5KMGB

Near-atomic cryo-em structure of prc1 bound to the microtubule
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
431
structure length
431
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
publication title Near-atomic cryo-EM structure of PRC1 bound to the microtubule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 176
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kmgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kmgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kmgB01
5LP6C 4TV9A 4LNUB 5J2UB 5JVDB 1W581 3UT5A 3M8KA 1OFUA 1FFXA 3C8LA 4TV8A 4EI9A 5JVDA 5J2UA 2RHHA 4IIJB 3JAKB 4F6RB 5EZYB 3RYFB 4I55A 5IJ9A 1W59A 3RB8A 1W5FA 4O2BA 2R751 4I50B 5EZYA 1FFXB 3RYFA 2VAPA 4TV9B 1RQ7A 3JARB 5EIBD 5LXTB 3R4VA 2Q1XA 4I4TB 1W5EA 4I50A 5M7EA 5LA6B 5C8YB 3JARA 4EI7A 5CB4A 5LXTA 1SA0B 4IHJA 1TVKA 4I4TA 5MN5A 5CA1B 5JCOA 5LA6A 5C8YA 4I55B 3VOAA 5FNVB 5IYZB 5IJ9B 5EIBC 1W5BA 1SA0A 4ZI7A 4ZHQB 4O2BB 4DXDA 4U3JB 5CA1A 2VAWA 3VPAA 5FNVA 5IYZA 3ZBPA 2R6R1 4O2AB 4ZHQA 1JFFB 4U3JA 4O4JA 3RYCA 4O4LA 3RYHB 5LOVB 3WGKA 3HKEB 4O2AA 5CB4B 4YJ2B 2BTQB 4IHJB 1JFFA 5JCOC 1TVKB 4ZOLA 4O4IA 4EB6B 1Z5VA 2RHJA 2BTOA 5J2TB 2XKBA 3RYHA 5LOVA 3HKEA 4DRXB 4YJ2A 2BTQA 4HNAA 5KMGA 4O4HA 3JAWA 4X20A 4ZI7B 3WGLA 3V3TA 4B46A 1W5AA 4EB6A 5IJ0A 3VOBA 3WGNA 5MN4A 5J2TA 4X1YA 4WBNB 4B45A 4KWEA 4DRXA 2VXYA 1RQ2A 1Z5WA 3WGMA 5JQGB 4O4JB 3RYCB 3VO9A 3ZBQA 4WBNA 5MN6A 5GONB 4O4LB 2GVIA 1TUBB 1FSZA 5CA0B 3ZIDA 3JATB 5JQGA 4ZOLB 4O4IB 5KX5A 3JALB 4FFBB 2RHOA 5GONA 4U39A 1TUBA 5EYPA 3E22A 5CA0A 2XKAA 5JH7B 4HNAB 5KMGB 3JATA 3JAWB 4O4HB 4X20B 5ITZB 4YJ3B 5LYJB 3N2KB 4M8IA 5IJ0B 5LP6B 3HKDA 5BMVB 3JALA 3VO8A 4FFBA 3M89A 4TUYB 4X1YB 4X1IB 4LNUA 5JH7A 1RLUA 5LYJA 5ITZA 4YJ3A 3N2KA 5LP6A 2RHLA 5BMVA 3N2GB 3RYIB 2VAMA 3HKCB 4TUYA 4EI8A 3JASB 4X1IA 4E6EA 4X1KB 4IIJA 3JAKA 4F6RA 3N2GA 3RYIA 3HKBB 3HKCA 5KX5B 2Q1YA 3JASA 4XCQA 5EYPB 3E22B 4X1KA 3CB2A 3UT5B 3HKBA 3HKDB 4TV8B 3WGJA
chains in the Genus database with same CATH superfamily
3CSUA 1WXXA 4JGIA 1OFUA 6YASA 3PD1A 4ASUG 3DC7A 5FPKA 5GTIZ 1FLAA 3PNYA 3QO7A 2WC1A 3DLIA 4O2BA 1ODSA 3TXQA 3ETEA 5KHHA 4X3CA 3EWNA 4UHBA 2BEKA 3NNNA 2R85A 3COWA 3T4ZA 2FWPA 4H7KA 3ABIA 3WSTA 1TA9A 4YMTA 2OKGA 4MXDA 4V0LA 1ZN2A 5EN4A 4B3DA 1UJ2A 1XALA 2IUEA 1ULAA 2JZCA 3CCJV 2DM6A 1P3JA 3AWDA 3M5CA 3KSUA 1GKUB 3C6XA 3KEGA 1YITF 3FTNA 4U00A 4FMTA 1IG3A 1MX5A 5C93A 1K6EA 1H3EA 5JNLA 3V1KA 4P4SA 1BKYA 3FCSB 2DCUA 1E32A 1LCIA 4PSAA 2CZWA 4LYJA 3AKDA 2FQYA 3GUYA 3I2FA 3G67A 4DR7O 5DWDA 2AKAB 1FNNA 3DJYA 3TX2A 1R9MA 4DSNA 2R4QA 2QJFA 3A1CA 4MS4A 2VP4A 4DOMA 2H9AA 2JIZD 3K71B 1SA0B 5E7QA 4L8GA 2VUHB 1VEWA 4A26A 2AJLI 4WSOA 2UXDB 3K9WA 2HRZA 1VHTA 2F55A 3VH4A 2R97A 5IVKA 2ZDQA 5DT9A 1ONSA 4HNRA 4FLUA 1OV4A 3PJEA 1O54A 4GQIA 1RZUA 2XT0A 2C2YA 5F51A 4IXMA 1V96A 4CM3A 2RHLA 1GPUA 5CFQA 4E6EA 3LYBA 2I71A 3T5BA 3Q85A 1KU0A 2CXNA 2V5VA 4DIKA 1YBHA 2EHJA 3K5LA 4ASUA 1AA9A 3L06A 3H2KA 5EE9A 4BMXA 1I94O 3KZCA 3BAAA 1CR2A 3JPWA 2I80A 4TTSA 1TYAE 3KHUA 3CB4A 2ADFA 4DYLA 2PUBA 5HGXA 4ND1A 4CV0A 2FKAA 521PA 2OEPA 1DX9A 3OO1A 4GF5A 3D4OA 3KB6A 3W5VA 3WGKA 1Y6RA 5F5XA 1G2PA 1T4MA 2Y1EA 5GM1A 3W9SA 1Z88A 2VP0A 2MJLA 3JQFC 2WYIA 4GC9A 2HRDA 1AH2A 4LDQA 2FZ5A 5CFRA 2XDQA 5B66Z 1AE1A 3UFBA 2UYGA 5E1DA 1DX4A 4GMDA 3MA0A 4GVLA 1W5SA 2E4AA 4CQNA 3AC0A 1TO6A 4KX5A 4M54A 5SZHB 3EGDB 4CUZA 4MA0A 5ICEA 3GO4A 2E5WA 3NEPX 3HBJA 3UJ7A 4P22A 2IIPA 2JH8A 3QKWA 3BKWA 4LCEA 2C4WA 2ZVPX 4PICA 1ZSNA 4XDGA 5TT1A 2Z5VA 1RHRA 2QN7A 3OAAD 4EEKA 4JTCB 1ZXLA 4K0RA 4NOJA 4TMXA 1OGYA 5EBLC 4KR7A 2FF5A 2UKDA 5CT9A 3G7NA 1V5WA 2Z8YA 4H0CA 1QLEB 1F4MA 1CZNA 3T0FA 4ZP1A 4RTJA 5FOSA 1DC8A 2RKOA 1ISIA 4IG4A 3CCMV 1MO5A 2IZ6A 4NK5A 4JR0A 4R5MA 1S4MA 1I2BA 3NVAA 2DUWA 1PNTA 1N1MA 3ZHYA 3QXJA 1NYLA 1HQKA 1CUGA 5BUQA 3PR1A 1K4CC 4I6EA 1S89A 5ITZB 3D8RA 1TL7C 5DM2A 1B3RA 5D3KA 4XLTA 2BEUB 5I45A 3N2YA 3PCTA 2ADPA 1ZXBA 2PQ2A 2FHSA 1VQ8F 3WMRA 4GOXA 3ESXA 2IW1A 5ETJA 4RLSA 4QWMA 4CQLB 3QJYA 2G25A 1UPGA 5HOQA 1KFBB 2AW5A 2XF8A 1PJAA 1M8FA 4AO7A 3DEAA 2Y92A 1FB5A 5B3JA 3A26A 4EGFA 5HUJA 1KSHA 2QB5A 3EVCA 3CPWF 2Q7XA 3GR6A 4FE3A 4L15A 3QVWA 1R6XA 1YF3A 3RASA 1JQKA 4PZCA 2GSMB 1UBKS 3VR0A 1AC5A 1T1GA 1CUIA 4YO8A 5LGNA 1CS0B 1LF5A 3T7RA 2DBRA 3L6CA 4XIYA 4F21A 1N8KA 4WJKB 1VPWA 3SDLA 2ZKOA 4FW8A 4HP8A 1BQ3A 4POOA 3P10A 1X1BA 5H16A 1YFLA 2CHUA 2ZSJA 3FPBA 1I5YA 3OFSA 4IOKA 4X84A 1AROP 4B3JA 2IU3A 2XUGA 2QMEA 2Q1YA 1E0JA 4O8CA 3FLBA 3ITEA 2NO1A 1T13A 2R25B 4NE2A 3F73A 4QD3A 1PVVA 1KU6A 2G76A 1H2GA 1XHXA 5AKXA 4CTMA 3JCZA 1F8GA 4YMWA 4POAA 5GADl 1RLOA 1UBMS 3WXBA 2P1RA 4P3XA 3AH8A 4Z4IA 3G8DA 4ZDKA 1I2ZA 2A9JA 4IIBA 4DA7A 1RM3A 3X1JA 4BO0A 5G53C 2D7CA 3BX1A 4AHCA 3OE7G 1Q0RA 2FFBA 1P31A 5LZ7A 3HB9A 3GPBA 3H3FA 5DV9A 1EN6A 4NYIQ 1Y33E 2ZM5A 1MOFA 1HLPA 3L84A 4REQA 2YICA 4G5YA 3TLGB 2OV2A 4OLJA 3NDIA 1SR8A 1P7VA 3KFXA 5AUNB 3QXCA 3WYEA 5EC2C 2A35A 1GSIA 3CF4G 3TSOA 4FHZA 1KFJB 1T2DA 1KNJA 3KT3A 4JI6O 1X38A 2YY6A 1JHYA 3HRKA 2IF2A 1CWUA 1WA8A 2KGWA 4FFVA 1DBSA 1ZWZA 4EY6A 4I0WB 4E70A 1EVZA 1A1VA 3V34A 5LL6Y 1AM4D 4EG0A 2J9ZB 2B8EA 1P17A 4RVHA 2ZVDA 2NQ2C 1NX6A 3ORFA 2DR0A 5GJBA 2YKGA 2I6RA 4XVRA 1M1YB 4MUHA 3SJZA 3KR9A 2X42A 3IJPA 5DBFA 3H01A 2UUAO 3UANA 5JI3E 2AXTZ 2WKPA 3DPSA 1KAGA 4CLOA 3AUUA 2IPXA 3EUAA 2BELA 4B82A 3QFFA 3CNQS 4CM4B 3SE0A 2GERA 2OFWA 3MTEA 2X7RB 1P0CA 2CUKA 3EAFA 2XHZA 1PG5A 1XQ6A 2NUBA 1CCWA 3CXRA 3TJRA 1G5PA 3CVXA 3DE2X 3CV3A 2OBFA 2OGSA 5C80A 1GG8A 1COMA 3H5VA 5HZHA 3R3WA 2A6PA 3V8NA 4F4JA 1PR1A 4EHFA 4DV5O 2ECOA 1S2GA 3JAMA 2HB6A 1Y3DE 3EHEA 3VQTA 4M55A 1T3GA 3SZOA 4YFVA 5JJEB 2SECE 3OE7A 2WD7A 4LK3A 5K2MA 4JODA 1SGWA 2CK3D 5EUMA 4V0OA 1YQUA 3WPWA 3TL6A 4K9LA 3PQDA 2VK4A 2JJ1D 1L1EA 4OXXA 1VGVA 3FCYA 5B7NA 1DARA 2P2DA 4KEAA 3AK2A 1IEQA 2BEUA 1JG6A 3LDDA 4LVCA 3CF4A 3IBTA 3NZEA 3H8JA 3N2GB 1PEYA 3PEEA 4LHEA 1ZLXA 3Q5GA 2HMWA 4HUQB 3WRVA 1IK6A 4UZSA 4QRIA 3F96A 4JUFA 2EL7A 3N8NA 3QXXA 5J47A 3LRTA 2ZE5A 4LJYA 4LHZA 2JLWA 4RD3A 5DSZA 1X8LA 3VYSC 4ITVA 4JA2A 2C5SA 4US2R 4TX1A 3RIGA 1PNOA 3N6RA 3OM0A 3AVYA 1PKEA 3GYBA 1CS0A 3PE4A 4UD6A 4B8ZA 3CTMA 1RA4A 1E4EA 2MINB 3HB5X 3W79A 4UBIA 1NA5A 4V02A 5LLDA 3U9TA 4A3SA 3GG9A 3M6VA 3ADCA 3D5TA 1BU8A 1QKKA 1MT3A 3RVQA 1V7QA 3UHAA 1KO4A 2W2LD 3LWZA 1Z0KA 2VP2A 3W3AD 3LA8A 5AVMA 1VJ1A 1YASA 1N5JA 2YVUA 3U7IA 5A5GA 3TW6A 2O1SA 1XE3A 4G25A 2FZVA 1KD1W 4PV7A 1ISMA 3WB9A 3RUHA 4EI8A 1VL0A 1M0EA 2PLRA 1P2SA 3H9JA 2K1EA 1OWOA 1CB0A 2O5VA 1VPEA 3CSXA 3WZLA 1A98A 5EGSA 4WKCA 3S6JA 3U13A 5TPWB 2H4WA 3R23A 4RZXA 5JG7A 2HDNB 3SPXA 1UMBA 4DWJA 2ODQA 4HAIA 1TUEA 2YI9A 3ZK8A 3SXUB 2C20A 3WL6A 4ESHA 5LFAA 1M9NA 2WTEA 3KKOA 3JSAA 3AM4A 1OAOA 4YBRA 1N8SA 3TSAA 3GHYA 1MGOA 3IOEA 2W6IG 3SHTA 4RMGA 3VC7A 2CVLA 3TLGA 1F0NA 4BGIA 4DADA 5DCYA 2VS1A 5AUPB 1NGSA 2H4HA 4TTIA 5GMOA 2B36A 3EAQA 5DRYA 3SZMA 2R5NA 3ZD9A 1PIWA 4LC1A 3IP5A 3S81A 2AEJA 4DLZA 1OB2A 2Q3CA 2LNDA 2BM1A 5F2KA 1VE6A 5I4IA 1W76A 5FHQA 1G7TA 2GZ1A 3RHZA 2RH8A 5FI5A 3WDSA 4JI4B 1TLFA 2WF8A 3F6YA 3A9UA 2QTTA 1IHPA 4R7CA 5BUCA 4IHJF 3WGGA 3HQ4O 4IIYA 1ZX3A 3H5TA 3N58A 2K2QB 2ZE7A 3HZHA 1M1YA 4TVSA 4TVKA 3DMNA 3TM5A 4E5UA 5AVXA 4QGHA 1X80A 1SOUA 4BLRA 1PWEA 1U0LA 3U44B 1HY3A 3FOFC 1ZI8A 5AP9A 2HHAA 2G1KA 2GTAA 2X6AA 2V7QD 1Q8RA 3IEPA 5EJ6A 2BR5A 4C2TA 3HDJA 2BMJA 2EIXA 3CG0A 2KKWA 3M1XA 1WWKA 3FNFA 2H1IA 5AKHA 3V8VA 3GD7A 3NUQA 3JQGA 4CG2A 5FBVB 3C14C 3HCOA 1W25A 3NNDA 5IAGA 4D9MA 4LAFA 2PGXA 3HI6A 1YAHA 4TGLA 1JW9B 3DDOA 3EVDA 4NUTA 5JVDB 4AURA 2HHHB 3KRTA 3H4VA 2IVZA 2OYQA 2XB2A 3ZYCA 2H3OA 1AGPA 3W5CA 3UV7A 3CX3A 5C35A 1B6RA 3STUA 5JQGF 3QIVA 4OQFA 4GHWA 1LH0A 2WSYB 3UB3A 1YTFD 1AO0A 4PIMA 5ALRA 5FF9A 5IJZA 3B2QA 4FZ1A 2W6IA 3LVBA 2OSVA 4ZT7A 4QELA 2HR1A 1WUYA 2P6OA 2E0IA 3BD6A 1QNMA 4OHUA 3A6ZA 2AXQA 3WXMB 4RKEA 3EASA 4P6VF 3K5PA 1DGSA 1Y42X 3J80A 4HO1X 5FTMA 1R6DA 1MSWD 3D4LA 4BO7A 3QH4A 4WKGA 1AV7A 3CRW1 3VR6D 4HUQA 4ITRC 1KJNA 1A71A 2ZF8A 3SHVA 1K7YA 1W1IA 5G0VA 2AQ8A 1IBMO 3KCYA 4P33A 4Y1EA 3GLIA 5AVRA 4EKNB 4UCRA 4PPNA 1OCZC 1Z0SA 4U2BA 2ALEA 3UJDA 4BZXA 2BUCA 1Y3HA 1MAVA 5EE3A 2HWYA 4EVSA 1F3LA 5AM5A 1KK2A 1VQMF 4R7TA 2AQKA 1XNJA 3HSKA 1S2LA 4CTNA 4DWOA 2Q7HA 2BHSA 3A1FA 3DCJA 1VQ9F 2R1TB 2WICA 3L0CA 4CL8A 2CHVA 5T4FA 4PQEA 2RJNA 1ESNA 1U4NA 3T1CA 4EB6A 3CJQA 4L0MA 5KVQA 2JK0A 2WW8A 5T7BA 4J0FA 5AKEA 3UUGA 1UUFA 1JG4A 1V54C 5CA0B 5DTQA 1HFWA 1KQNA 4KB5A 4KBYA 1I6WA 1TF2A 1ORQC 4BKMA 2ENWA 1IBKO 4M8IA 4RXUA 4FGZA 1XNGA 5EP1A 4BWAA 1XAJA 1LI7A 2R1VB 5TPWA 4KRFA 1BA2A 1NTOA 1D0VA 3KFVA 1IXRC 3TCXB 3RU9A 3LL4A 1VHDA 1QRRA 3JASA 1R4NB 4PHGA 1YA8A 4YUWA 3HEBA 1P8AA 2UZ1A 2A59A 5M29A 1JKJB 2JGJA 5DI9A 4MQUA 3I5UA 1Z35A 2ZUWA 3R7LA 1Q5OA 3ZMTA 3LL7A 1KNKA 1M0WA 2HWXA 3GFQA 1QQTA 4CIAA 3MNFA 4BT6A 1AY0A 3NAQA 1LGYA 5ERYA 3DBVO 4BVRA 4B5LA 4JT2A 2CD7A 2IYQA 4R84A 3E58A 4PZDA 4D3YA 1ODCA 2E48A 5KNBH 3CH7A 1QO7A 4KJZA 3QMMA 1TECE 4X6XA 2OQIA 1T5SA 2LKCA 4JT4A 1E92A 4FMDB 3AP1A 4JHLA 5CVCA 3T0IA 2PMFA 3MB5A 4LR3A 3IIKA 4M46A 2CTWA 4D0LB 4IDEA 2V7GA 2RJ3A 1YB1A 4I9QA 1VYTA 4HVAA 3C5CA 2RHRA 1QVRA 1W5TA 5JR3A 1X42A 1FNMA 2O7NA 3KBBA 4JBLA 1UDRA 1ZDMA 3IAS6 2VP6A 3H1BA 2Y9PB 3G2JA 4F6CA 3D8TA 1L9KA 3KDSE 3L8EA 4EATA 4M21A 2J5RA 4JMPA 5KHOC 3LVFO 2W0FC 2F1IA 1ZL0A 3U44A 4JQCA 4L22A 4HAYA 5CYFA 1KQSU 5KIAA 1GV0A 3U4IA 2JEUA 1MOZA 6AT1A 4F9GA 4F5WA 2C5HA 3G5TA 3RVZA 3L7KA 1KZ6A 3VH3A 2WIKA 1AN0A 2HNAA 3WV4A 2KQUA 1LNZA 3AYZB 4EH1A 4ZHQB 4EW3A 1S3JA 4MR7B 3E5NA 4NMLA 4YHHB 2J0SA 4YB8A 1P60A 1X8XA 3N8KA 5ULLA 2AG5A 1HO3A 2VF5X 4CDGA 4ZEMA 2EFEB 5LOVA 1UR5A 2RHBA 5F1KA 1Y1PA 3F4KA 1V9PA 1Q15A 1OCOB 4JF3A 5A5VA 1P45A 1AJNA 3L0ZA 4YRRA 3ZV5A 1TYZA 3RBVA 2P3OA 4NVRA 3GROA 1XAIA 1S8AA 4ETIA 4GW3A 1H9BA 3G0OA 3B70A 2VXBA 1YIAA 1WTCA 4S05A 2QA4V 3FDZA 4AIIA 4O2AF 4XDYA 4PDLA 1SHJA 2XVYA 2XTZA 1FXSA 3P4EA 3RYTC 1O5IA 5G3YA 3ZIUA 2AQIA 5L3CA 4MHSA 1GFIA 4I4TA 3MZ0A 2NU7B 1Y3AA 3ROFA 1KZ1A 4I55B 4GKBA 2OORC 1GT91 1PT8A 1P5HA 2YIJA 5B58T 3HXQA 3COZA 3P0EA 3QITA 2YC4C 4D0GA 5HWEA 2WT4A 4KFRA 1NBME 5JY6A 2Y6VA 3USZA 2PYLA 2IWHA 2QL5A 5A06A 4TQAA 2E5FA 2V0NA 5I51A 3B2EA 3GDGA 4K0KB 1JAHA 1NDUA 1OCZB 1A77A 1JR3D 3BHIA 3H8WA 2NW6A 3G8CA 3BK7A 4IFIA 4JGBA 4PX2A 3GFOA 2A3NA 1W1WA 3KUKA 5HKLA 821PA 4C0JA 2P9GA 3ZKAA 3W2TA 2OCGA 2AZ4A 3P9PA 5F35A 1QTRA 2EJ7A 2B6HA 4W7SA 1K27A 5J9FA 5LQSA 4CM9D 3UENA 4WERA 1RZRA 1UKZA 2BOCC 3Q10A 4JUDX 1EDZA 3CLHA 3NT2A 3JARB 1PLLA 5LXTB 3TL3A 1I4DD 3QX9A 2AHYA 2CCGA 4EJ6A 1WP4A 4QYWA 4QNMA 2X0DA 3R0JA 4PC3A 1JXQA 3GI1A 4KYTA 2H4YA 1X7WB 3P0JA 3DAFA 5IXYA 1V54B 1GKLA 2IXEA 5I3ZA 3K9QO 1ODTC 3ZJ5A 1BCRB 3L7LA 1XRJA 3AGPA 1T10A 3GNLA 4DQXA 4WTOA 2WJWA 1G8HA 4KWHA 4PRLA 3UGTA 2J7KA 3T80A 3QUTA 1I3OA 3FVQA 1DDGA 4PA6A 4JYCA 2AUTA 1RHUA 4GU5A 4W6ZA 4BLWA 4TYWA 2CW5A 2IJKA 3OZTA 4NENA 3A8TA 2W6OA 5F21A 1T24A 3SS8A 4PLTA 1RCFA 4E4YA 5JALA 2XVXA 3S8YA 3OLXA 3T7KA 3OFKA 3BFVA 4PLZA 3HFRA 3WB2A 3PX2A 2K7FA 3LUPA 3DZHA 5LKRA 4WZBA 2COEA 2YWHA 2LFRA 5IUJC 4J7CA 3MMXA 5BY2A 2P4QA 2XTAA 3SPCA 4GPTA 4EUHA 4QQRA 3PPXA 5AWFC 5GPBA 2PPVA 2V96A 1ZGCA 5CBKA 4E7OA 4NQ3A 1CUUA 4MKZA 2E4UA 3GRFA 1XLTC 5HTKA 1PQPA 3P8ZA 4DM3A 1VTKA 1V55B 3KUXA 2GVNA 5K03A 2A5YB 2XECA 3A04A 5HIIA 4JNCA 3LK7A 2A92A 4N5LA 3WJ1A 2GAIA 2P6UA 2B82A 3KWMA 3R1IA 4I4CA 2V9YA 2QLFA 1REQB 1QOPB 1U8UA 3EOAI 1ZBDA 1YL6A 4ZHYB 3OKFA 1G42A 1US6A 2V3VA 2C3MA 4BFYA 1PR3A 4N23A 1R0XA 4MR7A 3L7YA 4QRHA 3R7AA 2WKRA 1MW9X 4KRGA 3H19A 1JB9A 3L8GA 3NHUA 3UOWA 2GLXA 4CS2A 2AWNA 5CMLA 2F1JA 1RP1A 2LFSA 4Z1MA 4G3XA 1RABA 4MARA 4OP2A 3BD7A 1Y9AA 4DSZA 1GPAA 1Q0PA 2FHPA 5ECGC 4E30A 3ICOA 4TKUB 3PKJA 4RV4A 4QIWF 3D7NA 2WIAA 2Q4OA 1WUTA 4IWNA 3F6PA 4R8KA 5FUWA 1SELA 3B1YA 2YCBA 4RJLA 1X7GA 5A0VA 1K7SN 3MJVA 1FFYA 1NMYA 2C2HA 3HEAA 2I7TA 1WD5A 3CWZA 4H7EA 1RRPA 4ZIRB 3ZY2A 3VHQA 1V6AA 4B87A 1A8SA 5CBGA 4MGIR 4M1EA 1N6OA 4TZZA 3SBOA 2Q6TA 3L0PA 4I55A 1WPQA 3VPCA 5EJ2A 3BS4A 1TZMA 3OD4A 1RZ3A 2F1RA 2V3WA 3MS2A 4LECA 1XCLA 1UKAA 1XQ9A 2OESA 3BREA 3QUWA 4RU1A 5F98A 2Q5LA 3QBEA 2I4OA 3EXG2 2LRHA 4BVFA 1V5EA 4I1YA 1YFJA 4D4JA 3AF2A 4Q48A 4QVIA 2NXNA 1ZJ5A 2BMEA 3VHXB 5DBEX 1K0UA 3BIWA 5KMGB 5TF0A 1X92A 2J3IA 3ZCTA 2HQRA 2QSUA 4TKLA 2JAOA 2XUIA 2ZXFA 3G4SF 3UFXA 5KNBA 1IQPA 3MS4A 2C29D 1E3LA 1IE3A 1WPBA 4EI9A 5DTMA 1R27A 3K2BA 2Y9MB 1ARZA 1V11B 3QYAA 4AKHA 2VAPA 3PG5A 1X7WA 1MH1A 3OG9A 3FWZA 2HK8A 2A9KA 1CF2O 2OHIA 3TI9A 1JIVA 3LBAA 2PGGA 4UCXA 4K2AA 1VSBA 1EK6A 4B6GA 2OPBA 4L9RA 4PCVA 1IIRA 4R8RA 3S1AA 1XXHB 1BQ4A 1E6LA 2VDOB 2X5JO 3JVUA 5HKBA 3SLKA 1VF6A 1YHQF 4NXMB 1GG5A 3T7IA 4MJXA 4YRCA 2GETA 3ZHBA 4DV4O 4KNWA 1K3FA 5CYOA 2PL9A 3CR3C 1VPDA 2Y76A 2WTUA 1UIRA 2PTMA 1TQ6A 4JEIA 2PZLA 4N8SA 4I2VA 3P30A 2IYPA 4IIJB 2O2IA 1VB5A 3WVNA 1RU3A 2G07A 4CH5A 3F3SA 1SHTX 3Q7RA 4KVZA 4GMXA 5BQ5A 4AMBA 3WDMA 3AIMA 2IEDA 3FKQA 3DZKA 2CYCA 4GE3A 1T0HB 4E22A 2GAFA 1MJGM 4JBXA 1W55A 5LMUB 2H11A 1LZKA 4MDHA 4MI1A 4J7UA 3EX7C 1HE3A 2VXYA 3DQZA 2I6UA 2M6RA 4FWBA 1BS2A 3DBLB 3OZBA 3G8AA 2B69A 5AM4A 1HSZA 1U98A 5MDHA 1T8TA 2ID4A 3V7WA 4YJGB 4Q9NA 2EERA 3L46A 2OQ2A 4ALMA 4OD0A 4BNHA 2A2ZA 3OT1B 3PXUA 1G8AA 2BP7B 1QE0A 5DX8A 4BO9A 1AB6A 4D6TH 1Y1LA 4B3TB 4QXAA 1PQWA 1FRNA 4TRRA 2BL4A 2K5UA 2YXYA 1OXVA 1XZIA 4IL5A 1HOTA 4DSTA 1KY4A 4FYVA 1T0JB 5C8VA 1R5JA 2ZRJA 3KJGA 1HDEA 3Q6IA 1G55A 3WLMA 3R8XA 1M2EA 2DMXA 4KVFA 1U96A 2XW6A 1V47A 1IOZA 1NBAA 2X6QA 1DFGA 2D7JA 2DOKA 4B6PA 3DPIA 4D8XA 3DGFC 4QODA 2WHXA 4OFBA 2WU3A 4M0LA 1SKVA 4PU0A 3JD3A 3JXEA 3UNXA 2I1VB 3HDYA 3DLTA 3B12A 1N33B 5I5EA 5HG0A 1B2RA 3UV3A 4BNTA 1M3SA 3WZMA 3IKVA 3R65A 5C8DA 2LW7A 3TLZA 2YWDA 1MG1A 3OW2F 1HDCA 2O6LA 3QQPA 3CURA 3IR5A 1YRBA 3GA5A 5LP6F 5CLFA 1H2KA 3E8BA 1VPTA 5ES4B 2QN1A 4L5CA 4MLDA 2GEVA 2ETVA 5B3JC 4FOPA 3TM4A 3EULA 3FPEA 3C3WA 3KOUA 4DMHA 5KMGA 3WHIA 1CZOA 2W58A 4UUMA 1F5SA 1KVUA 4ENVA 1P1RA 1HH4A 3K9NA 5KLVH 2NPIA 1T36A 1AGXA 5KWEA 4XSHA 4PQGA 4LHVA 4LMAA 3ZGNA 1HC7A 4JBGA 2EGHA 4RZQA 1TAQA 1NXPA 4XARA 4ZO6A 1QP0A 3WLLA 2HKOA 2R4UA 5GTHZ 3IO3A 5AVZA 2I9PA 2WVAA 3RYIA 4UD2A 4G88A 4YRTA 4O1HA 2V6MA 2Q5IA 3R5JA 1TDJA 4G81A 4G97A 2WILA 1H2NA 2WJ3A 1GM8A 1RYEA 4YLYA 1GNLA 1PR9A 5KKAA 4MOWA 4PY2A 1AT1A 1P2TA 2D1QA 2FXVA 5IXJA 1QZZA 3I64A 1XXHA 4IOJA 2H1SA 1L4GA 4I5EA 4LGCA 3KC2A 3K32A 1UQUA 4AJ1A 4LTNA 3F9IA 3G68A 5KX5F 2EQBA 2BTOA 2WIBA 5CLIA 3GEMA 5ALYA 3V8BA 1JEEA 1DJQA 3LWRC 2P68A 2AG8A 3RAJA 5K8VA 4WBNA 3R8FA 4DLSA 4AJPA 3AF4A 4C03A 2R68A 5BN3A 1Z5UA 3GZTB 3OFNG 2P3SA 2G0TA 2ZI9A 1T1JA 2XTMA 1C3EA 2FWJA 4IIJA 2IT1A 2MYNA 3GDHA 5D5QA 2DJIA 1US8B 1ZD1A 1Z4QA 3BQNB 1GZ5A 1L5OA 1ZK2A 2YMMA 2PWBA 1UZAA 2XZOA 3AI2A 4UQOA 1E2UA 5AG2A 1DRJA 3BGIA 2WMOB 5AKLA 1OJ7A 2QKSA 1NKVA 1U7TA 2AKYA 1QMPA 3BH0A 2XUAA 1XRQA 4F6LA 4QA9A 2L19A 1N75A 2QX4A 4HB0A 1ICEA 3M4YA 2P2YA 1H2HA 1G5IA 5LB4A 1UMDA 4XXHA 4UUJC 3EJ6A 4BNDB 3BE8A 4KO3S 4Q19A 5DX1A 2L26A 4DW0A 5K8IA 1BJRE 4L57A 3BRWA 4AD8A 2VT2A 4AI8A 5FL7G 2ID9A 3RVPA 1K86A 4IZ6A 1TVCA 2TSYB 3RREA 3T9FA 3QVSA 2AC7A 3AHJA 1FFAA 4RIIA 4H1HA 4WFHA 4DYVA 2HL6A 5NLLA 5CFPA 3OT1A 1EVLA 3HKCA 4RGVA 1IEVA 3QA3E 3WLKX 4EJSA 3M2TA 4WOPA 1E6CA 1JA0A 2VDWB 4KV9A 3SR4A 3FYEB 2R9AA 3LPNA 5A9RA 3FHLA 3VR2D 1DCFA 2NZ8A 3SMVA 4GECA 3BUSA 3O4JA 2HLDG 1HEIA 1X94A 3GNTA 3MHPA 5FPQA 1NU1H 3NW9A 3ACDA 1E66A 5BWLA 4N0EA 1WHSA 1A2BA 1WOYA 5GY7A 3P32A 3Q8KA 2K9PA 2B78A 5G02A 1MUUA 5F2NA 1KC8H 2HIAA 2QVXX 2XLBA 3SZRA 1GZDA 5K0BA 3JQPA 1KVQA 4KX3A 2ALJA 2FWRA 1SCIA 5U4XA 1VXRA 1RFYA 2WWHA 4PZYA 2C2AA 5BNWA 3TGUH 4NH0A 4EG3A 3ABQB 1GPWB 2GWRA 3OFNA 4JROA 3PQ4A 5JNWA 2YUTA 3DO5A 2DHRA 2R2GA 1HKUA 4OIFA 4J1TA 3D8BA 4OY3A 3HA2A 3PQ8A 3SC2A 3FD5A 2XZDA 1Q14A 3O0TA 2EF0A 4Q02A 1U9JA 4ZANA 1JFTA 4BEWA 4WLOA 4CYMA 1H4SA 4L8LA 5HEKA 1VC2A 4PCLA 4RF4A 1O94D 3BE4A 4PCUA 4HDKA 3PC2A 2ZR8A 4Y9UA 3T95A 2AHRA 1NMSA 2EZOA 4G8JA 3LSSA 4ND8A 5EZSA 3RA6A 3P2IA 3RVJA 3UJ8A 4AJNA 1JI3A 3AJ9A 3HA3A 1M7BA 4C07A 3S3WA 3NHSA 4LZWA 3Q5EA 4UMEA 2A14A 1ISRA 5FL7A 3DULA 4LRTB 4TWIA 4O0MA 3MEQA 1L0LH 1C8VB 3DOJA 1J9EA 5K3BA 1SCJA 1AILA 4IMIB 4ZQCB 1XZGA 2AEEA 4FZ5A 4ALKA 2AUNA 3UMSA 2F9MA 1U81A 4FMCB 4MLCA 2QDKA 3EWIA 4AZ3B 1JTEA 3KOZA 1SUEA 4U8HA 1NLYA 2Q9AA 3B9QA 3GRAA 2GB4A 1WDKA 2N3ZA 1FUYB 4JV5B 5KNDD 2OZEA 3B48A 4E3ZA 1XMJA 2HLDA 5JWHA 1RS0A 2QTLA 1J06A 9GPBA 1P81A 4H9GA 4DK1A 2J09A 5D86A 3LCRA 4ZOLF 3TIIA 3E5HA 4HPWA 4MIOA 4CM6A 3I4CA 3BDVA 3W2HA 1BX3A 4K6HA 3LM8A 2X5NA 1OAOC 3J7TA 4REQB 1Z7BA 3HU5A 2YV4A 1XDZA 1Y6XA 3NATA 5GV8A 5E3IA 1UADA 1US8A 3SSOA 3OUFA 3QRWA 4R9SA 2F1MA 4DNPA 2AF3C 4HLQB 3CO0S 5LYJA 3DNPA 2IJJA 5DYYA 3O90A 3JVEA 4AVYA 5KSOA 4Z4FA 3GNQA 2E4YA 1XR3A 1WA8B 1K75A 4BN0A 1YIOA 3M83A 4P54A 2AS0A 3QI2A 3TPZA 1N2BA 1HNNA 5GVRA 3SJCA 1S9DA 4ZBMA 3E27A 3H86A 2JFWA 1HE8B 4MSWC 4BNDA 1FK8A 4D97A 3U49A 4KXWA 2YH2A 4CLOB 3VNQA 4JSRA 4BZZA 3LKDA 3PXEA 1ML3A 2BLLA 2DOSA 2HF9A 3OTQA 3VOBA 2ODNA 5J2TA 2R4TA 1ECJA 2VUUA 1TF7A 4RORA 4AP6A 3C3KA 2H6LA 1E2KA 2Q41A 1NUSA 5KSYA 3DXXA 3TFWA 4YIPA 3ZU4A 2C31A 5FPTA 1QK3A 5H9WA 1Y6FA 2VDWA 5B2ZA 1QDUA 2R8ZA 2FY8A 5LCXA 4TXHA 3LXXA 4C4PA 1CUBA 5FT9A 4ED9A 2Q27A 2M9MA 1RSZA 2MR6A 4B7KA 3WMGA 4GQBA 1ZGGA 4TWBA 4AJ9A 5EJFA 1DQRA 1DQYA 1U1GA 3A3PA 2H3HA 3DEIA 3DZJA 4NCNA 4UW9A 3ZCRA 4M60A 3QKIA 3B4SA 5IW8A 2WD7B 1Y6ZA 3P27A 1E9EA 2C4TA 4OLHA 1GGFA 1XVIA 1WNFA 4F38A 2ZK7A 1JTVA 4NBVA 4FNGA 1GTMA 2B98A 4BLOA 2A7WA 3K20A 5BURA 3CTPA 4QXQA 1UEXC 2OZBA 3S2SA 2YN0A 4IJQA 3SX0A 1NQTA 4JFAA 2WVHA 2YDYA 5BV7A 5DWQA 4JS0A 2WDPA 1DK1A 1L7NA 1EAYA 2PH1A 1F7UA 1TO1E 5BYBA 2DXIA 3GG2A 3I2KA 3B3AA 4OB7A 1KWGA 3IURA 3JD1A 4OMUA 1OZHA 4KQ9A 4O2BF 3FR8A 5GM2A 4MMYB 4A5OA 4IDFA 3OC0A 1IV2A 2NO5A 4UOQA 4D9IA 2PUVA 1PP4A 2QRVA 1DLBA 1IBLO 1J2UA 1PT7A 4R8VA 5BV0A 1DMRA 1YJWV 3RB8A 4CHGA 4ZALA 2FG7C 2ZDHA 3CUYA 1O4VA 4HBZA 3D43A 3D7SA 2J0EA 2Y1KA 1H7MA 1U9YA 3T1QA 4BX9A 1E4EB 3GGOA 2FI1A 3UC9A 1MPTA 1PXWA 3TDNA 3ZE7A 2CTPA 1P1KA 3DXZA 4B47A 3K59A 4L0QA 1M76A 1YGPA 4RBNA 2GD1O 4NBTA 3CMAV 1GZ3A 1A82A 3ROPA 4B2IA 4YJDA 4S24A 3K7EA 5FTJA 4AZ3A 3ELDA 1TF5A 1O5OA 3I0NA 5EJAA 5JECA 3KX2A 4BX2A 1A50B 2MYPA 3CCEF 1Z9BA 2PTHA 3IIJA 5H8WA 1CUXA 3ANNA 2Y4NA 5B3LA 1R3LC 2KSDA 5I7UA 5BO5A 4FDAA 4Q16A 3IBGA 1VIDA 2WWGA 1UMBB 5FEMA 4FQ7A 1MRZA 3NETA 4G2TA 2CBXA 5EB0A 5EERA 1TUEB 4RV5A 1NM5A 4YRZA 5J5VA 3OTHA 1TEZA 1H05A 1PK7A 1CUCA 1Q1QA 3Q9NA 4HQFA 5HDBB 3KJKA 2OCAA 4RF3A 2QF7A 2C03A 4BX0A 3SEFA 1HYHA 2O2ZA 4DBLC 3F6MA 5FWNA 2JRLA 2D59A 3KOWA 4YMLA 2ZTUA 4F5EA 1RI2A 5M3BA 1R7RA 3LPMA 3HA5A 4LZPA 4KXNA 1AU9A 1QFZA 4M8NE 3N27A 5JV5A 3TJTA 2JIOA 4Z2WA 4MWOA 2JEOA 1RC1A 4ZYLA 3QF7A 5AVSA 4Q4DA 3WISA 5LNK1 3W7WA 2EKPA 4AECA 1SQ6A 4ZZ0A 1Q1NA 3DVRX 3T2MA 2IBTA 3GFTA 4HOYA 5K09A 4CI9A 2FW8A 2VFAA 2MIIA 1HR0O 1EZJA 5IABA 2F8MA 3H5LA 2LBPA 2PTGA 3HVUA 1GVNB 1K4KA 1E7QA 1T9HA 3CISA 3WJQA 1X80B 4L3WA 1CQWA 1NSFA 3H5NA 5WRFA 1VHQA 1GN3A 4TLBA 4Y2GA 1CV2A 4OYLA 1YS6A 2R87A 4PR3A 3FCEA 2IEIA 3MQ4A 4Q3KA 1JXAA 2Y2UA 5JD5A 3K1ZA 1QZ3A 1ZHOA 3CD6F 2F6RA 3O85A 3I3FA 3TUIC 2IX9A 4NYIR 4D46A 3JQGB 4MVSA 3FMGA 4YP6A 2EEPA 1WU7A 1L5ZA 4R1TA 2Z56A 1RP7A 2WMYA 3C8HA 3IC5A 2A9RA 4G8CA 4MV5A 5EXTA 4J07A 1JNXX 2B61A 2QV7A 1VQOV 3THXA 2VJYA 4K9PA 5AK6A 1Y48E 1XWFA 5NULA 4DRZA 4JA0A 1F2UA 2ZRHA 1SKYB 1UBLS 4L16A 1ODLA 3ICWA 4QHSA 2ZS9A 3O1JC 3B5EA 1TJ5A 5CU7A 2QW0X 1P44A 4MW0A 4JYAB 3JAKB 3G8BA 3PE3A 4GEGA 4W5JA 1BEZA 3UHPA 3TZEA 2A9PA 4LZLA 2C94A 4TT3D 1U0JA 2MOKA 3R76A 5CEJA 2QT0A 4D9HA 3A70A 2DWUA 2HNBA 3ADDA 1RM5A 3GLTA 4HPJB 1AQYA 3BN3A 3QXHA 4Y2RA 5HFJA 2HMUA 5FTWA 1AVMA 4CKWA 3FPFA 4ZOCA 1HI9A 2C2MA 3NHRA 1ZWIC 3S02A 1H0HA 4ZGGA 3GIWA 3RK0A 4HTFB 2FA9A 3RRJA 1YKGA 3GLIB 4BU0A 2YXPX 5J23A 2V4UA 1V9SA 4P98A 4DLUA 3U9SA 5CW2A 5JBQA 3FM9A 2AXPA 4XWWA 3R7BA 1YDEA 3EA0A 2QX9A 4JOQA 1LVUA 4BPRA 4Z7JA 3KUCA 4RSGA 4Y6OA 3W9BA 2NM0A 3OFJA 4KO2S 4P93A 3BWYA 1K5HA 4FOOA 3QG5A 1GPNA 2QROA 4UC0A 4BT5A 3CNHA 3RC2A 4ZYXA 4QU0A 3I04M 5IMSA 4LIPD 1JMVA 1G5FA 4P30A 3MBOA 2C3PA 5FL3A 5D3ZA 3TGWA 3BHNA 3FD8A 2A06H 3UJ3X 2IUFA 4WQMA 4EB6B 1BVHA 4ES6A 1IB6A 1V6CA 2D00A 3FNEA 3M33A 2CW4A 1NH2D 1XL1A 2YC0A 3PLAC 3AR4A 3H7IA 1EK5A 2QZ4A 2XMQA 5JS6A 1R88A 2G70A 3FYIB 4I36A 4G26A 4N5IX 3JASB 3UMRA 4UVEA 3NEJA 3WYCA 1JDTA 1H9AA 5DNAA 2UZ1B 3LT5A 2HIMA 4NABA 4KITB 3VH1A 1E8DA 5KYWA 4LFAB 2QEXV 3IQWA 5BSWA 2AFVA 4E03A 4PRYA 4TQFA 3WGTA 3F5MA 2Q5HA 2P7HA 4FHGA 1EI9A 2EQAA 2VBGA 3OMLA 4Z0TA 1K6XA 4KYVA 2E49A 4OHWA 2QZ9A 4D4GA 5TSDA 3D1VA 5K4GA 2YOHA 1KI4A 3C7CB 2XA9A 2WVGA 1C9EA 2NSHA 2KI5A 1TVMA 5DU2A 2IIQA 2YVAA 2XOXA 4ZQIA 2NXJA 2QWQB 1Y7IA 4LSZA 5TE9A 1L0BA 2VDUE 2ZS7A 2XXJA 4V03A 5EMKA 3W90A 3KQLA 2RKBA 3UKMA 4QUIA 3FD6A 3HDQA 4CDNA 5HFNA 5IT9A 1K88A 3T7EA 3QF4A 3AR8A 1N77A 1O6ZA 5DXFA 4MPPA 2WSMA 1IUNA 3KKPA 2HXYA 3RDPA 3FUCA 2X8WA 1EXNA 3H5AA 2X1MA 1PS9A 2ZJYA 1V7CA 5CYPA 2E5LB 2VHJA 1YZUA 2X8BA 4YP5A 1Y3CE 1WNSA 3HGTA 2Z98A 2QL7A 3ESRA 2C4HA 1QGED 5I7FA 2VAXA 1RWXA 1MZFA 1E69A 5LOVB 4NKGB 4JLPA 4MB6A 4TXNA 4EDHA 1OCOC 4ZEVA 2IH3C 3MWGA 3HCWA 1N2IA 3IJ4A 2B4AA 10MHA 1Q3HA 2YQ4A 2OV4A 2O3UA 5GAPK 1BJTA 4JK3A 3IAM6 2P9ZA 1NYTA 3DDWA 4QU8A 4QO8A 4PA7A 3K6KA 4UNPA 3SQWA 3ZVRA 1O0BA 3FDZB 3JAKA 1Z29A 4RQFA 3ETQA 3WIBA 5G0WA 1R15A 2PZMA 3CRRA 3CXCF 3E1YA 3AI1A 1V8FA 4WX2B 4LXIA 4LSMA 1GM5A 1A97A 3A32A 3EJWA 2OV6A 5AW2A 4JYBA 1M8KA 4KXFB 3L4EA 3L6DA 5AJZA 4I4TB 4ZQEA 2CLCX 2UAGA 4X64B 2H63A 2FW6A 2PBZA 4S35A 4MIYA 3ZNOA 3LUKA 121PA 4MWSA 1OI4A 4CKCA 2ZJ6A 3ZZUA 1G1AA 2WF5A 1G63A 3RWOA 1YACA 4MW1A 2H85A 1R73A 3ZWNA 1VQ4F 5LDGA 4HTFA 2Y66A 2Y71A 5DN6D 2A1UA 1DADA 3WNCA 4ZN6A 1DT5A 4GLJA 5F9HA 1R6TA 2Q0AA 3GLFE 5F64A 1N2OA 3LSTA 4D7TA 3ELYA 1GN9A 1NXWA 4DUGA 1AHPA 3UPDA 2H2GA 5ADWA 5HTOA 2EJWA 1OHHG 4DR1O 4DIOA 1CUAA 1UQTA 3KD2A 4X71A 3TI7A 2WRZA 3BSSA 3M4JA 4OHYA 4UU7A 4PBSA 2ONCA 2XAJA 3W8FA 4WK0B 3FAVA 2Y67A 1CYEA 4EFDA 4NBRA 2YFHA 3IKTA 4B0OA 2PT7A 1ZXXA 4L73A 4EA8A 1DAIA 3ZVNA 4XPZA 1DO0A 5J40A 1WP9A 4OHFA 1KZ4A 1NF8A 1K8AW 1XYVA 3F0DA 2CNDA 3JWHA 3G89A 1LDYA 4EPXA 1LJLA 2FPPA 4LP8A 5J4YA 4AUNA 4D8VA 1F1JA 5CFMA 3O4RA 1THZA 5THXA 5LBUA 4K8RB 3C70A 2DHCA 3HFGA 1FMTA 3K4QA 1VF6C 3HCBA 4UNSA 4D26A 3WU2Z 3H65A 2A9HA 4X97A 1UOPA 5FI3A 2B33A 2CTRA 5B55A 4NENB 3P9KA 2LDBA 1G66A 2OVBA 2XOKD 3ZLUA 1DAHA 2CMKA 2GN2A 3LF2A 3B3GA 4GT1A 3KSAC 1WNTA 3L07A 1NVFA 4M0KA 3TINA 1MBZA 4RFSA 1YR9A 4ZZ1A 4I3FA 4WZBB 4BLQA 3GN1A 1EM1A 1ORHA 4RHAA 3RUDA 3NIGB 5EPOA 2XUQA 1YHNA 5CXUA 2GESA 1JQDA 5DLQC 1H2SB 4HRYA 4GKJO 3DMDA 2V6BA 3HDHA 2JGRA 4IIVA 2WWWA 2A0KA 4GG1A 1YB5A 2YYYA 1IIBA 3OX4A 4ZTBA 3L8MA 4I1IA 2CZQA 1N2HA 1V55C 3I1JA 3RNLA 5EHZA 1MTZA 2WD9A 4UJ5A 1HLFA 1OHHA 5IVDA 5LLTA 3PNPA 4F84A 1W75A 1MC8A 2RAPA 4QDZA 4MMXB 3V48A 1VB3A 3AF5A 1IHXA 5KOYA 3K3PA 1FX1A 4OMFG 4XDZA 4FYKA 3DKRA 1L7PA 1N2ZA 4ZU3A 2Q1UA 3N2LA 3PJSK 1XA4A 3D6UA 4IDBA 2X77A 2AZXA 3E7FA 1DEXA 3OAAG 1EWVA 3IUEA 3E86A 1RM0A 3C3XA 4Q1BA 2R62A 2FMFA 1N1DA 4MYHA 1T0BA 4BT2A 1X3SA 2RHGB 3QV1A 5ALEA 3GGSA 2A0UA 4FYWA 4M0UA 4E5YA 4MVUA 1XU7A 3RS9A 3WLEA 1OJLA 3V2UA 1RIIA 3PENA 5DK6A 2QLLA 5AM1A 3CCRF 1RBYA 1WW3A 2BOVA 2XNJA 3MAGA 3SHFA 4UUOA 3UYKA 4EHJA 1XMIA 3AEXA 2J59A 1Q7BA 2RMKA 2CVFA 3NV7A 1QIMA 4FFMA 4ZVVA 3DFMA 2RGUA 1VJRA 5FUQA 3O8DA 1QMGA 1SXJA 1YBVA 1X70A 2PBFA 4MP3A 1EG7A 3W3AH 3TXYA 4HRVA 4N9QA 3D1LA 5C7IO 4F9TA 4EY5A 3K5MA 1EMDA 1IL0A 4XE5A 2ODBA 1VJGA 1C4XA 3HBAA 4CIYA 4JL6A 1JPJA 2P2NA 3V4ZA 3B8EA 4MW2A 4LGYA 1B74A 3FTEA 1ZVVA 1Z22A 4PWYA 4ZYVA 2CXUA 1T3ZA 5HX7A 3EORA 4XVQA 3TB4A 3DLCA 1EUCB 1MNAA 5KPJA 4LJ6A 2HO4A 3N0TA 3P9IA 4ZI7B 3BB3A 3OQ6A 3BMQA 3MDSA 3O9MA 1DEHA 2NYAA 4JLKA 3CIOA 2X2PA 2XGOA 4R51A 4RYDA 5GONA 3FHCB 3HCAA 2XYGA 1UBOS 2O7VA 1QQAA 2IS2A 2VDJA 3B1FA 2REOA 2R66A 3UFXB 4XM1A 3DEHA 3VM6A 2PU5A 5T3YA 2Z8ZA 4IYJA 4F4DA 3WTCA 5KKNB 3UW3A 4C0SA 1M2NA 4X8HA 1SQSA 3PFWO 3BXHA 1WZUA 1KI3A 5KU1A 2GCOA 4WLNA 2VVTA 3WKBA 4BIUA 3M81A 4H7DA 4ABYA 1WN7A 4N0PA 1G2IA 1CULC 3OAAA 4Z1MG 4IUYA 1QAQA 2AMLA 3HP1A 2VF4X 1H22A 2VLBA 1L0NH 4ZV4A 3CT4A 2D3OW 2Q4BA 3D6JA 3LHSA 2ZIGA 3ZDZB 1I2AA 4DAOA 3CX7A 4INOA 4P32A 1T5TA 2I55A 4TS3A 3ENWA 3QLVC 3S1AB 3JYPA 3GJSA 4CJXA 3AIOA 1E3IA 2OTCA 4CF5A 3WLTA 3JWGA 1QBGA 1KO1A 1TW3A 2WSSG 5H59A 2GO1A 1T2FA 4L5YA 5G0UA 4WLFA 2JEZA 1P4GA 3W6NA 4YRJA 5HM6A 2O0HA 2AEFA 3Q1KA 4DA9A 2JKVA 1DG9A 5HP4A 1EN5A 2O06A 4D81A 4FKMA 1YJ9F 1EXMA 2OYCA 3P9QA 4IR7A 4KXQA 3HP7A 3TWOA 1ZL8B 4LF9O 3H84A 4Y2SA 3PI7A 2OXTA 1SC4A 2ADOA 2FQQA 1P2UA 4LFCO 2R60A 2VLIA 1CEYA 5FOUA 1SU7A 2G0NA 4IAOA 4NPAA 3H5RA 1P3DA 3EA5A 1QM5A 2V7BA 1FSFA 4EQ6B 1WUKS 2R8OA 4HWKA 5DBHX 2BGRA 1JN0A 3OZUA 1BA3A 3VPGA 1WBJB 4JWTA 1UPBA 3QEMA 4YCDA 3U81A 1R0ZA 1NFQA 1RR6A 2JI9A 3O83A 1J4AA 3QPUA 2A0WA 4W5NA 3F7MA 4IX9A 1YJ5A 3TTWA 4EKWA 3WGNA 1TLLA 3CNBA 1WDTA 1SRRA 4JBHA 3HXKA 3L40A 1T29A 3DLHA 2WA2A 2DJ5A 3F98A 4R50A 2BF7A 4W1QA 3ZTTA 2WY2D 1MHPA 3BDAA 3TGPA 1KEVA 2JPDA 2BFDA 4OLFA 3GP8A 2V8BA 2F95B 1O96B 3MD0A 6GPBA 5G4LA 5C4GB 2VGNA 3NGLA 5FH9A 3RS0A 3DMYA 1UBCA 3LSUA 4EHIA 3R9WA 1XOIA 4EJSC 3DE6X 2YW2A 3ZQJA 2YOFA 4OXNA 2RGGA 3HL4A 3HCPA 4KQ2A 2OHOA 4TM7A 1OPRA 1PZEA 3TCUA 1LRLA 5CB4B 3HJNA 3NYWA 1KK3A 3JS5A 4CT4B 2WSSA 2JJ1G 3RAFC 5JVDF 3AP3A 1QVAA 1W2BU 4X62O 2EYQA 3W2IA 4AJHA 1KI9A 4RAOA 3OCXA 3TTSA 3HR4A 1ADCA 2I2DA 4LY9A 3FR7A 3PX7A 2CLFB 2Z2IA 2QTZA 3BK1A 5KJFA 5DYNA 1UBFA 1JZTA 1KF0A 2RN9A 1G8MA 4AKTA 3DO6A 3W0LB 5IJAA 1VIBA 1RPZA 4B3CA 1WQ3A 5FWXA 4FLTA 2A1TR 4J1TC 5KHAA 2CVPA 2O8DA 2XQKA 2YS6A 1CRPA 3CCSF 2I62A 3HADA 3AFOA 2QUJA 1EUCA 3UXEA 2ZU0C 4ZI7A 4FLXA 4GYKA 1PFWA 3LW7A 2PH3A 3LGSA 1YMUA 5FWYB 1Y3BE 4BV2A 1JFFA 3UWDA 4JB0A 1MP0A 2X9QA 1T5OA 4UM9D 3ZWKA 2PA3A 1DBWA 4R2HA 3FWKA 1T36B 3DUFA 2ZWIA 3ON5A 3OQHA 4J94A 3K2EA 1S2IA 3FUTA 1QGUA 5J4VA 1NUAA 3WB1A 1J7KA 4MCAA 1RQNA 4QPNA 3TZLA 4P82A 2HT6A 3H17A 4TWKA 4K9QA 2H07A 1A5SB 2APJA 4AUEA 3RYIB 3A1WA 4MUGA 2XTJA 4IXNA 2VA8A 1UFIA 3W1EA 3QUBA 1GQ2A 3P9XA 1NY6A 4YCBA 3L5OA 1EFUA 4OGLA 1DDOA 4IIFA 2OHVA 3NGMA 4NZOA 3D7LA 1QDEA 4UM8B 5A0FA 3L7AA 5AW3A 1I4TD 3H1TA 4X65O 1EUZA 3KLBA 3NPAA 3GUCA 5CA0F 4NICA 2IELA 3AFHA 4TYMA 2IQ5A 3LFUA 3AFMA 3R3SA 2I87A 1GL9B 3N9IA 4Y6PA 2H7VA 4PC7A 1QO0D 5KSZA 4PINA 2JJ1A 2UYKA 1J1UA 1D09A 2ZIWB 3SDBA 4EGCB 3FTCA 4WBNB 2RCNA 3IIEA 3OIDA 5FPSA 4O4LB 5BN3B 1SD5A 3MWEB 2IU0A 5BSFA 3UAYA 1ZL8A 3RJ5A 5M04A 1T5IA 3VKWA 3EYWA 1SN7A 2BHTA 2B83A 2WIFA 1H47A 2QX7A 1B8OA 3RR2A 1CNEA 1GCGA 3K0GA 3AUTA 4YRLA 1G7CA 4YUZA 1C9NA 4QOSA 2VF7A 4EQ6A 3AHDA 3M6LA 4RPKA 1P1IA 2WWIA 2PI5A 3ZDRA 4KLRA 3FWNA 2PPLA 3OJXA 4ZVLA 5MFZA 4FMDF 9MHTA 3WFJA 4N7MA 3CC2F 2F3PA 1G5QA 4J90A 2VR1A 1FJHA 2B92A 3VU8A 4LHSA 3ROQA 2OFOA 5G4VC 2ZB8A 2G88A 1Q1AA 3SJCC 1UMDB 2QYTA 1QRTA 2V7QG 5KTKA 3ICQB 3K03A 1BE6A 4RKQA 4CETA 3W3AA 4ML3A 4LC0A 3E9CA 2E18A 3ZV6A 1X9GA 1QPZA 2JBWA 1KYXA 3EQZA 2LCAA 1IFXA 4DV2O 3TKYA 1NT4A 4NP6A 4U1RA 7MHTA 1QLHA 5D51S 3KZXA 4X3MA 1KYYA 1NVBA 2G5GX 1VSUA 2M1ZA 5IDWA 1O96A 3Q5DA 3HKCB 4RMJA 4BTEA 1U40A 2J6IA 3OE5A 4ZHQF 4EJSB 2O0KA 1F06A 1KD1H 2AD5A 1LK7A 1Q0HA 1E2PA 5JT1A 3EGEA 3AUFA 4QLAA 2FPSA 5FI1B 4QJFB 3ZH9B 2YNMD 3JTEA 5DIFA 3NORA 3TOVA 1FPMA 4BVLA 721PA 2C7RA 1G1MA 4OXYA 1C9JA 1V95A 1WHSB 1RPOA 2G5TA 2OTLF 5CB4A 4Q3BA 3NVKI 4J1QA 1XU9A 3IQHX 3GFPA 4IJVA 5C4IA 4JZYA 1BMFG 1MA0A 2RAVA 2CD9A 3EDRA 3L7MA 4TTAA 2OZPA 4QZVA 1NU8A 3OJLA 1U0SY 2HCBA 1XTTA 1G291 1IJEA 1DJNA 3WQSB 3KCXA 1E1RD 1GILA 4PN3A 4NL4H 3IR9A 1NXSA 1ZIXA 2E7ZA 1M1XB 1TEVA 5K3DA 5JZOA 2BVNA 4AKEA 5CVEA 4IJKA 3HGMA 4I55F 5CDHA 3DL2A 2Q5CA 4EYSA 3SC2B 4U7FA 4IUCS 2DUMA 3NUGA 2Q6OA 4Q21A 4BGVA 1QE3A 1NVXQ 2OT5A 1FMCA 3INNA 3U7EB 1LW6E 3P52A 4UBOA 2OXCA 5HE8A 4HDKB 5J9PC 1XREA 3B40A 2QIPA 5E1BA 5FWYA 4UEWA 2IYFA 2XJ9A 1FDIA 4ND8B 3AQIA 1QQCA 3DT8A 3BA9A 2V7QA 1QIHA 1IMJA 1B41A 2GRUA 3BE6A 4LI3X 3WTBA 1U97A 4ATNA 4IH1A 4KLNA 4M3NA 1XTBA 3WGLA 1KP9A 3BRQA 3CUKA 1N7JA 2DWPA 4GOJA 2OXRA 4Y9DA 4W9NA 4DG5A 1C5KA 4CIBA 4D42A 1G7SA 5LXTF 4NCXA 1R50A 4JYYA 1Q0QA 2Q3BA 4BN4A 3TECE 4GO1A 4EGAA 4I66A 1CJSA 1LNSA 4CLXA 3QLVA 2A67A 2J9FA 1L5YA 4JVMA 3VNRA 1JJBA 2EJTA 3O8RA 2N1BA 3DS8A 4L6IA 5I7HA 2QM7A 4WPGA 4IYRA 1AA6A 3EZ7A 3KETA 3ZJUA 2CFTA 3MGGA 1SVIA 5F2OA 2IYOA 1VJ0A 4ANFA 3NMUC 1Q84A 1Q20A 1XMOB 2V59A 2YBDA 4ZJUA 1V5GA 4CTOA 4B74A 1GAWA 3HDVA 2QLBA 3DEKA 1NM5C 1V8BA 3S99A 1QANA 4NWOB 4RJJA 2B1QA 1BMFA 3U19A 4FCVA 3NVIB 2D5BA 5KTRA 2C78A 3ZEIA 3VKGA 1K7DA 4O4LA 3MPUA 3ROMA 1NBEA 4ZI5A 3MWEA 2Q3HA 3C85A 4FB4A 3I45A 1ZIPA 1I30A 2MK3A 3LXMA 3X43A 2NYUA 1IXSB 1DKRA 1KKDA 4MW5A 1ICIA 2G08A 4QVGA 4AJLA 4ENWA 1VMGA 3D2BA 4ND5A 4MVQA 1JVBA 2CDCA 2XUFA 3DZFA 1WA5A 5LYJB 3LPAA 4KTVE 2E4WA 2C77A 4BE7B 1XL4A 3IGFA 2VGMA 2UUCB 2PKRA 1XVUA 2B8WA 4PVCA 3MJFA 1TJNA 3PHLA 4UNRA 1QJ4A 4RHUA 1LF0A 3EGXB 4D82A 1ZQ9A 3L77A 2OWOA 1OXXK 3Q41A 2ZRMA 4NOMA 4KHPO 4HDOB 1N5OX 5HJ7A 5DYIA 1YNSA 2PE5A 1I5EA 4NFSA 1PQ4A 2PRIA 1F5NA 1UKCA 2WIJA 2CVHA 4E07A 2FRXA 2O8FB 5J2TB 4BNVA 2H1OA 1N3LA 3KCNA 2GBFA 4LWQA 3OZDA 3E0XA 2L69A 2CFOA 1YJXA 2XOEA 1Z5WA 3IB3A 2AQHA 4MYUA 1Z6YA 3WMEA 2P5YA 1Q1BA 3BXOA 3NYRA 2BT4A 4RLQA 3H6HA 3GU3A 2ZS8A 1GDDA 3TIGA 3HUFA 5I7SA 3NVDA 1QHXA 4HFJA 1XVLA 3EIEA 3DAPA 1Q7CA 2B9ZA 4RF2A 4DHEA 4LOJA 4QBFA 4DLYA 4HGQA 3SVLA 3MJCA 5ED4A 3GXBA 4PYMA 2FP3A 5T8KA 2Z1EA 2GI4A 1W4RA 5AKKA 3OF3A 5CVVA 2Q45A 1N0NA 5DECA 3B82A 3ZVKA 4RHFA 1VRWA 2W6PA 4R4JA 2BFOA 5CXQA 3H7AA 1QG2A 3HJUA 3FB4A 1UPXA 4JP5A 2G1UA 2GDZA 4LZZA 3K5WA 1JT2A 4BO2A 4WUVA 1D7OA 3KE9A 2W00A 5TR9A 3KALA 3UJHA 5EVJA 4NCBA 4RDIA 1GLNA 2WJ4A 1QH9A 2A94A 2O19A 3UB4A 2Q7DA 2RGYA 3BD8A 5C34B 1MC4A 3NBXX 2QRVB 3CJTA 4KPFC 3VSDA 5I3CA 2LGQA 4O63O 4CH4A 1P72A 3AI7A 3N6XA 3H2GA 5DE3A 3H5OA 3FB8C 4NIMA 2YWEA 1DAMA 2FZKA 2IA5A 2ZI6A 4M9UA 3W05A 3ZEAA 5AVYA 2V9CA 1J6UA 3KWLA 5GIOE 4GSKA 4FEAA 1OIVA 3AEUA 4KACA 1P4HA 4AG3A 3CCVV 3VI6A 2JLXA 2D54A 2C4MA 1YKSA 4UVHA 3BXPA 3ZIAG 4I9NA 3BWDD 1SXIA 3B7GA 3CPJB 4BE4A 3VBBA 1SHLA 4Z4GA 5AI6A 4E5KA 5CNKA 3AGQA 1IH8A 5J59A 4BFWA 1G8KA 3RF7A 3Q3GE 2C5EA 4ZO7A 3NTUA 3B85A 4D1YA 3ZBHA 2B0JA 2Y0CA 5CAEA 3NX4A 5K6TA 2H7XA 4QFMA 1JX6A 4XJSA 2GJAA 4DCTA 5F3WB 4WY2A 4HEJA 3U0VA 3FGZA 2WG1A 1GRQA 1IEXA 3RFFA 3WSWA 5JFTA 2CSUA 3AG1C 4L1KA 4E32A 3KPJA 4QUJA 4GNRA 4F3NA 3BY6A 3EDCA 5FXMA 2EATA 4Z3OA 4RH3A 2BFWA 3WIEA 2RIPA 5AK0A 5EIWA 3N0WA 1G21B 2HR3A 2O5CA 1UZMA 3WPXA 1COZA 1JYEA 3W4JA 1LLUA 4PZAA 5LR6A 2XUMA 4RTLA 5BR8B 2OY0A 4RY0A 3VNSA 3TAXA 3TO5A 5E4TA 3OX3A 4BQRA 1VCIA 2BDUA 5DNUA 2I6FA 3FOBA 3JQ8A 4IIJF 3J81N 4LY3A 1KJIA 3AVPA 4E4TA 2ECFA 4D0NA 3VRHA 1SM4A 1Y3FE 4GI7A 4CKZA 1OXTA 3EGXA 3U5ZB 4GI5A 4E1AA 4CQMD 2DSNA 3UJBA 2ONYA 1P7YA 3T4DA 1K2VN 3T4EA 3HKBA 3A6JA 3AHHA 1SZDA 4JAUA 3PCRB 4CM9A 1L7XA 4WKBA 2WVJA 4P0PB 1FNCA 3L0YA 4DJ5X 4ZPJA 2EYUA 4UOEA 5B8FA 5GZ6A 1R6VA 4ID9A 4R05A 1D2AA 5ESRA 4CC5A 3VZDA 2O8FA 2A88A 3UAGA 3TLCA 3FH0A 1E2FA 1G4HA 2P69A 2VZ9A 4PGMA 3ZIAA 2J5QA 3TTYA 4D44A 1IYZA 4BJHB 1IDN1 1CIPA 2I3DA 1Y3IA 5JS7A 4JJEA 1Z18A 1QWOA 1NN3A 1F7YA 1ENZA 1ZMRA 3SYTA 4UU1A 4HHEA 4AMYA 5HOEA 4U2KA 3J81k 2I4LA 1UJCA 2IP2A 4NEGA 2I7XA 2HM7A 3EQ7A 3THXB 3OTFA 2NO4A 1DC7A 2GZDA 1F2UB 4KL1A 3NDJA 3VI4B 1NBHA 4GGPA 4QLOA 3SQDA 2HDOA 2ENUA 1UZLA 2WV7A 3A2NA 3GPCA 1E0AA 4II2A 1W581 3H6KA 3CNEA 2BRUC 4RULA 4UHKA 3C39A 1KVTA 4C7VA 4KPEC 4H3VA 4AILC 3L01A 4D79A 1VK3A 4H0LB 4GIBA 4I7ZB 2XRYA 1SBHA 4QDOA 2I54A 1KY3A 4LS3A 3M70A 2GHQA 1C0KA 4MP6A 1BKDR 3WK9A 1TO2E 4AUMA 2WM8A 4IYIA 2Q4TA 4TQUS 1ZINA 4DR4O 4IMRA 2RH4A 4EGQA 4AIRA 3L73H 4DIFA 3FOCA 1PX0A 1UFRA 2OB1A 4V3BA 4CKWB 3GRRA 2BGLA 2AFHE 1NVTA 5LIPA 2W11A 1ZVMA 3TQSA 1QV9A 2ROQA 1X87A 4CFSA 1OUMA 3E20B 1LC0A 2QRZA 3OJCA 3NB0A 4E11A 1E62A 3GA7A 2F9ZC 2HMYB 5TQJA 4HGZA 1ZD5A 4EL5A 2FOLA 3Q3IA 3NC1C 4PPGA 2OL4A 1U0GA 5KA5A 3PXBA 2CXOA 2FN7A 3AUSA 3E05A 4BQNA 4CIXA 4PZUA 3W7AA 5PGMA 2KG7B 4OXKA 3ZXXA 2G3YA 3S2UA 1KKCA 1L4LA 1H2FA 3G7UA 3GY0A 1DUVG 4B08A 5F76A 2PUEA 3HUUA 3DVQX 5LUAA 1NWHA 4Q7KA 1KERA 2POQX 4ENQA 1GG9A 4RO0A 4PLGA 3PK0A 3N0RA 1Q0UA 2Y4UA 2ZD9A 4HAXA 5AI5A 3I5DA 3CFYA 2O4CA 4F4IA 4KBFA 1Z33A 1CF4A 2ZUCA 3VQWA 3ONNA 4ZRDA 3I92A 3ZHQA 3ITDA 1J8DA 2WK1A 1TM7E 3DF9A 1IX9A 3GEEA 4TRJA 2DPHA 3JQ7A 2Q07A 4QICA 2ZKLA 3QVGB 3AG1B 5JRJA 2WJHA 4DG9A 5L4LA 2I7VA 5KYWB 4AZSA 3NFRA 3IVXA 3ZE1B 1T8PA 2D0OB 1JJFA 3S03A 3QWFA 1OCEA 1OWNA 4GLXA 2BGGA 1PR6A 3OQVA 5THKA 2CXRA 1UBHS 2PMPA 4WFFA 1G21A 1X7DA 1U2RA 3LLVA 3UQZA 4C2UA 1BE3H 2FP4A 2M6KA 4IHKA 5BN5B 3LX5A 2C3YA 1P0QA 1FTNA 4J3NA 4QUAA 4ZHVA 4B6JA 2ZIMA 1X1SA 4HGRA 3BULA 2VATA 4Y30A 1WZ2A 1J5PA 1KQSF 3HNRA 4QPZA 4FLZA 2JRCA 3KKMA 3B8HA 5JXWA 2FEPA 1SH7A 3C24A 2JDIG 1F0PA 4DRXA 1QQ5A 3O3CA 1QVGF 4J80A 3ONVA 2HGZA 1P6XA 1NF9A 2A33A 3ED5A 3L70H 4QBHA 3SFZA 2P5SA 2WB4A 5JH7A 5AI0A 3QF4B 5EOVA 3O6VA 4B32A 2IYNA 5I9BA 3PEYA 4RD0A 3GLHE 4M9ZA 4JLJA 4DJJA 4WN3A 3FKSD 3CE2A 3DP9A 3SBXA 5LU9A 3DEZA 1DQNA 3AO0B 3T1VA 1O6GA 2CJWA 4K9DA 1ILEA 4LV6A 4MGEA 5HY4A 3Q11A 4ACBA 2Q5QA 4JVOA 5KCMA 1XF1A 3L41A 5DSXA 2CDAA 1XC7A 2DZDA 4B6RA 2O3JA 2PSFA 4K26A 3N2EA 5EKUA 1N6IA 5K8UA 5ELMA 3VTZA 2ZJ0A 4W4KA 3EXFA 1XZLA 4RWEA 4G0OA 1EKXA 1FVFA 2O8CA 3WFVA 1H2ZA 4KK3A 5JJLA 1GTSA 5FO0A 3H1AA 1U0RA 4U7JA 2O05A 2WJJA 3K9CA 2ZB7A 1BJKA 4WFGA 3L7JA 1KAEA 1DKQA 2EFDB 2LBWA 4H7IA 1OI7A 3GJZA 3OZGA 2YSUB 4LK2A 3KOMA 4HEA1 2QMQA 4RPHA 5B6PA 5DH9A 4X1OA 1VL5A 3CCUF 4OSPA 5IF3A 4GYCB 3K6SB 3ISTA 2GCEA 1K5DA 3FIJA 4F4CA 2C2OA 1IV1A 4OGFA 2Q0XA 4NBLA 2QVBA 1X52A 2H16A 4OGQB 2E85A 4JZ2A 1T5LA 2GPNA 1XNRO 4DBVO 1WF3A 1OAAA 3V5NA 4UCWA 1SEVA 3D8SA 4MQ5A 4JB2A 1IXZA 4HJXA 1SXJC 2H00A 1VLHA 2G7ZA 3ITKA 4BP1A 4NDAA 2HSEA 2IZOA 1J2TA 2HRCA 2QRPA 1QAOA 2D3TA 3BXXA 1Y4SA 4CKCB 4GUAA 2GZMA 2HAEA 2QTBA 3QHDA 3WL8A 4RZ2A 3O9ZA 4XH9B 3JPYA 2GLUA 4ZVPA 1A96A 4D3FA 2JDIA 3KKEA 3RS8A 5KOIA 3O8QA 3AJAA 4BP8A 4ZCIA 2A1UB 4ZRNA 3T0GA 2NTYC 4P3NA 2WTMA 1AXEA 1N7IA 3WV5A 3AVXA 4PWTA 2VQFB 3K16A 1BD4A 1OWLA 4B3HA 5DHPA 2JCXA 5FULA 1GU1A 4MEBA 3O84A 1E2NA 4WOJA 2ZDGA 1JMYA 4J0KA 4M0FA 2EJVA 2VK2A 4NNPA 3X1XA 1Q22A 4AL4A 4FHDA 3IMEA 2KG7A 3OJOA 3PF9A 3L02A 3FAVB 4ONEA 5DCUA 1YDWA 1BHBA 1QYVA 1AKVA 5MF6A 1MORA 5C4MA 3F90A 1BCCH 4X41A 4ZU1X 3QVMA 5HY1A 2PQMA 4RA9B 1N4AA 1U2SA 2FWIA 4PTZA 4W5TA 1HNZB 1JIJA 3F67A 4FMCF 2W2MA 1I3NA 3DYIA 2FPPB 5HIAA 3AR3A 1DU4A 3QWIA 3OEEG 2DVMA 2QUZA 4JAAA 2D2VA 5B2FA 1NQOA 4P38A 2HJHA 3VYWA 2F67A 3GFRA 5DX0A 1N5RA 3D4IA 1V41E 2IZZA 1K6JA 2VSQA 1E0SA 4FZRA 2X23A 2ZWOA 3QVGA 1U3TA 1B7GO 1QQ7A 3Q7SA 1NZ6A 3JAWB 1YS9A 4AY3A 3DYVA 4JI3B 4I4NA 2PT9A 4RNCA 3QJGA 1II8A 3DCYA 3NMUF 4II7A 1GRVA 4LZJA 2WHEA 1KQFA 3H2SA 3NV9A 3VUFA 3C6BA 1PL0A 3WY9A 2E4ZA 5BN5A 2W2XA 2Q99A 3JYHA 5HQTA 1JEOA 3F8SA 2QEQA 4G4WA 2C95A 5ELXA 4RFSB 4DCOA 5JZ9A 4J0DA 2FUG6 4PFQA 2W22A 1ECGA 4Q9AA 4O08A 1QG0A 3DKIA 3BYZA 1BQEA 2GPWA 5AH0A 2HPAA 4JEHA 1M1UA 3U4MA 4XFDA 2AFIA 2WSIA 4KGXA 1SBYA 1NZJA 2NN3C 3KJQA 2CEAA 4BNLA 3SHWA 3SYMA 1E2HA 1LUVA 2ATEA 3EZYA 4R2MA 3TCNA 3ZY4A 5HY0A 4ZV7A 3M4NA 1VBFA 1JLMA 3F97A 4XQ9A 4ESVA 2JLVA 4D6YA 1GFSA 1H94A 5JZBA 3U6BA 1L7AA 3DSQA 3ZUPA 4B4DA 4IGKA 3JCUZ 4HAVA 2XWPA 2ZW9A 1ZJYA 4YP1A 2QJRA 4CF4A 1H2WA 3FZYA 4MQEB 2XBUA 1ZRHA 4DCNA 1E6UA 1BXRA 3TLJA 1T1IA 1ZMBA 1ZCZA 5K3SA 4ZAXA 1FUIA 3BCCH 4IH9A 1ZJJA 1OBCA 4E3WA 4MRMA 4DEYA 1P7WA 5E6SA 2NV0A 1Z0AA 2BCEA 1JH8A 2ONKA 2A4KA 3AFNA 4MUXA 3WGYA 2YFKA 4EHAA 4I08A 2E21A 2WPDD 1NJ5A 4FGKA 1JA1A 4ZVRA 1JJ7A 4YRAA 4MUYA 3OEEA 4I5IA 4PR0A 3IP1A 3TS1A 3UHOA 3A1NA 3PEFA 4MSUA 2BRUA 3R3JA 1BDMA 2BI8A 4D4MA 1T9ZA 3K6SA 1BHQ1 3AM5A 2PZ8A 1DWUA 1KEPA 3PNOA 3LBNA 4KLCA 1RWWA 2CL7X 4U7TB 2RMKB 3RSCA 1KSJA 3ONEA 4LPSA 1ZKDA 2MU1A 3GF4A 3AR9A 4KNVA 1P0MA 3CLRD 4NMWA 3FUXA 2FF7A 3EIWA 1SXJB 4RELA 2P2CA 1ZZEA 3ZCPA 2WA1A 3QHPA 3O74A 5KI6A 5LHGA 3TXXA 1Y5RA 1KORA 3NIBA 3KB8A 5BSVA 4TZTA 5K6RA 2IKSA 5FUYA 2VEOA 2YYSA 3LH5A 4PC2A 4NJMA 2HWKA 1JJIA 4MUJA 3U4GA 4LRWA 5KAPA 4GCZA 4D9BA 1WV0A 1U3UA 4X63A 4N21A 2PJDA 1BEUB 4RL6A 3BMQB 3TH5A 2A78A 3C6ZA 1IBSA 4C04A 3L7QA 3K3WA 3HV0A 3RT1A 2XAFA 4OHOA 4FQ5A 5GONB 1JPUA 4PFJA 4FX5A 1CUVA 1KBZA 2QM0A 2VZEA 3A1EA 2AN4A 3CR7A 4U3FH 3SFTA 1RNLA 1RQLA 3HI4A 2D1SA 1PVOA 3BMOA 2FV8A 3TNJA 3FOWA 4X7MA 1Z7YA 3G8YA 4YECA 3UVEA 2D0DA 2JIZG 2GCOB 5C53B 1UBNA 4E5SA 3K08A 4RA9A 4ZARA 4RDCA 3RAPR 3FAKA 4WCEV 3WYAA 3QEAZ 2X76A 4I50A 3QBJA 2RH5A 1GK9A 4FINA 2PS3A 3I5AA 1N2GA 3H4MA 2VPIA 3UV6A 1A27A 2A0YA 4RMNA 1HDGO 4IJUA 1LLFA 3ZQ6A 3EUEA 1NJIW 2EP5A 4M0EA 2H17A 1L5KA 1EP1B 4YAUA 3JAWA 3ZGVA 3RJMA 1IY2A 2J6CA 4FGLA 3QVLA 1EZVH 1FXVA 4BVSA 2OCXA 4XW2A 2HA4A 3PFBA 1PGPA 2CEKA 1MW8X 1X0XA 2NQTA 3EZGA 3H83A 3SP1A 1IPEA 4R31A 2UXNA 2C4VA 1KBOA 3NAZA 5BSMA 4Z6KA 1NYQA 4F04A 1AURA 4B71A 1KDRA 2AJBA 4BJ1A 4B8YA 4DC1A 2CVQA 3B1KA 4FHEA 1P4SA 2X5OA 3BVOA 1X19A 1AJEA 4M76B 3H1PA 4LOHA 1Y67A 3Q8LA 1TIKA 2OIGA 3LWOC 5E4YA 3MC1A 1N5MA 4HH0A 3WMWA 3DOFA 1G6Q1 1Y7LA 5E1MA 2O6HA 1SIUA 1WKBA 4EM6A 3QEMB 1XQ8A 2VH5R 5B3KA 4PZEA 3CCFA 5AJVB 2KW5A 4B09A 3FZEA 1RTTA 4MVZA 4I3HA 1E18A 4ZXPA 2LBTA 1B6TA 4DVGA 1V1JA 5L3VA 4RVUA 2Q6AA 1NVAA 5JMPA 4LQLA 2RAUA 3VNAA 4QGGA 3IBYA 2YYAA 2DW4A 1IK4A 4WZAA 1AP5A 1SUIA 2I4RA 1XG5A 1XX6A 4MQEA 1DEOA 4LF7O 3HU2A 1X9HA 3F5QA 4LF4O 4G36A 4ENUA 2OXFA 2BFDB 1XTUA 2GH1A 1M1YE 1EE9A 2JIZA 5CDTA 4B6OA 5L3BA 2ZRKA 3MGCA 2JGNA 4JXXA 4NTYA 3FAZA 3EHBB 2IY7A 4O8ZA 4MRPA 3TQOA 3VPBA 4GGMX 1RRCA 4HWGA 2WJPA 1R1BA 3I62A 3EF3A 5FV7A 5TQVA 1YK1A 3FG9A 1OXBB 1GTVA 1MEJA 1M72A 4CW7A 4XWOA 4G5RA 2WQ6A 4JSYA 1EEHA 4QRDA 1G3RA 2QYOA 1ZNQO 5TVKA 3PEVA 2NAFA 4WWHA 4YWJA 1BRTA 4S1WA 2ZTVA 2CXHA 1QGDA 5K9ZA 3OHPA 1WXFA 3C7AA 4LV8B 3E2MA 2X0JA 4GDMA 1JQ0A 4O4JB 5ALWA 5DHQA 1X3LA 3CP1A 3LGAA 1F3OA 2ZIVB 4OQMA 4ESEA 1MEOA 1EA7A 5AW7A 3ZKWB 4MKXA 5KTMA 5A6SA 4WACA 2IODA 4HUJA 3NHZA 3M82A 2BM9A 3K0HA 5FWXB 3H16A 2PRKA 2CN1A 4R1UA 1TFRA 3M99B 2IYXA 2QXUA 4ND4A 4XUEA 1T6BY 2OC9A 3ZCUA 3IAAA 3N2ZB 2O8DB 1Q12A 4LCJA 4RDXA 2FXIA 3R66A 1CDEA 3KOXA 3MMNA 5HJEA 2GOYA 1XMSA 3KAPA 5AJXA 2PKQO 1DUIA 3E3LA 2C2WA 3KU1A 3EK2A 3K9LA 1D3AA 1GNRA 1RI1A 3BIXA 4RH1A 1JFFB 4G4JA 2R8PA 4PZLA 4E2LA 4J49A 1A8IA 1Y1RA 5KVAA 3DSRA 3S8EA 4KFMA 2C7PA 3DUFB 4HEHA 1VG0B 4Z0NA 3RROA 2VDLB 3EGOA 1QGUB 2WDZA 2BGJA 1KPGA 3TEMA 5M34A 5DK4A 4NV3A 3TIFA 2WJVA 1VQPF 2WAXA 2RHOA 4AYWA 4P0QB 3GWGA 4I1UA 4URFA 1E9VA 1H66A 2V7EA 5KOHB 1SY7A 2ORED 4W9NC 1Z26A 3BJEA 1SMKA 3B2NA 3FRHA 3IP7A 4DQUA 2AT1A 4MDEA 1P9WA 1YVUA 1LD3A 2RHHA 4N3AA 4HDSB 5A3SA 3RSQA 1U02A 5TS2A 3GH1A 1DIRA 4XUDA 4C43A 4D5EA 1SB9A 3AT1A 3FPLA 4MUNA 4XTCS 5CM8B 2WF9A 5CURA 3BAZA 2IHKA 5JAOA 2ITCC 1JQEA 3W6UA 2ZODA 4Q05A 1RMQA 3DAHA 3MCWA 2QPTA 2ECPA 4MO9A 5JC1A 4MS1A 1D5CA 2HVYD 3I9KA 3QEOA 3OQJA 1Z0JA 2ITDC 3MQWA 4B3SO 2WYHA 2BJHA 3IMFA 4GVPA 5IY5B 4DNOA 4C0XA 1WLYA 1BZYA 3DBRA 5AJHA 1HMYA 4EHHA 1N0HA 3O92A 2IUUA 2PS0A 3ZWDA 1P1BA 3BH6A 3VSAA 2IIBA 1Z4LA 4UEKA 5A3JA 1IY0A 3NHMA 2Z01A 4CCAA 1VLLA 2HUNA 2GAJA 3T1HB 1SOVA 4A0HA 1H1DA 4PI0A 3FB1A 4Q4LA 1JG1A 4TL9A 3RBAA 4EKIA 3L1KA 4QJIA 3VA7A 5KS2A 1EE2A 4QTYA 4MULA 4PSUA 1HDIA 3LQQA 3R3ZA 3K57A 1EHYA 1MVOA 2VSOA 5JJBA 1NUUA 4ABMA 2HA5A 3SQMA 3SKXA 5GINC 1TE2A 1KYIA 3OOYA 4K5QA 3ORHA 3RRZA 3DMFA 2YINC 4BB6A 3SZUA 3FPCA 5IP5A 3SPIA 4MWEA 1DAPA 3FLAA 1DELA 3A3NA 2YJGA 1SOAA 4I5GA 5HCIA 3BMXA 3AB8A 3CH5A 4J43A 2KPOA 3NANA 1QKIA 3NR7A 4O25A 5FLXN 1X7ZA 5EFZA 1RRKA 4NR0A 4WXYB 3GEPA 4B80A 1YQXA 5IEBA 2VHEA 1D1QA 3VR6H 3OI7A 2VQEB 5JHHB 1SC3A 5LOVF 4A23A 3URKA 3LYHA 1BGYH 1B42A 1YXBA 3SKYA 3HAXD 1PD3A 2CK3G 2IP1A 5HW0A 4ID3A 3OM8A 3ZNPA 1UXJA 3L18A 1V8OA 3K96A 2W42A 3IC7A 5J3JA 3UK6A 3ZBTA 3LFHA 2I99A 1UC9A 4FS3A 4M83A 1VL8A 2QZPA 5T8KC 4O4JA 1FVOA 2QVYX 2H0QA 1R9NA 4FBLA 4ZJPA 1Z5PA 4YRFA 3ZKWA 4ZVMA 3MJHA 3BQ9A 5BOVA 3NBMA 4J9YB 1HZJA 4R3WA 7AT1A 4I4TF 3DLAA 3PICA 3A36A 5ILOA 1TM4E 2NZUG 1KHHA 3HACA 3LY9A 4G5XA 4AJOA 5E7MA 2II6A 4YRSA 4LNUB 1T9KA 4RPIA 8LDHA 1JPVA 1D7AA 4LF5O 5JTUA 1CFZA 1EVKA 1YDGA 4UMFA 1V4NA 3AIKA 3L82B 4NS1A 5C3MA 4KQJA 5ENZA 2OCHA 3BEDA 4YMHA 1CR0A 1LKZA 1KJYA 3CJRA 1ZP6A 5JW6A 4G1EB 3V6MA 1P62B 2GEFA 3KQPA 2UYNA 3AG5A 1JGTA 3NYQA 3CC4F 4XDLA 4GLOA 5HSGA 2X1VA 5KOHA 2I33A 1SZJG 4RENA 2V45A 3CEAA 2AIRA 3U7JA 3T3GA 4HWSA 2CDYA 4EY8A 3TIVA 3CPHA 1THMA 4HDSA 2J9FB 1QKJA 3NVKE 2CHGA 4JVSB 4B7EA 2ZXEA 3ZOZA 4YR9A 4L5IA 5ALIA 2PMDA 2CK3A 4BC1A 4FGUA 5CFNA 3OE1A 1IUKA 1XL6A 3CZ9A 3HWRA 5G1NA 1BH6A 4XIIA 1TC1A 2YV3A 4D02A 1SURA 2XJ4A 1JHZA 2I1QA 4LYDA 2PZAA 1MMMA 1GQSA 5FI0B 1UJ6A 5B37A 3I9NA 5KTPA 3G9XA 2BTUA 4LW8A 1PAUA 1SQQH 2BFCA 3BCRA 1FSGA 5LJLA 4YAEA 4GH5A 4QOFA 1A32A 1RKXA 2CMGA 3L0IB 1W1UA 1FJGO 4MPRA 2QRLA 2XB8A 4ZOEA 1WTAA 1QR6A 4DR7B 3ED1A 4A73A 1OBOA 2PMKA 4HL6A 2CJFA 3BCHA 1Z63A 2Z3VA 1AGRA 2UZIR 4OHKA 1U1FA 2RSLA 2DRIA 1XCPA 3WG9A 4OU4A 3L43A 4J4TA 3KTFA 2O7SA 4UVIA 1NW3A 3A14A 1QYCA 3AWIA 5KJ6A 2R44A 1WO8A 4FJ2A 4DVJA 1NS1A 3CEIA 4EEXA 3UUEA 1BIFA 1G4YB 3GDFA 1UOOA 2W2LA 4YBZA 5FFNA 1JQBA 5FFFA 1GQOA 1NASA 3STZC 2HY7A 2W2VA 1L1FA 3OHMA 5DT2A 2VP9A 1KNXA 2FSFA 2PLAA 1OH5A 5K0LA 3IPLA 2EGUA 3PTZA