5KMGB

Near-atomic cryo-em structure of prc1 bound to the microtubule
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
431
structure length
431
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Near-atomic cryo-EM structure of PRC1 bound to the microtubule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 176
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kmgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kmgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kmgB01
4O4HA 5LXTA 4E6EA 4YJ2B 5GONA 5JH7A 3HKEB 4YJ3A 5MN6A 4F6RB 3M89A 3N2KA 2RHLA 4O4LB 4ZOLB 5CB4B 4DRXA 3E22A 4IIJA 4LNUA 4O4JB 3JAKA 4TUYA 1W5AA 4O4HB 3JATB 3WGLA 3UT5A 4X20A 5GONB 5JH7B 4YJ3B 3RYFA 3N2KB 3RYIA 3E22B 5KX5B 1TVKA 4TUYB 3JAKB 3ZBQA 1W5FA 3JASA 3UT5B 4ZHQA 4X20B 5JVDB 5MN4A 2VAPA 4O4LA 4ZOLA 3RYFB 3HKDA 3RYIB 5LA6A 5EZYA 5CA1B 1FFXB 1TVKB 3JATA 3WGJA 3JASB 3ZBPA 1JFFA 4ZHQB 5MN5A 1W59A 3HKCA 3V3TA 3HKDB 3WGNA 1Z5VA 5LA6B 5KX5A 5EZYB 4TV8A 5IJ9A 2GVIA 4KWEA 5BMVA 3WGMA 5IJ0A 5JVDA 3JALA 4EI9A 1JFFB 3HKCB 4U3JA 3WGKA 3C8LA 5CA1A 5EYPA 4IHJA 5ITZA 1FFXA 2Q1XA 3VO9A 4ZI7A 4TV8B 4EB6A 5LOVA 5IJ9B 1TUBA 3RYCA 1OFUA 5JCOC 5BMVB 2VAWA 3R4VA 5IJ0B 3N2GB 5LP6C 4U39A 3JALB 3CB2A 5LYJB 4B45A 2BTQA 4U3JB 4B46A 5EYPB 2R751 4IHJB 5ITZB 5M7EA 4ZI7B 4O2BA 5J2UB 4EB6B 1TUBB 5LOVB 3RYCB 3JARB 1W5EA 5C8YA 4O2AA 2RHJA 5EIBC 2BTQB 4I50B 5FNVA 2R6R1 3HKBA 3RB8A 2Q1YA 4O2BB 3N2GA 4TV9B 4M8IA 4FFBA 5LYJA 5CA0A 4X1IB 4O2AB 5C8YB 1FSZA 4O4IA 3RYHA 5FNVB 2VXYA 3HKBB 3JAWA 5JQGA 4EI7A 5J2UA 1Z5WA 2XKBA 3JARA 2RHHA 2VAMA 5IYZA 1RLUA 1SA0B 4FFBB 5KMGA 1W5BA 5CA0B 4X1KB 4DXDA 4I50A 4O4IB 3ZIDA 3RYHB 4HNAA 5JQGB 3JAWB 5J2TA 4TV9A 5IYZB 4X1IA 5KMGB 4X1YA 5LXTB 1W581 4WBNA 1RQ7A 5JCOA 4I4TA 1RQ2A 5LP6A 4HNAB 4DRXB 3VOBA 4I55A 5J2TB 4IIJB 1SA0A 4LNUB 2RHOA 3VO8A 2BTOA 4X1KA 2XKAA 4YJ2A 4X1YB 3HKEA 4XCQA 4F6RA 4WBNB 4I4TB 4EI8A 5CB4A 5LP6B 3VPAA 5EIBD 3M8KA 3VOAA 4O4JA 4I55B
chains in the Genus database with same CATH superfamily
5AOBA 3TH5A 1ZJ5A 3J7TA 1PFYA 1QHIA 1PNVA 1DC3A 1K5HA 1A5AB 3CNNA 3CIOA 2H63A 1PUJA 1T24A 1U2GA 4YXWA 4WFQA 2HC9A 3PE4A 5F5XA 2BPOA 4PLVA 3D6UA 1NF3A 1E94E 1H2SB 2C1EA 5DCLA 3HKDB 6ADHA 3ASNC 3L1VA 1JJ2F 1RQNA 4AG5A 3LUJA 2ACEA 2H2IA 1R64A 3T3OA 5DLEA 3K6SA 3T4EA 2F3PA 3C97A 1E99A 3PX2A 3A04A 1UBUS 1PV0A 1ADBA 2PT7A 4N76A 4BAYA 1QU7A 1GAQA 5ISMA 2E4YA 1DQRA 4IS3A 2RB4A 2JAXA 5DTIA 4JTAB 5E4TA 3VDNB 4Q9JA 3E9CA 5KSYA 3QW4B 3NDBB 1KY4A 1XD2B 3B53X 1QQAA 4BNXA 3PKIA 1ZKMA 1TGOA 2JRCA 5FA5A 2HLHA 3LL7A 5CBFA 1RC8A 3U3JA 2UUBB 5KHIA 3L7LA 1ORHA 3CPEA 1M90H 1HYGA 3W1VA 1YE5A 1MIHA 1IY2A 4JMPA 1NTKH 4XVRA 3EA5A 4DR1O 2GD1O 1ZESA 3COJA 1XAIA 5AM3A 3X1JA 4WLOA 4YYEA 4BRUA 1YDEA 2BAGA 1N34B 2IW5A 1F23A 3AGKA 3SYNA 4EUHA 1DZIA 1H42A 1QOZA 3I5MA 1GY8A 3SIUA 2BCGY 1XMIA 2AG6A 4ETIA 3CVXA 3WLPA 4GWLA 5DM1A 2PGLA 1T8SA 1L3IA 2Q0XA 4B3MB 5AVJA 4IYJA 1GADO 1Z2OX 3CIFA 2AEMA 4URHA 4BIZA 4LWPA 4GR5A 4PWZA 2CBGA 3QG1A 1VPEA 4C14A 3SZRA 1DKNA 2X9LA 3QLVC 3UUEA 2X4DA 2I8CA 1U97A 1PJQA 1BFUA 1PT9A 4P4SB 2FZGA 2VZ0A 1SVSA 3WYEA 1VCMA 5G0VA 3MTGA 3EF0A 3L1KA 4BCDA 1NONA 4K9PA 3JZDA 1WCV1 3Q5EA 1Z0AA 4I4TF 4MLDA 5DGXA 4G0UA 2JFGA 2E4WA 2VPYA 4Y6SA 3CEIA 2I62A 1DKLA 4FT2A 4B9AA 4B44A 1AILA 5L3EA 3ZIAG 4O5AA 4IPTA 4MQFB 1JIJA 1KAEA 4RUFA 1Z4QA 2WF7A 1U2DA 1BA2A 3THXB 3G1WA 5J59A 2JCYA 4OBWA 2GS9A 3SYPA 4BGEA 2GAAA 1CQXA 3CINA 1MDBA 1P91A 3CVVA 4JI7O 2PLRA 2LW7A 5BNTA 4RQOA 4R8SA 3N7AA 5BSHA 3GDFA 4UB6Z 4QUGA 1NYRA 3WNZA 1C2YA 1WO8A 5AIAA 3WP1B 2ZJOA 3FMIA 3T3IA 4ZCRA 3S1SA 4WZBE 3IBYA 1US8B 1Z0UA 3P2OA 1MH9A 1RM1B 2YJNA 4CS4A 2GHTA 5HTOA 5H3CA 1SHZA 2YY5A 3P19A 2ZPAA 1EX1A 1U04A 3NOXA 4BUCA 3K9GA 2C2MA 2FFRA 4G5SA 2JAWA 5EESA 1U99A 4E5VA 2V6MA 2FOXA 2QSUA 4Z9YA 2JEZA 4MVMA 2G82A 4O8ZA 2IV3A 4B75A 1Z5UA 1F20A 4M1EA 2C98A 2W6MA 4IDDA 2WHQA 1Q1NA 1PXWA 2AA3A 2E4UA 1O0BA 1OBFO 5AVSA 3UC5A 1VQ8V 4RY8A 5HP7A 1LBHA 4FXOA 5PGMA 4CF7A 4N0MA 1VF5B 2FEOA 4D3SA 1GO2A 1PR6A 1D2MA 3ERNA 3PP8A 2X9QA 4YV0A 4FHZA 2WSSA 1R1MA 1A77A 2ZYGA 4QUBA 1P29A 1U0FA 3VKFA 2Y71A 2VWQA 4KXQA 5JT1A 2ZR2A 4R8RA 4MGHA 2JKYA 3ROQA 1YI2V 3GLRA 4LR3A 3Q88A 4LJ8A 2XBUA 4I7ZB 2ASVA 4QUDA 2Q5CA 4EHIA 2DH6A 5G3ZA 4QT4A 5B1NA 2J0UA 3GRKA 2YZNA 1JE0A 3UG7A 2DEUA 2QY6A 4NFSA 3A14A 3DFFA 3ML0A 4PBTA 1N2OA 1L5WA 4W8OA 3BMXA 3JZIA 2FMUA 2Q0OC 2QYTA 4QG7A 4CM9A 1VIDA 4GMHA 2C94A 4H60A 4X24A 1NUHA 1Q86W 3QF4B 1GO0A 1RJGA 4JC5A 2JAOA 3CCQF 1RZRD 1WETA 3OCXA 5K0JA 3VBEA 4MJLA 2QTTA 1PT7A 4LCKA 3Q72A 1N0VC 3GWOA 2EFHB 3K9AA 2WHXA 3A6GA 1BH2A 4V38A 1A1VA 1N4CA 3QUCA 4GL2A 4J1NA 1FFDA 4CV0A 1M2OB 3FNQA 1K4DC 5ALOA 4LRQA 6GPBA 3AESB 4OBBA 4QYWA 4ZCLA 1AXRA 4QVKA 2UXCO 5AUOB 3CZCA 5JSHA 4FTWA 2PKCA 5IJ0A 1QHFA 4R51A 2B9EA 1Y5IA 3QMMA 5D1NA 3D7KA 1D9XA 1GIAA 3SC2A 3LSTA 5IVPA 5K0NA 4DIUA 3PGVA 4EL5A 3O4HA 2XCRB 3MHHC 4LF9O 1RDFA 3DKKA 4DLPA 3O75A 1DWPA 4YQYA 2FF5A 4EFDA 5TQ2A 2MINA 3D6MA 2XMGA 3A2MA 1UCFA 3H4IA 4KREA 3GNSA 4H44B 3MBIA 5ERXA 1RXEA 3P45A 3DTYA 4YJDA 4OK6A 2B6NA 2P4SA 1IPHA 3PF8A 1C30B 3E6AA 4NCAA 2GV9A 3F5QA 3D8CA 5FPHA 1GO1A 2NU7A 4DYDA 4H37A 2HSGA 2HV9A 4X92A 1BGVA 3KSMA 2PH3A 4IQGA 3OLQA 3GFPA 1XDGA 2GZMA 3CV3A 3UHJA 4D9JA 4MUKA 3CRCA 3ZZ1A 3COPA 4KO1S 3SQOA 4URFA 5D85A 4Q47A 4EK9A 2ZSUA 4QELA 3DDUA 3AFIA 3K6SB 3N87A 4JQOA 4DPKA 3PFWO 1PFUA 1VQMV 2GDJA 3EWSA 4A8JA 2OHGA 2BM1A 2DUWA 3P9QA 4MSWC 4EKYA 3O8DA 5FBHA 3T7DA 4ALJA 4N01A 2P1DA 3U10A 4LWOA 1LNQA 7REQA 2HL6A 4Q3DA 2CLFB 1GPH1 1YI8A 2R62A 1G38A 4BYMA 1UZUA 3HV0A 3E58A 2WPDA 3SJQC 4PLTA 3KHKA 3JATB 4J0KA 5HIMA 1JQKA 1OQAA 4YIPA 4MR9A 3EG5A 1DO2A 1MNGA 1A9OA 4WFBV 1P4JA 4Q48A 4MRMA 4X71A 3WLFA 2F3QA 3GAFA 3F6CA 4YASA 2R1VA 1CB0A 2YHSA 3RS8A 2C7PA 1OUMA 1YH3A 1P6UA 4V39A 4M0DA 5LHGA 5IY5B 4OHKA 4RGYA 4EA8A 3FF4A 4IGGA 4UMEA 2R0QC 1K7CA 3OIGA 1EK2A 4EKEA 3JQFA 5IDYA 1H2HA 1B2RA 2HDOA 2OHVA 1V4NA 3RFXA 1SCBA 3PLAC 1XPRA 3DVSX 4ERXA 4UNSA 1RWNA 3CKMA 4PRYA 3H75A 5FWNA 1RQLA 1YDHA 3EX7C 4OHYA 2HHCA 3C3PA 4MYTA 2ACWA 4FHDA 3F7TA 3P0JA 4WERA 2OCKA 3B7WA 1N2JA 4NNPA 1P7ZA 1AQLA 3I2FA 2ESRA 4RV5A 1MIOA 3DCNA 3H0KA 3FIUA 3D0KA 1XTTA 1P72A 2BGIA 1U90A 3I09A 4B3SB 5A2QN 4KXVA 4E09A 1JLLA 1Y7HA 4TSFG 3MCWA 2F2TA 1KKCA 4H3KB 1WCXA 3QFTA 4EHFA 1Z2AA 3PXEA 5CH3A 1SC5B 2DKFA 4ON9A 2UVPA 5L3ZA 1CFJA 5FPQA 3SYKA 3CNEA 3LLCA 4FJ2A 3TAXA 3O83A 3LNNA 5M04A 1PIWA 4PWTA 3H5WA 4EBBA 4XJSA 4LA4A 2ZRPA 4XARA 2FZ5A 2DT4A 5E2AA 1FS5A 1K92A 5KQSA 3M4JA 3TQCA 3G79A 1FXVA 1ZGZA 3W7WA 3F5WC 3H9CA 1ZH8A 1Q1ZA 1PL6A 4ZV7A 3G9TA 1P60A 3D4PA 4JA2A 1NVDA 3SIWA 2C1ZA 2XLBA 2Y0IA 7AT1A 4DR6O 3TX2A 2RHWA 4X20A 1RXIA 1H4SA 1IY9A 3KDPA 2D8MA 2H8EA 3NP7A 1X14A 1ZI6A 3B60A 3U09A 5ELXA 3K0TA 2A9FA 3KCNA 3HJUA 1KJJA 4BZZA 3LW7A 2H9YA 2JFVA 2CEKA 3UKMA 1AZSC 1DAPA 1TJYA 5EZ6B 1IXKA 3SLRA 4LJ6A 3A2LA 2AZ4A 5CITA 2FQYA 3FB8C 1QK4A 2G70A 2Q28A 3B9BA 2JEOA 2ZUDA 1U3UA 1SCAA 4QFDA 1QDEA 2C03A 3ZZMA 2HF2A 1B74A 4IDPA 1Q3TA 1H2YA 1BVUA 2I8LA 1CY4A 4C30A 1M73E 4C20A 1UF9A 4LXUA 3KQNA 3VO8A 3GEDA 4X6XA 1BQ0A 3P10A 3AY0A 5ILQA 3RC3A 2QM7A 4DA8A 1SU6A 1C2TA 4CKWA 4ZOQI 5AIBA 4RUKA 4F04A 1M34A 1F7VA 5FI0B 3OQMA 6ABPA 4B6SA 3JCZA 2H48A 3S4YA 3WRWA 2J9ZB 4RYDA 4LF4O 4FYJA 1FFEA 3GN2A 2H6LA 1E7MA 4C06A 1T2DA 2GVIA 4CKBA 4YNBA 3N3BC 3COVA 2FSHA 1P45A 3UM7A 1XZJA 2Q3DA 3Q8XB 3SKXA 5FPKA 2FFQA 5AYVA 1G16A 1U4OA 2J0UB 4A3SA 2V1XA 4CMBA 3R5JA 2RFLA 3L0BA 4QODA 2JKVA 2WOJA 3RU3A 2F43G 1K8XB 4NTZA 2LPMA 3DR5A 4TMKA 5FI3A 1SG6A 4ER6A 2GZ2A 4FN4A 2H8CA 2QYHA 3V8NA 4YMTA 2XOKD 8MHTA 1Z2EA 3REOA 2R11A 4J7ZA 5C7OO 5AM1A 1VFNA 1SQ6A 4X97A 4BO5A 4HSEA 2VJLA 3Q4GA 4MVJF 3WC4A 4R9VA 1S8NA 4KZPA 3RVDA 1ORIA 3MIIA 4N7BA 3NIGB 4BEVA 2EV9A 3IBCA 1EZZA 1VB5A 3IVCA 5JISA 1WW2A 1EFPA 1QFSA 2KMLA 4WAUA 1PS8A 1KI4A 5TF4A 1X9IA 5IJ0B 2LD4A 1PNTA 1OROA 2E4AA 3VZBA 4EFKA 3NAQA 1CV2A 2OD7A 2QTVB 1RYNA 3SC2B 1E3DA 1H0HA 2W2MA 1ZU5A 4G88A 3C3DA 4GE0A 3KYIB 1G7RA 4OQQA 2WT8A 5CYGA 2WVHA 1WVGA 2E3JA 4LOKA 4MVJD 4DXDA 1JN0A 2A14A 2R6AA 5KOJB 1ENVA 2EJ7A 2PMKA 3IQWA 3UWKA 1GTJ1 5TQ2B 2MINB 1R8QA 1XYVA 2P5UA 2R1UA 4R0NA 2H2HA 2E87A 3BSYA 1JHAA 3N6XA 2VN8A 2P65A 4PX9A 3W8DA 1M1YA 2ZDQA 2I7DA 4G8CA 4OSPA 1DF5A 1CUWA 1F51A 1XLUA 4G8JA 4CZ2A 3ANTA 3E61A 3ORSA 1OXSC 5T4BA 3T5BA 4D26A 2JZOA 2ZU0C 5JG7A 4Q02A 5EEGA 1ZJWA 1M0EA 2ONZA 5AI5A 3H5LA 3SI7A 1V41E 3FWZA 2V9ZA 2PBRA 3IMKA 1I08A 3K0HA 1YS7A 1PKXA 2KQXA 3LX4A 2XX3A 4JR0A 4MO9A 1QMGA 3EQ8A 1YCHA 3HDQA 5DYNA 3U49A 3I58A 1FS4A 2IHJA 4F21A 1QF7A 3H42B 4JD5A 2ZAYA 1HORA 4D25A 1VA5A 1NDHA 4PPYA 3A9CA 4NDZA 3Q9NA 4FNGA 4RO0A 2J67A 3UMMA 5TC4A 1J70A 5CDFE 2OFFA 4OX9O 2D7DA 4YCJA 4Z1MD 1SA0B 2ZKLA 4PAWA 3ZE1B 3JQQA 4A8JB 3PEVA 3HS3A 5EIFA 3LBIA 3OE5A 1OX6A 2XVMA 2YN0A 1WCIA 4QUIA 2YV1A 5HOEA 2WTUA 4YY3B 3HABA 3DPIA 4PU0A 1AB6A 1SBQA 1G8HA 1ZINA 2P2YA 3BFPA 3FE2A 3PIDA 4PZDA 2XCQA 7REQB 2FEKA 2JNWA 3I0MA 4LNUA 2YIVX 4YMUA 2F1MA 2EFEB 5IC5A 3CWBH 1KAQA 3I04A 2HF7A 4XB2A 3FCSB 4XDYA 2VQFB 3ZBQA 4PLPA 3AFOA 1Z0JA 2FGJA 3KQKA 1WNTA 4MNTA 4GPD1 3S02A 4MR9B 4CUKA 1NVKA 5GPBA 5IBPA 1MXHA 3V7FA 2O2EA 1T1IA 2Z04A 4S0ZA 1XKQA 1RAEA 4MRMB 3F6MA 5DCVA 2R1VB 2PXXA 1COWG 4P3NA 3L5OA 1JHUA 1XHFA 1W4LA 1WP7A 1QAOA 1N8TA 3L0IB 1RE1A 4AJ2A 4LFBB 3TO5A 3QTYA 3KQUA 1BHO1 2QRMA 5BOVA 2VSYA 5EP2A 4YCLA 3I1IA 1HW7A 4MKZA 4TQFA 2G72A 1NVVQ 3PTZA 2AC4A 3PPVA 1QB7A 4LH7A 3HR0A 3T3DA 2RAUA 2AFHE 2XJ4A 2RIPA 2CB0A 5BN4A 3PQ6A 3ETGA 1NMYA 3WRYC 3BWBA 2CHSA 3QO7A 1AKEA 4BV8A 3VX3A 3FVTA 2AVNA 5JNTA 2J3DA 5A9SA 1XROA 1XV5A 3VYSB 4ANFA 1KQ3A 4YC7A 2WZDA 4X88A 1SM4A 3QNMA 3ZP4A 4FZ1A 3QIVA 1K1EA 1MIOB 2FP4B 1I4EB 1VMGA 3LK6A 4DANA 3F5TA 4CWAA 3U0ZA 3AK4A 1JHYA 3C6XA 4AKSA 4RMIA 1JLLB 1YC2A 4IM7A 1UBTS 4AF8A 4KLCA 5D8DA 2CYBA 2EKLA 2HP0A 4F71A 2VZ8A 4B6FA 3I9OA 4H3SA 4C05A 2EX0A 3N8DA 4Y1RA 3DWEX 1ZXXA 4HYEA 5HTKA 1XHEA 2UVPB 4IDEA 1LTKA 3D8UA 3STUA 4M4SA 3DPSA 3AR6A 5I9BA 4L87A 3Q2OA 1PVDA 4YFVA 4QAJA 5REQA 3RE3A 2C07A 1ADFA 3WK5A 5EAIA 3EYAA 1BWQA 1GZ4A 2EFCB 4BWFB 3JQ6A 3ZDQA 4KO3S 2ADPA 3MT0A 5JCZA 3PVZA 3DMYA 2XE4A 4AQDA 2HQSA 4EG8A 4E94A 1VHLA 4X20B 2NACA 4REOA 1C4XA 2EZ8A 4I19A 2GUWA 1N6HA 4OB7A 4L6IA 1YR9A 4V0LA 1T6XA 5AHKA 4HWSA 3CVOA 3CM0A 2Z0MA 4QU5A 3WJAA 1IM8A 3PLAE 1XC7A 2XA9A 2CMGA 4ASUA 3LC2O 3N39C 1W5EA 1U5AA 3DO8A 4ITVA 3IULA 4Q1BA 3KCXA 2KBFA 3CCVF 2ZSKA 3MOIA 4Y2SA 4BT2A 4Q21A 4YJGA 2DQZA 3ZN0A 1WHSB 5JI3E 1Q8RA 1N5RA 1VLHA 4ZYZA 4W7HA 2B3DA 5BURA 1UBEA 3M84A 3EHEA 4S24A 4KLAA 4RAOA 3QK7A 3BQ9A 1MX9A 3M5PA 3M99B 2QU8A 3OSUA 4BVLA 3OU2A 4D9EA 4XYGA 3HFSA 5HXUA 4YJ3A 3BUSA 3GGJA 2NLOA 1ZRMA 4OHZA 2PIDA 1SCIA 4MVJP 4GMGA 2WIFA 4CKWB 2IF0A 3K2IA 3PUXA 3GPLA 1K88A 1NVAA 4IV0A 3ELDA 2JIZG 1OHHG 3I2KA 1S89A 1M34B 1Y33E 2GPJA 1Z38A 3HH8A 2JG3A 1YJ9F 3VUEA 3GLHE 1Q0TA 4CKBB 1GR0A 3EOAI 3HYLA 2W00A 1YHNA 2ZYIA 2WKRA 2Z30A 9MHTA 2C2ZA 3ENKA 4HL6A 5IVDA 3X1WA 1Q2UA 1SBYA 1PR3A 3HJRA 2QI2A 5FBKA 4OOEA 1XZPA 4D98A 1KPHA 5CFMA 3PPWA 3TLCA 4X60A 1ATIA 1FP1D 3HHEA 1XWWA 5BNWA 3CCCA 4UFZA 1OCCC 4KDCA 3Q6IA 1QV7A 2ENUA 3ZWCA 1NTZH 2RI1A 5ALMA 3QFRA 4UBKA 2Y1CA 4C78A 2J31A 1RP1A 2XWQA 1ODLA 2YBEA 2WLSA 3PNVA 5IP5A 3LUHA 1SB9A 5FUBA 3T1TA 1JL3A 3P0FA 1Y3BE 3LRTA 2OT3B 2R6ZA 1IONA 3HGTA 4N9WA 1NM5C 3CW8X 3SQDA 3NWPA 3KQSA 3H1AA 2IYFA 3L18A 2HOQA 4U02A 3ILYA 3LJKA 4C4AA 3ZMSA 1EFPB 5M5BA 4B46A 3C98A 4NH0A 4DLZA 4Z7NB 3HTNA 4XDKA 3QMPA 3OQHA 5EI5A 3RFFA 2IOFK 3MWLA 3AL3A 3AEYA 4WXHA 1FTGA 1DG1G 3ECSA 3KD3A 1W75A 2CUZA 1JEOA 4LW8A 4TRMA 3ZZUA 3MG9A 3UCXA 4DMCA 2Q3EA 2BCCH 2YYAA 4MZXA 1Y4MA 1K6MA 3R5KA 2CVPA 1M1YB 3NNDA 3WGUA 2VDKB 3HNRA 2OSVA 3FKSA 4RVHA 1II9A 3KEOA 4DO2A 1KJWA 2FU5C 3K5IA 4HNQA 1Y3IA 4W6ZA 1IK6A 2OORC 4EYGA 3W9YA 2HW8A 3IUMA 4BQSA 3ED5A 1ZSNA 2N9UA 5JZVA 3V8VA 3KAJA 1IN5A 3J80A 3WIUA 3HUFA 1E3MA 3SBOA 4W4KA 1QFJA 4FBLA 4FOSA 4W8HA 2VP5A 4QJ4A 3DE3X 3AF2A 2Y1GA 1W36B 3A3NA 4UHCA 1EHCA 1NJ6A 3A3OA 3FZQA 4GHWA 2QZ4A 1E96A 2IFTA 3OMXA 3PR2B 3T3GA 4EI7A 4X65B 1B6QA 2Z43A 4HRVA 2G0TA 3D00A 4K6HA 4K26A 3MJVA 1WXWA 5A0FA 3SEAA 5JNVA 1K9MH 3U61B 2FRVA 1BWSA 1VJTA 4U8HA 3VR4H 4DYHA 4X3PA 4CLOA 1WCIB 3ZGVA 2ZI7A 2AW3A 1ORQC 5IT5A 2ADMA 4IDNA 1T0JB 4A9AA 4LHVA 1OFHA 1P1CA 1XLTA 4YRLA 1O58A 4QOIA 2QUIA 4AUEA 4I46A 2IU4A 4PELA 1GGKA 3E84A 4NATA 3RT3C 1JT2A 1FNMA 3ZHTA 1UDAA 2N1MA 2ERYA 4RK1A 4BWAA 2JCXA 1KJQA 2UYYA 1ZONA 4QPKA 4XEHA 2VTBA 1JVSA 1YR6A 5HMLA 5L53A 2CNWD 2CHGA 1TUBA 3S8MA 4OJQA 4GDFA 3QLTA 1ZAKA 3UJ8A 2GA9A 1T3HA 3UEOA 4XDZA 2M6LA 3IHLA 3PCTA 4MRSA 3VDMA 2EKZA 5AQEA 1XJCA 1CY7A 3DOFA 3R5TA 3FX2A 1KUQA 2H08A 1V2HE 2QSAA 1NC1A 4KQXA 3IA7A 1JT9A 4PXAA 2G09A 1U11A 2AE2A 2MHCA 1Y3HA 5BN4B 3KJFA 3L07A 1H6DA 1TKRA 3LQ2A 1OH5A 2R97A 1JTFA 1JYFA 3QXXA 5A9SB 3NR7A 3R9IA 5J9PC 2GXSA 1EK0A 5KVSA 1KH1A 1VPLA 4DK1A 3AR4A 4EGSA 2EP8A 1W4AA 1YTUA 2CMHA 2YV4A 3EVDA 1E1RA 2J5BA 5KOYA 1VF7A 5AW4A 2L35A 4XLTA 1UXHA 1XVUA 2GESA 1KIFA 3MTAA 5KCZA 3L8EA 3HVRA 2HP0B 3LBAA 5JARA 4H7HA 3HUUA 3UMSA 4QULA 1NLYA 4XWWA 3VI3B 4WVFA 4KIGA 2YXEA 1W2BU 3UH0A 4R8CA 2HSJA 2VS1A 3DGEC 5JSZA 3WLMA 2OM2A 1S3GA 4DDKA 2PL3A 3TD9A 1KQNA 2XWBF 1X87A 4D3FA 3KFVA 2Z1MA 1E3QA 3NJRA 3KKYA 3HB9A 3OPVA 2Q9BA 4TPKA 4I5DA 4DY4A 2AEJA 2OTCA 3DMTA 1CXZA 421PA 3PC3A 1NN5A 2WWVD 5LDHA 2XTAA 1M1ZA 1YJQA 3QEMA 5TJHA 4KQCA 2PU7A 1S4MA 4JXJA 3G2OA 4J7UA 3DW1X 2O1WA 4UVAA 5LYJA 5I01A 1KQFA 1LW6E 3HWWA 3V7QA 1X1TA 4MLCA 3OT7A 1K3TA 2WV9A 2I3GA 3NV7A 4E1BA 4BC1A 2IVZA 2HH9A 4Z86A 1R0WA 2BM8A 2JL1A 5ALSA 3M8KA 3CPWU 3RUDA 4IYIA 4KAJA 5DNYB 2VI5A 1JKJA 2EHJA 1EB8A 1KK0A 2VQSA 4YJ3B 4M9SA 3VC7A 1ZGHA 2E7ZA 2H7CA 1JAYA 3MK31 2ATVA 1J9GA 1O2DA 1UDCA 2VJAA 3AGQA 2NPIA 5E8RA 1Z6GA 1E69A 1UDBA 2VQ3A 3R0VA 3L4KA 1FFCA 2ORIA 4AUMA 6PFKA 3AONB 1LLDA 3C1OA 3C48A 3L05A 3V8RA 5FR1A 1YTFD 2HQ1A 4YP9A 5BNIA 5ALQA 3ZOPA 1F5SA 3JWEA 3TAUA 5KQMA 3FPLA 4JSYA 1G2IA 2IPOA 5IANA 1H85A 3NHRA 3LY7A 1VB3A 1E8NA 1RPZA 1HQKA 4EITA 4YV2A 4KQMA 3FB6C 3KWFA 4CE6A 2XA1A 1KECA 1OLXA 2REQA 3ZWQA 2MYUA 1QGDA 2Z98A 3DCIA 4MW8A 1WXFA 4K03A 1E1LA 2FEAA 3K92A 4I5GA 3BCUA 1L3CA 4WOPA 3A7EA 2QRPA 4QARA 2VS0A 1TJ5A 4KO8A 4E14A 1DB3A 4LOAA 2WUFA 4OQ4A 1OY1A 1Q7EA 3UJDA 1N78A 4BT5A 1XCMA 3AI3A 3CXCU 4A7PA 3A06A 4F1JA 1M1NA 2FWBA 4TV8A 3SBEA 3KO8A 2P0YA 4ND1A 5M29A 4JHLA 3OD4A 4JS0A 4F84A 3ENNA 2ZVDA 2FB5A 5JCJD 1MEOA 3HKBA 3WWCA 5FJ4C 3DLBA 3OE7G 3A1NA 4O4IA 5LB2A 1GFIA 1W36D 1DWUA 2RH5A 3KXDA 3OEEG 2VP2A 2YDXA 3OLZA 1CZHA 4QDOA 5HY1A 3LSYA 1FFBA 1FVXA 3PCXA 5BR7A 4OAOA 1S2MA 3NKLA 3FKJA 1NFFA 2VJPA 2D1RA 4KMSA 2AYXA 1KDYA 3RS2A 4JI8O 1I4DD 1SUDA 2W43A 1UPXA 2M98A 3WDLA 1NUQA 4AWAA 3IR6A 2CDAA 1XHOA 2D0PB 5E4JA 2F3UA 2Y4TA 2FSGA 1JAHA 2P6PA 3N8HA 4QDTA 2YYZA 2JLSA 4EWLA 1H47A 5J1SB 2Y69B 2D1FA 1AU9A 1ENZA 5DT9A 2J9YB 4MVCA 2V7QD 3NRBA 4RZXA 4DBVO 3E3MA 2XB9A 3LX6A 2IEAA 2XTZA 5JPIA 1UJMA 5C8VA 1E6LA 5BMOA 3ZD9A 4GOXA 4OHFA 4ZTUB 1CYDA 4JASA 2I55A 2NU9A 1SOVA 3TZBA 3E1GA 1T9DA 3TJZA 4E31A 3ROGA 2AL7A 2FUEA 4MP8A 4JI0B 1WTAA 3V7WA 1X15A 4WZZA 2LRHA 3BULA 1E3EA 3VXKA 4JUIA 3AR2A 3CWZA 3O38A 3C7TA 1ULZA 2Z3VA 3I6IA 1TCVA 2FRXA 4GKBA 4CLOB 1F8YA 2I4MA 3CA8A 1QUFA 3AVOA 2NXJA 2G67A 1RWXA 4IHKA 4HB0A 5I48A 2CNBA 2NADA 1T15A 1U96A 2P30A 1YZTA 3PUWA 3JQ8A 1FVHA 2HN9A 1LDGA 3FLBA 1SXHA 5BSUA 1UR5A 1B93A 3REGA 1U0GA 1XMQO 5F2VO 2Y4OA 5E7IA 5CVCA 2FPRA 1YB6A 1GAWA 1ZS9A 1TUBB 1CT9A 4WECA 4PZZA 4IVNA 5CBGA 2V6IA 3CCLV 3UW3A 3IEVA 1R0KA 4DV0O 3R40A 4TT3D 4TSKA 1A8QA 2R2GA 3CT4A 3G80A 2JLZA 1RWWA 2M6SA 3ZCQA 5T57A 3HXTA 4M8NE 1H3FA 4LYHA 2HMSA 3K1JA 5C7IO 5FNVF 1G60A 5BSGA 4MKGA 1U28A 3I61A 2FPKA 1E2LA 1RPOA 3V1LA 2AMYA 3H1EA 3WAGA 1ZZEA 4JV5O 3UYLA 3VU1A 4D5EA 4B40A 2XW6A 5MN4A 4C1BA 3IDZA 3NTRA 2DX7A 3UK1A 1DE0A 4XQ0A 1RZ3A 3U40A 1UM9A 3VR0A 1MB2A 2X2FA 1BGYH 4HYQA 3DCYA 3KUUA 2AKAB 2E18A 3H5TA 4ETWA 3ENZA 3PT5A 4O4HF 1CS0A 1M7HA 5AJZA 3ZRXA 4X90A 4EYSA 2KE5A 1T2UA 3F9IA 2A5YB 1Q44A 2EDCA 1CEXA 5E0KB 2B30A 1LF5A 1Y9DA 5GQSA 1GN2A 1SVKA 3WTBA 3L7QA 3QPAA 3G6EV 4BMZA 4IT5A 2KSQA 4LC1A 3FF1A 3U1VA 1MJGM 3V1TC 5ABPA 3HPRA 3CT6A 2ZRJA 4MA5A 3O95A 5LZ5A 4Z2YA 4PE5B 4RIHA 5CW2A 3WL7A 5TPZD 4K2HA 3L7MA 2M6YA 2F1JA 1J33A 4EQ6A 3ERCA 4K9QA 4IH9A 5H16A 1NMQA 3K5LA 3LFTA 2I6FA 4KLZA 2JIMA 2H5JA 3KPUA 3FCYA 2PVPA 1DO8A 3Q41A 4C0LA 5KWIA 2AZ0A 2I6UA 3I4FA 1V54B 1M2KA 4HQKA 2EJVA 4CTNA 4WY2A 2G4CA 3HLKA 3VO2A 2FUCA 3D0QA 3PEYA 3B5IA 4TRNA 1NQAO 3D43A 4FX5A 1Z63A 2PUFA 1DAEA 4QBTA 2YR0A 3QFSA 1KMHA 3D6JA 4U3JA 1LR1A 1VARA 5KQGA 2A59A 1M1KH 1NNUA 2F8SA 3JYQA 5FOSA 1CXZB 4HNHA 3VNSA 3ZDEA 1QYDA 1JA8A 3ADKA 2Z3WA 2Y8EA 1BE0A 4X1IB 2EYQA 4GKKB 5DIZA 1IVNA 1Q6ZA 5THKA 4MRAA 1WEHA 5CVDA 3O1LA 1Y1LA 4E7OA 1TM1E 1FDSA 5LL6Y 3E83A 1N6NA 2YWHA 5TEVA 3WA6A 4BLPA 2XMZA 1J22A 4TQDA 3UPTA 3KPVA 2BSKA 5DBOA 4BCBA 4AT1A 1GPAA 1L4UA 3PX7A 4JJGA 1R27A 2PMBA 2QS9A 1UBGA 4RTJA 3KB2A 2W48A 1PDOA 3QNUA 4DUZO 2F17A 4JENA 1JKJB 3SZOA 3O74A 3PYMA 3CLKA 2NUTA 1ETUA 4PO3X 3I3OA 4FOLA 5LZ7A 1YZNA 4GZMA 2R7KA 2BKEA 4HH3C 3N59A 4CQJA 2OCHA 3MSCA 5K0FA 4Q05A 2WAOA 3C7AA 4G28B 4YRRA 2CLEB 2EBWA 2CV1A 2ACKA 1RT9A 4JA0A 4RK6A 3G2PA 2OBMA 2HLDD 4MINA 3QVMA 3WE7A 3P2EA 3PHIA 5L6LB 4BQOA 1N3YA 4R7TA 3KZKA 4FP9A 4NZOA 2P22C 4BVKA 1TDJA 3KTOA 5IHXA 5EMLA 5LB4A 5AM5A 8ADHA 2ZTUA 1YOVA 3MW8A 3CPQA 2OO3A 2PVSA 3PSHA 3ZLVA 2JJ8A 2CJYA 2R48A 4UU0A 5T8KA 3RC1A 2ZBDA 2REQB 1B76A 3CPHA 2V9YA 3NBUA 4N82A 3H4MA 4UEQA 3BIOA 2FPGA 3ZE6A 5H02A 1UWKA 2W2OA 2Y0DA 1KGDA 1G1XB 5KA5A 4ZOLA 5BWLA 2ZW9A 4QNNA 3RW9A 3G2LA 1FF9A 1KI2A 3CCUV 2VA9A 3MAQA 1ISPA 1SVLA 4A10A 2EZ9A 5K3BA 4U2FA 4EB0A 3JQRA 1M57C 3FA2A 4WUVA 1X1AA 3H01A 2DBZA 3S2YA 5P21A 3F8TA 2Q8PA 1ID8A 1M1NB 5FI1B 4TV8B 4LE2A 3FZNA 3NNNA 1N2CE 5F5LA 2J1LA 3Q8MA 2JARA 1SCUA 1MAAA 2ZAUA 4GBMA 1JMVA 1H7MA 4FDVA 4C8EA 1QTRA 3HKBB 4I3FA 4DCOA 2AZMA 4QJIA 1P62B 1XXLA 4O4IB 2A33A 4KGDA 3W5VA 1O6GA 3RSSA 1YQUA 3BWVA 4NFYA 2PRIA 5AVQA 3P0ZA 4IWNA 2JGEA 1ZMRA 1AV7A 3E3AA 1WXEA 4WY5A 3RV3A 3B3QA 3L41A 3PPXA 1RBQA 5BWMA 3LWPC 4X8AA 4DIFA 4H13B 1Z35A 1BAPA 5T7BA 3WIDA 1RACA 1LLQA 2XMQA 4ZA2A 3Q0EA 4IDHA 3SKVA 1QZTA 1ODTC 1THMA 4Y6QA 3ZOZA 2O8BA 4TZTA 3NTXA 2RONA 1PQWA 4GIBA 3TQHA 5GV7A 3M5WA 2HCRA 4EDHA 2BD0A 4E4YA 4ZGWA 1Y6FA 1CUVA 1I3MA 2BMEA 4CM6A 4J9UE 1XTSA 4QSHA 2YOHA 2PRSA 4EJSC 4ARBA 3EIOA 3CX6A 4GXRA 1XELA 2QJTA 1EJ6A 5DHSA 5TB5A 2NU9B 4QM6A 3LQKA 2MYNA 2FPMA 2QVXX 4ABYA 1NFQA 2DPHA 2KG7A 5CB8A 4ZTBA 3DEJA 4C6SA 3F2VA 3MJDA 2AMJA 2VNIA 3D8TA 1VI2A 1QVVA 4MMYB 5AQ1A 5I7UA 3NOQA 2YWFA 3B8EA 4L6CA 5F1YA 3HBMA 3KPWA 5H9VA 1IEVA 4KR0A 4FSDA 1JFRA 1QE5A 1ONSA 3S7ZA 1DWOA 1I94B 4E5SA 1Q17A 3JQ8B 4EHLA 1B7GO 3TX6A 3UMCA 1DLJA 4RXTA 5IBQA 3AHCA 1R8YA 1R16A 3F71A 3UC9A 1QVGF 2GWHA 2PA0A 4NAVA 3G8AA 5L95A 1UMBA 4BVFA 3GGGA 1FSZA 4XYLA 3PLNA 2G1PA 3GNQA 4L16A 3N3AC 5B7GA 1PK9A 5ALPA 2X19A 4ZVOA 4P3OA 4ID3A 4K28A 3CMAF 4EHKA 1MC1A 4PG7A 2M32A 1PHPA 2QI9F 2IKQA 5C7YA 5IWAB 1VL5A 1O6CA 2Y2VA 1BYUA 1P5JA 4EMBA 2F23A 1FMCA 2C61A 4KXRA 4GKAA 1PSZA 3W8FA 4G26A 3PDIB 4MLPA 1BMFG 1W3EX 3RDPA 4UUAA 4PSDA 3C5HA 1D0VA 4AN4A 2FVXA 1UM9B 3O94A 1CS0B 4H6PA 5KYWB 4LJ5A 3TETA 2QVBA 3FCOA 1WJGA 4L1KA 1H1TA 5CM2Z 1WUJS 2AS0A 4LXQA 1E63A 3AB3A 1RQPA 4RDXA 1VSVA 2BFPA 2AI2A 2O23A 3EVBA 1JDBC 2MSKA 4V02A 3C1AA 2OYQA 4ND8A 3GVCA 2AZTA 1RHUA 2XHBA 4EQ6B 5C35A 4WLNA 5EPOA 1V96A 3CZRA 2F1IA 1GCOA 5LKRA 2QG6A 2WJ3A 4MI1A 3U13A 5E3HA 2I7VA 4KH1A 4RMNA 4MTLA 3FD6A 3F9RA 2RHCA 4PDRA 4EG3A 2SECE 4NE2A 4AZTA 1NU1H 3UT6A 2LCQA 3KZMA 3RRXA 1TQDA 1H9BA 2VZ9A 5B55A 2W0FC 1M2GA 1KMHB 4R3NA 4U3JB 5JRDS 4CL8A 4I3GA 4UE3S 1OFUX 1CR6A 3IVRA 1CUZA 3T4PA 1A8PA 1YB2A 3DB2A 2VC2B 1BOFA 3OETA 1MV5A 3MJCA 4M0UA 2GZDA 4OQYA 4C4YA 5HEKA 1P3JA 2Z83A 4JWTA 2C4UA 2WWHA 4LXYA 3HYRA 2CSUA 5TDHA 1QR2A 3FY4A 2XQJA 2BSKB 3ONFA 1E2HA 2N46A 2XH8A 2AC7A 4HVAA 3OUTA 3SX4A 1QO9A 1YU9A 2EKQA 1WXQA 2PBZA 4Y9UA 3JD0A 5H68A 4UZFA 2H85A 3RABA 4J3NA 2CL7X 1O1YA 2WINI 3ZNNA 3K72B 1KC8W 1S5HC 1KP2A 1U8XX 2NUTB 3NWJA 3ZBPA 3DE1X 4TVKA 4WPGA 3DUFA 4HY3A 1AN0A 1JDVA 3K9CA 3EDCA 1T5IA 2W7TA 3LY8A 5B6IA 3C85A 4M46A 2XYGA 3NASA 5I9TA 4UEJA 5TF0A 3GWZA 1DIOB 4PFQA 4CCAA 3KJIA 4U7NA 1JUDA 2OZEA 2GH1A 4UNIA 4WACA 1Z16A 2PYIA 3HADA 1Y6RA 4Z51A 5EVJA 2FK8A 4K9SA 4X64O 2IBMA 1E79D 4YJKA 3KB1A 4FHFA 1P8AA 1YOVB 2F93B 2OCPA 1GPYA 4FD2A 4IIBA 1M2NA 2IE8A 3FH0A 1UEJA 2OMEA 3ICWA 1U3DA 2W58A 2WF8A 2GYWA 2VWGA 2CXUA 2HJ9A 1M90W 3G7SA 2C3UA 4JMLA 3NU1A 4V0OA 3IJ5A 4YRMA 1SAYA 2FPGB 3TQTA 1TGYA 2PYLA 4P7JA 1FUEA 2BGGA 3T9FA 2CF5A 4S1TA 1ZD2P 1VTKA 1R4NA 2ERXA 2AGAA 4MS4A 2QA5A 4OGKA 5B58T 1V8OA 4GNRA 3LQQA 1IQ0A 4M2LA 4UBNA 1IMJA 2BDTA 2ECPA 2JGUA 4PPGA 4CMEC 2Y67A 4PPFA 4JSRA 1SCUB 1IQPA 5SYNA 2E5LB 3BREA 1YRQA 3FKQA 3ASOC 1OXTA 2CVHA 1NA5A 5KMGA 5C93A 4DJTA 1R0LA 4FYMA 1XZDA 4M37A 1JWBB 2HHHB 3AY6A 3BE8A 4KBGA 1OE0A 3R6LA 1SUCA 4IF6A 4RGQA 1HG1A 2EF1A 2CLSA 2FZ4A 2HEIA 5IS2A 2IUTA 1FLDA 2ZSFA 2A1IA 4LRUA 3JZAA 3BH7A 3ACDA 4NV3A 4MW2A 3N05A 3DDWA 4Q3KA 1GZSA 3K8YA 2N48A 4Q1AA 1IQRA 3AF0A 2XWJI 2CZWA 4LQ4A 1Z5NA 2R9VA 3HB5X 3HA3A 4RCYA 4UREA 5TE9A 1WQ3A 2JFFA 4HI0E 4NV1A 3W8EA 4OXYA 4DLXA 3HE3A 1CWUA 1OWOA 4ZKEA 3X2SA 2B4TO 4LXTA 1UFYA 2YQZA 5CG2A 1M7GA 3UZUA 4IDBA 3WHKA 2RI0A 5K45A 3L8DA 2H54A 2Z4RA 5K09A 3MJFA 2AKEA 4KYUA 1SQVH 4U6QA 3ED1A 2JH8A 2KLBA 2PS0A 1T2AA 4JVLA 4HLNA 4DILA 1XFAA 2H8PC 4J1SA 2HVJC 3H8VA 3HCEA 3MD9A 3SSMA 1CK2A 2JVDA 3L72H 1XRMA 5NULA 2VPPA 3EFFK 3JQBA 3C8MA 5CT5A 3EUAA 3AJEA 1LZLA 5CFNA 5JWPA 3OR6C 4M88A 3WMXA 3KQTA 3AT1A 2BZGA 2ZSIA 4DNQA 2E49A 5BNZA 1NZFA 2MSWA 4QOGA 4LEIA 3D2LA 4RQBA 2D2CB 4I7EA 5G1OA 4F3CA 2HD4A 2DF8A 4MROA 4R69A 3N58A 4C5AA 3ZWVA 1YV9A 4NC9A 2P5TB 1N6LA 5EAZA 5G41A 2Y1DA 4QGFA 2WKQA 1BYIA 3C8HA 4MV8A 3KZOA 4NMLA 2BCJQ 3QLUC 1B1CA 4MCAA 1UMBB 4FYKA 2FK7A 4OSEA 2JJ2G 5JDIC 4P7BA 1ZIDA 4MUEA 4XWTA 3KOUA 4B73A 1AMUA 4CVNA 4QBFA 4HRXA 5AMXA 4ND7A 4TTIA 4DNFA 4D9KA 1V8ZA 4XCQA 1JAZA 1XN1A 3FFBA 3LYLA 4Q6WA 5G4KA 4IG9A 3CCEV 4LWQA 1X7PA 4KYIB 2AX4A 1X19A 1I36A 4Y9SA 2H7XA 2C9YA 2P4EA 1XP5A 1O9GA 4HVTA 1B3BA 1F48A 5MDHA 2QJFA 4YXWD 3V00A 4UATA 4KQWA 4N3CA 2E76B 1SUSA 1GLVA 3G8DA 3D3IA 5BMVA 2JIPA 3ZS9A 4K2AA 5BXQC 2ZANA 2G9UA 1EXNA 1IUNA 1ZJJA 4Q7LA 2UAGA 4QOHA 4EG0A 1U7PA 2B8JA 2J08A 4M9UA 3L04A 3DXFA 2O07A 1DBRA 1QVWA 3CBQA 1I7PA 4RHEA 2IYNA 3GARA 1PCXA 5A5VA 1HYHA 4KP7A 1NE7A 2RG1A 1JH8A 3AG2C 5LGNA 1PG2A 5DNAA 1Y9JA 3VTFA 2AIZP 1IV4A 5KTPA 3CEMA 2NU7B 4OHPA 5TR9A 1RM0A 5FPTA 4ND8B 3BTOA 1EVZA 4IDCA 2B7BA 1KJ8A 2A4MA 2ZZNA 3O3CA 3WOVA 1C5KA 4MV4A 2OQRA 3DG9A 3L02A 3W5DA 3BXPA 2EJRA 1YZVA 2GHIA 1BCRA 4YHHB 3EZGA 1VDMA 1JFFA 2O3SA 2FPOA 1FU4A 4DV2B 1T8WA 4YUZA 4EY8A 3I34X 4TTVA 3NDPA 3R6WA 5TJ9A 2HDWA 4BUJA 4YRBA 3QVNA 1UBSB 4UCFA 4UCXA 3D3WA 1R5OA 4GT1A 4GWKA 1JFLA 1VQOV 2PUWA 4PO8A 3NM5A 1FRVA 1YCFA 2ZVJA 2REXB 4GYKA 4JIGA 3O85A 1TZ2A 3ZWXA 4EB3A 4JLWA 1EX7A 3WNBA 3NT5A 4CXMA 4YCCA 2BEVA 2BM9A 5EIAA 1ZD8A 3EXG1 3IPAA 4D9HA 3BGVA 2DH5A 2G7MC 3HCCA 1KP9A 5I9MA 2EJTA 1Y6GA 1XRPA 4OXRA 5DM0A 3RR2A 1M6YA 2AFRA 2I33A 2YRXA 2QTSA 1BO6A 1TD1A 4BLVA 3CR7A 2BGKA 4XSVA 3TJMA 1N92A 3V8BA 3D6AA 1Q15A 4B85A 4MYDA 4QECA 5EFOA 3LLUA 1CZNA 3Q3VA 1QX4A 2JIBA 4OP3A 3B12A 3GC6A 2IZ0A 2V7EA 4ALMA 2GM4A 2FFHA 3VPSA 4J0CA 5F76A 1DC6A 3G9ZA 1D1TA 3DUFB 1KOJA 1E5VA 3LPAA 2DU8A 1S96A 1AMOA 1Y4DE 1KU9A 5COAA 1CETA 3KTAA 5J4VA 2QMEA 5B6JA 2I99A 5DP2A 1LDMA 4Z7JA 4I6GA 4QYTA 3KLNA 1CDDA 4UMDA 1VC2A 3EB9A 2AXEA 4NESA 2FAXA 3QIAA 1S5PA 2X8BA 3TD3A 5D86A 5FBRB 5IYCO 1Z47A 4FK5C 1RYBA 3EVCA 4S1VA 4UU1A 3FYUA 4HKTA 2EZ4A 4QRIA 3LCRA 5BQPA 1TM5E 5TT0A 3NM6B 1ZOOA 4J49A 4MR8A 1J0BA 1UBMS 3SGLA 1V8FA 3Q3CA 3Q9SA 4PSKA 2IG8A 2WYIA 3PC2A 4QD3A 3QBTA 4ZCSA 3MERA 3CMMA 3DE2X 1XXHA 1YJNF 4JAAA 3WYNA 3RVNA 2Q1UA 1NW5A 3DYBA 2O6LA 3J81N 4W1SA 1R4NB 1WN7A 2UU9O 4MS4B 1TTQB 4DUYB 5DB4A 3UK6A 1WTCA 2P4KA 5C37A 1KRHA 1H9CA 2YUTA 4LRWA 4RIGA 4PDLA 4XB1A 2PTGA 3I6YA 1F2DA 3PNYA 2ZK7A 5KMGB 1AJNA 4OLHA 3EFOA 3P97A 4RD6A 4P54A 2VT7A 2J45A 2DQKA 2FMTA 4YMHA 2OOKA 5ALGA 4XGNA 2WSSD 4PQFA 3GEEA 1MW8X 1Z62A 2PJRA 1GNLA 3K0FA 5BZBA 2X1MA 4A82A 4U63A 2O1XA 5BQFA 1H0KA 4P4LA 5JD3A 1RQRA 1KDRA 1WD5A 3IT0A 5DW3A 5LQSA 3JQ9A 3K16A 2C42A 1OYYA 1C8VB 5E4YA 2RB5A 4RMHA 3QMVA 4DCNA 2KSDA 1NQTA 3JQ7A 1XL1A 1AA9A 3D4OA 4RH0A 4MKFA 2JFYA 4CM9D 4TWJA 1XJWA 2X0NA 3VHLB 2MSLA 2PBFA 2XAJA 1GAXA 3FFXA 5DI9A 3AQIA 3I39X 5J23A 4AXXA 5ELLA 2HIMA 4GSYA 1IZZA 5TS3A 4CNBA 3H8SA 2E75B 4JJ4A 2RAFA 4YT2A 5JZ9A 1NC3A 5CTAA 3UGQA 4TX1A 1U65A 4L0DA 1A9PA 3RKUA 4FR0A 5DM2A 3JX9A 1NRXA 2OIGA 2Y0PA 1Y7LA 3FRJA 1NN0A 1PVVA 4E22A 3AM5A 2JFZA 2ZI4A 1ENYA 5JYDA 3Q8WA 1Q7YW 3MB5A 2JCSA 4DLTA 3IUQA 1VPDA 1Q0UA 4FS3A 5DCYA 1ZU4A 4ARVA 1ZUD1 4G5OA 4NICA 1MB3A 2Q49A 1N0WA 5A4JA 1EMDA 1SN7A 2NV6A 1Y4ZA 2XAGA 3HDYA 1BG6A 4JI6B 2C0CA 1D4ZA 4TLBA 4ZFNA 2YUAA 2NZJA 3LXRA 1D2GA 3T34A 3LHKA 2C9DA 1TZBA 3E9NA 1A3CA 1YO6A 3CCBA 3RCBA 3HYTA 1YC5A 1GEEA 2GYUA 4BX0A 2A9QA 5SY9A 1ICIA 2Z4SA 2CFOA 2B2XA 3WLIA 4GNKA 2QQEA 3ZI7A 2RGGA 1CVRA 3DLIA 5FHQA 1HDOA 3WG7C 1VCIA 1B0AA 5G4KB 5EKTA 2PG3A 3QUWA 1EFDN 2ZWOA 1ENPA 4DLYA 2J41A 3QVTA 4UTVA 2NZ8A 2QDXA 3OPNA 4R8VA 1FNJA 2P7TC 2QWNB 1TZCA 4B35A 3GCXA 1NUUA 3K9SA 5KX5A 1A2QA 4BW9A 3PFCA 4CLEA 3FPIA 1O95C 1TAUA 1FYXA 4K6FA 5BMVB 5AOCA 1DC7A 4X3OA 5G40A 1I4TD 3DMFA 1DCTA 4BQEA 3SQWA 3JVEA 3RI3A 3CUEF 4LZOA 4LE1A 2ATKC 3U4HA 4ZOEA 3PS9A 2IYSA 1Z37A 1Q7TA 3CPJB 3L77A 3PICA 4FVMA 4DIBA 1QRRA 3BDVA 3K5PA 2GN9A 3EC1A 1FA9A 4KBYA 3GJXC 4BO0A 1I7NA 4PLZA 4J7JA 2WPDD 1E9AA 1CR2A 4DR4O 4EUSA 1UBJS 2LGJA 4INPA 3N0RA 3CCVV 3NGLA 2QJRA 1EGHA 4ZAVA 1SDSA 3D5TA 4M76B 4B43A 1XREA 3OP1A 1Y8RA 1N0JA 3HXQA 2Q3FA 3Q3EA 5KTOA 1JHPA 4S1WA 3KZIZ 1BCRB 1XEXA 2ITDC 4K0KB 1D04A 3OEHG 1JFFB 2C5SA 1QH1A 5DGHA 4KUHA 3ZCTA 2EX1A 1Z26A 5EZSA 5I8PA 2GM3A 2WC1A 3CLRD 4WWHA 3M70A 4HDQB 3D3WB 4C3OB 2EVWX 3ZNPA 4TLDA 1XK7A 4YMWA 2HVYD 5JCXA 2PUDA 2CV0A 3THWA 4J29A 4NYJR 4PC1A 1EHIA 4DZZA 5LQMA 5LQUA 2NLJC 1BHSA 4LNUB 1QGUA 2BEVB 3A0HZ 4RLQA 1JQLB 3NBFA 3IP6A 1NASA 3QHPA 1NW7A 2O2IA 5LMUB 2OBXA 4QQRA 1E1NA 1R0CA 1AS2A 4A1OA 2UUBO 3DW3X 1U02A 4C0WA 3UUGA 4BLRA 4P3KA 1Z0ZA 4PNZA 1ZCBA 1G5IA 4UFOA 3F74A 4AK9A 3WJPA 2PX0A 4YP0A 4MV0A 2HVKC 1SRRA 4GLJA 3IPCA 1MAUA 3AIIA 2IK8A 4L8VA 3QMWA 3VR5A 5D84A 2GFHA 2QMYA 2YJTD 4TWIA 5FV4A 1FMTA 2X77A 4NXNB 4RORA 3L40A 2DFNA 2C8VA 3DC5A 1GP2A 1Q16A 1IBCA 4ENSA 3P8ZA 1U7TA 3KTAB 2VPQA 5B4VA 5BR1A 1Y34E 2VPWA 1F4PA 2C2OA 2W6JA 4MB6A 3RRMA 5K0TA 3WGIA 4B3MO 3V7UA 3HFRA 1E59A 4S05A 1LX6A 3TD2A 5IZ4A 1MAHA 1FNCA 5JY1A 1S4QA 1LLUA 4IDQA 5DJ5A 1AIPA 2XGJA 3M9LA 3NH9A 2WM3A 1G6KA 1GFZA 1PF5A 4TS1A 3FYUB 4XUCA 5GTHZ 4RK5A 3RQSA 4QEZA 4BHTA 3DM5A 4LGMA 4PG6A 4MR8B 1CDOA 3D7RA 1WQ1R 3H2IA 3NDIA 3WIBA 1UZNA 2QR3A 4BN0A 4GMFA 3H9VA 3K58A 4ATNA 2QMHA 4A5OA 4D0NA 2JIRA 4Y1RB 2O5EA 5C53B 4JX8A 1IDSA 2I29A 3AVUA 2WB4A 2BMVA 4UARA 1XF9A 3G67A 4DLAA 2BKAA 4ECAA 3GN1A 1VKHA 2IYWA 1WCWA 3HPQA 4E0BA 1JA9A 2PWAA 5REQB 3WWDA 3TOCA 5JXIA 3MHPA 4RMGA 1Y5NA 1ZVVA 1HZZC 5KNCH 3JQEA 1NJ5A 5EQFA 5AVXA 3OFNG 2X6AA 3NX4A 3K2QA 3L8GA 4QAQA 2WHRA 4WK6A 2C3PA 1NM5A 5ECWA 3EFOB 4L72A 3DLCA 4C9BA 2DECA 3H87A 1X2BA 1T0UA 5SV2A 3S2ZA 1SF9A 4KPUA 4ARSA 5ECDA 2FJUA 3UIEA 3K0FB 3T7RA 4YRTA 4WCDA 3BK7A 1AF7A 2C0QA 5KSWB 2GM9A 2OKCA 3G8CA 5DYGA 1KRWA 4BMDA 3PHLA 4JLUA 1Z82A 5C7LO 3FWPA 2HK6A 3KU4A 5IVHA 3OPXA 4YJGB 1R1DA 3DDCA 1GPMA 2ZIEA 3KSRA 4EUFA 5FBWB 4FGZA 4HDCA 5AO9A 2G17A 5KJ6A 2XYRA 5J58A 3JQ7B 2CGEA 3A6EA 3ZJYA 4AP6A 3EPHA 4NJMA 4RGBA 4G1EB 2OORA 2JK0A 2VDVE 2PYZA 5G0SA 1T8PA 2Z1NA 1PR0A 1RLGA 3GRVA 1QP0A 2PLAA 4QG3A 1U8AA 1NUAA 1SVMA 2BGJA 1KJZA 4BB9A 1PEAA 3UF0A 1X1QA 1PPJH 3C1UA 2PR2A 2A9VA 1K8AH 3QW2A 4YP5A 4RWZA 1YULA 3THOA 2R86A 4LK3A 3PR1A 1RABA 2WD8A 3WVNA 3IR5A 3H2KA 1ZCZA 4G0XA 3PBKA 1V5EA 1IZ7A 4LQCA 3R3YA 1VIMA 3DOHA 2V3CC 1NNEA 4HX2A 5K0ZA 1QDUA 4DMMA 4OK5A 1HL3A 3WLQA 1WL8A 1UZMA 4NZZA 1DJPA 2AFVA 2X5NA 1SRYA 5EHNA 1AKMA 4AY4A 2HMVA 1YITF 3E9MA 3MCUA 2E3CA 5LBUA 2C8LA 1V8BA 1DEOA 3LUCA 5AW3A 5JZSA 3H2ZA 3SYLA 3COSA 1SXGA 3TTSA 2FMXA 2QR2A 3W7XA 2EBOA 4G85A 3B48A 3D2BA 4KV9A 4J0DA 3SC3A 4OQLA 4X61A 1SKBA 2K7FA 2HK9A 3IR7A 5DYIA 4Y6PA 5GJVC 4OH1A 5C31A 2QR5A 3X44A 5HY2A 3IEUA 3FBGA 2QL7A 3G71F 4B6QA 4FQ8A 3Q40A 2B36A 4M9CA 2QVLA 4RK7A 2QN9A 3ZHCA 4KDEA 4RF5A 4IBOA 3QM1A 1UOQA 3OPQA 5EL0A 2CLOB 5A9TA 3K15A 1UKCA 1RXWA 2DM6A 4XYMA 4ZREA 1XQVA 1ZICA 1XR3A 2W6PA 5JXJA 2NU6A 1HK7A 1E5DA 3CMEF 1CQJA 2HNAA 4J41A 2B61A 4ZRDA 2HEPA 2Q3LA 2FC3A 3HY6A 3D4IA 2OR3A 3BICA 3K0BA 4BTLA 1IBLO 2ZCEA 4OIFA 1EZJA 1N5LA 2YC0A 1ZKDA 3N76A 4PQRA 4L8JA 2WALA 3AV0B 4YJ2A 4DLUA 3IEWA 4CYMA 1UT8A 3U4IA 3NUQA 3UANA 3WLJA 1Z13A 3W2FA 4EFNA 3IGFA 1TXGA 4IV8A 4J91A 4EVIA 5B1BB 2V6BA 3N2EA 4LFCB 2VYVA 3B2EE 3AEUA 4ND4A 3EMKA 4FLZA 3WMWA 5H6RA 2DHCA 5F12A 1EVIA 1YB7A 1NRIA 1FUKA 1H2XA 1PL0A 5DK6A 2AIFA 3PQ7A 2JI6A 1Y8RB 4ZQHA 2FFJA 1QORA 3T2MA 4D2IA 4WCVA 1XEXB 2P06A 3O84A 2P3OA 4D9BA 2LGQA 1IVYA 1QH1B 2FPIA 4IEEA 3ORFA 5K3CA 1P74A 1J39A 2P0AA 3BX1A 5C3UA 3DE0X 2ZCUA 4X89A 3CQ9A 2JJ1G 2P75A 4YCMA 4I50A 5KREA 4JEIA 4C5CA 2B2NA 2I7TA 2PWBA 4GAEA 4MDEA 1XQ1A 1Z8FA 3THWB 1C9JA 3ZD6A 3ZX5A 3GJ6A 3JCMM 4UOZA 1QGUB 4FMDB 3DZIA 4H27A 1ZM3A 3H17A 3N2IA 3STHA 5JMTA 3PHGA 3IJPA 5IZCA 4CGYA 3H9UA 2VTBB 4WVLA 1XEWX 1HYBA 2H2WA 2JEXA 3AUXA 2FQ1A 1ISIA 1GL3A 3ASYA 4JOBA 3K5WA 3WWEA 4R0VA 1QOQB 4CEJA 3QOXA 1JFSA 2HZ7A 2D2XA 1B42A 2P6YA 4ALKA 1BEUB 3ADOA 4CKZA 1LRLA 2LFRA 5C1DA 4M8KA 2UZ1A 3AY7A 2A9RA 2PO5A 2FZVA 1CQPA 5L3FA 4DNXA 4WZBA 2EG9A 3K0AA 2BFNA 1QIKA 4E3ZA 2WSLA 1R3KC 3X1ZA 4HLQB 4TMTA 4CIVA 3GJ5A 2ZUVA 4LPSA 2R8PA 1GQFA 1MNAA 3HGMA 1LUWA 2EQBA 3VPAA 5LWHA 1ZC4A 4TS4A 4EATA 3L4BA 1XIVA 2H1VA 1RWOA 1HSZA 2V3WA 3VU3A 1RVV1 2CLKB 4ZCPA 5HR5A 5CK4A 2ISQA 3PC7A 2BIFA 1YS9A 5J47A 2QNBA 4DJAA 1NXOA 4ZV4A 2XDWA 2J4CA 3GPBA 1WDWB 3E48A 2QMOA 4B3SO 2CXQA 1MVNA 4Y9TA 1Y5MA 4RA6A 5DDIP 2D8AA 4YJ3F 1PEKE 1VLJA 3ELBA 3HA2A 4B83A 4XAQA 3CB2A 2NX2A 4ASUD 1ECFA 2C57A 2FUG6 5K8LA 5B3SC 3PKZA 2B99A 1GG2A 4XKJA 3BVPA 2BDUA 3URKA 5HRUA 4OFZA 1TLLA 3HVJA 2L82A 5H83A 1FNSA 4XGKA 2QZPA 1E5QA 4MWSA 5JSZB 2WM8A 4LYJA 4BEBA 2AGVA 4H7FA 3VVBA 3IUNA 4MIYA 4RSMA 1UC8A 1DU4A 4G5HA 4TWZA 1MZEA 2GTHA 1P4HA 5IT9A 2ZIXA 2VGNA 3ZC3A 4PGAA 3OTIA 1XVAA 1P49A 2SBTA 4JYCA 1L7RA 3FLAA 1R8XA 4XQ9A 3G0IA 5D5HA 4B87A 4EECA 3S44A 3RC8A 2GVZC 3ISVA 2RH4A 3BVOA 1N7GA 2OO5A 3NWBA 2NTEA 2H9AA 4KPUB 3LGSA 3JVVA 2IGTA 5CGZA 4KQFA 1YR8A 3QEMB 1NBMG 3IQFA 4LVUA 1KNKA 2R84A 4I4IA 4KXXA 3G1TA 1V47A 2MYTA 1RMTA 3OECA 3ZX6A 1LDEA 5LYJB 4QDZA 5EE9A 3NTOA 4H1WA 2EZUA 4XDHA 3NHYA 3TUJC 5JC8A 3U5TA 2RGCA 3ZV6A 3TGLA 4X7RA 3FZGA 3W6ZA 4OHVA 2C2KA 4QQNA 2JIQA 3T0GA 4BIUA 2ZXEA 1WXIA 2BN4A 5G0TA 1BQEA 1EP9A 1Z7YA 3K5NA 2JJYA 5DASA 4NJMB 1ZXLA 4C6HA 2VKTA 4YMIA 2I6QA 3BIXA 2BMAA 3MOGA 4MS3A 2WMNB 2RDCA 3KFXA 4MUFA 3OJEA 2M1XA 2W2NA 3INYA 4LHYA 1K8YB 5CCBA 2ZQMA 1U1GA 1IIRA 4CT0A 1KYYA 2OHOA 1YKSA 2RH8A 1HT0A 1Q1BA 4HFMA 1G0NA 3ICPA 4WN9A 1CUEA 3KKKA 1PWXA 4OI1A 4ZI7A 2L18A 1SVIA 3PUZA 4F4LA 5F7JA 3B1ZA 2JHPA 4O08A 2KX7A 3S8EA 3OJ0A 3KKLA 1EFTA 1PNKA 4NEHB 2ZVQX 4G5YA 4YRCA 4OM8A 4HBGA 4NCNA 1JPVA 4K87A 3RUHA 1ZTEA 2FOLA 1OLXB 4MPDA 4RFLA 4B5LA 4LF5O 3OFJA 3GEBA 1DXYA 1ILWA 5L3SA 5BSVA 1P7WA 1QU2A 4RUEA 3DE4X 2AG0A 3WMGA 4EH1A 2BFCA 4NZ9A 4NE9A 2FMHA 3RM3A 3FKSD 2VDQB 2PN1A 3NIDB 2ODNA 1CVIA 4C2BA 3IAM1 4Z9BA 1ZZGA 1QD9A 1T25A 3AP2A 3FCEA 1LZKA 3ESRA 1T3GA 4P4GA 1B14A 1Y3FE 4YLEA 2PZGA 4UW9A 4BLSA 3ICCA 1BE6A 5HUQA 3KUKA 4R9SA 4EGAA 5B2EA 2QORA 3O1JC 2VH1A 2REOA 2ODWA 2D59A 3TZKA 2PY5A 4O1HA 4XJXA 1R2QA 4O2RA 3SMQA 1XUOA 4U0JA 2AHZA 2NU6B 1H9AA 1JX9A 2D62A 5LJLA 1CQJB 1H66A 3LWNA 4ZAGA 3I9V6 2WSYB 1ZVQA 3S2GA 3ZGOA 4EJMA 4OXSA 1NJGA 3P27A 3UAWA 4YJ2B 4DR5B 4QT0A 2QN7A 3I2IA 2C8KA 1KY2A 2Q0HA 1FNDA 5CIQA 3HDGA 2H17A 5BT9A 4LTNA 4B3HA 1UJ6A 4JJEA 1D8TA 4LBYA 4W6QA 3HL4A 1CU1A 1VFPA 3H2JA 2ENWA 2VJKA 3AEUB 4PPNA 4ZVMA 2WIKA 4XIFA 3N2LA 3AG4C 5BV8A 2VP4A 4GD3Q 3W06A 1E4VA 2N1BA 3CSSA 1P7BA 2O8FA 1IN1A 1JBEA 4JASB 5LOVA 2EW1A 2SKEA 2VR1A 5J4LA 1X7XA 2X9GA 3JAMN 2IYEA 2ZQ5A 3OQPA 5F5NA 1WLSA 1W9HA 2FPIB 1MZFA 2A58A 3P9XA 4BT6A 4C3ZA 4LYEA 3A4YA 1GZUA 1CZRA 3GPDG 4KWCA 4A8PA 3P7MA 5SZHB 2F6RA 1GTMA 3BN3A 2OA0A 3G13A 2QR4A 4XW2A 3C5EA 2CKMA 1R4ZA 1UPBA 1AX9A 1PGNA 3MIZA 1S0UA 5DE3A 3CNLA 3ACCA 1XALA 2DFLA 4RZ2A 2I1WA 1VG9B 1QTIA 1RYFA 3KUXA 5IAAA 1ORWA 2HJWA 3G88A 4GKJO 4PA7A 4UM9B 1E1RD 1YZFA 4WDQA 1BS9A 4PEVA 3LU1A 3EDQA 3V4VB 3A3KA 1KIMA 4O2BA 2IWRA 3F3MA 4N12A 2GZSA 4YREA 2W42A 3NRCA 2WKWA 1PBTA 1RPAA 2C20A 2PT6A 4LFBO 1UMDA 2P9QA 4GBJA 2ZIAA 2H3EA 2LGWA 2UZ1B 4UASA 3PK0A 4G23A 4TRRA 3K0AB 3E23A 4CL0A 1RC0A 1DBQA 1BQ4A 1MGOA 4F38A 5LYJF 5CLHA 4XTCS 4QBIA 1XKXA 1W87A 3RTDA 1KBZA 4IHQA 2QIPA 1P9NA 3ML1A 2XAAA 1V9CA 1N25A 3DO6A 2KBEA 3DMHA 3OU7A 1HE8B 1PLLA 2NO7A 1L5MA 4AFNA 3TMKA 3ZVMA 4D8XA 1BMTA 2Z2XA 4EKDA 4BEWA 2JVJA 3L2OB 3QLVA 2P1RA 3GYGA 4EG4A 4FEYA 5AP9A 4GMKA 1JJBA 4RA6B 1XMVA 1ORVA 1OXXK 2XHEA 1G42A 2UYPA 2QBYA 1PJSA 2FE4A 4LJAA 1NW8A 3AKYA 2B1JA 5ELMA 3RU2A 4R2XA 3G0GA 5BN5A 1LRJA 1FYWA 4LI0A 4YUXA 4JR1A 3I37X 1RWKA 3AG3B 3OPYI 2AQHA 2OHJA 1N2HA 1J21A 3TRKA 4DLKA 1A4RA 4EELA 3S40A 1B8VA 5I3ZA 3GFOA 2NZ2A 2HXYA 5BW6B 1YZKA 3ETEA 2ZIXB 1Z2GA 3RTBA 2QTHA 1OC4A 4EJ6A 1P2FA 1KBHA 2BUCA 1TVKA 1A5SB 2NSHA 1GZ0A 3P9SA 4M0FA 3CZAA 5T3UA 3Q0TA 1RPTA 5DNWA 4WUTA 1SGWA 1XP8A 1XNRB 3IIEA 4UPVA 2ADQB 3WBJA 2UYKA 3LPMA 3IDOA 1L5OA 3RYTC 1JW9B 3Q2KA 2HSEA 4BX3A 1DBSA 1L8DA 3GT3A 2V7TA 4M8IA 4N6NA 4I36A 1P0PA 4NFLA 4TV8F 1ATZA 3V1UA 3R9XA 2J0EA 4E21A 3HSYA 3T38A 3FDJA 1ABBA 3IKFA 4X94A 4TKZA 4IXWA 2XLCA 3NVAA 1IK4A 4W5RA 5DYWA 1I4LD 4PG8A 3JS5A 5BSWA 4O4IF 3ZW8A 1V55C 1NTOA 5F52A 1FJ2A 3UBMA 4WKCA 1MO2A 2VHZA 4BO3A 2GK6A 2LV8A 3CCQV 4EPWA 2CWWA 4LDAA 1QAMA 3GG9A 3KXKA 5LP1A 1H2EA 2EBHX 1KI3A 1LI5A 1SC1A 3AVVA 4B76A 3G9UA 2AD5A 2DLNA 4K6GA 1EKXA 4KXUA 1JB1A 3ZN2A 2ZJYA 4A1FA 2P2GA 3WBFA 3CMAV 1HM5A 1CY6A 4P81A 4WN9B 3ZWBA 5D2CA 3QXCA 2WLIA 3B7PA 3NGXA 3IOBA 1NBIA 4Y9DA 4ZI7B 3B6IA 5FIUA 4YJ2F 4AD8A 2ZRMA 2BEUA 1WOYA 4MVOA 1Z9BA 3GRFA 4XRRA 1BJTA 2DTEA 4LCEA 4JAVC 4AP5A 3U56A 1KE1A 1QCZA 3C5CA 3ZZTA 2HFJA 3LXXA 4IIHA 1DDGA 1R0BA 2VH5R 3BJZA 4JWKA 1PZMA 1FW8A 3MJHA 4NL4H 3AUUA 5L3SB 1YMQA 1OBHA 3PVSA 1EZVH 1RAFA 4ZOLB 2BFCB 3SFZA 1XOIA 4KGZA 3RH0A 1BSVA 3SJCC 1AGXA 3H2GA 1NURA 1C1DA 4ODIA 4HEA1 1K6EA 4HWRA 1SELA 1DC5A 4DSZA 2VIIA 1F8XA 3DEIA 4TYMA 3I5YA 5CDFA 5AH0A 3U1BA 1GFSA 4F2WA 3VVCA 4QATA 4MWDA 4BC0A 1J5EO 1RXCA 2N04A 3WAKA 4EYKA 4NE7A 5ITZA 4TTRA 2D74A 3WLAA 4EEKA 1LV8A 5I9NA 3DZDA 3C16C 2Y1FA 4LOIA 4Q3OA 4QJFB 4Z7QB 1AO3A 1L4HA 3O4VA 3IGAC 3VH2A 2CTWA 4B09A 2C3MA 1AJEA 2D4HA 3P3PA 3LBHA 3MBMA 3HBJA 1PZEA 2NO5A 4BFYA 1CHNA 4PHGA 5K9ZA 1ZJZA 4H59A 1T5SA 3AEIA 5EGSA 3KDAA 3NEAA 2O1SA 3Q3JB 2CT8A 3GD5A 4F6EA 2EIXA 3UJ6A 1J8YF 3CKKA 4BNDA 5D5QA 1DARA 1G3IA 1JS1X 1KAHA 1MC5A 3BKXA 3BPZA 5AXBA 4EO7A 2B9VA 3FYIB 1L5ZA 2JA2A 3CISA 3DYVA 3K32A 2O8BB 3AERA 1YE3A 4D4JA 2DR2A 1OKKA 2JD2A 3QTBA 2QKCA 2FDXA 1I7QB 3C4VA 3ICOA 3G2QA 1EE1A 4EI9A 1VQ6F 1XRLA 2O8FB 1OC2A 1UK7A 1E2IA 5GGXA 3TLAA 5LOVB 2AFHA 1ZL8A 1CERA 4GPZA 4KXLA 2VJBA 3TQQA 1MQSA 4PZ9A 1Y66A 1HYEA 2CE7A 2C4NA 2I9PA 4RJ2A 2REBA 3T1NA 4LBVA 2KG7B 1G2QA 1Y80A 3PGJA 1L5RA 5IUJC 2I1LA 4TN1A 2DTDA 3O3NB 1JDSA 2PCLA 1AC5A 3QEAZ 4X65O 1MHPA 3PXDA 3ASNB 1HQCA 2IYYA 2EGHA 3D6HA 3VDQA 2E85A 2P3LA 2ZIMA 4M9RA 3DYIA 4P36A 2P9TA 4G0YA 3FAVA 3OCYA 1LPBB 3O8CA 3HLTA 1JR3E 1L7AA 3WRXC 1OXBB 5I7AA 2O8VA 5F1KA 5HS4A 4W1QA 1N36B 3LE8A 3JSAA 3EOZA 3QU5A 1QF6A 5JLAA 2XSZA 2CZCA 5HUJA 3BAAA 1A9QA 1X7HA 2YWGA 2H51A 1C8KA 2EP7A 4RKEA 3CXHF 3WS7A 1SZCA 3MRSA 5EIOA 2H29A 1RRMA 4O2BB 5LNK6 2D5AA 4UULA 3CC7F 1ZG3A 4YMGA 1UXKA 5DHPA 1AR5A 1MR3F 1UMDB 1J2EA 3AUKA 1OGYA 3G49A 3VR3A 1RLJA 5AUNB 1BX1A 1W35A 5L4NA 1Q81H 3ZTWA 3A2NA 5D3QA 4OA8A 3EJ6A 3PXGA 2Q67A 3BA6A 3J81k 5FH9A 3O21A 2O59A 3UXHA 5J4KA 2UXBO 3EW7A 3ORYA 2N74A 1EG2A 5FV7A 1B8PA 1UAAA 2OVFA 3D7LA 4WNAA 3P30A 4LTMA 1VJ1A 2C4VA 3TZ6A 2B6HA 3P2KA 2VNAA 4L75A 4P9NA 2IM9A 2F9FA 2V7XA 1M9NA 4Y0NA 3OF5A 4UOEA 1VH8A 3VZQA 3V80A 3KE1A 5CHYA 4KHPB 4JXZA 4OL9A 2VF7A 2Z08A 2ZYUX 4B17A 2AXNA 1KZ9A 4RTSA 1GN4A 1YZLA 1ST3A 2QBYB 1WCYA 5CA0A 3QHDA 3IMCA 2G77B 1L7EA 3ELWA 4YHBA 4EX6A 1NV8A 1II8A 1GUFA 2BKLA 1AK2A 4KFRA 2TMKA 4C7UA 2G83A 3D01A 1H22A 3P3NA 3AVXA 3D9QX 3E9RA 2HF9A 3OTHA 3EDRA 2PWYA 2R6JA 4UE2A 2AXQA 3GY0A 1ONNA 1YTLA 2TS1A 2W83A 2Y05A 4CHGA 1USKA 4R5HA 3MRVA 3NK7A 1W52X 3N75A 3BEOA 3GLHA 3AZQA 2VXCA 4QJ3A 2GSWA 2WJHA 2OEPA 4BGUA 4O1MA 3NC4A 3DOCA 3NT4A 2HTEA 2YYSA 1T2FA 2HHLA 1TVKB 5JASA 3HU1A 1JKMA 1S8FA 4IJKA 1DF4A 4W82A 5B1DA 3ZW9A 1KZ6A 5CTJA 4S1OA 1OZFA 2JFWA 3AEQA 3FTDA 1JR4A 5HKOA 1X25A 3WSWA 4ZOLF 4NTWA 3G5LA 2OTLF 4UDNA 5K05A 1IZYA 3C6YA 1ZSPA 1F3LA 3RSOA 4H9GA 3MFYA 4HCJA 3C15C 4J10A 4GR4A 5IF3A 3RK0A 3RS3A 3ZRWA 4NYKA 1LSUA 1Y6QA 3R9XB 2PX3A 3UV7A 4BKMA 2GVDC 1FRZA 2D7CA 3PD7A 3TIXB 4BAGA 4KR9A 1KNJA 3U6BA 4TYPA 3T15A 1ULBA 1YDGA 4DR7O 5F98A 4XVQA 1RR6A 3NIFB 3PSAA 1NY6A 2JLCA 1IM2A 1RKQA 2GLUA 4M38A 2NO0A 2VYQA 3OY7A 4MGKR 3ZMVA 5WRFA 1E1YA 3UO3A 4JJKA 4BLWA 4C7MA 3NWEA 1NSFA 3D8RA 1DJOA 1RRKA 2OY0A 1T9HA 3SR0A 2DKOA 3KB6A 1RXVA 2IS6A 3TVTA 1A50B 3R2JA 2WK1A 1QZXA 3MCQA 4FC6A 3SEZA 3E1YA 3NXSA 5F78A 4GXTA 5BYKA 5L4SA 3E05A 2WLIB 1VLMA 2AN9A 1A32A 3IKTA 5HMMA 1FCJA 2FX2A 1OWPA 1WWKA 2BEUB 2A9PA 1LDBA 2H7YA 3BE6A 2FWRA 3V1KA 1QG4A 3INTA 3ETDA 4OP2A 4NS1A 2IPNA 4G1UC 5C1BA 3HJFA 4HMOA 4DJJA 4KSCA 4OMFG 1QR6A 4GPEA 3GI1A 2YQ5A 1NF2A 1TEXA 4WE3A 4LXIA 1XJ0A 2BBTA 4ZVVA 2D5CA 1C0IA 1HI9A 5H5NA 1GPUA 1AKYA 3TNLA 4F93B 5JATA 2O2ZA 3DZ8A 4QEKA 2R47A 3KZCA 3D3NA 4XOIA 1QVFU 4AWBA 1C1DB 5B66Z 1DIRA 2DPYA 3SIRA 4D9NA 4QPDA 3NT2A 2C2AA 1V5IA 4GYJA 3CZQA 1VLZA 3ET5A 3NC0C 2MTBA 3I23A 4RS4A 2CB9A 1GT91 4BKPA 1N5JA 5ITZB 5B1HA 5T41A 4D4KA 2OCYC 3ZDAA 3TPZA 2UZ0A 1JQ0A 3CLUC 2VEOA 1W2HA 2JLAA 4J03A 5A2QA 2V7PA 3E03A 1T1SA 1NVXQ 2B1IA 1IUKA 1N0IA 2OLKA 5B1SA 1EDOA 3L7AA 1H93A 3KVVA 1N6IA 3S0JA 3QQPA 4X0EA 3QVVA 3ZDRA 5CPBA 3EUEA 3KUDA 5DGIA 3RPEA 1K08A 1WMBA 2Z8YA 2PUBA 2XXJA 4Y30A 1VP3A 1PYDA 1K3UB 1HX7A 3WB2A 2QZ9A 2WHPA 4BNDB 4K8RB 4EMUA 3CJHA 4LYAA 3IERA 2HS0A 4FIPC 1WUHS 1HMYA 5E7QA 4GX2A 1U1FA 4TL7A 5EWLA 2C58A 4C22A 5A4AA 3UCEA 2R1TA 1HNXB 3AERB 2WTAA 3ZEDA 3RQIA 4PG4A 1P6QA 3X1KA 4J8PA 1KIAA 3PU6A 2IP2A 1ZLZA 4CV3A 3SOZA 2WAMA 2HDNB 1XCGB 5FUXA 1ZL8B 2FGKA 3DAYA 1DUIA 3ZJTA 4HYTA 5FTWA 3BMOA 4D44A 1VQLF 5HFJA 1FQKA 4L08A 5EVCA 4AYWA 2XAUA 3HMQA 4JI0O 4E5NA 4N49A 4LDQA 3LVRE 2QWRB 1PJ2A 3OKCA 1YS4A 2O2DA 3QTTA 1ESMA 2OM6A 4II2A 3T0IA 2YDYA 2J6IA 3UT5A 3FAVB 2H3OA 2IIBA 3MWGA 5T3YA 3HU3A 3K5OA 1DAGA 5IASA 5G4VC 2HUNA 2FETA 4BVTA 1X74A 3H7AA 1VIBA 3ZY5A 2Z9DA 4DW0A 1T4BA 2V4MA 5MN5A 2V7BA 1UXGA 3MGAA 2I78A 1WDMA 3W7TA 4QFMA 1PQUA 3A0UA 1W30A 1Z56C 5IJ9A 1DINA 5JJEB 4CW7A 4DMUB 4RJKA 3R5HA 1XL0A 5IBRA 5HJ7A 4D81A 4EKIA 1LDYA 1EFCA 4Q9IA 4F9TA 1YF2A 1Y3DE 2FSVC 4NBRA 4NR1A 2X42A 3ZK9A 4HLUC 4KK4A 3BRCA 1GM5A 4HGZA 4U2CA 2I1QA 1NGSA 3PE3A 3DXYA 2AG5A 2V4ZA 2Y1OA 1M5UA 1U2EA 5B3KA 3GK3A 3OC6A 3KR0A 3FTFA 3KL4A 1G5TA 2BTOA 4X1KA 3PJGA 1TJPB 4UUBA 2JH9A 1G6OA 3TCNA 1YJNV 2OHWA 2IZ7A 2DULA 2Q3JA 3V55A 4OGLA 3IRUA 3BK1A 1NIJA 4CM1A 5HGJA 3T1HB 1DKPA 5BN1A 1QHTA 5CAEA 5JECA 1S77D 3CKLA 2G4VA 3B20A 1CSEE 2PJDA 1LD3A 4WNAB 3V3TA 1ZHFA 1SVWA 3WRYA 2LZ0A 2J5RA 3D6VA 3E20B 1IB0A 5AJVB 1Q77A 3EOBI 3AP1A 3VX4A 1I0LA 3KVYA 1YBAA 3VYTC 1BFDA 4UBJA 5FWAA 3IV6A 2JPDA 3NALA 3IBGA 5CA0B 3B1XA 4F2DA 3ZP7A 3HCOA 3HEAA 1IHXA 1II8B 2WLMA 1ZUNA 2R8RA 3L6CA 4R40A 1J7JA 3QX3A 1KSHA 1JG1A 3FROA 1AY0A 3ZWMA 2O2HA 2Q3CA 4XDJA 4AS1A 1YL6A 1P19A 3PE6A 3GZJA 5CFRA 5I9IA 4Q15A 2FPLA 2A9JA 1BCCH 3RTCA 2PMFA 3GLHB 2O06A 2HYIC 1PKEA 1D0SA 4D7SA 4B82A 1X9GA 2IEIA 1HGXA 4OMDA 1B04A 4MGZR 3ZD7A 3L74H 4CMIA 4PA4A 2WG2A 1ZL2A 5JOQA 1UFQA 1SXJE 4GEKA 3TK1A 1WA5A 2COKA 1MNQA 3AEQB 2ZM5A 3K12A 4FYHA 3TOVA 1VPWA 2AN4A 3HHPA 3P32A 1YJ9V 3FPKA 1FDRA 1EGAA 1T9AA 2LTAA 1ELOA 4G1BA 1RZVA 2VLBA 4Q6GA 1PRYA 1YDXA 1XGKA 5EE5B 2AJLI 3ZRWB 3W6PA 2GJ9A 1X86B 1XA0A 1J9ZA 3AOEC 2AD1A 1I30A 1ISHA 1VE9A 1CEQA 4YRDA 1RHRA 3WJRA 2GCPA 4C4XA 4NENA 4J94A 3AJDA 3ETNA 4QTYA 4ERHA 1XJQA 5BOSA 1WB8A 2R44A 1XU9A 4DR2B 3ZI0A 3OTOB 4WCFC 1N34O 4FYXA 1GGFA 1UK8A 4K7JA 4E07A 3PD0A 3VKUA 5AVKA 3L1HA 3LBYA 2XYHA 4AMGA 1Q20A 4OOFA 5JS1A 5J1TB 2WUVA 1WB5A 4WXRA 3VJKA 2JW5A 2Z4TA 3PXBA 1UFRA 3RJ9A 1TK2A 4JBHA 5EJ8A 4ZBMA 2X0KA 1FXKC 3JCUZ 5IPFA 3C3XA 3KSZO 1KYTA 3KJXA 1UINA 3TB4A 5DHRA 2IY7A 3M4SA 2Q07A 4NG5A 1RWVA 2QRLA 5JS2A 1V9LA 4MWBA 2O3QA 4DB2A 4FLMA 1FFTB 4UCSA 3WYFA 1GNTA 2HWWA 1WMSA 1JZSA 1JD1A 1XRJA 5LLDA 4M54A 2PRJA 2FF7A 5ES3A 1HE1C 4RV9A 2I6TA 5IYDO 1UAYA 1P1BA 1XXHB 2YJ3A 4ZD6A 1M8PA 5JS8A 3EUFA 3DJYA 4QHYA 2JS7A 1HV8A 6REQA 4LF8B 5AK3A 5HIKA 1AT1A 1IURA 1CF4A 3S06A 3F0EA 4R84A 1DBFA 2ZJAA 1J0AA 4PGHA 4UV8A 3K57A 3OJCA 2K1SA 3SJZA 3C3CA 5AW8A 3C3BA 3SJ7A 2GJAA 3N4YA