5KLVE

Structure of bos taurus cytochrome bc1 with fenamidone inhibited
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
196
structure length
196
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrogen Bonding to the Substrate Is Not Required for Rieske Iron-Sulfur Protein Docking to the Quinol Oxidation Site of Complex III.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome b-c1 complex subunit 1, mitochondrial
total genus 37
structure length 196
sequence length 196
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 2016-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 5klvE01
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 5klvE02
1L0NE 2FYNC 4NB9D 1SQBE 1SJGA 2YFLA 3H1HE 5CXMA 1PP9E 4QURA 3CWBE 2YIUC 1O7GA 2ZYLA 4H13D 1SQXE 5AEWA 1O7MA 5HL4A 3GZXA 3C0DA 3GB4A 1VM9A 1SQPE 2YFIA 4NBFD 2Q3WA 4D6TE 1VF5D 3GOBA 1G8JB 4NBAD 1RFSA 2NWFA 1O7NA 4HM4A 2GBWA 3DQYA 1BE3E 3CXHE 5KKZC 1UUWA 4QUPA 4EMJB 2B1XA 1EZVE 3H1KE 1NYKA 2DE5D 4HM6A 4NBED 3L71E 2XR8A 3VMGD 1BCCE 3L70E 1NU1E 4P1BH 4HM3A 4HM1A 1NTME 4H0LD 1P84E 4OGQD 1G8KB 2QJPC 2QPZA 2BMQA 1O7PA 3VMID 1KYOE 3L74E 2HMLA 3GL0A 2FYUE 1SQQE 4AIVA 2XSOA 2YFJA 4HM2A 2QJKC 4QDFA 4HM7A 1RIEA 1ULJA 3VCAA 2XSHA 1NTZE 3CX5E 1PPJE 3L73E 3AZCA 2E4PA 1JM1A 3L75E 4H44D 1VCKA 2QJYC 1O7HA 4AAYB 2HMKA 2JO6A 2E76D 3GCEA 1L0LE 4PV1D 3GL2A 4QDDA 3EQQA 4U3FE 2NVFA 3D89A 2YVJB 1O7WA 3TGUE 2HMOA 2HMMA 2NUMA 1Q90C 2XRXA 3EN1A 4QDCA 2E75D 5KLVE 1UUVA 2DE6D 4NBDD 2JZAA 1WQLA 3VMHD 3GZYA 1ULIA 2HMJA 2D2CD 2NVGA 4P1CH 3H1JE 4QUQA 4NBHD 1KB9E 2B24A 2BMOA 1FQTA 3FOUA 2IBZE 4QDFB 5BOKA 4NB8D 1BGYE 2ZT9D 4HJLA 3VCPA 1NDOA 4NBGD 2E74D 2CKFA 3L72E 2NUKA 4PD4E 5KLIC 4HKVA 4QCKA 1EG9A 1SQVE 4HM8A 5AEUA 2BMRA 2HMNA 2BCCE 3H1LE 4NBBD 2E4QA 2GBXA 3H1IE 3GKEA 2DE7D 1ZRTE 3N0QA 2I7FA 4HM0A 3GTEA 3GTSA 1NTKE 4HM5A 3BCCE 4NBCD 2A06E 2NVEA
chains in the Genus database with same CATH superfamily
5KLIB 2SPZA 1QVFO 3LW5H 5CXMA 1JTHA 3HTKA 4QURA 3AEGC 3L70J 1SQBG 1RF1C 1NTMG 3GHGC 3SWFA 1CW5A 1IK7A 2Z5IA 1KQLA 1OWAA 1NTZD 3S1KA 1SQVG 3M9QA 2C9NY 2N1TC 1ZR2A 3CCSP 4PJ0E 4HM4A 1NTKJ 2WSEJ 4XA4A 1SQPK 2O01N 2O01J 1JY3O 5AW9B 3HD7D 1IC2A 1KYOE 5B66E 1FZCA 3CCVP 3BRTB 3H1JJ 5AW1B 4HM2A 1RIEA 1HVVA 2P2UA 2XSHA 3KPEA 2WSCJ 2HPCB 3NXSA 1VL2A 2PFXA 5KLVD 1LNQA 5AW5B 3VTPC 5AW8B 4GT1A 4LGDE 1KB9I 2FFDA 1GL2C 3AECC 2E75D 1FZGA 2IBZG 3A0BE 1PP9J 3B8EB 1SP4A 2K9JB 1K73Q 1FQTA 1ZP0C 3GW6A 1A02F 1FZCC 2AEMA 1KILA 2B87B 1M56D 1LT1A 2BMRA 2HMNA 1BGYG 4NBBD 1N86A 1DEBA 1NTKE 1FJPA 3CCLP 1NYHA 2FYUK 2IYPA 1L0LD 3RL0C 3U59A 2BCCD 1SJGA 2OTKE 4OWFA 1FZBA 1NHLA 1NTMK 1M57D 4YXWH 2KNCA 1VQOP 3WU2H 4WWIA 2OGUA 2VRSA 3PH0A 1JNMA 1XTGB 4HKZH 4UB6E 1KQGB 1TU3F 3A7OA 1PV3A 5AW4B 2E74C 4H0LD 3SSUA 2QJPC 1NAYA 1O7PA 1N2DC 2P58A 1SQQK 1NU1D 2XSOA 4QDFA 2PGDA 3MHVA 3CXHH 1JY2P 4ZMDA 2WPSA 3WMM0 3FWLA 3EQQA 3V2QA 3FX0A 3I56P 4QDCA 1H0TA 3HRNA 1A02J 3AE3C 1QEXA 1N73C 2IDBA 2IFMA 2JZAA 2L91A 4OGQC 2ZJSE 3GF7A 2ITAA 1H8AA 3VCPA 2K37A 1T3UA 1KYOI 2RH0A 4ASWA 1SQVE 1T2KD 2QIWA 2I7FA 4YPCA 1KYOH 4H13B 2A45G 3AE9C 1SQBE 2ZXEB 1ZMEC 1NU1K 2ZYLA 1R5LA 4Z1MH 2I8DA 3S4RA 2XNDH 5KLVG 1KORA 4YXDC 4GOFA 2PP6A 1OXZA 2YXRB 1FOSE 2ZT9C 3GF3A 1G2CA 2G8YA 2V7QH 1IFJA 5CHXA 1S72P 1YJWP 2MJZA 1VQMP 1VDFA 1NTMD 1AFOA 3AEAC 2JWDA 2OQQA 4H44D 2H8PD 5DJUB 1FE6A 2E5TA 2JO6A 2LR2A 1SQVJ 3RBZA 3U1AA 2W27A 1FJKA 3II6A 2GM4A 4UB6H 2KI7B 2A45I 4IFMA 1GDTA 1JMBA 1FC2C 3B4SA 1GK6A 1BCCG 1EDLA 3P8CE 2JO1A 3A3YB 3JC22 2E43A 1HUCA 2R44A 4NBGD 2CKFA 4QCKA 4WY4B 4HM8A 2OTJP 3KZIH 4DT0A 1LWUB 4W80A 2P10A 3Q5RA 3BCCE 4NBCD 5GTIE 1R5SA 1SVFA 4LLHA 2WQYC 3H1HE 1GU4A 3CI9A 3L37A 3AE6C 3W68A 1OVVA 4HYTB 1VQKP 3CMAP 4H0LB 1VQ9P 1BGYJ 2W8ZA 2QE7H 1VM9A 3L72J 3QWOC 1DD3A 1KB9H 2FXOA 1K9MQ 3S9OA 3R2PA 3MUDA 1M1KQ 1SLQA 1SQPD 1RFSA 3L71D 1N7SC 4AYCA 1KILC 3D71A 1OVUA 5AW3B 1X9VA 1L0LK 1EZVE 2XU6A 3H32A 4I1LA 3VOPA 2YMKA 1FDIA 1KN7A 1AQTA 2QPZA 2O1JA 2HMLA 3L73D 3L73G 1KC8Q 3G9RA 1M90Q 1SFCA 3VCAA 4AQRD 1S9KD 2NPSD 3CX5E 3Q1MA 2E4PA 4NPFX 1N73B 3HD7C 1L4AD 3VN0A 2HODA 3TGUE 2JR8A 3L71G 2QM8A 3V2NA 3RK3E 5AVTB 1LTSC 1OMIA 2M3EA 1G1IA 4ASVA 2O01H 1BGYE 1NDOA 1Z56A 3RK2C 3L72E 1PGQA 2RN0A 3CC4P 1N7LA 5AVVB 4HB1A 1OVRA 3PLNA 3AE1C 3PRJA 1SQPG 1ZOYC 4HM5A 1M7LA 1S3JA 3L70G 4U3FD 3AEDC 3MIWA 5GTIH 2FYNC 3MZWB 1J1DB 3L4FA 4I2LC 3MP7B 1JEKA 2A06D 4IL6X 1YTZT 1IFMA 3BATA 5AVYB 1J1EC 3JCUE 3P32A 3NFQA 4UB8E 2B89A 3KQGA 5AVZB 2IZ1A 4NPDA 2E76B 3SFDC 3VMXA 5CCHC 3TGUJ 3EQ2A 2XKMA 3HUSC 2GUVA 2M0BA 4NBED 5CCHA 1BE3D 2Y0EA 1EXJA 3M0DA 4GDOA 2FXMA 2JDIH 2LXCB 2YFJA 4TT3H 4DJGA 3KHUA 4L76A 1MFTA 4N78D 1PFIA 2HMOA 3CWBD 2JEEA 2KXPB 1SQBD 2WT7A 4BXLA 3K5BA 2FY8A 1LTJC 5EFWB 2D2CD 5APTA 1KB9E 3FOUA 1OZHA 5CBNA 4I7ZB 4HJLA 3H1HG 4I6MC 1VQ8P 2H88C 3I5CA 3P8MC 2GBXA 3CMEP 2I1KA 5CCGD 3FWNA 2OYIA 1RE4A 2WVRA 2E42A 1S2EA 3L35A 1SQXE 4I7ZC 2CPBA 3NMDA 1U7JA 1NWQA 1NTKD 2XV5A 1QGKB 3D6ZA 1WT6A 2O3JA 2B9BA 1EQ7A 5KLVK 1VF5D 5KAIH 3Q5PA 1PGJA 2GBWA 1BDDA 5KKZC 5CBOA 2OYOA 1U57A 2FYUD 3IR9A 2KK7A 2O1KA 3A0BH 3M9BA 1HF9A 3CD6P 4U3FG 3L70E 1DD4A 2Y9ZA 1W2BO 2YIUB 1S4XA 1SQQE 1IJDB 5BU5A 4PD4D 2AXTH 1NVOA 2QJKC 3TYYA 1GMJA 1WRGA 1HBWA 3H32B 1CZQA 1YJ9P 3CC2P 3T97B 4XE5B 4EI2A 1KD1Q 2E76C 3BCCD 3H1KJ 5CMZA 3H1KG 5KLVE 1J1EB 1L0NJ 1YQ3C 4IL6E 1DIPA 4P1CH 2AEFA 1N73A 1IO4A 3FXEA 1SQXK 3A0HH 2ZFCA 5E79H 1J1DC 2FYNB 1L0LG 2FXPA 4U3FJ 1ZRTE 1JO5A 2KSEA 1VF5C 1Q82Q 2QJKB 1N7SA 2KS1A 4NB9D 1K04A 1UIXA 1PP9E 2YIUC 2C0WA 2WTYA 2KYVA 1SQQJ 3CX5D 2BASA 2IBZD 2AXCA 3AE2C 1SFCB 2ZXXA 3GOBA 4AUWA 2R5BA 2KLUA 3RK3D 2B1XA 2K3RA 3H1KE 2ZAEB 3VYIA 1NO4A 1KFNA 5AVSB 5B5EE 3P7KA 5KLVJ 4HM3A 3F5HA 3KXDA 1LT9B 2BMQA 3M9HA 4PV1B 1L4AB 3Q5SA 2FKWB 4PD4I 3V6IA 1KQSO 2WSFH 3GL2A 4QDDA 4U3FE 5APWA 3D89A 2HMMA 1NKZB 1YITP 2Q3EA 5KAIE 2NPSA 1LTJB 4NBDD 4W7YA 2P67A 1VQLP 4QDFB 4H0LC 1ZW0A 2BEQD 1Y47A 1SQXG 2N1TA 3CCRP 2H7HA 2Z4EA 3ITKA 1EZVI 1KZUB 1O7GA 1ZR4A 4WBAA 1VPCA 5HL4A 3C0DA 1VQ5P 2N1TD 1L4AA 3I55P 4N78E 1KILE 3L75J 3JSVC 1FOSF 3DQYA 3GMAA 1RF1A 4EMJB 2WPQA 2DE5D 4HM6A 3RK2D 3VMGD 5K5GB 2NPSB 1P84E 1GZLA 5DJTB 2HODB 1W5CE 3CLQA 1PPJD 2RKLA 1QX8A 2W6JH 3KZIE 1EDKA 2WSFJ 1LTIC 3AZCA 3HUSA 4N3YB 3B71A 3WUTA 1YIJP 2KB7P 1L0LE 1LTAC 1VQ7P 3RK2B 4D6TD 2W6AA 3L71J 1PZQA 3EN1A 3L74G 3OJAB 1RE4C 4K35A 5H2FH 1GW4A 1RH5B 2Q9IA 1FBMA 1M1JC 2B24A 3T97A 4JQ0D 3UIAA 2QVAA 3L73J 3FGAD 3A2AA 5KAFH 2I1JA 1LTJA 3GKEA 3D70A 2CK3H 2K9JA 5B5EH 3AE7C 1DX7A 3HE4B 2KOGA 3N7NA 1PL5A 4OGQB 1O7MA 1YJNP 2Q3IA 3L72G 4K3AA 1KILB 2C9LY 1N7SB 2KS1B 1X79B 5CCGC 1AV1A 2G3AA 5APQA 2YKOA 1D7MA 4QUPA 1Q86Q 3L71E 3Q2YA 3CCUP 1NU1G 3CX5H 1L0ND 2L5GB 2QM7A 1NGMB 4WVZA 1FU1A 4L74A 1Q2NA 1FZAA 5KJ7C 4GOEA 1LWUC 3L73E 3KYQA 1JY2O 4Y99B 4HJGH 1X22A 2E76D 1LJ2A 1GD2E 1S9KE 1VQ4P 3VMAA 4B86A 2YVJB 2RMZA 3V4WA 2NUMA 2WSCH 5CJ0A 1QL1A 3E1IA 4YTPC 2WPVB 2IYOA 3CXHD 3LW5J 5AW2B 1WMKA 1NH4A 2FYUJ 2NVGA 1BCCD 2PAJA 2WZ7A 1HH0A 1SQPJ 2IFNA 1LTBC 3RL0B 3M91A 5KAFE 1SS1A 3CCJP 1PGPA 1CI6A 2DE7D 1SQVK 3G71P 5B66H 3M0AA 3H25A 4PD4H 2POHA 1YI2P 1HGVA 2ZT9B 4QMAA 2CPSA 1XTCC 1K05A 4NBFD 4IOIH 3H1JD 2HYNA 1QL2A 2HPCA 1ZN5A 2JJLA 2V7QJ 4OVNF 1YYCA 4RKUJ 2H89C 2YO2A 1JOCA 1IFIA 4HM1A 1L2PA 4MN4C 4JF7A 2WSEH 5APUA 3GG2A 4KT0J 2FYUE 1X0TA 1EXIA 3RL0g 3U1CA 1G2CB 1MUUA 1NOHA 2WPRA 1L4AC 3GCEA 3H1JG 1MV8A 3A5TA 3H1HD 2E5YA 2N1TB 1LT9C 1PGOA 2C0XA 3L36A 2HLOA 1KFMA 2XDJA 1X8YA 3AEFC 1USDA 3EFGA 1OX3A 3RGUA 1M1JA 1JCDA 1E79H 1FS0E 4EDFA 3JCUH 3H1ID 1SFCC 5KLIC 1KILD 2YKQA 3V5BA 1LGHB 1EZVD 3H1LE 2ZYGA 5APXA 2FFDC 3ABVC 3GTEA 3GTSA 2JWAA 5CJ4A 2NVEA 1RQVA 2FBWC 2YFLA 1IFNA 1JY3N 3B5NA 1BCCJ 1P84H 3BASA 1BE3G 1ZRTD 5AEWA 1VF5B 2GUSA 3GB4A 2R32A 5AVUB 1HTLC 3TSIA 1PP9D 4R4LA 1AA0A 2W90A 1JB0J 3MGNA 4BRYA 1O7NA 1MZ9A 1LP1B 2PRRA 2KNCB 1N8RQ 2OYHB 4DZOA 4C7NB 4A7PA 1NYKA 1Q81Q 4CPGA 4P1BH 1SQXJ 3L74E 3MTUE 4WB4A 4AIVA 1W2EA 3H1KD 3L70D 4ZKPA 2ZYAA 2AXTE 1M8OB 5AW6B 1RF0A 3O6QA 1AVYA 5KJ7A 4M3LA 1VCKA 1PP9G 1AJYA 3H1LJ 2OYIC 2NVFA 1O7WA 1UUVA 3HE4A 1H89A 1YTZI 1E5WA 1RQUA 2KZJA 1IFDA 5KKZB 1GL2B 3HE5B 2ZT9D 3E7KA 1KV4A 1SQBK 3N4XA 5AEUA 1PIXA 3AEBC 1YHQP 4HM0A 1LTTC 2OYHC 3PTZA 1S5LE 4GKGA 4C7RA 4L73A 1L0NE 2OYHA 1NTKG 3TNUB 1EC5A 2QG4A 4C7NA 3L74J 4D6TG 2YKPA 1N7SD 1GU5A 2YFIA 3C8VA 3IFMA 2P7JA 2ZYDA 1AVOA 1OFCX 2R3CA 3G6EP 4RESB 1G8JB 4GODA 3M0DC 2M5AB 2FYUG 4U7JA 1SQVD 4TLFA 2QJYB 1KYOD 1HWTC 1KB9D 3GHGB 3USSA 5AW0B 1G8KB 3GL0A 5GTHH 4KHXA 2YXQB 2K1AA 1GW3A 3LIDA 3HE5A 1ULJA 5L8RJ 1URQA 4AAYB 3SFEC 2B87A 4WY4A 5AW7B 3A0HE 4H44C 4PJ0H 1Q90C 2OTLP 3AE5C 2XRXA 3GLMA 1P84I 1IZNB 3MD0A 1NU1J 5C39A 2LKMA 4OH8B 2DE6D 1LWUA 4RJTA 3HUSB 3RK3B 3V2PA 5BOKA 2NRGA 2KIKA 3EWKA 3HTKB 5CCHD 3F89A 1EG9A 3M06A 3PJSK 2BCCE 2J59M 2R3SA 4DCKA 1HGZA 1USEA 4H13D 5BU8B 2UWJE 4JYCA 3GZXA 3TDKA 4N6JA 1GTWA 2WWWA 2E75B 3CL3D 3WUUA 3ZDMA 1IK9A 5TISH 1JTHB 2NWFA 5CCGA 1RE3A 2N9BA 1FDOA 1URQB 1NU1E 3C9IA 3BVHA 4OGQD 2V4HA 5M1BA 1GL2D 2P1JA 1LP1A 3IAOA 3HD7B 3MUDC 1PPJE 3B5ND 2HR3A 2XNXA 3IF4A 1KTMA 3L75E 2FYZA 2BCCJ 3G3ZA 2Y9YA 1SQQG 2D2CC 5KJ7D 3H6PA 4JBZA 1U7MA 1NTMJ 1FZEA 4Y99C 1SQBJ 2N9YB 3VMHD 3O6QB 4ZNCA 1ULIA 3GZYA 2HMJA 1NKNA 2IZ0A 2IBZE 1HJ0A 4NB8D 3L75G 2E74D 1NTZJ 2WSSH 1OW6A 1L0NG 1OIPA 1Y9BA 4HKVA 1L0LJ 3WU2E 4IFFA 1R8EA 4BRYB 5APYA 3CCMP 2M8RA 4EOTA 3CCEP 1MKMA 3WUVA 3CXHI 4KJMA 3TGUD 1JY2N 3H1IG 1T8ZA 3L74D 1SFCD 3KDPB 1GL2A 1EDIA 2M3BA 1KQFB 5H2FE 3VMYA 3SWKA 3RL0D 4WY4C 5APVA 3AE8C 5TISE 3HD7A 1BGYD 3TNUA 2IPPA 1ZV8A 1KMIZ 1LTGC 1VQNP 3CWBJ 1GK4A 2YMYA 1NTME 4L75A 4XFJA 2BCCG 1NJIQ 1CSBA 2WT7B 1M1JB 1QLED 3CC7P 3EFFK 5AVXB 1NTZE 1JM1A 1UIIA 1O7HA 1JM0A 2M5AA 2HMKA 4R4MA 3B5NC 3V2RA 1QVGO 2ZVNB 3BCCJ 5BVZA 3Q3DA 2NZ2A 1LT9A 4RO0A 3H1HJ 2E75C 1OW8A 3B5NB 2NUKA 2NPSC 1JY3P 3AEEC 4W7ZA 3CWBG 2A45H 2W83C 1H0TB 1P84D 4WY4D 1YQ4C 1Y8AA 1URQD 3CWBE 5E79E 2WITA 3GHGA 3VP9A 2K9YA 4H13C 1VQ6P 4BWNA 1RY3A 3RK3C 2Z5HA 2QA4P 1SQPE 4JYBA 4D6TE 3CPWO 2J58A 3H1IJ 3RBXA 3OW2O 3CX5I 3OAKA 2WMMA 1UUWA 1RE3C 1ZLLA 2DW3A 2BEZF 2XR8A 2KP8A 4C46A 2Y0CA 1H88A 3VMID 5AVRB 2ZVOB 3FXDA 3C1LA 5AVQB 3TGUG 2Q6QA 2A06G 3IN6A 1RHZB 4IFDK 1RF0C 2QJYC 2J5UA 3E1RA 1G1JA 2R5DA 3P8CD 3BRVB 2QJPB 3LIEA 3NTNA 2B88A 2E74B 4EYYQ 1WQLA 1CI6B 4UB8H 1MFZA 1S1CX 3L72D 4QUQA 4LC1A 2BMOA 5APSA 2D2CB 1T3JA 1YBKA 4PV1C 4NPEA 1DEEG 1SQQD 3W67A 4PD4E 2QEXP 5AVWB 4D6TJ 3D6YA 1DH3A 2E4QA 3H1IE 3N0QA 1IFPA 2YNYA 4DOJA 3V4QA 4ZKUA 2Q7CA 3QH9A 2A06E 1S5LX 1T2KC 3H1LD 1FAVA 1BSNA 2OARA 2KSJA 1HJBA 2H43A 3CCQP 2KUBA 2KZIA 1URQC 3BCCG 4IL6H 3PHLA 2LXBA 2HFED 2HG5D 4GIFA 2Q1KA 2Q3WA 3L75D 5TJHA 3VP8A 1T6AA 2W6BA 1FZCB 4NBAD 2Q5UA 5KTBA 2OYIB 1BE3E 3CXHE 1JUNA 2IX7C 1BCCE 2JKVA 1NTZK 3AE4C 4Y28J 1K8AQ 1NAFA 1EDJA 2GA1A 3OA7A 3G4SP 2JP3A 3H1LG 1JCCA 1L0NK 1BDCA 1PPJG 4O9BA 3SWYA 5GTHE 1J2JB 4HM7A 2IBZI 2YO3A 1Q90D 1AQ5A 1VQPP 1JMMA 3TK1A 4PV1D 2KLVA 1BSHA 2Y0DA 3O8ZA 2QSIA 1OW7A 3R4YA 3H1JE 4NBHD 1FZFA 4JPZB 2K88A 2QRXA 3TF5A 4H44B 1ZXGA 3PP5A 2XZRA 2MKVA 3VMZA 1EZVG 1NTKK 4EIJA 1FDMA 2AEJA 2FFDB 1NTZG 1S5LH 1BE3J 4HH2A 1RF1B 1SQXD 1Q7YQ
chains in the Genus database with same CATH topology
1L0NE 2FYNC 4NB9D 1SQBE 1SJGA 2YFLA 3H1HE 5CXMA 1PP9E 4QURA 3CWBE 2YIUC 1O7GA 2ZYLA 4H13D 1SQXE 5AEWA 1O7MA 5HL4A 3GZXA 3C0DA 3GB4A 1VM9A 1SQPE 2YFIA 4NBFD 2Q3WA 4D6TE 1VF5D 3GOBA 1G8JB 4NBAD 1RFSA 2NWFA 1O7NA 4HM4A 2GBWA 3DQYA 1BE3E 3CXHE 5KKZC 1UUWA 4QUPA 4EMJB 2B1XA 1EZVE 3H1KE 1NYKA 2DE5D 4HM6A 4NBED 3L71E 2XR8A 3VMGD 1BCCE 3L70E 1NU1E 4P1BH 4HM3A 4HM1A 1NTME 4H0LD 1P84E 4OGQD 1G8KB 2QJPC 2QPZA 2BMQA 1O7PA 3VMID 1KYOE 3L74E 2HMLA 3GL0A 2FYUE 1SQQE 4AIVA 2XSOA 2YFJA 4HM2A 2QJKC 4QDFA 4HM7A 1RIEA 1ULJA 3VCAA 2XSHA 1NTZE 3CX5E 1PPJE 3L73E 3AZCA 2E4PA 1JM1A 3L75E 4H44D 1VCKA 2QJYC 1O7HA 4AAYB 2HMKA 2JO6A 2E76D 3GCEA 1L0LE 4PV1D 3GL2A 4QDDA 3EQQA 4U3FE 2NVFA 3D89A 2YVJB 1O7WA 3TGUE 2HMOA 2HMMA 2NUMA 1Q90C 2XRXA 3EN1A 4QDCA 2E75D 5KLVE 1UUVA 2DE6D 4NBDD 2JZAA 1WQLA 3VMHD 3GZYA 1ULIA 2HMJA 2D2CD 2NVGA 4P1CH 3H1JE 4QUQA 4NBHD 1KB9E 2B24A 2BMOA 1FQTA 3FOUA 2IBZE 4QDFB 5BOKA 4NB8D 1BGYE 2ZT9D 4HJLA 3VCPA 1NDOA 4NBGD 2E74D 2CKFA 3L72E 2NUKA 4PD4E 5KLIC 4HKVA 4QCKA 1EG9A 1SQVE 4HM8A 5AEUA 2BMRA 2HMNA 2BCCE 3H1LE 4NBBD 2E4QA 2GBXA 3H1IE 3GKEA 2DE7D 1ZRTE 3N0QA 2I7FA 4HM0A 3GTEA 3GTSA 1NTKE 4HM5A 3BCCE 4NBCD 2A06E 2NVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0N E;  2FYN C;  4NB9 D;  1SQB E;  1SJG A;  2YFL A;  3H1H E;  5CXM A;  1PP9 E;  4QUR A;  3CWB E;  2YIU C;  1O7G A;  2ZYL A;  4H13 D;  1SQX E;  5AEW A;  1O7M A;  5HL4 A;  3GZX A;  3C0D A;  3GB4 A;  1VM9 A;  1SQP E;  2YFI A;  4NBF D;  2Q3W A;  4D6T E;  1VF5 D;  3GOB A;  1G8J B;  4NBA D;  1RFS A;  2NWF A;  1O7N A;  4HM4 A;  2GBW A;  3DQY A;  1BE3 E;  3CXH E;  5KKZ C;  1UUW A;  4QUP A;  4EMJ B;  2B1X A;  1EZV E;  3H1K E;  1NYK A;  2DE5 D;  4HM6 A;  4NBE D;  3L71 E;  2XR8 A;  3VMG D;  1BCC E;  3L70 E;  1NU1 E;  4P1B H;  4HM3 A;  4HM1 A;  1NTM E;  4H0L D;  1P84 E;  4OGQ D;  1G8K B;  2QJP C;  2QPZ A;  2BMQ A;  1O7P A;  3VMI D;  1KYO E;  3L74 E;  2HML A;  3GL0 A;  2FYU E;  1SQQ E;  4AIV A;  2XSO A;  2YFJ A;  4HM2 A;  2QJK C;  4QDF A;  4HM7 A;  1RIE A;  1ULJ A;  3VCA A;  2XSH A;  1NTZ E;  3CX5 E;  1PPJ E;  3L73 E;  3AZC A;  2E4P A;  1JM1 A;  3L75 E;  4H44 D;  1VCK A;  2QJY C;  1O7H A;  4AAY B;  2HMK A;  2JO6 A;  2E76 D;  3GCE A;  1L0L E;  4PV1 D;  3GL2 A;  4QDD A;  3EQQ A;  4U3F E;  2NVF A;  3D89 A;  2YVJ B;  1O7W A;  3TGU E;  2HMO A;  2HMM A;  2NUM A;  1Q90 C;  2XRX A;  3EN1 A;  4QDC A;  2E75 D;  5KLV E;  1UUV A;  2DE6 D;  4NBD D;  2JZA A;  1WQL A;  3VMH D;  3GZY A;  1ULI A;  2HMJ A;  2D2C D;  2NVG A;  4P1C H;  3H1J E;  4QUQ A;  4NBH D;  1KB9 E;  2B24 A;  2BMO A;  1FQT A;  3FOU A;  2IBZ E;  4QDF B;  5BOK A;  4NB8 D;  1BGY E;  2ZT9 D;  4HJL A;  3VCP A;  1NDO A;  4NBG D;  2E74 D;  2CKF A;  3L72 E;  2NUK A;  4PD4 E;  5KLI C;  4HKV A;  4QCK A;  1EG9 A;  1SQV E;  4HM8 A;  5AEU A;  2BMR A;  2HMN A;  2BCC E;  3H1L E;  4NBB D;  2E4Q A;  2GBX A;  3H1I E;  3GKE A;  2DE7 D;  1ZRT E;  3N0Q A;  2I7F A;  4HM0 A;  3GTE A;  3GTS A;  1NTK E;  4HM5 A;  3BCC E;  4NBC D;  2A06 E;  2NVE A; 
#chains in the Genus database with same CATH topology
 5KLI B;  2SPZ A;  1QVF O;  3LW5 H;  5CXM A;  1JTH A;  3HTK A;  4QUR A;  3AEG C;  3L70 J;  1SQB G;  1RF1 C;  1NTM G;  3GHG C;  3SWF A;  1CW5 A;  1IK7 A;  2Z5I A;  1KQL A;  1OWA A;  1NTZ D;  3S1K A;  1SQV G;  3M9Q A;  2C9N Y;  2N1T C;  1ZR2 A;  3CCS P;  4PJ0 E;  4HM4 A;  1NTK J;  2WSE J;  4XA4 A;  1SQP K;  2O01 N;  2O01 J;  1JY3 O;  5AW9 B;  3HD7 D;  1IC2 A;  1KYO E;  5B66 E;  1FZC A;  3CCV P;  3BRT B;  3H1J J;  5AW1 B;  4HM2 A;  1RIE A;  1HVV A;  2P2U A;  2XSH A;  3KPE A;  2WSC J;  2HPC B;  3NXS A;  1VL2 A;  2PFX A;  5KLV D;  1LNQ A;  5AW5 B;  3VTP C;  5AW8 B;  4GT1 A;  4LGD E;  1KB9 I;  2FFD A;  1GL2 C;  3AEC C;  2E75 D;  1FZG A;  2IBZ G;  3A0B E;  1PP9 J;  3B8E B;  1SP4 A;  2K9J B;  1K73 Q;  1FQT A;  1ZP0 C;  3GW6 A;  1A02 F;  1FZC C;  2AEM A;  1KIL A;  2B87 B;  1M56 D;  1LT1 A;  2BMR A;  2HMN A;  1BGY G;  4NBB D;  1N86 A;  1DEB A;  1NTK E;  1FJP A;  3CCL P;  1NYH A;  2FYU K;  2IYP A;  1L0L D;  3RL0 C;  3U59 A;  2BCC D;  1SJG A;  2OTK E;  4OWF A;  1FZB A;  1NHL A;  1NTM K;  1M57 D;  4YXW H;  2KNC A;  1VQO P;  3WU2 H;  4WWI A;  2OGU A;  2VRS A;  3PH0 A;  1JNM A;  1XTG B;  4HKZ H;  4UB6 E;  1KQG B;  1TU3 F;  3A7O A;  1PV3 A;  5AW4 B;  2E74 C;  4H0L D;  3SSU A;  2QJP C;  1NAY A;  1O7P A;  1N2D C;  2P58 A;  1SQQ K;  1NU1 D;  2XSO A;  4QDF A;  2PGD A;  3MHV A;  3CXH H;  1JY2 P;  4ZMD A;  2WPS A;  3WMM 0;  3FWL A;  3EQQ A;  3V2Q A;  3FX0 A;  3I56 P;  4QDC A;  1H0T A;  3HRN A;  1A02 J;  3AE3 C;  1QEX A;  1N73 C;  2IDB A;  2IFM A;  2JZA A;  2L91 A;  4OGQ C;  2ZJS E;  3GF7 A;  2ITA A;  1H8A A;  3VCP A;  2K37 A;  1T3U A;  1KYO I;  2RH0 A;  4ASW A;  1SQV E;  1T2K D;  2QIW A;  2I7F A;  4YPC A;  1KYO H;  4H13 B;  2A45 G;  3AE9 C;  1SQB E;  2ZXE B;  1ZME C;  1NU1 K;  2ZYL A;  1R5L A;  4Z1M H;  2I8D A;  3S4R A;  2XND H;  5KLV G;  1KOR A;  4YXD C;  4GOF A;  2PP6 A;  1OXZ A;  2YXR B;  1FOS E;  2ZT9 C;  3GF3 A;  1G2C A;  2G8Y A;  2V7Q H;  1IFJ A;  5CHX A;  1S72 P;  1YJW P;  2MJZ A;  1VQM P;  1VDF A;  1NTM D;  1AFO A;  3AEA C;  2JWD A;  2OQQ A;  4H44 D;  2H8P D;  5DJU B;  1FE6 A;  2E5T A;  2JO6 A;  2LR2 A;  1SQV J;  3RBZ A;  3U1A A;  2W27 A;  1FJK A;  3II6 A;  2GM4 A;  4UB6 H;  2KI7 B;  2A45 I;  4IFM A;  1GDT A;  1JMB A;  1FC2 C;  3B4S A;  1GK6 A;  1BCC G;  1EDL A;  3P8C E;  2JO1 A;  3A3Y B;  3JC2 2;  2E43 A;  1HUC A;  2R44 A;  4NBG D;  2CKF A;  4QCK A;  4WY4 B;  4HM8 A;  2OTJ P;  3KZI H;  4DT0 A;  1LWU B;  4W80 A;  2P10 A;  3Q5R A;  3BCC E;  4NBC D;  5GTI E;  1R5S A;  1SVF A;  4LLH A;  2WQY C;  3H1H E;  1GU4 A;  3CI9 A;  3L37 A;  3AE6 C;  3W68 A;  1OVV A;  4HYT B;  1VQK P;  3CMA P;  4H0L B;  1VQ9 P;  1BGY J;  2W8Z A;  2QE7 H;  1VM9 A;  3L72 J;  3QWO C;  1DD3 A;  1KB9 H;  2FXO A;  1K9M Q;  3S9O A;  3R2P A;  3MUD A;  1M1K Q;  1SLQ A;  1SQP D;  1RFS A;  3L71 D;  1N7S C;  4AYC A;  1KIL C;  3D71 A;  1OVU A;  5AW3 B;  1X9V A;  1L0L K;  1EZV E;  2XU6 A;  3H32 A;  4I1L A;  3VOP A;  2YMK A;  1FDI A;  1KN7 A;  1AQT A;  2QPZ A;  2O1J A;  2HML A;  3L73 D;  3L73 G;  1KC8 Q;  3G9R A;  1M90 Q;  1SFC A;  3VCA A;  4AQR D;  1S9K D;  2NPS D;  3CX5 E;  3Q1M A;  2E4P A;  4NPF X;  1N73 B;  3HD7 C;  1L4A D;  3VN0 A;  2HOD A;  3TGU E;  2JR8 A;  3L71 G;  2QM8 A;  3V2N A;  3RK3 E;  5AVT B;  1LTS C;  1OMI A;  2M3E A;  1G1I A;  4ASV A;  2O01 H;  1BGY E;  1NDO A;  1Z56 A;  3RK2 C;  3L72 E;  1PGQ A;  2RN0 A;  3CC4 P;  1N7L A;  5AVV B;  4HB1 A;  1OVR A;  3PLN A;  3AE1 C;  3PRJ A;  1SQP G;  1ZOY C;  4HM5 A;  1M7L A;  1S3J A;  3L70 G;  4U3F D;  3AED C;  3MIW A;  5GTI H;  2FYN C;  3MZW B;  1J1D B;  3L4F A;  4I2L C;  3MP7 B;  1JEK A;  2A06 D;  4IL6 X;  1YTZ T;  1IFM A;  3BAT A;  5AVY B;  1J1E C;  3JCU E;  3P32 A;  3NFQ A;  4UB8 E;  2B89 A;  3KQG A;  5AVZ B;  2IZ1 A;  4NPD A;  2E76 B;  3SFD C;  3VMX A;  5CCH C;  3TGU J;  3EQ2 A;  2XKM A;  3HUS C;  2GUV A;  2M0B A;  4NBE D;  5CCH A;  1BE3 D;  2Y0E A;  1EXJ A;  3M0D A;  4GDO A;  2FXM A;  2JDI H;  2LXC B;  2YFJ A;  4TT3 H;  4DJG A;  3KHU A;  4L76 A;  1MFT A;  4N78 D;  1PFI A;  2HMO A;  3CWB D;  2JEE A;  2KXP B;  1SQB D;  2WT7 A;  4BXL A;  3K5B A;  2FY8 A;  1LTJ C;  5EFW B;  2D2C D;  5APT A;  1KB9 E;  3FOU A;  1OZH A;  5CBN A;  4I7Z B;  4HJL A;  3H1H G;  4I6M C;  1VQ8 P;  2H88 C;  3I5C A;  3P8M C;  2GBX A;  3CME P;  2I1K A;  5CCG D;  3FWN A;  2OYI A;  1RE4 A;  2WVR A;  2E42 A;  1S2E A;  3L35 A;  1SQX E;  4I7Z C;  2CPB A;  3NMD A;  1U7J A;  1NWQ A;  1NTK D;  2XV5 A;  1QGK B;  3D6Z A;  1WT6 A;  2O3J A;  2B9B A;  1EQ7 A;  5KLV K;  1VF5 D;  5KAI H;  3Q5P A;  1PGJ A;  2GBW A;  1BDD A;  5KKZ C;  5CBO A;  2OYO A;  1U57 A;  2FYU D;  3IR9 A;  2KK7 A;  2O1K A;  3A0B H;  3M9B A;  1HF9 A;  3CD6 P;  4U3F G;  3L70 E;  1DD4 A;  2Y9Z A;  1W2B O;  2YIU B;  1S4X A;  1SQQ E;  1IJD B;  5BU5 A;  4PD4 D;  2AXT H;  1NVO A;  2QJK C;  3TYY A;  1GMJ A;  1WRG A;  1HBW A;  3H32 B;  1CZQ A;  1YJ9 P;  3CC2 P;  3T97 B;  4XE5 B;  4EI2 A;  1KD1 Q;  2E76 C;  3BCC D;  3H1K J;  5CMZ A;  3H1K G;  5KLV E;  1J1E B;  1L0N J;  1YQ3 C;  4IL6 E;  1DIP A;  4P1C H;  2AEF A;  1N73 A;  1IO4 A;  3FXE A;  1SQX K;  3A0H H;  2ZFC A;  5E79 H;  1J1D C;  2FYN B;  1L0L G;  2FXP A;  4U3F J;  1ZRT E;  1JO5 A;  2KSE A;  1VF5 C;  1Q82 Q;  2QJK B;  1N7S A;  2KS1 A;  4NB9 D;  1K04 A;  1UIX A;  1PP9 E;  2YIU C;  2C0W A;  2WTY A;  2KYV A;  1SQQ J;  3CX5 D;  2BAS A;  2IBZ D;  2AXC A;  3AE2 C;  1SFC B;  2ZXX A;  3GOB A;  4AUW A;  2R5B A;  2KLU A;  3RK3 D;  2B1X A;  2K3R A;  3H1K E;  2ZAE B;  3VYI A;  1NO4 A;  1KFN A;  5AVS B;  5B5E E;  3P7K A;  5KLV J;  4HM3 A;  3F5H A;  3KXD A;  1LT9 B;  2BMQ A;  3M9H A;  4PV1 B;  1L4A B;  3Q5S A;  2FKW B;  4PD4 I;  3V6I A;  1KQS O;  2WSF H;  3GL2 A;  4QDD A;  4U3F E;  5APW A;  3D89 A;  2HMM A;  1NKZ B;  1YIT P;  2Q3E A;  5KAI E;  2NPS A;  1LTJ B;  4NBD D;  4W7Y A;  2P67 A;  1VQL P;  4QDF B;  4H0L C;  1ZW0 A;  2BEQ D;  1Y47 A;  1SQX G;  2N1T A;  3CCR P;  2H7H A;  2Z4E A;  3ITK A;  1EZV I;  1KZU B;  1O7G A;  1ZR4 A;  4WBA A;  1VPC A;  5HL4 A;  3C0D A;  1VQ5 P;  2N1T D;  1L4A A;  3I55 P;  4N78 E;  1KIL E;  3L75 J;  3JSV C;  1FOS F;  3DQY A;  3GMA A;  1RF1 A;  4EMJ B;  2WPQ A;  2DE5 D;  4HM6 A;  3RK2 D;  3VMG D;  5K5G B;  2NPS B;  1P84 E;  1GZL A;  5DJT B;  2HOD B;  1W5C E;  3CLQ A;  1PPJ D;  2RKL A;  1QX8 A;  2W6J H;  3KZI E;  1EDK A;  2WSF J;  1LTI C;  3AZC A;  3HUS A;  4N3Y B;  3B71 A;  3WUT A;  1YIJ P;  2KB7 P;  1L0L E;  1LTA C;  1VQ7 P;  3RK2 B;  4D6T D;  2W6A A;  3L71 J;  1PZQ A;  3EN1 A;  3L74 G;  3OJA B;  1RE4 C;  4K35 A;  5H2F H;  1GW4 A;  1RH5 B;  2Q9I A;  1FBM A;  1M1J C;  2B24 A;  3T97 A;  4JQ0 D;  3UIA A;  2QVA A;  3L73 J;  3FGA D;  3A2A A;  5KAF H;  2I1J A;  1LTJ A;  3GKE A;  3D70 A;  2CK3 H;  2K9J A;  5B5E H;  3AE7 C;  1DX7 A;  3HE4 B;  2KOG A;  3N7N A;  1PL5 A;  4OGQ B;  1O7M A;  1YJN P;  2Q3I A;  3L72 G;  4K3A A;  1KIL B;  2C9L Y;  1N7S B;  2KS1 B;  1X79 B;  5CCG C;  1AV1 A;  2G3A A;  5APQ A;  2YKO A;  1D7M A;  4QUP A;  1Q86 Q;  3L71 E;  3Q2Y A;  3CCU P;  1NU1 G;  3CX5 H;  1L0N D;  2L5G B;  2QM7 A;  1NGM B;  4WVZ A;  1FU1 A;  4L74 A;  1Q2N A;  1FZA A;  5KJ7 C;  4GOE A;  1LWU C;  3L73 E;  3KYQ A;  1JY2 O;  4Y99 B;  4HJG H;  1X22 A;  2E76 D;  1LJ2 A;  1GD2 E;  1S9K E;  1VQ4 P;  3VMA A;  4B86 A;  2YVJ B;  2RMZ A;  3V4W A;  2NUM A;  2WSC H;  5CJ0 A;  1QL1 A;  3E1I A;  4YTP C;  2WPV B;  2IYO A;  3CXH D;  3LW5 J;  5AW2 B;  1WMK A;  1NH4 A;  2FYU J;  2NVG A;  1BCC D;  2PAJ A;  2WZ7 A;  1HH0 A;  1SQP J;  2IFN A;  1LTB C;  3RL0 B;  3M91 A;  5KAF E;  1SS1 A;  3CCJ P;  1PGP A;  1CI6 A;  2DE7 D;  1SQV K;  3G71 P;  5B66 H;  3M0A A;  3H25 A;  4PD4 H;  2POH A;  1YI2 P;  1HGV A;  2ZT9 B;  4QMA A;  2CPS A;  1XTC C;  1K05 A;  4NBF D;  4IOI H;  3H1J D;  2HYN A;  1QL2 A;  2HPC A;  1ZN5 A;  2JJL A;  2V7Q J;  4OVN F;  1YYC A;  4RKU J;  2H89 C;  2YO2 A;  1JOC A;  1IFI A;  4HM1 A;  1L2P A;  4MN4 C;  4JF7 A;  2WSE H;  5APU A;  3GG2 A;  4KT0 J;  2FYU E;  1X0T A;  1EXI A;  3RL0 g;  3U1C A;  1G2C B;  1MUU A;  1NOH A;  2WPR A;  1L4A C;  3GCE A;  3H1J G;  1MV8 A;  3A5T A;  3H1H D;  2E5Y A;  2N1T B;  1LT9 C;  1PGO A;  2C0X A;  3L36 A;  2HLO A;  1KFM A;  2XDJ A;  1X8Y A;  3AEF C;  1USD A;  3EFG A;  1OX3 A;  3RGU A;  1M1J A;  1JCD A;  1E79 H;  1FS0 E;  4EDF A;  3JCU H;  3H1I D;  1SFC C;  5KLI C;  1KIL D;  2YKQ A;  3V5B A;  1LGH B;  1EZV D;  3H1L E;  2ZYG A;  5APX A;  2FFD C;  3ABV C;  3GTE A;  3GTS A;  2JWA A;  5CJ4 A;  2NVE A;  1RQV A;  2FBW C;  2YFL A;  1IFN A;  1JY3 N;  3B5N A;  1BCC J;  1P84 H;  3BAS A;  1BE3 G;  1ZRT D;  5AEW A;  1VF5 B;  2GUS A;  3GB4 A;  2R32 A;  5AVU B;  1HTL C;  3TSI A;  1PP9 D;  4R4L A;  1AA0 A;  2W90 A;  1JB0 J;  3MGN A;  4BRY A;  1O7N A;  1MZ9 A;  1LP1 B;  2PRR A;  2KNC B;  1N8R Q;  2OYH B;  4DZO A;  4C7N B;  4A7P A;  1NYK A;  1Q81 Q;  4CPG A;  4P1B H;  1SQX J;  3L74 E;  3MTU E;  4WB4 A;  4AIV A;  1W2E A;  3H1K D;  3L70 D;  4ZKP A;  2ZYA A;  2AXT E;  1M8O B;  5AW6 B;  1RF0 A;  3O6Q A;  1AVY A;  5KJ7 A;  4M3L A;  1VCK A;  1PP9 G;  1AJY A;  3H1L J;  2OYI C;  2NVF A;  1O7W A;  1UUV A;  3HE4 A;  1H89 A;  1YTZ I;  1E5W A;  1RQU A;  2KZJ A;  1IFD A;  5KKZ B;  1GL2 B;  3HE5 B;  2ZT9 D;  3E7K A;  1KV4 A;  1SQB K;  3N4X A;  5AEU A;  1PIX A;  3AEB C;  1YHQ P;  4HM0 A;  1LTT C;  2OYH C;  3PTZ A;  1S5L E;  4GKG A;  4C7R A;  4L73 A;  1L0N E;  2OYH A;  1NTK G;  3TNU B;  1EC5 A;  2QG4 A;  4C7N A;  3L74 J;  4D6T G;  2YKP A;  1N7S D;  1GU5 A;  2YFI A;  3C8V A;  3IFM A;  2P7J A;  2ZYD A;  1AVO A;  1OFC X;  2R3C A;  3G6E P;  4RES B;  1G8J B;  4GOD A;  3M0D C;  2M5A B;  2FYU G;  4U7J A;  1SQV D;  4TLF A;  2QJY B;  1KYO D;  1HWT C;  1KB9 D;  3GHG B;  3USS A;  5AW0 B;  1G8K B;  3GL0 A;  5GTH H;  4KHX A;  2YXQ B;  2K1A A;  1GW3 A;  3LID A;  3HE5 A;  1ULJ A;  5L8R J;  1URQ A;  4AAY B;  3SFE C;  2B87 A;  4WY4 A;  5AW7 B;  3A0H E;  4H44 C;  4PJ0 H;  1Q90 C;  2OTL P;  3AE5 C;  2XRX A;  3GLM A;  1P84 I;  1IZN B;  3MD0 A;  1NU1 J;  5C39 A;  2LKM A;  4OH8 B;  2DE6 D;  1LWU A;  4RJT A;  3HUS B;  3RK3 B;  3V2P A;  5BOK A;  2NRG A;  2KIK A;  3EWK A;  3HTK B;  5CCH D;  3F89 A;  1EG9 A;  3M06 A;  3PJS K;  2BCC E;  2J59 M;  2R3S A;  4DCK A;  1HGZ A;  1USE A;  4H13 D;  5BU8 B;  2UWJ E;  4JYC A;  3GZX A;  3TDK A;  4N6J A;  1GTW A;  2WWW A;  2E75 B;  3CL3 D;  3WUU A;  3ZDM A;  1IK9 A;  5TIS H;  1JTH B;  2NWF A;  5CCG A;  1RE3 A;  2N9B A;  1FDO A;  1URQ B;  1NU1 E;  3C9I A;  3BVH A;  4OGQ D;  2V4H A;  5M1B A;  1GL2 D;  2P1J A;  1LP1 A;  3IAO A;  3HD7 B;  3MUD C;  1PPJ E;  3B5N D;  2HR3 A;  2XNX A;  3IF4 A;  1KTM A;  3L75 E;  2FYZ A;  2BCC J;  3G3Z A;  2Y9Y A;  1SQQ G;  2D2C C;  5KJ7 D;  3H6P A;  4JBZ A;  1U7M A;  1NTM J;  1FZE A;  4Y99 C;  1SQB J;  2N9Y B;  3VMH D;  3O6Q B;  4ZNC A;  1ULI A;  3GZY A;  2HMJ A;  1NKN A;  2IZ0 A;  2IBZ E;  1HJ0 A;  4NB8 D;  3L75 G;  2E74 D;  1NTZ J;  2WSS H;  1OW6 A;  1L0N G;  1OIP A;  1Y9B A;  4HKV A;  1L0L J;  3WU2 E;  4IFF A;  1R8E A;  4BRY B;  5APY A;  3CCM P;  2M8R A;  4EOT A;  3CCE P;  1MKM A;  3WUV A;  3CXH I;  4KJM A;  3TGU D;  1JY2 N;  3H1I G;  1T8Z A;  3L74 D;  1SFC D;  3KDP B;  1GL2 A;  1EDI A;  2M3B A;  1KQF B;  5H2F E;  3VMY A;  3SWK A;  3RL0 D;  4WY4 C;  5APV A;  3AE8 C;  5TIS E;  3HD7 A;  1BGY D;  3TNU A;  2IPP A;  1ZV8 A;  1KMI Z;  1LTG C;  1VQN P;  3CWB J;  1GK4 A;  2YMY A;  1NTM E;  4L75 A;  4XFJ A;  2BCC G;  1NJI Q;  1CSB A;  2WT7 B;  1M1J B;  1QLE D;  3CC7 P;  3EFF K;  5AVX B;  1NTZ E;  1JM1 A;  1UII A;  1O7H A;  1JM0 A;  2M5A A;  2HMK A;  4R4M A;  3B5N C;  3V2R A;  1QVG O;  2ZVN B;  3BCC J;  5BVZ A;  3Q3D A;  2NZ2 A;  1LT9 A;  4RO0 A;  3H1H J;  2E75 C;  1OW8 A;  3B5N B;  2NUK A;  2NPS C;  1JY3 P;  3AEE C;  4W7Z A;  3CWB G;  2A45 H;  2W83 C;  1H0T B;  1P84 D;  4WY4 D;  1YQ4 C;  1Y8A A;  1URQ D;  3CWB E;  5E79 E;  2WIT A;  3GHG A;  3VP9 A;  2K9Y A;  4H13 C;  1VQ6 P;  4BWN A;  1RY3 A;  3RK3 C;  2Z5H A;  2QA4 P;  1SQP E;  4JYB A;  4D6T E;  3CPW O;  2J58 A;  3H1I J;  3RBX A;  3OW2 O;  3CX5 I;  3OAK A;  2WMM A;  1UUW A;  1RE3 C;  1ZLL A;  2DW3 A;  2BEZ F;  2XR8 A;  2KP8 A;  4C46 A;  2Y0C A;  1H88 A;  3VMI D;  5AVR B;  2ZVO B;  3FXD A;  3C1L A;  5AVQ B;  3TGU G;  2Q6Q A;  2A06 G;  3IN6 A;  1RHZ B;  4IFD K;  1RF0 C;  2QJY C;  2J5U A;  3E1R A;  1G1J A;  2R5D A;  3P8C D;  3BRV B;  2QJP B;  3LIE A;  3NTN A;  2B88 A;  2E74 B;  4EYY Q;  1WQL A;  1CI6 B;  4UB8 H;  1MFZ A;  1S1C X;  3L72 D;  4QUQ A;  4LC1 A;  2BMO A;  5APS A;  2D2C B;  1T3J A;  1YBK A;  4PV1 C;  4NPE A;  1DEE G;  1SQQ D;  3W67 A;  4PD4 E;  2QEX P;  5AVW B;  4D6T J;  3D6Y A;  1DH3 A;  2E4Q A;  3H1I E;  3N0Q A;  1IFP A;  2YNY A;  4DOJ A;  3V4Q A;  4ZKU A;  2Q7C A;  3QH9 A;  2A06 E;  1S5L X;  1T2K C;  3H1L D;  1FAV A;  1BSN A;  2OAR A;  2KSJ A;  1HJB A;  2H43 A;  3CCQ P;  2KUB A;  2KZI A;  1URQ C;  3BCC G;  4IL6 H;  3PHL A;  2LXB A;  2HFE D;  2HG5 D;  4GIF A;  2Q1K A;  2Q3W A;  3L75 D;  5TJH A;  3VP8 A;  1T6A A;  2W6B A;  1FZC B;  4NBA D;  2Q5U A;  5KTB A;  2OYI B;  1BE3 E;  3CXH E;  1JUN A;  2IX7 C;  1BCC E;  2JKV A;  1NTZ K;  3AE4 C;  4Y28 J;  1K8A Q;  1NAF A;  1EDJ A;  2GA1 A;  3OA7 A;  3G4S P;  2JP3 A;  3H1L G;  1JCC A;  1L0N K;  1BDC A;  1PPJ G;  4O9B A;  3SWY A;  5GTH E;  1J2J B;  4HM7 A;  2IBZ I;  2YO3 A;  1Q90 D;  1AQ5 A;  1VQP P;  1JMM A;  3TK1 A;  4PV1 D;  2KLV A;  1BSH A;  2Y0D A;  3O8Z A;  2QSI A;  1OW7 A;  3R4Y A;  3H1J E;  4NBH D;  1FZF A;  4JPZ B;  2K88 A;  2QRX A;  3TF5 A;  4H44 B;  1ZXG A;  3PP5 A;  2XZR A;  2MKV A;  3VMZ A;  1EZV G;  1NTK K;  4EIJ A;  1FDM A;  2AEJ A;  2FFD B;  1NTZ G;  1S5L H;  1BE3 J;  4HH2 A;  1RF1 B;  1SQX D;  1Q7Y Q; 
#chains in the Genus database with same CATH homology
 1L0N E;  2FYN C;  4NB9 D;  1SQB E;  1SJG A;  2YFL A;  3H1H E;  5CXM A;  1PP9 E;  4QUR A;  3CWB E;  2YIU C;  1O7G A;  2ZYL A;  4H13 D;  1SQX E;  5AEW A;  1O7M A;  5HL4 A;  3GZX A;  3C0D A;  3GB4 A;  1VM9 A;  1SQP E;  2YFI A;  4NBF D;  2Q3W A;  4D6T E;  1VF5 D;  3GOB A;  1G8J B;  4NBA D;  1RFS A;  2NWF A;  1O7N A;  4HM4 A;  2GBW A;  3DQY A;  1BE3 E;  3CXH E;  5KKZ C;  1UUW A;  4QUP A;  4EMJ B;  2B1X A;  1EZV E;  3H1K E;  1NYK A;  2DE5 D;  4HM6 A;  4NBE D;  3L71 E;  2XR8 A;  3VMG D;  1BCC E;  3L70 E;  1NU1 E;  4P1B H;  4HM3 A;  4HM1 A;  1NTM E;  4H0L D;  1P84 E;  4OGQ D;  1G8K B;  2QJP C;  2QPZ A;  2BMQ A;  1O7P A;  3VMI D;  1KYO E;  3L74 E;  2HML A;  3GL0 A;  2FYU E;  1SQQ E;  4AIV A;  2XSO A;  2YFJ A;  4HM2 A;  2QJK C;  4QDF A;  4HM7 A;  1RIE A;  1ULJ A;  3VCA A;  2XSH A;  1NTZ E;  3CX5 E;  1PPJ E;  3L73 E;  3AZC A;  2E4P A;  1JM1 A;  3L75 E;  4H44 D;  1VCK A;  2QJY C;  1O7H A;  4AAY B;  2HMK A;  2JO6 A;  2E76 D;  3GCE A;  1L0L E;  4PV1 D;  3GL2 A;  4QDD A;  3EQQ A;  4U3F E;  2NVF A;  3D89 A;  2YVJ B;  1O7W A;  3TGU E;  2HMO A;  2HMM A;  2NUM A;  1Q90 C;  2XRX A;  3EN1 A;  4QDC A;  2E75 D;  5KLV E;  1UUV A;  2DE6 D;  4NBD D;  2JZA A;  1WQL A;  3VMH D;  3GZY A;  1ULI A;  2HMJ A;  2D2C D;  2NVG A;  4P1C H;  3H1J E;  4QUQ A;  4NBH D;  1KB9 E;  2B24 A;  2BMO A;  1FQT A;  3FOU A;  2IBZ E;  4QDF B;  5BOK A;  4NB8 D;  1BGY E;  2ZT9 D;  4HJL A;  3VCP A;  1NDO A;  4NBG D;  2E74 D;  2CKF A;  3L72 E;  2NUK A;  4PD4 E;  5KLI C;  4HKV A;  4QCK A;  1EG9 A;  1SQV E;  4HM8 A;  5AEU A;  2BMR A;  2HMN A;  2BCC E;  3H1L E;  4NBB D;  2E4Q A;  2GBX A;  3H1I E;  3GKE A;  2DE7 D;  1ZRT E;  3N0Q A;  2I7F A;  4HM0 A;  3GTE A;  3GTS A;  1NTK E;  4HM5 A;  3BCC E;  4NBC D;  2A06 E;  2NVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...