXD A;  4IL6 E;  4HKZ H;  2JDI H;  3GG2 A;  1PP9 D;  1SQX E;  2NUM A;  3E1I A;  2YKQ A;  4AAY B;  1GTW A;  1SQB D;  3HRN A;  3AE2 C;  3H1K G;  2N1T B;  1UIX A;  3P8M C;  3FX0 A;  4NBE D;  2YNY A;  3H1J J;  3SSU A;  1P84 E;  1OZH A;  4U3F D;  3A5T A;  1N7S A;  4HJG H;  2OTL P;  1G1J A;  3V2P A;  1FE6 A;  2YFL A;  3U1C A;  1GL2 D;  1MZ9 A;  3M91 A;  3GHG B;  2KYV A;  1QL2 A;  5KKZ B;  4PJ0 E;  2YVJ B;  3B5N A;  2YO2 A;  1R5L A;  1EDL A;  3N4X A;  4H13 B;  3ITK A;  3LW5 H;  1Y8A A;  1QGK B;  3CX5 I;  2AXT E;  2W8Z A;  3QWO C;  2M8R A;  4HM6 A;  2R5B A;  5TJH A;  2K9J A;  2Q9I A;  1YJN P;  1NYK A;  1KB9 D;  2B89 A;  2FYU K;  1LWU B;  2YXR B;  4IOI H;  1VF5 D;  5HL4 A;  3H1I G;  3W67 A;  4NBA D;  4HH2 A;  2NVF A;  2HLO A;  3M0D C;  2OYH C;  3H1K D;  5H2F H;  4XA4 A;  2B24 A;  2P10 A;  1O7W A;  1VQ9 P;  1NTZ K;  1SFC A;  4EMJ B;  3WU2 E;  4R4L A;  4JQ0 D;  4UB6 E;  1JB0 J;  4PV1 C;  2KI7 B;  3C9I A;  5KLV E;  1H88 A;  4NPE A;  4WY4 A;  1FZE A;  2ZYD A;  5KTB A;  1IFP A;  1NTK G;  1HJB A;  1L4A D;  2HMJ A;  4WWI A;  3EN1 A;  1Z56 A;  2M3B A;  1ULI A;  1RE4 C;  3H1H G;  1BCC E;  2Y9Y A;  1N73 B;  1EDJ A;  1URQ A;  3E7K A;  3PH0 A;  2IFM A;  2WTY A;  1SQQ G;  2KZJ A;  2J59 M;  1UUV A;  1HJ0 A;  3AEA C;  4YTP C;  3LIE A;  3T97 A;  1SQB K;  2H43 A;  1L4A A;  1CI6 A;  2W6J H;  3RBX A;  4DJG A;  3K5B A;  1FJK A;  3AED C;  1ZME C;  3QH9 A;  3HUS B;  1BCC G;  2Q6Q A;  4UB6 H;  2R44 A;  2BMO A;  1SS1 A;  4H13 C;  3WU2 H;  1QX8 A;  3V6I A;  3CXH E;  3G3Z A;  3GTE A;  3GHG C;  2BCC G;  4QDF A;  3S9O A;  1BE3 E;  3T97 B;  4BWN A;  3GB4 A;  1IFJ A;  1QL1 A;  2IZ0 A;  3RL0 B;  1OVR A;  2SPZ A;  3CCV P;  4D6T G;  2NVG A;  3VTP C;  3G6E P;  2VRS A;  2WZ7 A;  3SWF A;  4Z1M H;  3L74 G;  3AE8 C;  1S4X A;  1FZA A;  2W6A A;  2YXQ B;  3CC4 P;  1P84 I;  1GDT A;  5E79 H;  3JCU H;  2HMK A;  3EWK A;  3FOU A;  1LT1 A;  1Q82 Q;  3KHU A;  1E5W A;  4U3F G;  2PAJ A;  3L70 E;  5M1B A;  1OFC X;  3GL2 A;  1J1E B;  1WRG A;  1M1J C;  1JTH B;  3VOP A;  1UUW A;  3WMM 0;  3VP8 A;  2HPC A;  2WSS H;  3RK2 D;  1ZV8 A;  2YMK A;  4NBG D;  3CLQ A;  2RMZ A;  2R3S A;  1LWU A;  5AW0 B;  4HKV A;  3L75 E;  3RL0 g;  5CCG A;  2FXP A;  3H1L E;  4TT3 H;  4OGQ D;  5AVY B;  3CWB D;  5KJ7 A;  2WQY C;  3L36 A;  3C8V A;  3MGN A;  1SQV J;  2QPZ A;  1W2B O;  4RES B;  1J1D B;  2KXP B;  1N7L A;  2DE7 D;  4UB8 E;  1S5L X;  2E76 C;  1JEK A;  3I55 P;  3CCS P;  2B88 A;  2E74 B;  2IZ1 A;  3MP7 B;  1GL2 C;  1USE A;  5CXM A;  2KOG A;  2W90 A;  1NO4 A;  2BAS A;  1S9K E;  2N9Y B;  1OWA A;  2V7Q J;  5AW5 B;  5KJ7 C;  1IJD B;  2XU6 A;  5DJU B;  1BE3 J;  3PP5 A;  4DZO A;  1Q2N A;  3CCQ P;  4NBD D;  1VDF A;  2J5U A;  2NPS D;  2H8P D;  3MUD A;  1GW4 A;  4HM7 A;  1T3J A;  3EQQ A;  3L71 E;  1L4A C;  2HOD B;  3C0D A;  3CCE P;  1MKM A;  5KLV D;  1OXZ A;  3VYI A;  4QUQ A;  1OX3 A;  1AVO A;  1H0T A;  4DT0 A;  4HM0 A;  2HFE D;  2KK7 A;  4UB8 H;  1KC8 Q;  1KIL D;  4GOF A;  1XTC C;  2UWJ E;  5APQ A;  1T8Z A;  2E5Y A;  2Q3E A;  2XSO A;  5AVS B;  1N7S B;  1GZL A;  1RE3 A;  3A3Y B;  2O01 H;  5GTH E;  3S4R A;  1FZC A;  1BGY D;  3SFD C;  2KS1 B;  1PL5 A;  1O7M A;  3TNU A;  2E43 A;  3H1H D;  4HM1 A;  5DJT B;  5APV A;  2BCC E;  3L70 G;  1R5S A;  5CMZ A;  3H1I E;  1FS0 E;  2CPS A;  2NWF A;  2NPS C;  1OVV A;  3HE5 A;  5APY A;  3H1H E;  1SQX K;  4HJL A;  3KPE A;  4W7Y A;  1CSB A;  1BGY E;  1RHZ B;  2ZT9 C;  3JCU E;  4OGQ B;  1NVO A;  2XR8 A;  3L35 A;  2K88 A;  4MN4 C;  1M56 D;  5AW6 B;  5E79 E;  2IBZ E;  2WSF H;  1L0N G;  4O9B A;  1FU1 A;  2M5A A;  1O7G A;  1HGZ A;  3CX5 D;  3CCL P;  5AVT B;  2IX7 C;  2IBZ D;  2Y9Z A;  1NU1 J;  1URQ B;  3MZW B;  4XE5 B;  2JWA A;  3WUV A;  4NPD A;  1N73 A;  2P7J A;  3KDP B;  3L37 A;  5CCH A;  3RK3 C;  1KB9 I;  3TK1 A;  3EQ2 A;  1EXI A;  1QVG O;  1BSH A;  1D7M A;  3A7O A;  1JY2 N;  1KQL A;  3O6Q A;  1FAV A;  1XTG B;  5L8R J;  3RK2 C;  2I1K A;  2HMO A;  3CXH H;  3BCC E;  4WVZ A;  3NTN A;  5KLV K;  1FZC B;  2GBX A;  3RBZ A;  2Z5I A;  1JMB A;  3TSI A;  3Q3D A;  5KAI H;  4N78 E;  4OGQ C;  1KYO I;  2FY8 A;  2LR2 A;  2K37 A;  3AEB C;  2OYH A;  5AVZ B;  5BU8 B;  3I56 P;  4HM2 A;  1FBM A;  2J58 A;  4BRY B;  1KIL B;  1X79 B;  1JY2 O;  3FXD A;  4U3F J;  1PPJ G;  1ZP0 C;  1M1K Q;  5KLV G;  2XSH A;  4YXD C;  2KZI A;  3L75 D;  1NYH A;  5AVQ B;  3CMA P;  2K9Y A;  5CCG C;  4W80 A;  1LJ2 A;  4KT0 J;  3L71 D;  1NKZ B;  2HYN A;  1VQ4 P;  1L0N J;  4H0L D;  5KJ7 D;  3L4F A;  1GL2 B;  1HWT C;  5H2F E;  2O3J A;  2KSJ A;  3NMD A;  4D6T D;  1SFC C;  4GKG A;  1SQP E;  1MV8 A;  3IAO A;  2DE6 D;  2E4Q A;  1IFN A;  2Q7C A;  2WSF J;  4OH8 B;  4U7J A;  3TGU E;  3HUS C;  1NJI Q;  2E75 B;  3L74 D;  2AXT H;  1T2K D;  2QJK B;  1A02 J;  3HE4 B;  3VMY A;  1RE4 A;  4ASW A;  2WSC H;  2WMM A;  2OYO A;  2JJL A;  3L72 D;  4PJ0 H;  2YKO A;  1GMJ A;  1SQV K;  3B8E B;  1G2C A;  2ZYL A;  2PFX A;  3OJA B;  2XRX A;  1H0T B;  2WPR A;  1PGP A;  1P84 H;  5CBN A;  3G9R A;  4HYT B;  3U59 A;  3HE4 A;  3E1R A;  4C7N A;  4IL6 H;  1SLQ A;  1BSN A;  1NH4 A;  1SQQ K;  1FOS E;  1KFN A;  3H32 A;  2C0X A;  2E4P A;  2FYU G;  2ZT9 D;  4H0L B;  1K04 A;  1EC5 A;  3WUU A;  4ZMD A;  4YXW H;  2QJP B;  3AEF C;  1BE3 G;  4PD4 I;  3TGU D;  2QJK C;  2N1T C;  1CW5 A;  3AEE C;  1DIP A;  1O7P A;  3GHG A;  1NU1 K;  1VQO P;  4H44 C;  4R4M A;  2E75 D;  1U7M A;  1M8O B;  3W68 A;  1OW6 A;  2WT7 B;  1KMI Z;  1L0L G;  1AVY A;  4L75 A;  5AW9 B;  4AUW A;  3RK3 D;  3HD7 C;  1KYO E;  1LGH B;  1FZB A;  2A45 H;  1OW8 A;  3AZC A;  3H1H J;  3V2N A;  3U1A A;  3AEC C;  2LXC B;  3A0H H;  5GTI H;  1VQ5 P;  2QEX P;  3CD6 P;  4QDD A;  1OIP A;  1G8K B;  4OVN F;  4GDO A;  1LTS C;  3D70 A;  4L74 A;  3M0A A;  5B66 H;  1HUC A;  2CPB A;  1GL2 A;  2IYO A;  1KB9 E;  2HG5 D;  3VN0 A;  1LT9 A;  1M1J A;  2G3A A;  3GMA A;  1KD1 Q;  4EOT A;  1SQQ J;  2XZR A;  2YFI A;  2CKF A;  1N8R Q;  1BGY J;  3IFM A;  1J1D C;  1BGY G;  3B5N D;  1IC2 A;  1RF1 A;  4L76 A;  3KQG A;  1IK7 A;  3M06 A;  1Q81 Q;  1LP1 B;  2PRR A;  3IF4 A;  5AEW A;  1PGJ A;  3RK2 B;  2D2C D;  2Q1K A;  1NTZ D;  2Q3I A;  1VQK P;  1JM1 A;  2BCC J;  1YYC A;  3VMA A;  5APX A;  4EIJ A;  1H8A A;  4A7P A;  4M3L A;  4HM3 A;  2WIT A;  2O1J A;  3I5C A;  2W6B A;  5B5E E;  1QLE D;  1PP9 E;  1SFC D;  1R8E A;  1PV3 A;  3V2R A;  2A06 D;  1O7H A;  1RE3 C;  2KB7 P;  3FXE A;  3KZI H;  2NUK A;  1LTT C;  2OTK E;  5CCG D;  1OVU A;  4QDC A;  3CCM P;  4PD4 D;  2O01 J;  1ZOY C;  1L0N K;  1VL2 A;  1W5C E;  2KLV A;  2ZJS E;  1S5L E;  5TIS E;  1GW3 A;  2G8Y A;  3BAT A;  2W27 A;  2MKV A;  4RO0 A;  2HMM A;  2DE5 D;  2XND H;  3BRT B;  2LKM A;  2LXB A;  3L72 E;  2PGD A;  1J1E C;  3RL0 C;  1LT9 B;  1EXJ A;  2ITA A;  2QA4 P;  1AQ5 A;  1JY3 P;  3SWK A;  1X8Y A;  1QVF O;  1N86 A;  2GA1 A;  4PD4 E;  4I7Z C;  2AEM A;  2K3R A;  2A45 I;  3II6 A;  1SQB E;  2Y0E A;  2AXC A;  1FDM A;  3CL3 D;  4QMA A;  1VM9 A;  1SQX D;  2HR3 A;  3GKE A;  2YIU B;  5CHX A;  5APU A;  2IBZ G;  4NBB D;  1ULJ A;  5AW7 B;  1RF0 A;  4RKU J;  1JOC A; 
#chains in the Genus database with same CATH homology
 4EMJ B;  1O7M A;  4H13 D;  2NVE A;  3GZX A;  3N0Q A;  4NBF D;  3VMI D;  2GBX A;  4HM1 A;  4AIV A;  2NVG A;  2I7F A;  1SQV E;  1PP9 E;  2QJP C;  1L0L E;  2BCC E;  2HML A;  5KLV E;  3H1I E;  2YIU C;  1WQL A;  1KYO E;  1O7H A;  5CXM A;  2B1X A;  2BMQ A;  3AZC A;  2NWF A;  2YFJ A;  1FQT A;  1SQX E;  2NUM A;  2ZYL A;  2HMJ A;  3H1H E;  2NUK A;  3EN1 A;  4QDD A;  4HJL A;  4AAY B;  2XRX A;  4HM2 A;  5AEU A;  3CWB E;  1Q90 C;  1ULI A;  1RFS A;  4QCK A;  1BCC E;  1NU1 E;  1G8K B;  4HM4 A;  4QDC A;  4P1C H;  1EG9 A;  2HMK A;  2E76 D;  2FYN C;  3FOU A;  4NBC D;  4NBE D;  3DQY A;  3GTS A;  3VMG D;  1P84 E;  1NTM E;  5BOK A;  1BGY E;  2FYU E;  1RIE A;  3VCA A;  3L70 E;  2XR8 A;  4NBD D;  5KLI C;  2XSH A;  3GL2 A;  1UUV A;  3GCE A;  2BMR A;  1O7N A;  2GBW A;  2IBZ E;  2YFL A;  4HM7 A;  3EQQ A;  1KB9 E;  3L71 E;  3D89 A;  3GL0 A;  2JZA A;  2HMM A;  3C0D A;  2DE5 D;  1ZRT E;  2HMN A;  1L0N E;  1UUW A;  4QUQ A;  2YVJ B;  5KKZ C;  3GZY A;  1SJG A;  1VCK A;  4H44 D;  1O7G A;  1EZV E;  2YFI A;  2CKF A;  3VMH D;  3L72 E;  1SQQ E;  2E4P A;  3L74 E;  4HM0 A;  3CX5 E;  2A06 E;  2BMO A;  4P1B H;  2ZT9 D;  1PPJ E;  2Q3W A;  4NBG D;  4H0L D;  4HM6 A;  2JO6 A;  3CXH E;  4PV1 D;  4NB9 D;  5AEW A;  4PD4 E;  4HKV A;  1NYK A;  4QUP A;  3VCP A;  3L75 E;  4NB8 D;  4QDF B;  3GTE A;  4HM5 A;  3H1L E;  4QUR A;  2QJK C;  2XSO A;  4OGQ D;  3H1K E;  4QDF A;  1VF5 D;  2D2C D;  3H1J E;  1SQP E;  1O7P A;  1BE3 E;  1SQB E;  5HL4 A;  4U3F E;  3GB4 A;  1JM1 A;  2QJY C;  1NDO A;  1NTK E;  2DE6 D;  1VM9 A;  2E4Q A;  4NBA D;  1NTZ E;  2QPZ A;  3GKE A;  2NVF A;  2E74 D;  4NBB D;  1ULJ A;  4NBH D;  3L73 E;  2E75 D;  3TGU E;  2HMO A;  2DE7 D;  2B24 A;  3BCC E;  4D6T E;  3GOB A;  4HM3 A;  1O7W A;  4HM8 A;  1G8J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...