5KMGB

Near-atomic cryo-em structure of prc1 bound to the microtubule
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
431
structure length
431
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Near-atomic cryo-EM structure of PRC1 bound to the microtubule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 176
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kmgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kmgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kmgB01
4U3JB 4ZOLA 4X1IB 5EYPB 2VAPA 3JALB 4M8IA 4DRXA 4YJ2A 3VPAA 3HKDA 4O2AA 4E6EA 3HKCA 4YJ3B 4TV9A 2RHHA 4B46A 2GVIA 3C8LA 2Q1XA 5CB4B 3HKBA 5GONB 3WGNA 3HKEA 3CB2A 4WBNB 1W59A 4XCQA 2RHJA 4LNUB 4TUYA 4X1IA 1W5BA 5EZYA 3JARB 3RYHA 1W5EA 3RB8A 3V3TA 4TV8B 5MN6A 4X20A 4EB6A 5MN5A 5LYJB 3ZBPA 1TVKB 4O2AB 3JATB 3VOBA 3HKEB 1TUBB 4O4HA 5LA6B 5JVDB 1FFXA 4ZHQB 3M8KA 5ITZA 3HKBB 5CA1B 4YJ3A 3RYCA 4EI9A 3JAKA 4ZOLB 1SA0A 3JALA 5LXTB 4O4JA 4TV8A 5EIBC 3E22A 5IJ0A 5EZYB 1FSZA 5KMGB 4EI8A 1Z5VA 5JH7A 1W5FA 5M7EA 3M89A 2VAMA 4FFBA 3ZIDA 5BMVB 3RYHB 3JAWA 2BTOA 4TUYB 5C8YB 3N2GA 4HNAA 3RYFA 4WBNA 2BTQB 1W5AA 1Z5WA 3JASB 4ZI7B 5CB4A 5CA1A 2XKBA 4IHJA 3HKCB 2Q1YA 5JVDA 4DXDA 3ZBQA 4I4TA 3JATA 4IIJA 4O4LA 4I55A 4X20B 4EB6B 3R4VA 5BMVA 1FFXB 4ZHQA 3VOAA 2RHOA 1TUBA 5KX5B 2BTQA 4I50A 3N2KB 4X1KB 2VAWA 3E22B 4O2BA 4O4IA 3WGLA 4O4LB 5LOVA 3RYCB 5J2TB 3RYIB 5IJ0B 1SA0B 3UT5B 5IYZB 5LXTA 4IHJB 5JQGA 4ZI7A 1JFFB 3N2GB 3RYFB 4IIJB 5J2UA 4YJ2B 4DRXB 1RLUA 4X1YB 5IJ9B 3JAWB 5C8YA 5LOVB 5J2TA 1RQ7A 5MN4A 4HNAB 5LP6B 4FFBB 4O4IB 3WGJA 3JASA 4X1KA 3N2KA 4I50B 3WGKA 5CA0A 5FNVA 4LNUA 3WGMA 2R6R1 5KX5A 4F6RB 4TV9B 4I55B 3VO9A 2VXYA 3HKDB 5IJ9A 1JFFA 5GONA 4I4TB 3VO8A 2XKAA 4KWEA 4U3JA 5EYPA 2RHLA 3UT5A 5IYZA 1OFUA 2R751 5JQGB 4EI7A 3RYIA 5CA0B 3JARA 4O2BB 1RQ2A 1W581 5LYJA 4F6RA 4B45A 4O4HB 5LA6A 5FNVB 1TVKA 5LP6C 5JH7B 4O4JB 4X1YA 5JCOC 5JCOA 3JAKB 5J2UB 5KMGA 5EIBD 5LP6A 5ITZB 4U39A
chains in the Genus database with same CATH superfamily
2X2PA 1PHRA 1DEHA 2XTMA 3OTHA 1UKCA 5HVNA 1LWOA 1P61B 1NTMH 1XMQO 2BMWA 2KG7B 3OQHA 4F7DA 3DXRA 2GXSA 3LDDA 4FU0A 3L73H 1THGA 5CB4B 1XXHE 4NBTA 4TZTA 4QOIA 2HW8A 3O82A 3ZX4A 1SKBA 1U7OA 3E15A 4RH0A 5TIIA 2ONCA 4WZBB 4NXNO 4PR0A 4QNHB 2RGWA 3OCUA 5I7HA 3KJXA 1I7FA 2FX2A 4LWZA 4JBNA 4NVPA 2PMFA 4CMBA 4DLLA 3ZDBA 3QVUA 1RYZA 4FZ3A 4L8VA 4C7KA 3S2FA 3KSBC 1GRJA 4PCLA 5C5DA 5JNVA 2IH4A 1F0KA 2RJOA 5DK6A 3TTWA 3I01A 4D9HA 3P26A 1QJ4A 3OUTA 1HE2A 1R4ZA 1JQ0A 3TGUH 4HB3A 4UOQA 4EHLA 2H54A 2VJNA 5DNUA 2QX9A 4R2HA 3E7DA 4DSZA 4MPJA 4K3AA 1BS1A 5JC1A 2GDJA 1FA9A 2EZTA 2JIQA 2EF0A 5G4UC 3LO8A 3D2AA 3GLGE 3JCMM 4DUYO 4UCTA 4QXRA 3MRSA 3I73A 4BX0A 2FPIB 1C2TA 3P19A 4QUDA 5H7XA 1NMXA 2V58A 2J9FA 3I5UA 3OX1A 4PCVA 1F4MA 4CTKA 4Z51A 1YIOA 1Y82A 1ZK1A 2JFYA 2JIZA 4FI3F 3HWRA 1QGAA 3SQWA 2WUFA 4BQRA 4F1JA 2C2XA 1MX5A 4IGGA 3OP4A 4Z0NA 3FM9A 4LZWA 4V0OA 2CV0A 4CGZA 2ZUSA 3P4YA 5BNZA 5DTIA 2D1TA 3HCRA 3FWKA 2KSDA 1RHRA 4RPKA 1KZ6A 4UC0A 4R31A 4FVMA 3COVA 4XIYA 5K8UA 2BLLA 4IIYA 1TUBA 1G60A 1TZCA 2YFHA 3MCZA 2A9HA 2C9YA 3CKKA 3AF2A 3LDFA 1VGQA 4G0YA 3ZDXB 4JP3A 1L7MA 4JVMA 4F7WA 2VCYA 4ZVTA 3O4HA 2ZIMA 4JUFA 1GN9A 2CCKA 2QL9A 4QDOA 3UANA 5CDFE 3ELYA 2RGAA 4MTLA 4PSCA 4EYOA 4ETNA 1NXPA 5AP9A 3KX2A 2ISCA 3UHAA 2C4UA 3V4VB 2Y0PA 4UFZA 1T8RA 1JRLA 2XQIA 3D01A 4Q39A 5BN5A 1Q16A 5EK0A 3FDXA 4MWDA 1E6CA 1GNSA 3TGLA 4ZVUA 1O6GA 3UMYA 3RYFB 5B53A 2J3DA 1D1SA 1KVRA 4GZ3A 4A91A 1ENZA 2HNAA 3T9CA 4IWXA 3IE0A 1A4IA 1YQGA 3BPZA 4LYJA 1QV7A 3KQWA 1QHEA 3EOZA 3C4VA 2H0RA 4W6QA 2NSDA 4WEQA 4XX0A 3VVMA 2Q73A 3Q3EA 4B7CA 3J81A 4KNYA 3DQZA 3CZ9A 2XE7A 4DJDC 5FPSA 3DE1X 3CUTA 4NL4H 4Q02A 3E58A 3II6X 3KLMX 5EHQA 3WP1B 4R5HA 1ISIA 1H3FA 1PX2A 1W1IA 3K9AA 5KTRA 5CK4A 1PJ4A 1KNQA 4WXRA 3RFCA 3HWUA 3KQYA 4MVRA 1GNTA 3A58B 1XZDA 2DBRA 3DLPX 4IZIA 1K9MW 3RO7A 2DBYA 4CE6A 1RKVA 2WUWE 3WAKA 3QYAA 3JARA 1OLSB 1WW8A 2ZWPA 3VRHA 5COBA 4W8HA 1HOTA 4FJ0A 3SHTA 4TVSA 2QORA 2Q5ZA 4NCAA 2WQ6A 1GLGA 4AP9A 1P1RA 4PQGA 3EG9A 5DFAA 4D4MA 1ENYA 2AI2A 4AYXA 2QE6A 3RHTA 1SQVH 3MJVA 4V03A 3VC3A 1DEAA 5HUJA 3I76A 2KJQA 2ZR2A 3WK8A 3QM1A 4RJKA 1PSDA 1M72A 1YWGO 4B46A 2DFKB 4Y6LA 4MUIA 3H2GA 4AKSA 3ZEDA 4DEYA 3BFJA 1HWYA 2EQ5A 5A7GA 1Z73A 4RHEA 4MV1A 1YIJF 1YVPA 3NRBA 1JV2B 1W96A 3AR6A 3JAMM 5EKDA 5AFSA 4MI9A 4B6GA 1TPZA 2LP4Y 3C15C 1I0IA 4BIUA 3MLEA 3L0BA 3PT5A 4QGFA 4EYQA 3G8YA 4DR5O 3VYTC 2VQ6A 3MILA 2CNWD 2WWVD 4DNQA 4C4WC 3G4SV 4A2CA 2WUDA 4R41A 4BUZA 1ZIPA 4KAXA 4G4JA 4CG1A 3Q9NA 2FGYA 5A2GA 3RUFA 1EVLA 4KR0A 3HCOA 2IU4A 1JWAB 2BR3A 2MSCB 4N9WA 2RFLA 3V32A 4D6YA 3FAVB 1TKRA 2YI9A 2OZKA 1KVSA 4BS9A 1K3FA 3KR0A 1O9GA 2R0QC 3DFFA 5EXSA 5EZYF 2VP4A 3KQOA 3ODGA 4MV3A 5H4HA 4LZAA 4HWPA 2VDPB 2D2IA 2FZGA 2L2QA 2VP0A 3PUXA 5A2QM 1D2HA 2Y77A 5DHTA 2H1WA 5H59A 4BW9A 4B4WA 3NS7A 1SUPA 5CT6A 3JRNA 2IUSA 3AUXA 4O25A 3GJ6A 5BW5A 1W7AA 1A9PA 3QMPA 1E7KA 1ROPA 5B6PA 4PHGA 1X1EA 3K53A 2ZTVA 3QU9A 3RFFA 4D0NA 4MCAA 3L0IB 3A9UA 3BA8A 1N8NA 1KD1W 2A6PA 4QYSA 4WXEA 2P6NA 5IN5A 2KG4A 2YN0A 3QHDA 1TM5E 1A88A 1PFKA 3PRYA 3WGHA 4R16A 1XBIA 4NYMQ 4J3FA 1D3AA 2EWVA 4ZVKA 5DCWA 4N5HX 1D6MA 1Z5UA 4NMHA 5TMEA 1W73A 3B20A 3GEGA 4MLPA 4D0LB 2CJXA 3AHJA 3CONA 3O2QB 2P6JA 2OGTA 2GTAA 3AY7A 3PQ3A 4LJAA 3PWSA 2HV8A 1NVDA 3TOXA 3TB6A 5H9WA 5K3CA 1WBBA 3KE9A 1JLLB 1ADCA 1SA0B 5EXEA 3M9XA 3NEJA 4CM5A 2AQHA 4MGHA 2JANA 3IODA 5BVHA 2D3OW 1BO6A 3IBSA 4WDQA 2RHBA 3SYAA 3WNCA 1URFA 1WCWA 1U2EA 3QA3E 4DY4A 5IYZF 3UC9A 3L7BA 2AN4A 1Y76B 1CUAA 1G21A 1UM9B 2CHVA 2HM7A 3KZ1E 2I62A 1UKZA 2NPIA 4R81A 4N7MA 4XJVA 3T5DA 3ACDA 4J80A 4EABA 1X25A 1RSZA 2ODBA 2I6DA 2QT1A 2VK4A 2DPHA 3NBMA 5DH9A 5JWPA 3SQMA 4DBZA 3SC6A 4LPSA 4L0DA 1U2DC 4ID3A 4N82A 1W0JD 4YAWA 5DBHX 1Q3EA 5CURA 4N23A 2FF7A 4GEGA 3HKDB 3DV0B 2VJBA 4JCOA 5JYBA 1PD1A 3VZCA 5JDIA 1Q3TA 1R0WA 2V7PA 3USZA 3CXCU 3LWRC 1G18A 1PVVA 1TT5A 4WUVA 3F8WA 1YHZA 1J22A 2QLJA 5EIFA 3OMLA 2FEWB 1LUVA 1JKIA 1CDDA 2VQSA 3BH0A 3TW8A 4G63A 1ESMA 1FBTA 4JX9A 3LUHA 6LDHA 2A3NA 5A3SA 5BVGB 1KMMA 3GH1A 1W2BF 1K33A 1KGSA 3FIUA 4LOJA 5TB5A 1UADA 2ADMA 1NT4A 2IW5A 4IJVA 4X92A 1NHWA 3DOJA 2E4AA 2JNBA 2R8PA 4X7RA 3W6NA 2O8CB 1JIXA 3LHDA 3Q41A 3QEOA 4OP3A 1A32A 2Z2YA 5K8TA 4EW3A 1WUHS 1X1AA 1FSFA 2DX7A 3I23A 3CUEF 3MELA 5T64A 2EILB 3ROEA 3UXHA 3VPAA 3ZZTA 3U44A 2CDBA 4LJSA 3SLRA 2GAIA 3IUBA 5K0EA 4FS3A 3HKBA 1RPJA 4BBPA 4KBYA 4LXQA 2D1QA 4J6EA 3CEJA 4GGMX 2VQEB 4DAOA 5DNYB 3QOFA 1FTWA 3K72B 1MZVA 1PQWA 1GPUA 2W6ZA 3BFPA 3ONFA 4Q15A 4FLEA 4DCMA 2ZRFA 3OTGA 4FE3A 1AV7A 1FUIA 3KKZA 2LO1A 3BDIA 3VAAA 1YB2A 1HQKA 2C83A 3MHPA 4JYPA 1JB9A 1OX4A 2ATKC 1VMDA 2VPQA 2X41A 4YP1A 1XVAA 3MYYA 4DYVA 3ZD9A 1YV9A 4Q3AA 1BC5A 2L42A 3SXJA 4DADA 1T5EA 4BGIA 3KXPA 4W1SA 4J9YB 1A5SB 3GU3A 3FNHA 2EAUA 1Q0UA 2CGNA 1TEXA 3QXJA 5FTNA 5TGZA 3O8BA 2WWWA 3D31A 3IVCA 3Q8WA 4JC8A 2BGMA 1LK7A 2Q8PA 5BP7A 1P17A 2GN6A 3WDKA 1N6RA 1MXHA 3MEQA 4DWJA 2FH5B 2GXAA 1T35A 1VQ6V 4FX5A 4MPDA 2PBZA 4LF7B 4LFBB 1Z5WA 4BT5A 2RDCA 3K6KA 2IXDA 3JQRA 1JEDA 3COZA 1RD4A 1CUWA 3A4NA 2AEFA 4P7JA 2BKXA 1Q92A 1OX4B 5HQ3B 5BR8B 1L2TA 2C2HA 3C8DA 4WMLA 4OFBA 2VKTA 5AW2A 3SZLA 1Y48E 1TNDA 1UDWA 3SQDA 5LQAA 1U40A 4RA6A 3OMAB 5GQSA 1R64A 2WSSG 2AZ0A 1T2NA 1MCZA 1X7XB 4H1TA 4I0XA 2GD1O 4ZEOA 4KQHA 4IJMA 4IOLA 4REMA 3SYOA 3UIEA 1XDDA 4QO7A 3EXFA 4GNKA 4DDTA 5GWXA 4OLBA 1U5AA 4CIAA 1W55A 3FPJA 4XM0A 1AX9A 4PRKA 1XL4A 4W9NA 4HZ3A 2J4DA 1YI1A 5AKHA 3ZE2B 4B7XA 5KYXB 1JMYA 5BOSB 2ZB8A 3D5QA 3CNNA 4IHJB 3H5AA 3FMVA 4B62A 2BGGA 2WF9A 2AHOA 2IY9A 3HJNA 4JKOA 4Y0NA 5BQOA 1KRWA 2A7QA 3LSUA 2IKSA 2V98A 1N1GA 3RKSA 1N75A 5U9CA 3GCDA 2JGRA 3F1LA 2RH5A 1P33A 2A94A 2NT3A 2QYTA 3OHPA 4YRJA 2HU7A 4R4JA 2AZDA 1CSEE 3SGLA 2Q5QA 2W6IA 4YACA 3E7FA 1KPIA 2EX4A 3CZCA 2XAFA 5HZMA 3STYA 1NVTA 1XTTA 3ZP4A 3U1TA 2NSJA 3IQFA 3UT6A 1E9DA 2CNLA 4NC9A 4Q19A 1JFFA 1L7OA 1XNQO 3K94A 3NM4A 1Y7HA 5A2QA 4PAMA 2X9QA 3CZAA 3ODPA 4HTFA 4P5PA 1FYJA 3BFXA 3CSXA 4Q7MB 1G8MA 4UHEA 3TIVA 2IYSA 4AKIA 2GYYA 3LLMA 5EUQB 5CFPA 1QVGU 4WESB 2Q3CA 4DSOA 3T0FA 4JITA 3JPWA 2O8BB 3H1AA 3GEEA 3D1JA 3AHHA 5HG0A 2B21A 1L4MA 3P7MA 3PJGA 4ADSG 4C78A 4ZTUB 1G6HA 1PVDA 3MB8A 3Q1KA 4FQ5A 2FNAA 4JYYA 3D1VA 3RK0A 4BNDA 4PA9A 4KMSA 1N32B 1SKUA 1L7EA 1JEYB 4NULA 2Z30A 5TQJA 3SE0A 4BE4A 2XITA 5U4QA 5A71A 1SHUX 4CEJA 1YIAA 1H85A 5K3FB 3PCRB 821PA 2O3TA 3HKDA 5B7PA 5M5BA 2PO7A 1BDJA 4TS1A 1Y3BE 2PBRA 1KVTA 1A98A 1PNOA 3LIIA 2CAZC 1J9GA 1YOVB 1IN6A 5KC9A 2X1VA 3CPJB 4KN8A 5M34A 2WBLC 1QHYA 3H83A 3KG2A 1CRPA 3UH0A 3PQ7A 2DWEC 2FJPA 2XE8A 2YDYA 2EHJA 2HHCA 4HBNA 1GZVA 3HCAA 1PFVA 1XR3A 2GSMB 3B1FA 1K5GA 3C8MA 2VF8A 3HFGA 1W40A 3AVYA 2B94A 4QHSA 4EYGA 4BMVA 1DARA 4I1IA 1G2OA 3GO4A 1V41E 3DO6A 3PNLA 5KYTA 1VCMA 4LEIA 4LE1A 4C7XA 2XT9A 1J42A 3R3UA 2XMGA 1ETHA 4U8HA 2XSZA 2OZEA 3KVNA 1U0NA 2QX6A 4HPWA 4HSGA 4ZIRB 4INZA 4ZOLB 1CIVA 1Z0JA 2I2AA 4KLZA 2ZSKA 3C3MA 5DCUA 4EPWA 4IDCA 3SD7A 4IZOA 1JVSA 1M83A 4KIWA 3U9LA 2YZKA 4FCCA 1C81A 4NBUA 5J47A 4DNXA 1DJMA 4A10A 4PAGA 5U1PA 16PKA 1R2QA 2GK7A 2BE7A 2V55B 4DLNA 4A6EA 1E98A 4FR2A 5LFAA 2P7HA 2R6ZA 7MDHA 5AW9A 5BR8O 5LWQA 1DJNA 2H3OA 3ZN0A 3H17A 2YYEA 4WGGA 5FT9A 3E3MA 2VPYA 4KPGA 5LIRA 5JMTA 4N5NA 1PQPA 5A02A 3QEBZ 3AUTA 2JLUA 1GAQA 2FQXA 2QD1A 3HH8A 5TARA 3KS9A 3L7IA 4MVJG 1APBA 1T4DA 3C16C 4ZHQA 1JHZA 1WTCA 2HNBA 4JJ6A 3GLIA 1EFPB 4DZTA 1CJVC 3WIDA 5BVHB 1OXMA 1DHRA 4X66B 1L5KA 2EGUA 1SC1A 4K9NA 1KEPA 3ZBTA 2VDQB 1DTWA 1GGEA 2J5QA 5JU6A 3K9CA 3T5PA 1K08A 4Y98A 2P8JA 3M4NA 5CJJA 5SY4A 2P27A 4C2TA 3E7WA 2FB9A 1YGYA 2XUZA 3JPYA 3PUHA 3QXGA 5KJEA 3QU5A 3SVLA 4MJXA 5AK4A 3P2OA 2FTKA 5FUWA 3UATA 2AA3A 1H05A 2IBZH 1EGVB 1Z6YA 4PS0A 4ABMA 1SZTA 3ETEA 2QTFA 4RDIA 5KHAA 5D1NA 4AX4A 2ZIAA 1U8YA 2PGJA 2JVDA 2OHOA 1PNLA 2BGJA 3CQ9A 4HZUB 4NEQA 3P2KA 2D1FA 1BXZA 1JH9A 5LGUA 1HXHA 1OLUA 1K98A 4FYVA 3N2KA 1AHNA 2LIVA 2QN7A 3OZ7A 3T7TA 4Z86A 3IERA 2FTKE 3OQ1A 1V6CA 3AXSA 4HLCA 4MQFA 3BMQB 4GI1A 1WHTB 4MYCA 3F4BA 3DAGA 1Q0TA 1VQ5V 2N47A 4AJPA 2JHAA 1EI9A 2Q6IA 4CKCB 5JJJB 2WHQA 2P9ZA 1XMVA 1SCUA 2R8XA 4K9KA 1W76A 4U3JA 2OG2A 3M1AA 3MG9A 1NBAA 1XNJA 1Z4OA 2RGBA 1H2ZA 2ICAA 1K73W 3JQPA 4AILC 4BKMA 1UBMS 3DAYA 4CDGA 5CNJA 1XF9A 2JH9A 2NU6B 2Q46A 2ZSDA 4NK4A 1H8EA 2IE8A 2MR6A 4GAEA 4O4HB 2P69A 4RENA 4Q4DA 2DCUA 5HFJA 3HTNA 5HY4A 1FNNA 3HB3B 2XTAA 4GRDA 4NZOA 1NM5C 4XZ3A 1GN8A 1NM5A 1VPLA 3RT1A 4TZ0A 1S76D 1X80B 1XWIA 3AR4A 4X84A 3UA3A 1ZK2A 4M7RA 5GVSA 3BFVA 4LJ4A 2CDCA 4ZAXA 2P9CA 2CW4A 4H6XA 3U0BA 1G8GA 1EFHA 3JQAB 5IZ4A 2AN3A 3O3CA 4CLRB 4BX8A 2CTWA 1IV2A 2VJDA 1A7KA 3RIMA 4AQDA 4PVDA 2QD4A 1WF3A 4XCQA 1VQ8V 2HCFA 2H8KA 2XMCA 4PRYA 3X1XA 4IX1A 2J7PD 4JLMA 3GVMA 5T3YA 4C87A 1OXTA 1CLIA 5FX2A 4FHZA 2PMDA 2B5OA 5ECGC 2YXNA 5A9SA 5GJBA 2XOKD 4Y6PA 3V2HA 4DIKA 3B1ZA 2GPSA 2OYCA 2IH2A 1WMSA 1VCIA 2BFDA 4JYCA 3CC4V 2Q2OA 2OTJF 2DUJA 2ZYUX 3FA2A 1KZYC 4J94A 1U96A 1R5NA 4BAGA 3D3WA 2JFWA 3K2EA 1DL5A 4QWWA 3L6EA 1U9ZA 5EI5A 3WC4A 2DMXA 5B64A 1XSEA 4FLFA 1V55C 1JG1A 1Z39A 4E2LA 2V4UA 3DZCA 4H1UA 1NI4A 2AOVA 1SCKA 2J5KA 3FHTA 3G71V 4HH4A 4DIEA 1XL0A 3P0RA 3ISTA 3C3EA 4Q4HA 1LJ8A 1Z0DA 1YQWA 2DPYA 2MT9A 2OQ2A 3R5JA 3TW4A 2FFAA 1DCFA 4M1EA 1O95A 4CM7A 4EHNA 4J2TA 5C53B 4GXRA 2FZLA 5F2OA 1MB3A 1CXZB 1XV2A 1ANKA 2H18A 5EPEA 3TJZA 4E5SA 2HP3A 3R4VA 2NO5A 3MM4A 1N5MA 4YMLA 1T5SA 2LCAA 2XVYA 3Q8KA 2VZ0A 1KMHA 3VH4A 4GPAA 1PYDA 1LBIA 4RGYA 4LYHA 3TZ6A 1F6DA 4RTJA 4CKBA 1J49A 4XDKA 3R44A 1ZUIA 2Z2JA 3DOUA 1CRZA 4OSPA 1R1MA 3AJAA 4LR3A 5LOVA 4AI6A 4UAUA 3CC2V 1AS0A 2P4KA 3D36A 3CMEV 1R8YA 4ME6A 3OZVA 4KREA 1B1CA 1H5NA 1W9HA 3P5SA 2C2OA 2PS9A 4BMYA 2AHZA 1QKJA 2M1XA 3G67A 3KTOA 1H1LB 2P9TA 4M36A 5TJHA 2O2IA 4QEZA 2A9JA 1ZD5A 4LF9B 2F1IA 1UWKA 5A9TA 3KKQA 1N5JA 2IHKA 4S1NA 4XR4A 5AO9A 4NV3A 3SYLA 3T4PA 3RJZA 1XRSB 2QPLA 3NBQA 4BBJA 4AFNA 1RCFA 5FTMA 3VOUA 1N9GB 1AE1A 1R0XA 1RQRA 4FFOA 3AG1C 3P2EA 2G0AA 4FFPA 2Q9AA 3PQ5A 1QLHA 5K1XA 1Y42X 5EIWA 2FOXA 4E0BA 4E31A 5EJ4A 4LCBA 3WKCA 2DRIA 3K9HA 3QTCA 3C6QA 4X24A 5ILGA 5LUAA 5L3EA 4XWYA 1EWTA 1QFZA 2AZTA 3OEEA 4XD7D 2VUUA 2IW3A 1AKYA 3EPLA 1NKDA 1Y74B 1GFWA 3O4IA 1Z12A 5C18A 5EB1B 4BXOB 2QA4F 3T1HO 3KWMA 2V9YA 2ZQYA 3L1HA 4FR5A 3FMFA 3ICXA 4FYJA 4PYRA 1J06A 3BXZA 4AUEA 5IKXA 1KQOA 3PUKA 3DMDA 5JNSA 1V45E 2WLSA 4FPPA 4KFTA 2ZWOA 4YAOA 2N48A 2A1UB 2FWAA 2HQBA 2JA1A 2UVDA 4MUBA 3UHJA 3V7QA 4CUKA 3OPVA 1ZOLA 3RJ9A 3NT4A 2I55A 4FEGA 3U11A 3M3PA 3ZIAA 4CRWB 2YC4C 4K8ZA 1BX0A 2FW8A 2Z5FA 3ET5A 3GEBA 5TQ0A 3P0JA 2HSZA 1QQBA 4IO1A 2IWRA 2FX3A 2I87A 4ZOEA 5JSQA 3EE6A 1Z0ZA 5FNZA 4XDHA 2VATA 3QX8A 4BCDA 1M8JA 1X0XA 3F9IA 3ZOZA 3K73O 4Y1EA 1L7VC 2G28A 3TEMA 2BFCB 3DKKA 5DRYA 4RF5A 3LQQA 3OTFA 1XYGA 2GPTA 3NWBA 4Q0MA 3DHEA 3K4QA 4HX2A 3V4SA 1RJEA 3VHXB 3H42B 4C0SA 3M1YA 4GP6A 3MTEA 2Q27A 3GVHA 1QS0A 1S5HC 1U8TA 3MNFA 3FFWA 4NFLA 1UQRA 3SN6A 4C0JA 2WUGA 3V1MA 3N5KA 1SU7A 2GQ0A 3H4TA 4GFDA 2JS3A 1GRCA 1GX1A 3C43A 3BRCA 2ZKLA 3N2NA 1SKVA 2QL5A 3E8BA 2TS1A 3S28A 1Z5VA 1OC2A 4LTMA 1GA6A 1V7QA 2R79A 1U90A 4KDCA 3RRXA 1U1EA 3WLHA 4ZU3A 4JR0A 4NMMA 3NXSA 3LBAA 4GOLD 2QG4A 4K9LA 1QP7A 2C99A 3ABSB 5T4FA 3KJJA 4CDNA 4G1BA 5LN1A 2H00A 3F8SA 4IDHA 1N0JA 1E2HA 1UBOS 3E83A 2CXUA 3D4OA 1SQ6A 1XRNA 5HKAA 3S7TA 2IZ6A 3JWEA 3DTTA 3ESRA 4G3XA 2X2OA 4WXYB 3O8QA 5JCXA 5F1YA 5HY1A 4EPTA 1QU2A 1EK0A 2JJ2D 3WNDA 3ZQKA 3T9AA 2SKEA 4RDCA 4WJLA 2GZHA 3W77A 2X6TA 3ZWOA 2HVYD 3BHJA 5K8LA 1R5OA 4C5BA 3M84A 1XMIA 3N2KB 2XAGA 1RCUA 5BYAA 5FFFA 1E2QA 1X1DA 3IP6A 4DUYB 3QLTA 2CWWA 1B42A 4I9HA 4TTPA 5H3LA 3TSCA 2DLNA 1MR3F 3DVAB 1ZA2A 2FPOA 2HP0A 3OJLA 4IOKA 3TJMA 4D96A 1JSZA 2FZEA 2P6UA 4D9JA 2LP7A 1EFRD 3Q9SA 2J1LA 1WD7A 3L7CA 2PZSA 1J2JA 2G82A 3ANNA 3JQQA 3O1JC 5DZSA 4UMFA 4X94A 1TCCA 4KXRA 1EAYA 3E53A 1AQ6A 1UBUS 2RHDA 4I8IA 3QE0A 4W7HA 3RC7A 4ZV4A 5C1PA 1DTWB 1OWNA 2ILTA 3K20A 1OUMA 3FOEC 2OEPA 3OPMA 3PZBA 4AMZA 5G1NA 1XGKA 2IHYA 1QH1A 4DA4A 1E9RA 4X00A 4FEYA 1KOJA 2Y1EA 3C3AA 4HXEB 3RTDA 1LNQA 2BZ1A 1EFLA 3DDOA 3RHFA 2JGDA 4Z7NB 2ZUFA 2J0VA 2ZWIA 3NBFA 5EKXA 5HZKA 4B7UA 5CX1A 3BRSA 3GC6A 3U3RA 2XAUA 3CVWA 2UUBB 1AT1A 2AOUA 1BYIA 1UJNA 2OP0A 5FI1B 5LU9A 4B6FA 2C95A 2Y48A 3HP7A 4RA9A 3FYCA 2BMDA 2NR5A 3RYIA 4WKGA 3SSNA 2PX2A 5M2QA 3WA6A 1J24A 4UM9B 4PZDA 5BQ3A 5HK9A 3GOQA 2DY1A 3LWNA 1ADGA 1TKAA 1YHNA 4GWGA 3SVTA 4YCNA 1P2BA 3MOGA 1JLMA 1YU9A 3BYQA 2CFOA 4KACA 4M9RA 4HNSA 1S96A 4QVGA 2YFQA 2OK8A 4RZ3A 4DDVA 1T9KA 1ZZGA 2K6GA 1WU7A 2FPRA 1VG0B 4ZOLA 2I34A 5LL6Y 1SY7A 1K97A 2ST1A 2XYGA 3AONB 3CEPB 3OTIA 3QEJA 5CLIA 4DYLA 3K0EA 4IF4A 4WFHA 1VQ9V 1YQUA 2IJHA 5IU6A 5ARDA 2C4NA 2JS5A 4HN4B 1P2UA 1IWPB 4JVNA 1IG0A 3O3MB 4MJ3A 1TUGA 3S3WA 2I2WA 5B3SC 4ZYTA 1UXKA 2V03A 2D0PB 4KXVA 4NI5A 1XREA 5CM2Z 3I2KA 5A3RA 4GOMD 4RU1A 1DCKA 3QE3A 1YR8A 2JG3A 1W5EA 3I1IA 5DHPA 1I6WA 4IH4A 1PWXA 3I9FA 4HAIA 3H16A 1LSJA 1XILA 4JI4B 1T0AA 2OHWA 2GD0A 2WHYA 4RJIA 3U9SA 4PX9A 2ZI4A 2WD9A 4XEHA 4Y1GA 1MFPA 4KVAA 5E2IA 2DWPA 3UOWA 1U63A 3F5SA 1XCJA 2YIJA 1OXXK 2LD4A 3LS2A 3THWB 3PSAA 3KVOA 5EFOA 3P94A 1S8NA 4BVGA 1SA0A 2JFOA 3H7IA 4B3IA 2OBBA 1R3IC 1EVKA 1YB5A 2HA3A 1O8BA 2L18A 3L0PA 1XTZA 1G59A 2M6LA 3HRHA 3DBRB 4NS4A 2XMBA 3AHCA 3A6KA 4ZMSA 1NNLA 1Z6ZA 2GD2A 5I5GA 2QENA 8ADHA 3T61A 1Z6XA 3QVKA 2QG9A 4O2BF 4DMCA 2IH1C 2AT1A 1OI4A 3AT1A 3DLHA 5H5NA 3IDOA 1LX6A 1Z2OX 4D99A 2DWQA 2P35A 3B5IA 3IEVA 4QL3A 4QYIB 4W4LA 1ESZA 4TMWA 5HE8A 1KDYA 2HMVA 3CSDA 1MIHA 2J30A 5T8KC 1Q83A 4KUGA 3PNVA 1W75A 4OKIA 1KQSU 2K4MA 2PMWB 1NJ1A 2IYLD 3H1BA 2G5CA 4WVFA 4LPKA 1KH1A 3H5IA 3ZY2A 3FN4A 4WKPA 2HMWA 2FRDA 1QU9A 1EUZA 2F48A 1MU0A 5CBGA 3AEQA 3F90A 1ST2A 3LDHA 1NXXA 3AF3A 3TOVA 4AU1A 4B48A 5JNLA 3DAFA 3MT8A 2P22C 1RW4A 5GZ6A 3ZDAA 5L3SB 1M5UA 4LZJA 2UZ1A 3ICEA 3VPGA 1NJ5A 3K04A 3DC2A 3PWTA 3FSGA 2H7YA 2GCGA 4HNRA 5L40A 2VRZA 5ERYA 5B1BC 1FPOA 4FQ8A 5FPYA 3EVCA 2PY6A 1E4EA 4FOOA 4DT1A 2WHPA 5KJFA 4G5FA 3UMJA 2I7VA 3OT4A 1PR9A 4X1YB 3BK2A 5AVSA 1OAPA 2VSFA 3WYGA 5D84A 5H6QA 1CS4C 4NHOA 4XGKA 3GMIA 3I0MA 2JEZA 3SIUA 3FKJA 5F9HA 3QX7A 2FUCA 5SZKB 4PA7A 3C8ZA 2P1ZA 1G0NA 1M6NA 2X5JO 1UM8A 3CMAF 1ML4A 3K2QA 4GD3Q 4RA6B 1XZMA 2OFFA 2WKWA 3KJIA 1ODIA 2BH9A 2DHQA 1ADBA 2C9CA 2DQ4A 2HWUA 3G89A 1UJ5A 2AG0A 4JA0A 1KZHA 4AZVA 1JHPA 4TYNA 3DSRA 1LJUA 2H1FA 4HDAA 3ROGA 1BAPA 1ARZA 1J21A 1ZJJA 2BMVA 1RABA 2BR4A 5B66Z 2FN7A 2YOHA 3GLHB 2KQXA 4LWSA 1NN5A 1QVAA 3PE4A 4FD3A 5DYIA 4YRPA 1N6KA 3B3QA 4Q3OA 2BYTA 2C9ZA 4HEA6 3FRJA 2EBFX 5BR4A 4EVIA 4EUHA 5AW7A 5K2OA 3ABIA 1D0VA 4LRYA 1FXUA 3UWPA 1SUEA 1SVWA 1OASA 2DE0X 3A7DA 1Y1SA 2X7HA 3NZEA 4RGVA 1AA6A 3A3YA 1NBMD 1E2KA 1F4NA 1VLMA 1WDKA 2RNBA 3BD7A 3QIVA 1YL6A 4JB3A 4UKDA 4NNJA 3RRNA 1PTJC 1RT9A 1ZUD1 5FBRB 4BIIA 1YQTA 3K5NA 1RFYA 3F74A 2GKGA 4CL8A 1DKLA 1NF2A 3COSA 1N2EA 4G4GA 4XWTA 1AHIA 1QAQA 3OD4A 3HDVA 2OUIA 1CIPA 1R37A 2IYTA 2QN1A 1Q14A 4HRYA 2DQYA 3VTAA 1OFGA 2B36A 2BGIA 5IK2A 4U9IS 1YAJA 3CCLF 1JI3A 1NWCA 3HB1A 1QPZA 3ENKA 5JAIA 1TF2A 3M2TA 1ZFNA 4JVLA 2Z4TA 2QW0X 1VJ1A 2DWDC 4TMKA 5JISA 3QO5A 1GZSA 1K5DA 4YRLA 2NSYA 4MRVA 4YO8A 3I39X 1I10A 2IOFA 1C1XB 5DU2A 1YJCA 1Z7GA 3SYTA 2YRWA 3S2SA 1EBUA 1GPAA 2F43B 4H3SA 3R3WA 3W90A 1B0AA 2OAQ1 3ZWVA 2FYUH 4UDNA 1T10A 4Z1MG 2ZUDA 2QA5A 1T9AA 1JHYA 3B78A 3QKIA 2Z4SA 3V5NA 1Y8ZA 2PD4A 1JDJA 2OZLA 4GYJA 3CD6F 4ZGWA 1C41A 4HDNB 4OHZA 5J4VA 3H4IA 2VDWA 4WFKA 1JL3A 3IAYA 1GPNA 1W0KA 3V4LA 3EVGA 4GZMA 2O2EA 2YHBA 5KNDA 5IVKA 4HO1X 2XMDA 4D92A 2GASA 2I54A 2QK4A 3TTUA 4G1CA 2OT3B 2CLSA 1SURA 2WHPB 1E3TA 4MI6A 3MGAA 2C7PA 2WE8A 2ZDQA 5THKA 5BR7A 4UU8A 3BULA 3LCVB 3IJPA 4UB6Z 3BSYA 1TIBA 1G0OA 4KMRA 4AQYB 4J42A 1KDOA 3FTEA 5BSEA 4KWIA 1D2RA 3INNA 5KJ6A 4G5YA 3ZLTA 1GAWA 1Z0AA 2GPAA 2R6CA 3NAZA 4AO8A 5CBPA 1XZPA 4L08A 2O4UX 1IG3A 3G9XA 2H2IA 2ISSD 4FMDB 4J0FA 4M9XA 1NQ5A 5HS6A 4C0BA 3FSEA 4O0LA 4CKEA 1VQLV 3NT5A 3O3NB 4TTSA 4XGQA 4MITA 4ZK2A 1JHAA 4BATA 1JLHA 1WCV1 4L02A 2ENUA 1FRZA 4NBNA 1T6YA 3FB7C 1W1WA 3CF6R 1QE0A 3R5XA 3R7LA 1XZAA 3V2IA 4XX1A 4YAKA 4DTIA 3LW8A 2YBEA 3H6GA 1U2DA 1XJ5A 4I1RA 5IYCO 4NXMO 3PEVA 4M9ZA 1JEAA 1M2KA 1IUNA 3D0QA 5ALMA 4TWKA 3U16A 3C0KA 3U3KA 2LBWA 1Z4LA 1PX0A 2PKRA 1E2PA 1EUDB 3IQZA 3TI7A 1Q0SA 4MRAA 5AKIA 1E5DA 1MQSA 4P33A 3CEAA 1ENPA 3TIFA 1I6KA 3K0HA 3LI2A 1RXEA 2P3LA 2VNIA 4S1WA 4BVFA 5SZHB 1VHDA 2HX0A 2XWPA 4UUJC 5CA0A 4WZBA 3T8YA 1YOVA 4CTJA 2HADA 2Q5FA 3EGIA 3AFNA 4CZ2A 1CULC 2O48X 4GKJB 1P1CA 2E4ZA 2K2QB 4GUNA 1FYEA 3A10A 3KV1A 3SHQA 1SVMA 3G1UA 4U4AA 3A1VA 5T6MA 3O74A 2R8YA 3D9QX 5HQTA 1E64A 3U7RA 3GL9A 1JDSA 3H8WA 3OOEA 2O8DA 1U0SY 4NE7A 5CH5A 1F12A 1ZC3A 1S4QA 4P31A 5JCJA 3H9QA 4P9PA 2G40A 2K7ZA 4F72A 2PLNA 3AVUA 2JB9A 3Q7QA 1GP2A 4PX2A 1SVKA 5B57C 4FSXA 5I7FA 1F0NA 1FX1A 1MC1A 3HB4X 3VDRA 4BLPA 4TQFA 2VH2A 5IAGA 3KUCA 4F04A 4CIBA 5B1BB 2AJDA 2VAPA 1M10A 4PIPA 5B7QA 4KWTA 4TS9A 5B1SA 1FIUA 3FPLA 1D5NA 1IIRA 3L7DA 3T7CA 5HR5A 3AIOA 3HUTA 2XZOA 2GYVA 1XQWA 2Y92A 3NHBA 4NEHB 3THSA 2R66A 3NOOA 4JJ8A 1T5BA 5AVTA 3DF7A 2IY8A 2P0AA 2B9ZA 2O1WA 3N05A 1YZBA 1DKUA 3HR8A 2IKQA 4LWOA 4RK0A 1SVSA 1UC5B 1N7GA 2VBIA 1F8YA 4QDZA 1G20B 1WB4A 2WPDA 1JEJA 3FPBA 3DMRA 3CIOA 3SGIA 3V3TA 1GZ5A 3BSWA 3SS8A 4D8WA 1MVNA 3ECCA 3S0HA 3LVQE 3OI7A 2QWNB 4M0FA 5ICFA 2BVNA 1U04A 3DOOA 4FZJA 3RC9A 3ZBPA 1EYZA 2EW2A 1NYRA 1ESNA 3EPKA 1ORRA 4ODIA 3EIUA 4W5WA 2H5EA 3IA2A 4HYQA 1IN7A 1O96A 2SKCA 1AQIA 1Y5IA 4Q3CA 5ALTA 1AO0A 1C2YA 3SBXA 1RYHA 4YA6A 3UB2A 3UJ3X 4MKRA 2GEJA 4YNBA 5JARA 1MOFA 1AP5A 3OZXA 4DMUB 1N33B 2WWGA 3B3JA 4G65A 1EJ0A 1JR3A 3AESB 2M9MA 3ILXA 2I8CA 3JAWA 2NQTA 1GQSA 2EINB 2ZJAA 1C8KA 4KRXA 4RK1A 2XCIA 1P6UA 2BTQB 4UV9A 1WV0A 4RK4A 3PD1A 3OIVA 4BKUA 3EEIA 1KHTA 4ZFNA 3SZOA 4DSTA 5B58T 1AG9A 4QTXA 2Q5CA 1ZMOA 2XZDA 4XW2A 2HRUA 1GRQA 2JK0A 1JN1A 3K79A 4CBVA 1YFLA 3CCUF 1USUA 5EIAA 1GYQA 1IVYA 4DC9A 1KZ7B 3W5CA 3FB6C 2UUBO 1GL9B 4DJJA 3F7VC 2J0UB 1OZAA 4JAUA 2YMQA 4U5QA 4ALLA 2ORIA 1OLSA 1Q7YW 4QBHA 2IS1A 2YHUA 4ZRDA 5EC8A 1FS4A 1SULA 1H4VB 4K35A 1XFDA 3UWMA 1H3EA 4QC2A 2BMAA 5C3UA 3F6CA 3UYKA 4MH0R 5AJZA 5BZBA 1VJRA 4IYRA 2QB5A 2EILC 1ECFA 1KC3A 5CH8A 3NJRA 1CUSA 1SBCA 1JKMA 1BWPA 2F1OA 3PR3A 1X1BA 3LRXA 4GSKA 4D9BA 4Q1FA 3R6GA 4TQUS 1NRJB 2EU8A 3WB1A 3WGJA 1DFGA 4FS8A 4UBOA 1AQYA 3GUUA 3RRJA 4JCCA 1G8YA 3E9DA 3HV2A 4JBHA 4DV7O 3Q12A 2C9OA 3R7SA 3EJ6A 3SZUA 3D00A 3PQ4A 1UEIA 5IUJC 3OFJA 5LDHA 1L7DA 4TLMB 3B9QA 4C01A 5GINC 1FTGA 5HJEA 5HK8A 4XCXA 3KJKA 1V5WA 2L17A 1CNEA 3A1SA 3HSKA 1Z7YA 1YGPA 3ILVA 4LJLA 1NJFA 2GXQA 5J5AA 4MB6A 5ICGA 1ZUNA 3QU7A 1IWOA 2GRUA 4L4SA 3APQA 4QICA 3C3BA 1VTKA 3EHEA 1CLEA 3ZHRA 5IUKC 4F3KA 3EDQA 3EVAA 4BO6A 1RP7A 2G5TA 3NHLA 3LNTA 4LVOA 2GHTA 2DFTA 1KPGA 2A4KA 2QXUA 3PQEA 5K99A 3MTGA 1EK1A 4L5CA 3K9FC 4QT0A 3TKLA 3WYEA 2VUTA 1T4GA 1NG9A 2UUPA 4TROA 2O5RA 2MR5A 1QG0A 1UANA 2X58A 4BAZA 2Z8XA 2AN9A 1IEVA 4BTEA 1JH8A 1TCVA 3HBAA 4G4YA 1E1RD 1E8NA 1LNSA 1ZO8A 3IALA 3MOSA 3WL5A 1TEHA 4YJ3F 1BMDA 4EB3A 1NUPA 2YZ2A 1IQUA 1L1EA 4IVNA 4RVFA 1O87A 2FPGA 1XEXA 3TM5A 1SCDA 3WK4A 3GLFE 5J58A 2EX3A 1K0FA 2HPHA 2NAPA 3UHFA 3H2HA 3ULKA 5KTMA 3FFBA 3MWEA 3LCCA 1GN3A 4HUJA 2NOAA 2ZODA 4LF4B 2VPIA 2WK1A 5DW0A 3VKVA 5DYNA 3IT2A 1NPTO 4IFIA 4QXAA 3RB8A 4B9AA 5AW0A 2WFLA 1VKJA 3IVMA 4YTEA 5JSUA 2EEZA 4DCPA 3QF4A 5FL7A 3E2PA 1T8UA 3LFTA 2NN3C 4GPBA 3HYRA 1MJHA 1XTJA 1J0CA 1DAPA 1NJ2A 2OKGA 1AB3A 3MJ4A 4BIZA 1QQCA 1SN7A 2JD1A 2E76B 3DC7A 2PQ6A 3LK7A 1N6IA 3VPDA 1IDSA 3D6VA 3A3KA 1G4UR 4QDJA 3HBFA 4A7PA 2PYLA 2EJVA 2VF5X 4ZMBA 3AF0A 4Q3DA 1CJSA 3FUTA 2QZZA 3UXEA 4FC7A 5TEWA 4QGSA 3G68A 4XTCS 2QRHA 1X38A 4WA8A 3VR3D 3GBSA 5L4NA 3CRQA 1KMHB 2V4MA 1F1BA 1RWWA 4MRMB 4DF3A 1P60A 2AG6A 1Z36A 4RTSA 2FSVA 4X6LA 1SVLA 1K8RA 4EZEA 5JY6A 2HRQA 2B35A 2ILMA 3LSSA 2ZOVA 1YZVA 1C50A 2RIRA 4TM7A 5AI9A 2BIFA 1B74A 1I2MA 2BEVB 3EC7A 1YD7A 4QQ8A 3A9VA 3IV9A 4Q3LA 1SQXH 3U7GA 4QHYA 2IVFA 3CZQA 3P9CA 3L0YA 4UMEA 4PE5B 2QTHA 4RJJA 1C0IA 3M70A 3RAFC 2Z1UA 3GDHA 2BFOA 3ZHOA 4RAIA 4I5GA 3KP1A 1UXIA 2J6IA 3ZDQA 3PB3A 4DLAA 4PX5A 4YJGB 3RQIA 3OONA 4N6GA 1QU3A 1L5MA 3W4JA 4BT3A 5FTWA 2ODEA 4Q34A 1XVIA 1A82A 4RA9B 4OB6A 1NL3A 2GWHA 1VSQA 2FSUA 3NKFA 4OREX 1LPOA 4BNNA 4F5WA 3QVTA 4UJ5A 1T36A 4ZZ3A 1K4KA 5KHHA 4AT1A 5J4LA 2YEVA 1WMBA 2O5EA 1GKYA 3L7AA 3OA2A 3ROZA 1DDGA 1QWSA 3NWEA 5FDFA 5E0KB 5K6AC 1B8UA 1M54A 4GGPA 1M5TA 1I1OA 5UKDA 4NKGB 2AJCA 2CXSA 2ZSIA 5K2MA 1Z2CA 3U48A 3D8TA 1IY9A 1SRYA 4G0UA 2F43G 5EFZA 1WZUA 4YXFA 1T9CA 4JJEA 4JYAB 2PUSA 1X42A 3WGKA 5BV7A 1MOSA 4OA8A 4ZC8A 3FJ1A 4KXYA 3BCCH 2WYVA 4H7KA 2DYRC 3TCKA 5G4KB 4X8AA 4KR9A 1Q90D 1S5JA 3P9KA 4AQ7A 1DC3A 2JLYA 4S1VA 3TOZA 4JXXA 1TA8A 3ZRXA 1T1RA 1U11A 2BFDB 2VJPA 3PUWA 3O9OA 1XTKA 5ALIA 3UB4A 3TLGB 1JKJA 3UCEA 1TAEA 1T3TA 1OTYA 2CZQA 1WP9A 1PJSA 3NLLA 4XVHA 4DQXA 4OJMX 1UUFA 3OESA 2CNWA 2ARHA 4BZXA 1QRDA 1SHTX 2YIBD 2VDOB 1T15A 1C7EA 1Z4MA 1I5YA 1A5BB 2Q41A 2VNHA 2Q2VA 3SU8A 4IICA 4AUNA 4ROTA 2LCQA 1KFEB 2A9VA 3TR6A 3SKVA 1V55B 1AURA 1ZEJA 2A86A 4Y7CA 1Z17A 1E3IA 2A5LA 2SBTA 4JGIA 2J0SA 1UP4A 1Y3IA 4CUZA 1LRJA 4UZSA 4KTVE 1H66A 3FR8A 1JYSA 5LMZA 5GIPE 2YXLA 3ADOA 4LNUB 1TYCA 1V6AA 3AKEA 4YYZA 3UUFA 3GLRA 3DLIA 3O2NA 2QWRB 1N9KA 4E21A 4KE7A 1KJIA 1V1MA 1K9VF 1X94A 1OJ7A 3I09A 3ABTA 1R0SA 3T4XA 1Y4MA 4TL7A 3ZTWA 3U10A 1H0KA 2PV0A 2P6OA 1CQXA 5TVKA 4S04A 1XRQA 3TLGA 3RS4A 4EKGA 4GQIA 3RM3A 1VQ9F 3QVJA 2AIFA 2ZINA 3TRJA 1BQZA 4P4SA 3OIFA 3ZJVA 3WJ2A 1F0YA 2ZBVA 4XE5A 2YOGA 3BMOB 3RFVA 4ED9A 2PX5A 4EYEA 5A7FA 1Q6IA 3K4HA 2QI2A 4GMDA 1PNMA 5B3JA 4YPOA 2PD6A 1SCIA 5B3JC 1Z35A 4AMBA 2JLVA 4B3SB 4CM4A 1O5OA 1ZR2A 3CC7F 1JFRA 1QX4A 2J85A 2Y1KA 2YJGA 2Z8YM 2DFLA 3OCXA 2DPGA 5CK5A 2CKDA 2O6LA 2NUPA 2P5UA 3WFVA 3O93A 3R8XA 3ZZUA 3ZWBA 4BVEA 1I7PA 1IB0A 4D4KA 4EHHA 1QG6A 1CZKA 1JQKA 2ZITA 2QJRA 1G1MA 2WJWA 3EIFA 4YQYA 1VQPV 4DQUA 4F3TA 5B3AA 2JGNA 3KEMA 3UQ8A 1DOZA 1EHYA 3D3WB 4L7QA 1EDDA 1FMTA 3H8VA 1LPSA 3AR5A 3D81A 3LX4A 4K6GA 5KQRA 3N8NA 1KI6B 3QX3A 1QLEB 1T9ZA 3CLUC 5T5QA 1HURA 2AHYA 5FOWA 1ZX3A 1Q15A 4YMHA 1DV1A 4QPCA 3A2FA 3MJHA 2TYSB 4QGAA 4Z0PA 3A6FA 2RGYA 3SHVA 2GF0A 3D4NA 1CBUA 1HC7A 3ZHXA 1ZGGA 2UYPA 4I1OA 3VYWA 3UFXA 4WZAB 3WIBA 2VF2A 4Z7OB 1QAOA 4ZKDA 1YHQF 1C0PA 1CR2A 1CJTC 1USVA 2CEKA 4C04A 4DV1O 4CKXA 5ALPA 4P8RA 4UEWA 5J2TB 1JAZA 2BM8A 1Y4ZA 3ABUA 1KAEA 3PDCA 4FFWA 4EY5A 2FDRA 5ICMA 4BU0A 3U3JA 4D6TH 3VJKA 2PWAA 3RW9A 2C92A 3DVQX 2BJVA 3AHIA 3KYDB 4CGYA 3L06A 1PNTA 4NCNA 4NV0A 4RUFA 5GJWC 1GAEO 3FCOA 4MUAA 5HE9A 1ECCA 3AW9A 3H84A 3KYCA 3GFRA 1JFSA 3HJHA 1LFDB 2BHTA 4YJHA 4OUKX 2VA9A 5COQA 4EVRA 4IIBA 1U28A 2C3YA 1X70A 3TBHA 2QMUA 4MKIA 1DIGA 3DMTA 1OHHD 2WAYA 4BJ1A 4EYSA 4LYGA 4BT2A 3GZNB 2WU0A 3OD5A 4TX1A 2IV3A 3T9EA 5LOVF 3HBJA 2GTIA 3HMQA 4UHBA 3DXRB 4J0KA 3ZQ6A 5DM0A 1W3EX 2Y1OA 5B1DA 5EBMC 4MPRA 5K3OA 2LFRA 2NNUA 1OW3B 1K5QA 3QVSA 4M60A 2ZRDA 3LXMA 4OGFA 1JXOA 3H1HH 3HEMA 1KUQA 2CUTA 2DKNA 3A4TA 4A0SA 1NA5A 4JUIA 3P3PA 3TETA 4DXWA 4GMGA 2CJWA 5AIBA 1YACA 4US1R 3OZDA 3MFQA 1I0HA 1GAXA 1J9EA 1QBKC 1YNOA 2O3JA 3KEFA 1TVKA 5IAJA 3RA6A 3RVQA 5DBOA 1PL4A 3OIWA 3ZU2A 1DHTA 5I6DA 4R0NA 1RZ3A 2QI9C 3KJHA 1OBVA 2OXFA 4FDVA 4U2CA 1K8QA 1JDPA 4P9OA 1E94E 2D0OB 2GAJA 1NJ8A 3JALB 3GP5A 4NIMA 4ANFA 3MLAA 5KNCA 1VYUA 3NETA 3NP9A 1RWMA 3MOIA 4Y9DA 3LW7A 5JZBA 1JMKC 4XUEA 1T9BA 2QP3A 3UMGA 4GE0A 4MR9B 3BDAA 1QHGA 2C3MA 4KQEA 4F1KA 2N3ZA 4TV8F 2J0EA 5L3DA 5JJNB 1SQQH 3PJSK 1N2OA 1Z0KA 4MV8A 4C6TA 4NVRA 4YMSA 1SVUA 4DE5A 1ORQC 1E8MA 1EFPA 3HACA 2W4IA 4R2LA 4I5FA 1UPGA 3SJ7A 5LL6P 3VOBA 1ZD8A 2ONKA 3WTBA 2H8GA 1LXCA 2HEIA 5AM3A 1UFYA 2VNKA 4Q4AB 5E4FA 5JY1A 1QFJA 2Z4RA 3WLNA 3T06B 5FLYA 3C6KA 4Q1DA 1ZSVA 3UAGA 3V2UA 5IF3A 5ENZA 5K0GA 1PVOA 5BMVF 4HDKA 3Q11A 1YBMA 4BLWA 4GQBA 3HS3A 3VC1A 1A7AA 3AUYA 2WJ6A 3BIOA 3MCWA 3MQFA 5GOTA 2YJTD 2WJ3A 5KQPA 4X45A 3F2IA 2BFWA 4ZVRA 5BSKA 3RPEA 2ZRQA 2I1WA 2B34A 1RAIA 1B6RA 2ZOSA 1JJ2U 4R3WA 2Q4BA 5K0ZA 1RVV1 1SS3A 3SPCA 2IP4A 3L7OA 3ECAA 4F6LA 1PWZA 3OICA 2BM0A 3FYTA 5HFMA 2ZM6B 1N25A 3IO5A 2QUJA 1FCJA 4D3FA 3ETNA 4EZIA 4JWTA 4BFWA 3N74A 3WK7A 1WUIS 3NDRA 3H8JA 1DX6A 4J41A 3O31A 2FFQA 3MW8A 4D4LA 4JELA 2NTYC 1Z33A 3GGGA 3ME5A 4E3WA 3T38A 2W00A 1DDIA 1CLUA 1P7ZA 3IPRA 4Q3EA 4F93B 1ZL2A 3CLRC 4OMUA 3WZLA 3PFKA 2QTPA 1D9XA 2NU6A 4HVAA 2R4QA 1IAVA 1JX9A 3MUEA 4RQBA 2VAXA 3OJEA 3WQSB 2IIBA 1D5AA 1P39A 5GGYA 2EZ9A 4R8KA 2X42A 1R0RE 3UK2A 1CIJA 5K3FA 4JOQA 3BHMA 3HI6A 2WD8A 2YV2A 221PA 3M83A 4XVCA 3HY3A 1XROA 2CUNA 1VF6A 3EQ6A 3GJRA 3IH5A 1EDOA 3SX2A 2XNDD 1VE6A 3SIRA 3JAWB 1U43A 3BFKA 4XUCA 3WQQA 4EX7A 3OQPA 7ADHA 1X7ZB 5AWFC 3BL8A 1L5WA 3IIJA 2RARA 4CWAA 1P29A 3TSOA 3X1ZA 1EFAA 3C98A 1W0CA 4QGGA 3UEOA 3DOEA 4GPTA 4M0PA 2QYHA 4U02A 4C0XA 8MHTA 1M56B 1HTTA 2XSZD 3AEKB 2NXJA 3O1LA 4NK5A 1T0KB 1X77A 2I6GA 4PPYA 3OX4A 2E75B 1DT3A 1LFAA 1PU2A 3ZJ4A 1ILWA 1MV8A 1U5CA 4KWEA 2R8BA 5L3ZA 5LZ5A 2PH1A 2QRLA 2CFRA 3LHIA 2PAAA 1JXMA 2Y1GA 2R1ZA 4MVJI 3MHHC 1GQ2A 3UMMA 5DN9A 4JB0A 1LEHA 2ID7A 2WFAA 1YI8A 3PCTA 4PZYA 1FFWA 2VTVA 4AROA 3C14C 2OCHA 4UBKA 2FDCA 3EFBA 1SWVA 2YS7A 3PPXA 1UPBA 3Q8XB 4KSYA 4PC3A 5DXAA 3UCFA 1JPVA 3PQCA 1IBLO 3L01A 4LJ7A 3GDWA 5KNLA 2DERA 2JFFA 1D2MA 3E3NA 1DWUA 4P35A 1E7MA 3A1FA 4DWWA 1JX6A 2XD4A 4KU4A 1SO8A 1EZ4A 4X1IB 4G88A 4NATA 4CQLB 3EYWA 5IM5A 2VFAA 4E6EA 3TD9A 3ZX6A 2OLJA 4HQKA 3M9WA 5F2EA 1SDSA 2G9IA 3HKEA 1GLNA 1UIRA 2JFGA 2QM0A 1E62A 1CJMA 2Q69A 2P4SA 2PL9A 2YWBA 1JBEA 3EVZA 3JSNA 4RKRA 1B8NA 1CW2B 1SBTA 2QUKA 3LFOA 5DWDA 5A06A 1CJBA 4WJKB 4WNYA 4C0HA 2IUEA 1TVMA 2G1KA 4FWIB 5PGMA 4QREA 2GJ8A 1FS5A 2VH1A 3PJFA 1VHWA 2NV0A 2BI4A 2JKYA 2HXYA 4GDMA 4KQWA 2PH5A 2NZ2A 2XYQA 3VR1A 2W71A 3GOHA 2TMKA 4LV6A 4H59A 1PR1A 3CNOA 4N1AA 1ZD3A 1K88A 3W8DA 1SQGA 3K0AA 2JFBA 1GT6A 1YA4A 1W88A 3OE7A 1G98A 5KYKA 3FPCA 5J5CA 1ZQ1A 3ON1A 3RRFA 4W1RA 3TOCA 4E5YA 4Q9LA 2XWQA 2X4LA 3TPZA 4H27A 3NNDA 4HZUA 4CEHA 4JOCA 4KXWA 1W19A 2EW8A 2P3QA 3TXSA 3KZXA 3PLRA 4KDRA 1EUDA 2X40A 3U31A 3PEWA 2YIDA 1NVXQ 2BDUA 4H16A 3EA0A 5BWBA 2RGGA 2J4FA 2A9RA 2X3UA 2XBUA 5KREA 2XYVA 4EO4A 4ZV9A 2Z3YA 3ASOB 3VNRA 3GFOA 5BSHA 5ECWA 4B3JA 1RRMA 1H8ED 3MK31 5ELMA 3W2EA 4MQLA 4U8GA 5M29A 3WKEA 3U40A 1CEQA 4QU9A 2PLFA 1RKXA 3H99A 2PT6A 4CH3A 1UDXA 1IWBB 2EJUA 2ZSJA 3CX7A 1JYEA 2XEDA 2BGLA 5FR1A 1XDWA 1AZSC 2GH1A 2JGKA 3OMNB 4HXFB 2CL6X 3SJCA 3USCS 1PGPA 3ZWKA 3AG7A 1BVRA 4QRHA 2Q07A 3QYJA 2ZRHA 2F55A 2MIIA 1U97A 3WI7A 3LWVC 5IJ0B 1D03A 1H6BA 1MNGA 4Q6GA 1TEVA 3CPSA 2BGKA 5KVQA 2IZOA 4YMUA 5AW1A 4RZSA 2NP7A 1Z13A 1YR7A 3S02A 5FWXA 1AK1A 4DKJA 2Z95A 2YICA 3K57A 1FNBA 3HU1A 5I01A 3OJCA 1J7JA 1H2KA 2PQ0A 5KBYA 2QM7A 4NJMB 5K6RA 4LRXA 1K4CC 4PGFA 3UJHA 3ZV5A 1CY7A 1V7PC 4LTNA 1OWOA 3EXIB 3DJYA 5INTA 3ZPXA 3G49A 3I1JA 1HE8B 1Q74A 1W34A 1ISRA 1B26A 2DUMA 2PI5A 1YAHA 1ZW1A 5AK0A 1W36C 1WL8A 2MINB 2PHNA 1COWA 1O0BA 1IZ3A 3KPYA 4ZO4A 3W8FA 5LP6F 1E1CB 3C5VA 3QOYA 3M5CA 3TIXB 4JBXA 1GPJA 4G0VA 1IK4A 1FTSA 1ZMXA 3IEXA 1ADYA 3DE3X 1JQDA 3QW4B 4H4EA 4DWVA 3B13B 5KA5A 4YPVA 5AW6A 1TO6A 3QENA 1GTJ1 4UASA 4B80A 1ZM9A 2P5YA 2VHTA 4LHYA 5EL0A 2ZSFA 3ACCA 4O2BB 3DXYA 2D7CA 4MPTA 3PQ6A 5JSZA 3VPFA 3GD5A 5BRAA 1K4MA 3UW1A 3VTFA 1XI1A 1P9NA 1S1CA 3KYBA 3NEPX 4QFBA 4F6CA 2IH5A 1QH8B 4UTNA 1I1QB 1HM5A 3U1VA 1JPUA 1BZKA 2AYYA 2HO5A 1NQOA 4MYSA 3W34A 3N7AA 3AB7A 4FYXA 1P18A 1JQJC 4N49A 3D1LA 4QSMA 3RI3A 3KTAA 2VQFO 3KKEA 1VYVA 1Q86W 3LZCA 4LCKA 3M6MD 4HEA1 3GELA 1PR0A 4MINA 5A4IS 1ZM2A 1GZ7A 2FFBA 4ZVMA 2ZM6O 1U7DA 2PH7A 3UNXA 1YHYA 2H2HA 1JJ7A 2QEXF 1DAKA 2PXAA 3OZEA 4IGFA 3VSDA 1PWEA 4CIVA 2ZUWA 4RO2A 5JE8A 1K9SA 1XZGA 3GF4A 1F2VA 1TQ6A 2VDMB 2FMIA 1OCOB 2I71A 1PJZA 2F9MA 1Y4DE 3RBZA 3M2PA 2F3TA 3NFYA 1J09A 2EGHA 2RN9A 3BA6A 3HPRA 3JZIA 3F49S 5MN5A 1FYXA 3VNVA 2OAP1 1O94D 2OV3A 4FIDA 3DPUA 3HUEA 5D8DA 3AK4A 5DB4A 4DPLA 5BSFA 1RIFA 2SHKA 3OIGA 1CHDA 3FLMA 4QNRA 4RK5A 1KI8A 3RH0A 3IHWA 2QRJA 2EKBA 2QMYA 3CE9A 3JYLA 4RHFA 3CVXA 3T9DA 2X4IA 1G66A 5FOTA 1PZFA 2IBMA 5AXBA 1DWPA 1M57C 1KEWA 4PYIA 3S4YA 1H22A 5KMGB 2KM1A 3ENNA 1N77A 1ZVMA 4RBNA 3WMGA 1KJ9A 2FFHA 4H35A 4ARVA 1M66A 3ZU4A 2IBSA 1BMFA 1O4VA 3BCUA 4HGQA 3U7IA 5DNEA 4YPFA 3RRMA 3UVEA 3ZJYA 1S2GA 1SFRA 4DUGA 5CEFA 1B2LA 3B1VA 4DTCA 4D7TA 4D7AA 4RQOA 3K5HA 1AQUA 1E2LA 5I7AA 3N27A 4IHJA 3L77A 1EK2A 4U2DA 4IW3B 5ICSA 5GAJA 1M2GA 1CUFA 1CZOA 2OC4A 4PIVA 1LC0A 4BX3A 4X20B 5G0SA 2GHYA 1KJWA 1ZJ6A 4NH0A 1XTVA 1E2IA 3KQHA 3VXKA 1U6JA 2ONZA 1L5VA 4II3A 2PZMA 4HLNA 4H6PA 4FDTA 3ZW9A 1DIAA 1OT3A 2GBGA 2FE1A 1FFHA 1KECA 2B7CA 3LY7A 3M9LA 3UK7A 3ILHA 3P0EA 2I65A 2HGSA 3RTEA 1JWLA 5EG5A 5HNKA 2QIOA 4E1AA 3RWOA 1NN0A 4G8BA 4JFRA 4MGEA 4UXIA 1S7GA 1JJOA 3L7KA 2JFPA 4WK2B 4G4XA 1JNYA 2JLZA 2JGIA 2P9FA 3CXHF 4XB6B 3SNHA 1SUWA 4IFEA 3U62A 4C3OB 4IIJB 1QCYA 3WWEA 1U98A 3A2NA 4YEDA 1VF5B 3QF7A 3F6MA 2A14A 2VQDA 4X61A 3RVNA 2XCSB 4JIMA 2RHCA 4HK4A 3MD0A 2HBYA 9ABPA 1XVUA 3TGPA 1IM5A 2VHUA 2C2YA 2COEA 3AF1A 3PD0A 2YMPA 5A9RA 1FBNA 1ONNA 2HG5C 2NSHA 4DCVA 1AM4D 4JI4O 5H1YA 4OTZA 4R69A 3TSZA 4PDMA 1L6RA 4B5LA 4V1CI 3HVRA 4XUGB 4GLBA 4CH6A 2NADA 2HI0A 1OCZC 1WF6A 3R3SA 1NT2A 4KBFA 4YCSA 1Y5RA 3P20A 4Y8VA 3EZLA 4KX3A 1ULBA 2CJYA 1XXHA 3I5YA 1JXAA 3HB7A 2FJ0A 4K1LA 3HGTA 1YTFB 4KE6A 4ZHSA 1BDHA 4J0HA 3KQQA 1VMEA 2PBFA 1P1KA 2Y68A 4M53A 5CA0F 2X3YA 3JR3A 5LBQA 4TYYA 3A6ZA 2VA8A 3CTPA 3VPBA 1Y80A 4OIFA 4QLBA 2O19A 3QJYA 3PNBA 1RBYA 3OPYA 1P1HA 5HF9A 4RPLA 1G3QA 1F2UB 1G19A 4M1MA 4DIMA 1CUJA 1TM7E 1RYYA 1FNSA 3QGMA 4HQOA 1B0UA 3NNSA 4KXQA 1VP3A 3W9SA 2BFMA 2I3ZA 5K7SA 1FRQA 2H52A 4R83A 1TC1A 4BVSA 1OX6A 2GEDA 4A82A 3E3AA 2Y0BA 1HQDA 3LK6A 4GI5A 2HPAA 1NVVQ 4OHVA 3EY4A 3M7MX 2IPXA 2BFBB 3UYLA 2I29A 2RHJA 3BXXA 5DBEX 2GPNA 5ELLA 2SKDA 3IVAA 5F52A 1VZ2A 1EINA 4BECA 1EZVH 5ED4A 1OAKA 5AD1A 3FYUC 1WMFA 4N3CA 4E5VA 2IQIA 2UUAB 5BUSA 5I48A 4ZVNA 4E2YA 5LMUB 1IIBA 2H5LA 4GR9A 4O2AB 2XLCA 4AURA 5HILA 1H2MA 2ZDIA 2OBYA 5KDOA 1L7QA 1BD4A 2DH6A 3ANMA 3I01M 4HBZA 4MO9A 1XEWX 5DTQA 3RJ5A 2NMVA 3JAKA 2I80A 3QI2A 2MW2B 5F1PA 2BGTA 3ZD8A 4MQUA 4E1VA 5ADWA 4ZAZA 1UBLS 3F46A 3DE7X 3PT9A 3DG9A 1XJ0A 3L5OA 5ULLA 4AJKA 5C4IA 1UFKA 5CCDA 1VCOA 5EZYB 721PA 1NULA 4WW0A 1CVIA 1Y3HA 2FDXA 2ZU6A 4WZ6A 4KBGA 2J3JA 1V7ZA 3ETJA 2ZROA 3O9ZA 3W79A 4GL2A 4LF5B 1D2NA 5ERGB 1MKYA 3IMFA 3T4UA 4B87A 4F3NA 3QUBA 4EIWA 1BIFA 4RD3A 1R0YA 1VQ1A 2ZIEA 4HF7A 4LOAA 5EWLA 5B1IA 4A2PA 3R5SA 1OILA 3APOA 5IDWA 2X8JA 1CU1A 1JLLA 4BJ5A 4IZHA 2O14A 1BVUA 4RL6A 1P0FA 4CM6A 4EDFA 3KR9A 1QCCA 2YCBA 2RKWA 3EMBA 3SIXA 5CAEA 1R6DA 2OB2A 2W98A 2HD4A 4UUMA 2YWCA 3VR6A 3NB0A 1J07A 1BHSA 2B8WA 4PFKA 5EMKA 5AKZA 1OCOC 5F1OA 1JHRA 3ZE1B 2DMRA 4UTRA 2A78A 3IC5A 4LVUA 4R51A 1T13A 3O03A 3HL4A 2CLEB 3MCAA 3B3GA 1XELA 3DBVO 2EZPA 1C4XA 3N59A 2FWJA 4LXIA 4ZARA 1UPXA 4MDFA 4B76A 2GJKA 3Q85A 1VJCA 3ORRA 4NJEB 2VPXA 1T4BA 2G4LA 2HHAA 4KQGA 3RU9A 3UN1A 4Q47A 4RTLA 3EGDB 1H69A 4A6XA 1REQB 4XASA 2C7VA 1UK8A 4R7TA 1QORA 5JXJA 5F3WB 4KE9A 1Z47A 3GRCA 1DQRA 3DEYX 3RADC 4LWPA 1VP9A 2HQSA 1MVOA 2Q0AA 3HXPA 4MZDA 4NDAA 4U3FH 1QP8A 2DM6A 4G6ZA 4DVJA 4YRMA 3OFKA 2CLCX 1RQ7A 1G63A 3BE4A 2O54A 3PNMA 3EB9A 3V34A 5I8ZA 2DF8A 1M1YB 3MUFA 3OQ6A 3MMSA 2I6QA 4TWAA 2VP2A 4P98A 4PPNA 2YHIA 4UPDA 3PXUA 5AHWA 5EP1A 1QZ3A 1JJIA 2C3PA 1NW5A 3LCRA 3KSAC 4J75A 4JLJA 1DC4A 5T41A 2YIAA 2F1MA 1AGNA 1R0CA 3NBAA 3F1KA 2FVXA 4WACA 1XKLA 4DGSA 1QHHB 3OM0A 3IEMA 3D7NA 2CTRA 4NTYA 1AHHA 4JI8O 3KV3O 1M57B 1HW7A 4BO1A 1Y98A 4XCVA 2CGEA 1XYVA 1BN6A 1MPTA 3FFMA 1NVVR 4YUXA 4ZDKA 1B3RA 1TZMA 1Y34E 4R1UA 3ZMVA 3EH2A 3A4MA 2QX4A 3STHA 4AXXA 1N4AA 5JFGA 4CM8A 1SQSA 4BMNA 4X65O 3PYLA 1PD0A 3BHIA 2P9GA 2W2PA 4ID9A 5BSTA 3A4VA 3TFWA 5EIEA 1I30A 1OV4A 4V2IA 2OO3A 2Y1WA 1UC8A 1ORIA 5CXSA 4ZO7A 5I8PA 4M37A 4BPRA 1IAQA 5AJHA 4I4LA 3V1NA 4EKEA 2KYRA 5EN4A 3ZTTA 4NEGA 5IT4A 1X9GA 1ABEA 1KO1A 1EWVA 4ZCLA 2V3VA 5AXDA 4AMUA 1U6IA 5BW6B 4ENWA 4DJTA 1CTQA 2KQUA 3L84A 2I76A 2CK3G 2R6JA 4EEQA 3N76A 1PJAA 4GOOD 4PY2A 2XMRA 3WX0A 3WWOA 3JARB 4ZJPA 1FXKC 2OTLV 3K31A 4RY8A 3OCYA 2N46A 3OPNA 3NVAA 1QR9A 3PEYA 3BGIA 4CM9A 4PS1A 2V7QA 1Z4NA 2VP9A 3ICOA 5AJYA 5DHQA 3TIGA 4DKXA 1YKFA 5EHZA 5I7RA 4ZHVA 3FDIA 1WQ3A 3M8KA 1L6IA 1TQDA 1VJGA 4MP8A 3IKLA 4YJ3A 2HJHA 5BN1A 2YFKA 1KEUA 3FDFA 3M6IA 3AG3B 4RAOA 2HZBA 3W7WA 4N8DA 2YUAA 2O9JA 5EZ5A 2AGAA 3OZAA 3RJTA 3TSYA 1PGOA 1V9LA 3V6MA 2OIEA 3BQ9A 3GRKA 5AJTA 2UXXA 3HG7A 4PO9A 2VAMA 1JT9A 2R6AA 3CGWA 1H2AS 2Y2VA 4U7HA 1T8YA 2C4VA 1N2CB 2F1KA 4FC6A 4LTDA 4OIMA 1KIAA 3OPXA 3GVCA 3N2IA 3VTKA 3TPFA 3AG4C 2DR2A 4YIHA 4MTOA 1W5AA 3JASB 1H38A 2ABWA 4ZZ1A 1H1LA 1E3DA 2XY4A 4R1PA 4OQDA 4U00A 4IQFA 1ZKMA 1UZMA 3I04A 1JDZA 1GCIA 1ZXXA 3VHXA 2JIRA 3ICWA 3QUTA 2HL6A 3DFKA 4J0IA 1BXKA 2PGAA 4YBZA 3ZNPA 4HNTA 3TDKA 2BZSA 3P10A 1U4SA 1VA4A 4H7HA 4WHMA 1VRWA 3SZGA 3CLTD 4KE8A 1YHQV 4NE9A 4CCYB 4EENA 3KXKA 4L9SA 2ZBDA 2W42A 1XRPA 3PLNA 2OXRA 4TMTA 2QAIA 4WZZA 2PUBA 2A5FA 4NU6A 4D0SA 3OBYA 4J4BA 4KI0A 2ODPA 3FGZA 3OOJA 1UT6A 1QYVA 2WC1A 4HEQA 3B77A 2BSKB 1CUDA 3Q6NA 1Q3KA 3NBXX 3WDSA 3LTNC 4EGQA 3ER8A 4RHXA 2B5WA 2A79B 1K7FB 1Z56C 1P81A 4ZHWA 3QFRA 2QM8A 3BA1A 1SBZA 4MAMA 4PC6A 3SPGA 4L51A 1P1BA 3IVXA 4JKYA 5EJGA 3O3OB 3WU2Z 1FL9A 1T1SA 3RK1A 5J2UA 3T9FA 1VXRA 5KWVA 1HK7A 2AMYA 2CXRA 4EX6A 5IJ9B 4FUTA 2OT5A 3LAWA 3CLRD 5BN4B 3K6SB 2FZCA 1M1KH 4XXHA 1BXRA 4WN3A 5F51A 3ANXA 3KNZA 1YF2A 3A9SA 2N04A 4UM5A 5KOIA 2W4QA 2HHHB 1VPTA 2CL7X 2PNFA 1JR3E 2DJ5A 1HBJA 4HAMA 3LDUA 2CZGA 4RSMA 2AXEA 3C3TA 2ZYAA 4TZKA 3EA4A 3NHFA 3DFZA 5AJXA 4AMVA 1S4MA 3A9TA 4NDNE 5EYPA 2NVBA 4TWRA 1YJWV 1PXWA 3SNKA 3JQ8A 3HJFA 2BZGA 3HA5A 4MA4A 4UBLA 4LGYA 1CZLA 1QIJA 1SGWA 2EHDA 2OHHA 3EA5A 5KNDD 1RQ2A 4D25A 1QNLA 2ZJZA 2OD2A 4L3OA 4FK5C 4F6RA 2DYRB 1NJSA 2POCA 4BLSA 2UXCO 1LX7A 2PMEA 3AV0B 4C4AA 4MKZA 4DLSA 1PBTA 3T1YO 4K6OA 3CRW1 4Q1AA 1E5XA 3ASUA 4J9UE 4PF1A 4YHHB 4R8MA 2BMJA 3DZKA 5TE9A 1VLJA 4QXOA 2GEUA 4F3CA 1KJJA 4IXTA 3WLIA 2AN5A 4F97A 1NT2B 3O95A 1OU0A 5THXA 1N5RA 3C1AA 3TQRA 3GDOA 2EOAA 2QTVA 4FYHA 2GUWA 4TMVA 4A5SA 2HLHA 1L8QA 2Q3FA 3S1AA 3BQMB 3HABA 4UULA 3S40A 3GVIA 4Z9FA 1UWVA 3ZUPA 4EAAA 3GB7C 3H9JA 2W22A 1ZSNA 4AG6A 1UMDA 2BT4A 2Z8ZA 3OKPA 1XNQB 2N1BA 1WULS 4C0WA 2IEGA 2IYVA 2WP0A 3CZ4A 4J1QA 1GPYA 5EJ8A 4EB6A 2QKSA 1JIJA 1W87A 2GBFA 4X0EA 1WLSA 2GCPA 2MU1A 5KVVA 1JR9A 3NV9A 5KJ1A 4O1IA 1A76A 2ZTSA 1IE3A 4BWYA 2Y1DA 1T2VA 3WBBA 3LGXA 3PC7A 3P9RA 2O57A 4J0GA 3IKTA 4OMDA 1SIOA 1WQ1R 3KWFA 3FVWA 3FPSA 3FYEB 1RCTE 4XDLA 1O2DA 3CVJA 3U3DA 4H0CA 5EHGA 1NJGA 3DMNA 4ZU6X 5TT0A 1NLMA 4EOGA 4M49A 1U2QA 3UAXA 3PJRA 1B6QA 2WILA 3GZTB 4BVJA 1W35A 2SCUB 3GARA 4I1VA 5FOUA 1TIPA 4R1LA 4LXTA 4F1WA 3ON5A 4J90A 4UVEA 1P4SA 2QWOB 4DR3O 4TKZA 2VTDA 4DXDA 5AMXA 5SY9A 1YR6A 4G8CA 3AY3A 3JTMA 4II7A 3KYIB 5FR2A 3TGWA 3RIYA 3HPLC 1CS0A 3WB2A 1RRVA 3KALA 3UAZA 3WLKX 4DIFA 3RSGA 1I1NA 4R7ZA 1SQPH 2OSBA 4QXQA 1XMXA 3EC2A 5HP8A 3QP9A 4K1XA 3U3XA 5TMPA 3UB3A 1NI5A 3GRFA 1A9XA 5HCIA 2NZYA 5BYBA 1SHLA 2K5UA 1MW9X 1Z2EA 4JGSA 2WLMA 1ZA1A 2SICE 3BWVA 1XWWA 1VEWA 3K5WA 4TRMA 3TRIA 3NWOA 2H8PC 1LJLA 4UOEA 5HM6A 4BLVA 3GRPA 2WALA 2ZBEA 1MG0A 1PZHA 2C42A 3EFEA 2TSYB 3KQTA 4WCDA 5DM2A 3FAKA 3FMOB 1WXEA 4CG2A 5EWJA 3LYBA 3BORA 2JLXA 2GAAA 1EMDA 2O3QA 4MULA 2R65A 3HP4A 3CX8A 4IDGA 1L8XA 4YJDA 1L4NA 3NIDB 1E9AA 4RD1A 4HDRB 1LDEA 1E2DA 4NENB 2QYSA 5IKMA 1H65A 2JIMA 3U09A 2AFRA 3ML1A 1GGJA 2JBAB 1U8AA 3HDQA 3ESDA 2WFZA 2ZVQX 3UPUA 4LF4O 4BYMA 4DR4B 2BKUA 1Y8QA 1I2DA 1I4WA 4Y2XA 3PTAA 3IOEA 2OCAA 1GR0A 1R12A 5IE9A 2SECE 5DM4A 3ZY3A 3EPHA 3FOAA 2WIJA 2YYAA 2EINC 1NOJA 1SERA 1HDRA 1UT5A 5KTYA 3RVJA 3WGQA 4BO0A 1ZU4A 4P7GA 4DANA 2GBCA 5FHRA 1BVYF 1XCLA 1TW2A 2LKDA 1OR8A 3IIEA 4JROA 3VV3A 2LCFA 3OLZA 1FP1D 1O0CA 4EI7A 4GM1A 4TRNA 1RBQA 1YS6A 1W8IA 4YLYA 2A67A 4X3CA 3AFIA 5LNK1 1Z6GA 2FW7A 4B31A 4GYKA 3WNVA 4F8YA 5BYJA 4PICA 1VB3A 3ZKWA 3DUFB 2GA9A 1J0EA 4DSAA 4YRCA 4PA3A 4HT3B 5L6MB 3B38A 2CXHA 4WFAV 1SU4A 2FPWA 1YC2A 2A0FA 2CB9A 3BICA 3R3VA 2HWXA 2I6TA 4AJLA 4ASUD 1PD3A 3HKCA 1K8ZB 5A3JA 1A69A 4IF6A 3R1IA 2R1TA 3I05A 2R70A 3GAFA 3NGMA 1JEOA 4PANA 5CM9C 2CLKB 3IE2A 2YVLA 1C9JA 2JAWA 1KAHA 1XU4A 3PHCA 3KE1A 5D5HA 5DSXA 2JIDA 4E11A 3W7VA 2AOTB 1IUKA 4LJ8A 5KINB 2ZI3A 3SG0A 4KQ6A 5FLXM 4BP9A 1EBOA 1HE4A 5HF5A 1OBHA 2O8BA 2GSWA 1YJ9V 2ZT5A 1NY5A 5TGDA 1JG7A 1IEXA 4F9EA 2H29A 4B6EA 1DOAA 5BT9A 4Q82A 1PR5A 4AWAA 4HTFB 4G5GA 1TMOA 1TA0A 5T3UA 3PFNA 4QYXA 3CVYA 3JQDA 4EBBA 2QTVB 4RDHA 2R7NA 1SG0A 1WZIA 3DDZX 1XKTA 1P3Y1 4IKOA 4NMXB 4TV8A 1EWRA 2P9EA 5TMBA 4ZEWA 2RB4A 1IZZA 5HTOA 3WOVA 1Y4AE 2X7JA 3W78A 2ZYDA 3R9WA 2PEYA 4ICIA 1NUQA 2AEJA 3HNOA 4PG7A 2P9BA 2ZE8A 1F4PA 5K05A 1D1TA 4QBGB 3S5JA 2IHNA 1G4YB 3H4VA 1US8A 3JZDA 2OTMA 1EM8A 4C8IA 2PSEA 5AVMA 2DECA 4KQCA 4WBXC 4EY3A 3Q10A 4CF4A 3GXOA 4F4UA 4AY6A 2JGEA 5F35A 3RVSA 2RG1A 4FLZA 5IC5A 2KBEA 1CERA 4BYGA 3MS7A 3T1HB 3PK0A 5E6SB 1E69A 1T5DX 5CFZA 4BWFB 4NCBA 3G13A 1B00A 3JVVA 5BMVA 5CGZA 1ONBA 2WG1A 3OT1A 4Q3KA 3NGXA 4EPVA 1SPBS 1WW3A 5DHRA 1GG5A 1FYFA 1SIBE 1VIBA 2PMKA 3V8QA 1UEXC 2NNWB 5HDQA 4XFKA 4KPFC 3O94A 2AFIB 3PU6A 4UUNA 3ANSA 3E5MA 4YONB 5E6UA 1K6EA 1B73A 3ZWDA 1T2AA 1FXKB 1DMSA 1VIYA 4TMZA 4D3SA 4DR1O 3WADA 1S2OA 1E6EA 4L8FA 2ZSEA 4IQ8A 1LI7A 1IK6A 2ANBA 2J07A 4W63A 5EERA 2JRLA 4Z4FA 3ED5A 3BJEA 2PUAA 1KMNA 1AKQA 4X3OA 3QWBA 1W6UA 3LUCA 4OAOA 3HHPA 5LA6F 2C61A 4E94A 1M73E 2UYKA 3MAQA 4K9PA 4YRZA 1IRIA 1KBOA 4HDSB 5G0VA 1BRMA 2X5XA 2GPYA 3L0OA 2WWIA 3EASA 1RMTA 5CBKA 3HLTA 3FY4A 2VXYA 2FPSA 4W4KA 2RB5A 4FGKA 3CE6A 4V0LA 3MGKA 3SXPA 5CXUA 4BGUA 1Y6GA 1DJOA 3MXTA 5D3KA 4INPA 1C29B 4TYQA 3OD1A 5FBVB 2HJDA 2RHLA 1OLXA 3FWZA 4Q6WA 1SHZA 3JWPA 4BO4A 1OFUA 1MQ9A 2FN8A 3HCWA 3VMFB 2QWXA 2XCOA 2YW9A 3FETA 3HBLA 5L3FA 3K12A 2IXTA 3LT1A 2AKEA 1H3NA 3T3EA 1E79G 3N7UA 5JH7B 3JD1A 1EDEA 1NMQA 1VJ0A 3R0PA 2D2FA 5DLYA 5C8ZA 1RXWA 1EUQA 5F73A 1JZQA 1T1IA 3EZYA 1BJRE 4MR7A 3UJPA 5EP2A 4BFVA 4PLYA 1IBMB 4BZPA 4L75A 3OW2F 1V9SA 2EP5A 2I4NA 2P0YA 3L7MA 3PSHA 4QARA 2EVWX 4D4JA 1WDTA 4DIUA 3H1JH 4RS4A 4EEXA 4ZREA 3IXLA 1G9XA 2FR8A 4JS0A 4HWKA 3W1WA 2FPKA 1MNQA 2I7DA 1RQLA 3B9BA 4UMVA 3W2GA 1QQAA 1KK0A 1C3EA 1EFVB 3CR8A 3ZCQA 3PXDA 1LUWA 3RC1A 2EIKB 4EGAA 3ZH9B 1IX9A 1EFKA 1BMTA 3T3DA 1YBFA 1YL5A 1JP7A 2UVPB 1G8SA 1Q0HA 3FKSA 4HLDA 2OPHA 2DH5A 4AYTA 1ZRMA 3T94A 4DWOA 3OM1A 2XHZA 3AG2C 4B3GA 3NVKE 1P5ZB 2XTJA 1BEUB 3HEAA 1RXSA 3NR7A 4DR2B 1FP2A 1QXSA 2FWNA 3DEIA 4FGSA 1IV1A 2F90A 3CMCO 4M1OA 4CT0A 2ZCVA 5GVRA 3AC0A 1T3HA 1GTSA 2ZJ7A 2C54A 3ZXYA 2C2WA 1J2EA 3X43A 3E6AA 1KY5A 1VG1A 4OKSA 3BRWD 1QB7A 3KJFA 2PZAA 3MWYW 2HRYA 1CR1A 4K8OA 5JEDA 4JLKA 1RWPA 3AUJB 5HF8A 2JPDA 4JH0A 3E1GA 4UE2A 4LDPA 2CMFA 2GUZB 1Y76A 4G56A 2GM5A 1HE1C 1EFCA 4QFDA 2JI8A 2ZXWC 2M7WA 2EJCA 4I4IA 3DZBA 1XEWY 2Z2ZA 2ZBGA 2XI4A 3BMCA 3MHSC 1DUVG 3GRRA 2IXAA 5A4KA 3F6YA 1DJPA 4DR6B 4C29A 5E9JA 4EF4A 5L3QB 1O6CA 4ARIA 4OV6B 4PZZA 4I9QA 3MA0A 3OLXA 1SUSA 1J39A 4KO8A 1MJGA 3PN1A 2OCPA 2BFEA 2AW3A 2G4CA 4DILA 2NVUA 1XDCA 4IDNA 2ZR0A 4GKJO 4FJCC 2V1XA 3N70A 1H4TA 3PA6A 1GGMA 3RUEA 5CMLA 4A8HA 5AVRA 4BAUA 1L5HB 4HDKB 1C1DB 1N2GA 5LHGA 1T5TA 2B2NA 2CJWB 2REBA 4LFCB 1Q1AA 1QMPA 3A2LA 1B76A 3B2NA 3DWFA 3FYUB 2IYEA 3MBOA 3MTDA 4JDUA 5DGXA