5KMGB

Near-atomic cryo-em structure of prc1 bound to the microtubule
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
431
structure length
431
Chain Sequence
b'MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tubulin alpha-1B chain
molecule tags Structural protein
source organism Homo sapiens
publication title Near-atomic cryo-EM structure of PRC1 bound to the microtubule.
pubmed doi rcsb
total genus 176
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kmgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kmgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kmgB01
5IJ9B 1RQ2A 5JQGB 4X1YB 5JQGA 1FFXA 5CA1A 2R6R1 5MN6A 3WGKA 3JAKA 4X1KB 4U3JB 5JCOA 5EIBC 5EZYA 1W5BA 5LP6B 3VO8A 4ZI7A 4TV8B 5LXTA 5IJ0A 4B45A 4O4JB 3RYIA 5KMGB 5KX5B 5LXTB 3M8KA 3M89A 3RYIB 5KMGA 5KX5A 5IYZA 4FFBB 3JATB 3ZBPA 4I55B 5M7EA 1TUBA 2RHOA 1JFFA 3RB8A 5EYPB 4I4TA 3E22A 4LNUB 2R751 3UT5B 5BMVB 2BTOA 4O2BA 4X1YA 1Z5WA 5JH7B 3RYFB 4EB6B 4U3JA 3WGMA 3VOAA 3RYFA 4X1IB 1TVKA 3RYHB 4O2AA 4EB6A 2XKAA 2GVIA 4X1IA 3RYHA 3ZIDA 3JAKB 4X1KA 4O4JA 4WBNA 1W581 3JALB 4ZI7B 5IYZB 4I55A 2XKBA 2VAWA 1OFUA 3C8LA 2Q1YA 3WGLA 1JFFB 1Z5VA 4EI9A 3UT5A 5LP6C 2RHHA 5CB4A 4O4HA 4KWEA 5EYPA 3N2KA 4O4IB 5LA6B 4YJ3A 2VAMA 4ZOLA 5BMVA 5LA6A 4ZHQB 4O2AB 2BTQB 3HKDA 2RHLA 3JASB 5CA1B 5FNVB 1TVKB 5J2UB 5ITZB 5EIBD 5ITZA 4HNAB 3V3TA 5IJ0B 3N2GA 3JALA 4HNAA 5JVDB 4X20A 2Q1XA 3CB2A 4YJ2B 4XCQA 4O4HB 4B46A 4I50B 4ZOLB 3E22B 3HKEB 4IHJB 4LNUA 4TUYB 4F6RA 4IHJA 3JAWA 4DXDA 4O2BB 4DRXB 4YJ3B 3JAWB 2BTQA 4M8IA 5JH7A 4EI8A 5MN4A 5LYJA 5FNVA 5J2UA 2RHJA 3HKCA 3HKDB 3RYCA 3HKBB 3RYCB 3HKBA 5J2TB 4WBNB 5JVDA 5C8YB 3WGNA 5J2TA 4X20B 4U39A 4YJ2A 1W5EA 3N2GB 2VXYA 4IIJA 5CA0A 1W59A 1W5FA 4IIJB 4I50A 5CA0B 3R4VA 5GONB 3HKEA 1RLUA 4TUYA 4F6RB 3VO9A 3VPAA 4O4LA 1FSZA 4DRXA 2VAPA 3N2KB 4O4IA 5LOVA 4TV9A 5MN5A 5LYJB 5LOVB 3JARA 4ZHQA 3JARB 1RQ7A 1SA0A 5JCOC 3JASA 5IJ9A 5EZYB 3HKCB 1W5AA 1FFXB 5LP6A 5C8YA 4E6EA 4TV8A 4FFBA 4EI7A 1TUBB 4I4TB 5GONA 3JATA 3VOBA 3ZBQA 5CB4B 3WGJA 4O4LB 4TV9B 1SA0B
chains in the Genus database with same CATH superfamily
1EH5A 4L6CA 1DBQA 4RHCA 4H3KB 4IQGA 4XFDA 4MHTA 3LBFA 4LQCA 2RC5A 4G4VA 4RKQA 4QPPA 2M32A 1JZSA 1N9GB 1P7WA 2IL1A 3GJXC 5IJZA 2D6FA 2V54A 1Y7LA 2H4JA 3SXUB 4R31A 2CJXA 2GRAA 5JSHA 1D9ZA 2RB4A 2AFHB 2VUHB 5HKKD 3G4SV 3DH0A 2QX4A 3WSTA 1Z38A 4HQRA 3ZKWB 4O0MA 2BFWA 3FNGA 1IUOA 4HAXA 2I8LA 2OZLA 2NU8A 1B0ZA 2MINB 4ATNA 4CKEA 1YVPA 4LF9O 3FB4A 2YOHA 3D7RA 1SRQA 1CQZA 2V4ZA 1V0JA 1BEUB 1TPZA 3FTPA 3I8OA 4YS6A 4X1YA 2PQ6A 3WG9A 1YZGA 2W6ID 2PSHA 1Q21A 1XP5A 2QZSA 2WKSA 2WUEA 3DC5A 4K46A 1HEYA 3KFLA 3PA8A 3QNMA 4I0WB 4RS4A 5LQSA 3U48A 2QM3A 1Q83A 5DNWA 4E5MA 2BF7A 2CW4A 3KDSE 1Z26A 1V45E 4IFEA 4W5WA 3RGBA 1ISHA 2HXGA 5CGQB 4BQIA 4K03A 4MIEA 1P9LA 2HDHA 3U3ZA 3UGKA 3SPCA 3THYB 1ZI6A 4N48A 1FXKA 2YYAA 5B1BC 2RHHA 4BV3A 1B6RA 4RBNA 1QX3A 2ZSUA 5CLQA 3UK0A 1U5BA 3M5DA 4EHKA 5GADl 3ER9A 3AF3A 3DMYA 3EBLA 3DFFA 4JAVA 3LYBA 4CQMD 1HE8B 3EXFA 2VT7A 1QZ3A 2HK7A 2A9FA 3W6ZA 3M84A 1T6XA 4UCQA 3ZE7A 4OIFA 5T57A 4D43A 1JA1A 4MIKA 4N12A 1P44A 2CN1A 1EDOA 3WGHA 2N04A 1EYZA 2NO4A 3PNOA 1BFDA 1QAHA 3KHKA 3PGVA 2DFDA 2J7KA 1VSVA 1LSJA 2VSQA 4YAEA 1U0BB 3WHPA 3UWSA 2A5LA 4X20A 4JWKA 3CVUA 1XREA 1YQDA 1P7YA 3OMIB 1Z39A 1GPWB 1IB6A 3ABIA 1ISJA 1BKDR 1EWVA 2FUNB 4UATA 1ABBA 2ZUDA 2VLBA 3BIJA 4GXTA 1R0BA 4UBIA 3H97A 1P1BA 2Z2XA 3RC8A 3A1TA 4QJBA 4TLDA 1L7AA 3SZ3A 2HFEC 4C81A 1MIOA 2QL9A 2WZBA 3EGXB 3I6ZA 3U4CA 3JAMM 2UU9B 3WP0A 3HR0A 1OF1A 4DLXA 1G60A 3PB3A 5BV2P 2UYPA 2MR5A 3S2ZA 1Q1BA 2IYNA 4AQYB 4F06A 3MINA 3C6XA 4BGIA 1CF2O 2HLHA 3T4EA 2EEPA 1BQ0A 2ZS8A 4AZ3B 1AZTA 1ZIXA 4GKBA 4Q15A 4UASA 1ELOA 3GP5A 4YQEA 5K8TA 1L5GB 3FB8C 3RAEC 1RJGA 1G2OA 4IGKA 1RPJA 5D84A 4LF6B 3NG1A 1PK7A 3L8ZA 1H8EG 5E9WA 4ZAWA 3WB2A 1L4BA 3FB1A 3NHBA 1DAGA 4JIMA 5DHSA 3RV3A 2FWNA 5DHRA 3ZIAA 4POAA 4MW0A 4EM6A 3VISA 4LFCO 1GILA 2R6CA 4J0JA 4DT1B 2QJFA 4GLLA 4B75A 3G88A 4MVSA 1AZSC 1R64A 1AKRA 1U8CB 4B3DA 1JIQA 1A0OA 1DAOA 2BMFA 3ROPA 4GWGA 3Q8XB 1ZGZA 3A9VA 4RJLA 5I48A 2GH1A 1NLFA 2MHCA 2IQ5A 4Q3OA 4FFBA 1M2EA 2CHFA 3BFXA 3OQ6A 4NTXA 1BHO1 3OZBA 3PL5A 4I4LA 1W52X 5AUNB 1I7SB 3JATA 2ISQA 4N6OA 1L8XA 5L6LB 1YZUA 4IEEA 5LL6Y 4ZAZA 4RD1A 1UFRA 1G4UR 4IIUA 2ZE7A 1AZWA 2DGDA 1FNKA 2EVWX 2AR9A 4ALKA 2JAQA 2Q8PA 1DMRA 3HXMA 3VIUA 4F84A 5CB0A 6REQB 2AG0A 5DCLA 4KN5A 1UC8A 2VF7A 3AVTA 1KI9A 1CUAA 3M8KA 2BDTA 2WJAA 3OIYA 1JW9B 1YZLA 4FOLA 3ADCA 2LUOA 2PXHA 3MWJA 1HBJA 4NOLA 4PYIA 3JSXA 4ZAGA 2WQ6A 1MO6A 2DY1A 1NLUA 5KYXB 5A4DA 1YQGA 4MARA 4NZPA 1K6EA 3A7EA 4CYMA 2GPSA 3QXGA 3TEJA 1T0IA 1COMA 4UFOA 4US0R 1MZVA 3H0CA 1OTXA 2H0RA 4R0VA 1YK1A 4WXEA 5CVDA 5HF8A 3R8CA 3TQFA 2JGAA 1C5KA 1ULBA 2BMAA 4G8JA 1POXA 1FKAO 1KBZA 3E7XA 4HXGA 4CIBA 3S70A 4W5RA 3JQ7A 4HQ0A 4MDHA 1G2QA 3AEXA 3ABRB 4GNRA 5B3SC 3TCUA 1R8JA 2PL9A 1XWFA 2XOEA 1FF9A 1YFKA 2XDQA 2GM3A 4GFDA 4Q9LA 3INYA 3E1YA 4JODA 1ZSPA 1NJFA 3KAKA 4G1VA 2DFLA 1CPYA 5JRJA 5SZHB 4DUGA 3HR8A 4HRVA 3CRZA 1THGA 4R01A 1YE8A 5LP6C 2MMGA 5LMUO 1IM2A 3KBBA 2RGAA 2HI0A 2E3JA 4BNZA 4DV2O 1GZ0A 1G8HA 4LBWA 4HS4A 4QUHA 1HEUA 1DQYA 2C7QA 1FLAA 4F38A 1CEEA 1PAUA 2FDXA 1YJXA 1KRHA 1TKRA 4CM7A 1NBOA 2N1MA 3DR3A 1DKPA 1DU4A 1HI9A 3PE4A 4P4LA 5JAMA 1J7HA 4HNAB 5H6RA 1CVLA 3NBMA 3GVPA 4MV5A 1O96A 4ZT6A 4DG9A 4ERXA 3DE2X 4CDRA 2W2PA 1FXKB 4HQOA 2MSCB 1I1NA 1E1CA 2Z0MA 3PDWA 4LZZA 2GASA 3GFGA 4KIGA 3SKXA 2GPTA 4HGRA 2ZTLA 1CF4A 4R1NA 1Y4MA 1VPLA 1IBMO 1UZUA 4RDHA 3T5DA 3LSYA 5H82A 4KPUB 4Q9NA 5JXHA 2R00A 3S03A 4CETA 3EZ6A 3Q9LA 5AVSA 5F7JA 4AS3A 3MC1A 2BV3A 4YECA 1RJEA 4MEBA 1CETA 2WIGA 4NPHA 2OLEA 2I65A 1D6MA 2FN8A 4RYDA 3IP9A 3K0AB 1AOXA 2BBSA 3LVRE 1Y9AA 1JVMA 3RT1A 4A0SA 2GAAA 2VNIA 3SBEA 1RU3A 1D2AA 4JT9A 3O8LA 4EPRA 3NM5A 5ELLA 4CTOA 2J07A 4A16A 1E2IA 1R6DA 2GYYA 2UXXA 3KZ1E 1U1CA 1VF6A 2IEYA 3Q7SA 3ZHZA 5A3SA 4IH4A 1ENYA 3E3MA 1GZ5A 1KGDA 3DV0A 1Q86W 2HW8A 3LUTB 2ZXWB 1GN6A 1EN6A 1U2RA 2NUTA 3B7WA 3BB1A 2WG0A 3ASOB 1OCEA 2JK0A 3EGVA 3QW2A 3EGIA 1JX9A 1CUYA 3F6SA 1U3FA 1NTZH 2OYQA 1PGNA 2PFKA 4YJKA 1PJRA 2C5AA 4JENA 4UAVA 4BR6A 1JBQA 4P2BA 5JAOA 5JNTA 2QR4A 4ZPJA 2BEUA 3HBLA 4PI0A 1G1MA 2V6IA 2YHBA 1KNJA 3RA6A 1FFGA 4HDKA 1GRCA 1KP9A 5FUYA 2O8CB 2HQOA 5EJ6A 2GCEA 1HDXA 2HJ9A 4ZMRA 5JROA 3E1GA 1ZKDA 2QJOA 1JLLB 3F6EX 1ZD4A 2BI4A 1N77A 3R23A 1CDZA 4S1VA 1NFFA 3DXXA 5HJ5A 1JWAB 3BCSA 3WE7A 5AK4A 3FOEC 2YV4A 1I6MA 4INAA 2ZI4A 5IJ0A 4Q4AA 2RMKB 4PR0A 5DBEX 3S8MA 2LV8A 4NABA 4KPEC 5EIXA 3ESBA 4HYOA 1BW9B 2WTEA 2XAFA 4AY4A 5KHJA 3NT4A 3FAVB 3MWKA 4QOJA 1MG1A 2PKYX 4PPQA 3RABA 4A0FA 1WF6A 1Z6YA 2KE5A 4HPXB 2LCFA 4IS2A 1YI2F 1KEZA 2P9TA 2HOQA 2QA4V 1QU9A 3HVUA 4V0QA 5JZOA 4MS4A 4PR3A 2QTSA 1B6GA 1G4YB 1EUZA 1E60A 2ZIOA 2XHBA 1XVVA 4AI8A 1POWA 2DUUA 2NUAB 3TNDA 2X19A 3OT1A 1US6A 5TQJA 4X91A 3Q8LA 2V1DA 3KJKA 2WLSA 2RHMA 1E0SA 1VQ8V 5GAPK 4WZ6A 5C8YF 2WHPB 1KDRA 5EB1B 4RF5A 4D46A 1KK1A 2QMOA 3NONA 2BBWA 2Q50A 4AJEA 4CZ2A 1GZ6A 2VQ6A 4A0HA 5JNVA 2X6TA 4JEMA 3ZY3A 3H1LH 3S1AB 1AJNA 3F3SA 3LTNC 3RH0A 4AQ7A 2BMWA 2Q2QA 4BNYA 4LZLA 2CDCA 3LQRA 2H6LA 1XYVA 3OJXA 4HNGA 4TMKA 4TQGA 1ZOIA 2YX1A 4WHMA 5C9ZA 3I55F 4MR7B 4DCVA 3EVCA 3IVRA 4EKGA 5AG2A 1NAHA 1RFLA 4S0ZA 2EOAA 4PI2A 1UJWB 5AJTA 4UM5A 2RJNA 3QKTA 3VU9A 5J40A 4N0QA 3FLAA 1RC0A 4CMKA 4G5QA 2BOVA 4RQTA 5BW5A 5F7OA 1V26A 5H1YA 1E7YA 1P61B 2X0LA 5J4HA 1N6LA 3DAGA 4FWIB 3EXEB 4JLUA 1E20A 2NZVG 1RJDA 5FTWA 5JH7A 3UCXA 2CHVA 3EDQA 5IANA 3ER8A 5IYDO 2G9NA 1AA9A 4DLBA 2D0DA 3WWDA 1ZL8A 1FFTB 2VTEA 4K9QA 1N5IA 4NXMO 1RRPA 4NU8X 4RSGA 5TV2A 3OF2A 1ZITA 4BO9A 4BECA 5CA1F 2W8ZA 1Q7EA 2VBIA 4CQMA 5MFZA 3OLQA 2R6FA 2OOSA 2ZJZA 4FYJA 5GM2A 4WFAV 1SB9A 3L9DA 2HWUA 3SHVA 2I1QA 2GTHA 1K66A 5K1ZA 4KPUA 3LWOC 4JC5A 4TKZA 3SQDA 2VPQA 3ZCXA 1Q6HA 4QIWF 4HUJA 4RVFA 5CBPB 1D7OA 2MDTA 1GD1O 1JWBB 3KFVA 3V7QA 3DE1X 4LRQA 4WESB 3U4QA 3NETA 3UGQA 2CXNA 1SKUA 4AROA 2OMEA 2POQX 1JEJA 4UCTA 1W35A 4DLUA 1G41A 4LWOA 1H9CA 4YIPA 3U4DA 4E5VA 4AMZA 1OLXB 1UQUA 1BDIA 1U3PA 1R3LC 3ZQUA 2F6RA 4O4IF 3L4BA 2ZBVA 3JZMA 2Z0AA 1TQ8A 5FJ4C 4GP7A 3AM1A 3VYTC 1OVGA 5HQJA 2RBEA 5JFTA 3TTVA 3GLQA 2F3QA 4JXXA 1XKQA 4BMOB 2H16A 5ALVA 2WWRA 2V6GA 4H16A 4QXPA 4C2TA 3CZMA 2WM9B 4J8PA 4I6EA 2Y69C 2DBZA 2D8AA 3C8ZA 1U28C 2PLAA 3O7MA 2Y2VA 3DLHA 5KJEA 1ZLZA 3DGEA 2QE6A 2ZF8A 3C48A 2QV7A 3S2GA 4LF4B 4A27A 1FFXA 2GTAA 1JEQB 1M6HA 1CRLA 5JS8A 3DZDA 1P84F 4EHHA 3PHHA 1M5TA 3L40A 3G59A 3OLVA 4IR7A 3M6IA 2HJDA 1J7JA 4IX9A 5EKSA 1RQGA 4UXHA 1NUQA 2ZCVA 5DBIA 3QK7A 3GLIA 1SC1A 1YBFA 3BIFA 3VQTA 1GZUA 1ORWA 1FTYA 3VR6H 2PSEA 3GARA 2YS8A 1I1HA 4ZYZA 1JSZA 2E18A 2EP8A 3PRHA 1UOOA 1UEJA 3V7WA 3T1TA 4U1RA 1E79A 1W41A 3CCQV 2HXSA 2YXDA 2H7VA 2XCLA 3P9IA 4R05A 4UXIA 2XH8A 4QUEA 1T9ZA 5HJ2A 3MHPA 3UAVA 3UQ8A 1G8FA 1KZHA 4CDMA 4NAVA 4R84A 3OF5A 2E89A 1YNOA 3F78A 4AUEA 1H1LB 2XKBA 3AH8A 3GJ4A 4UM9D 3RJ9A 2NO9A 1KEKA 4OEHA 2AA3A 2FFBA 5IX8A 3FOWA 2P41A 3TRIA 3CLVA 1IRIA 1OX4A 2ZDIC 1QTRA 5AXCA 5HCIA 1ULHA 1C0PA 1TTHA 3EN0A 4JI0B 1V1RA 2C9YA 4KG7A 3UJHA 2CDYA 4L50A 5CFMA 3STUA 5LDGA 4ENSA 2YUAA 3ISTA 3LGAA 1AUQA 1K7DA 1E8DA 4M1ZA 4U9IS 4XZ3A 4ILKA 4ZAFA 4KP4A 3SDLA 3VTIC 1SULA 1V11A 1VKRA 1XPRA 4U5QA 3BA9A 2BSKB 4C7XA 1TB4A 1Q6YA 4LFBO 1E2FA 4Z1MD 2FFQA 1RWOA 3S2SA 5KHGA 1DPFA 4DR5B 1JPNA 2QVYX 2QX7A 1T9GS 1V35A 3K2QA 4J2OA 1Z6XA 4QARA 2OXIA 4CMIB 3N39C 3WKCA 3G5AA 1EBFA 4R50A 2R6HA 4WOBA 5C1BA 2O54A 2TMGA 3BHNA 5IP5A 4BFLA 4I50B 3NP9A 3REGA 5A1TA 3CYFA 2QVZX 3E4DA 3VPGA 2OYSA 5G3YA 3F97A 3KG2A 3HCFA 3N74A 3LIIA 2FCAA 2O0HA 1JAHA 1GVHA 4NP6A 4AO7A 1NT2A 1XHFA 3ABLC 1Q81H 3OETA 3RUDA 4P4TA 4DA8A 2DWEC 3OPMA 3I2IA 1Y8ZA 5CBFA 3T7JA 3OEEG 5CW1A 3RFTA 4C4WC 2C99A 2PNJA 1LFAA 4HUQA 4QTTB 1YDGA 2PMWB 3AG6A 2ZM6O 1DDGA 4L8WB 1EJBA 2C4UA 3JSAA 2GK4A 2D7CA 3SR2C 2VH1A 2ZREA 3EVBA 3NW9A 1DT3A 3MCAA 4P5PA 2Z1FA 4B5KA 1XQWA 1VQKF 2FRXA 4BJ6A 2WNIA 1CKEA 3DLIA 3NZEA 5DW3A 2NACA 4J0KA 4XCXA 5FIUA 4GHWA 2Y0IA 4KQEA 3HDJA 4GI3A 4BYGA 1CJMA 1HQCA 2IU0A 1VQ6F 4RD6A 4D1YA 1SESA 1V16A 4RIIA 4RW0A 4LJKA 4WZBE 3RLIA 3W5HA 4U02A 5LM3A 2WSBA 4FZ1A 3GAMA 2VCYA 2P2YA 2PKRA 3TI9A 1A5BB 2ZDIA 2DT4A 4GUAA 3OESA 3AK1A 1ST3A 4M2LA 1RACA 1Y4UA 2R96A 3AU8A 3ORYA 4CTJA 2VOEA 5EC1C 2V4DA 1ZD3A 2HF8A 2KPOA 1DADA 4FSHA 1JILA 1NVBA 2QL6A 4MP3A 1D1SA 1U9CA 4ETIA 4DDTA 1F7UA 1QF7A 2JK5C 2VIIA 1XMQB 3AFGA 1IQUA 2OHGA 2RIRA 1YMUA 3LMKA 3NNNA 4KX3A 3IMEA 4XTRA 3CTPA 1SXJC 4ZT5A 5C8DA 4KHZA 4N0MA 4EI2A 2B21A 3QMMA 4LRTB 5AHRA 3DE6X 4EABA 3KETA 4KBYA 1GPUA 2VSNA 3DTYA 3FFAA 3VO8A 4FSXA 4MI6A 3BOSA 1ZM4A 2GEJA 2PSJA 5A3JA 4BE9A 4EKNB 3NWPA 2PA3A 2PH1A 4OXQA 3IULA 4QE3A 3K0FB 4RF4A 3QTCA 4YQZA 1KQOA 4B35A 4LG1A 2Y92A 5LLTA 1O6ZA 2MYUA 2IU4A 5HE8A 2MYTA 1QK5A 3K1AB 1QH8A 1GQRA 3LY7A 3IAM6 1XA4A 3RWBA 5AUQA 4WVFA 2HMUA 2XVAA 3GBPA 1P2UA 4J7JA 1EFUA 3GB9A 5BMVB 3R3VA 3TZQA 4ZCRA 3B6IA 2PKXA 1CERA 4D5EA 3KE8A 2PGJA 3GG2A 1B3BA 3LCMA 2WKRA 4ARUA 3L0YA 2QKCA 5TMDA 3OLZA 3BHPA 3MJRA 3KP1A 2XRZA 4UHJA 3H9UA 5HA5A 2QKAA 1B6TA 3U2QA 2AG5A 4FMCB 2YVAA 1MOQA 2PUCA 4E5DA 2Q3LA 1ZL0A 4MRPA 1Z75A 2ZXWC 5H6QA 1VQPV 3ESQA 3K2EA 1HR0O 2FSUA 4F12A 5JAIA 4DW8A 1UK7A 3H1FA 3BREA 3L4BC 3DVSX 1N9ZA 3S0WA 1JT2A 2VYQA 1BCRA 1UKYA 5BQPA 1P1KA 2BH9A 2JFWA 3B7GA 3KFXA 4HBGA 3IKTA 3EMKA 2JA2A 1JG6A 5HXAA 3AUTA 1KAMA 1SG6A 4AF7A 3E7WA 3DDSA 2PFSA 3ITNA 2XX3A 4FFWA 4NNPA 1WP7A 1L1EA 5FD8A 1I5EA 1V47A 1IXKA 2AWNA 2IVZA 5F1PA 3OPQA 4B7CA 2YBEA 5BQXA 4MUEA 4RHFA 3P4EA 1URFA 3MBMA 1NN1A 3WHIA 2CDBA 2DSNA 2PTGA 4FDAA 5ALLA 3CB2A 1XZMA 4JJ7A 3UMMA 3EZFA 2OEPA 3AZPA 3ZDYB 5TISZ 3WNCA 4UM9B 3SGLA 1PTJA 5G0WA 4Z7NB 4DR5O 1W48A 3EYAA 5BOSA 4J10A 3MDSA 1IEXA 5BYBA 1KQNA 3FOAA 2I2WA 1SRRA 4DMUB 4E70A 2CK3A 2F8TA 3I2HA 4PZUA 1GVNB 3QEMA 4Y2HA 3K0KA 3S2UA 1Z2NX 3C3SA 1NBHA 1WLYA 4MVJA 4DLSA 4P0TA 4JXZA 2YQZA 5KHOC 3T0IA 1T0PA 1MN6A 2FWAA 3UWKA 3LXMA 4KR3A 1VQ7V 1QBGA 3K70D 1ZJ5A 1YA6A 3EFFK 2YOFA 1ZM9A 2CJYA 4C87A 1T5DX 1VPDA 4CTMA 4I50A 5JXGA 1CP2A 4A8TA 3RWRD 3GEMA 3IC7A 2PMFA 4EUFA 2YKGA 1D1TA 2FPMA 4LXHA 1PR9A 4BNNA 5C80A 1HSOA 1JQ5A 1ZCAA 3AG3C 2VDPB 3E83A 4YV1A 2BHLA 4W6QA 3U26A 2X0JA 2VO1A 1T36B 4L5JA 3WTCA 1U6KA 4TKMA 4PLGA 1BMFG 5AM1A 1GG8A 2C7RA 2YJ3A 2DC1A 2OENG 3MS7A 4TVOA 1SHLA 5EQTA 1SD5A 2I9KA 4DSUA 4G85A 4E6EA 1ISSA 3BSFA 2E21A 3PQ4A 2COKA 1YR3A 2W2MA 3GYGA 1Y9DA 1QR8A 2X8LA 1VF5B 3TOSA 4ZI3A 3E2EA 5CVJA 1R5NA 3NDJA 4JX8A 3OE7A 4RD4A 3WK6A 1V4BA 4S2EA 4BAUA 4L7QA 1RBQA 2HM7A 4DEYA 4URUR 3KCYA 1KH1A 1QG6A 1T1RA 2CXHA 3JQEA 4C20A 5KOYA 1XTVA 1N8TA 4KKVA 3VPXA 3WXMB 1D6SA 2QTVA 1F2DA 5CM8B 2EKQA 5JCJD 1UZNA 2RDMA 3RNOA 1TDJA 2D1TA 3SSMA 3W77A 2HYIC 3KPWA 3ZLUA 1NHWA 1QVFU 3IB6A 2CVZA 3K59A 1XVIA 1MQ8B 1IM5A 3VVBA 4Z99A 4PGMA 2GZMA 3S2FA 5E1MA 2YEVA 3KQHA 4MS1A 1J6UA 5KX5A 2EFHB 4B17A 2C2GA 2TRSB 3D1VA 5AOBA 5HP8A 1QH1B 1AX9A 3HA7A 3QHAA 4K26A 4B32A 4AO8A 4CIVA 5AKLA 5L3BA 4LP8A 2B82A 2IXTA 3V4VB 4YAGA 1KAOA 4FGSA 1LJ8A 4DV3O 5B57C 1JT9A 3CNOA 4BVSA 1CZHA 1VMIA 2G5PA 2ZBEA 2FX5A 4H3SA 1S8OA 4UCRA 2BI7A 1XUOA 3FETA 2FTKA 4O1IA 3A0HZ 1X7GA 3PDIA 2NUPB 4HB3A 4MMXB 1ZXBA 4HRAA 3FVWA 4PE5B 1OFGA 2JGRA 1R6KA 3KPUA 4ZC1A 3UWOA 1YZNA 4WLNA 1A98A 5C46F 2FSHA 3D7LA 4LOKA 2K5UA 3VKGA 4X9QA 4TQ9A 1IHXA 2JFFA 2V6FA 4ZVQA 3LUKA 2PM8A 4BZXA 3HSSA 2P78A 2R8OA 4IDQA 3UFXA 2JS3A 1IN4A 1CQXA 2Z57A 3EASA 3RNLA 3LG2A 3TRFA 4AJPA 3LBYA 2YIAA 2E5LO 5BT9A 1H42A 2X9VA 4RQOA 1Y74A 5L4NA 4KVZA 1US8B 5DM2A 3RRBA 1DFHA 4CM8A 5EHXA 1WXQA 3GHHA 2CLOB 4E09A 2HRQA 3K9GA 2GCIA 4PZCA 4OJYA 4EYGA 1KETA 1TQHA 4G27B 2B6NA 2HA5A 4I4CA 1ACJA 4PSVA 4X5OA 4QGGA 4B7UA 1TVEA 3CCCA 3K0TA 4E4RA 3D8HA 3C7CB 2NAPA 4XB1A 5FB3A 2UYJA 2ORWA 1IDN1 4IDPA 2YC2C 4ZOCA 1CUHA 1KEVA 1UPFA 3AEUB 4B34A 1MGPA 3MWYW 2CSXA 1DX6A 2NQTA 3RU3A 3U44B 2PL1A 1P4HA 4OHOA 3HBJA 1NGSA 4HB2A 3Q0IA 3Q87B 2O20A 3MTBA 2EX3A 1ISMA 3C4VA 3IUSA 4HH1A 4LXQA 3CX5F 1Q3TA 3CUKA 1ZWIC 3CCVV 3ZC3A 5L3QB 3CEPB 4LRUA 4RK4A 3WGNA 1PL7A 1XRRA 2FEKA 2WUFA 3U1VA 1JUDA 2CMHA 2QRHA 5ALRA 1F06A 1DTWA 5FV4A 4PSKA 4MW7A 4AS1A 3ED1A 3V2GA 3TW0A 2IKSA 2GSWA 1FQOA 4Z2WA 3E58A 2G7MC 1VMGA 1BXRA 3OKCA 2V5UA 4XIFA 5CYPA 1IWBB 5AVXA 3EIXA 1VYTA 4O4IA 1MT0A 1T10A 1GRJA 3VJKA 4X44A 1BXKA 2RCVA 1FXWA 4NYIR 2XEDA 1CB7A 3UVEA 2C7OA 3LX4A 1LY1A 2X41A 3HPLC 4G37A 1ORQC 3H13A 2RAUA 4PGFA 4WXMA 2Z1EA 5CXSA 5J4VA 1FDIA 5KIAA 3JVUA 3TXAA 3VYRB 4HLQB 4BO0A 3SYKA 4KJXA 2IXFA 3W9UA 4CMGA 2Z08A 4HDMA 2ZZNA 4OG2A 1HXHA 2D0OB 4QGAA 5FHRA 1CE8A 1CR6A 2H51A 3FDZA 4PX5A 1VPWA 1NLYA 4QNNA 5F52A 3VNRA 1UXOA 2C92A 4IF6A 1PEYA 4P6VF 2QD4A 1O94D 2B25A 3KTDA 1QHSA 4CFZA 4IEIA 3MT0A 1JHVA 5T41A 3RSCA 2NU7B 3SDBA 3VSCA 4RZHA 3LXXA 4YRQA 2Q9LA 3CD6V 1K63A 2EG5A 3Q8WA 4U7TB 5LQJA 5GJBA 3T7CA 3EG9B 5E6UB 1AKTA 4HNTA 2CXXA 5GAJA 4QRHA 1T2NA 2NAFA 2XUPA 5IEBA 3NU1A 1CN7A 1CWUA 4PC2A 2BKXA 2H06A 1YFZA 1YA8A 2PD6A 1QFZA 2OCXA 2VRWA 1F4VA 4QNHB 1WKCA 1WN7A 2XGOA 3BB4A 5DNCA 4E2XA 3WMGA 3QLEA 5M7EA 3AYXB 1U5CA 3ICXA 1U96A 4M8NE 1IL0A 1PJLA 2VWGA 3NPMA 3H8JA 1E2EA 1RBMA 3STHA 2QKSA 3L8FA 3IHLA 3CYPB 1OCZB 3BFJA 1L7BA 2ZTMA 1FRVA 4NZZA 3WGMA 2VNHA 3UMCA 4H7IA 1NYLA 2C07A 2IHBA 3ICEA 3JSLA 1TIKA 3NDIA 1E2KA 2YWCA 1TAHA 3QYPA 4W5HA 2QPTA 5KAIZ 1M0WA 1MOZA 2C5FA 2GGSA 3B12A 3BMOA 3OA0A 5IYBO 1S76D 4HRYA 4G2TA 4I55A 2J7PA 1EDBA 1H0SA 2H2DA 1RM0A 3KEQA 4DLYA 5AKYA 2P90A 2A7WA 1AUPA 2QX6A 4N0DA 3UWPA 3GP8A 1QU3A 1A7JA 1HE1C 1P2DA 1VHLA 1TK3A 1ARZA 5FO0A 3GJ6A 3V42A 3GV0A 4F4IA 3LF2A 3PUKA 4MGHA 2DFTA 5BSGA 2Z2JA 4V2IA 4AKIA 1YWGO 3A3OA 4M9QA 3M3DA 2PUAA 4F4HA 1VQKV 1K0UA 3L02A 5KC8A 1ZW6A 4OFXA 2BCEA 2IX3A 1JFTA 4QODA 3CR3C 3QY0A 1O6FA 4Y0VA 3VU1A 1ZIYA 3GZTB 3D54A 1F2TA 2R8XA 1XMVA 4N5MA 2D0PB 3UEOA 5C3MA 4M8KA 3R3UA 1E96A 2Q0XA 5FYDA 4XW2A 1WA8A 1C1XB 1NW3A 2OV3A 1D4ZA 2QP9X 5A4JA 5ES4B 3FD5A 3A0RA 1ORRA 3DDHA 1KQGA 1H2MA 3CKMA 5FNVA 2JVKA 2O05A 2FUCA 4DK1A 3CLHA 1UMBB 4KYUA 3QVUA 4WDQA 4XJXA 4QYMA 3DBRA 4YAKA 2IK8A 3AEKA 4JP5A 3CISA 5AKXA 3CWQA 1Y33E 1NFRA 2G1KA 4BQEA 5DGXA 5EP3A 1M2OB 2QLBA 4BRUA 3L92A 2FGKA 2XRFA 3ZNQA 1PRYA 4WW0A 2HCBA 4UNQA 2IF0A 4C22A 1GK9A 3PHGA 4OH7A 2E85A 4X64O 3F0TA 4G8CA 3D2LA 1STOA 4IIGA 1EBOA 5HY2A 1PDVA 1EWRA 3HUUA 2R8RA 3MMNA 4FZVA 4IT5A 1W42A 3G4SF 1Q74A 1YQ9A 4U2FA 3FYDA 1KOFA 2CLSA 2IHVA 4TLCA 3WNZA 3DXRA 1KMCA 1VZ3A 2WHYA 2I33A 5FADA 4EFBA 3HQ4O 3WI7A 1SCAA 5BQ3A 5KOHA 2PVPA 2DT8A 2WK1A 1J2TA 2F8MA 2YN4A 4X9XA 3RS8A 1F4NA 4QT0A 4I5FA 2O2ZA 1Z28A 4ZC8A 3LSUA 1JLKA 3G17A 3ESJA 4XFJA 1ZA1A 2CSUA 1BXRB 3A3KA 3C39A 4IIFA 2NPFA 3VTKA 3VZDA 4JN6B 3D6VA 1VL5A 4OXYA 3SSAA 3QYFA 3UV7A 5KNCA 1QGUB 4FLMA 2Q8QA 5LQRA 2BGKA 4WV3A 5AQEA 3N2NA 5HF6A 3G71V 2ECQA 1ZW1A 1DBIA 4L5BA 5DZSA 1HE3A 4F72A 1QYXA 1HYHA 3ZMTA 1ZY2A 2GKOA 1SC9A 1IPEA 5FPKA 4WBSA 3DJYA 4QUGA 1MFZA 3AG4B 5IBRA 1GM8A 1DWUA 3AKCA 4OA5A 1GQ2A 2WT8A 3CUYA 3DOOA 2GUZB 2A9VA 2IOFK 2A84A 2ZJ5A 1I7QB 5CM2Z 3GLGA 4MVJI 4YMHA 3TLXA 3PTZA 3WWPA 3QUCA 4RNDB 4ZAXA 1WW8A 4DV0B 2VSOA 3AG1C 2YZKA 3IX7A 3QVGA 3NVAA 4YRLA 4Y1FA 2FX3A 3WYNA 2WLLB 3NGXA 3K2XA 1JJIA 2W6QA 4ZIRA 1ROPA 3AG4C 4KFCA 4M99A 3EG9A 3QMPA 5E6UA 4BXOA 1JQLB 2CFRA 3LRXA 1HQYE 5IABA 2HHAA 1BE1A 4RLQA 1VGVA 2Q8VA 5IAOA 4MEAA 2Q4BA 3WDLA 1X4TA 2ZJ4A 3ETNA 5I7UA 1XPJA 1QP0A 4YYEA 1H2WA 4Y9RA 2HA6A 1AKNA 3L3BA 3BA6A 3VC1A 2H31A 2F4NA 5B1AC 3EOAI 3QVJA 4LPKA 4XDGA 1DT9A 1JHXA 4HN4B 1YL5A 1GZVA 1NOIA 1ZO8A 4X94A 4UTRA 2ZULA 2J5KA 2RBGA 3PEUA 1EX6A 5CLGA 4EX7A 5JI2E 3U3KA 3CJHB 4PNZA 4BNMA 2FEPA 1Q84A 2NN4A 2CXQA 4BBPA 5CMLA 2JLQA 4D0NA 1T25A 4MINA 2QLNA 2CMKA 3O0TA 4H0FA 1NASA 2YCBA 4J1TC 4IZIA 2W2XA 5DH9A 1EWQA 1QGYA 4W1PA 4UM8B 5HFNA 2ZYDA 4AJ2A 5DM6V 3KQVA 1VGQA 1YIOA 3FWPA 5K4GA 2JLAA 3TIXB 1UBSB 2XMGA 1AB5A 1TM4E 4JLMA 4QOIA 5FLYA 1QLNA 4UVIA 1Q1QA 4KXUA 5A7FA 1XQ9A 3LT4A 4FGJA 4MPPA 1I5OA 3WR5A 3U62A 1QNLA 1XZLA 3DMHA 2WRZA 3PD1A 5AXAA 2EIJC 3DO5A 3EQZA 4HBNA 5GINC 2QMEA 2XJ9A 4KR9A 4NYJR 1C9DB 2GXUA 2E3CA 4C0XA 1ZNQO 4P4SA 1NMXA 4JPRA 1QGAA 2KLHA 4X20B 2DWDC 2DUNA 1YONA 3BTOA 3NHRA 3OU6A 4RHYA 5AUOB 2HBYA 3G7NA 4RMNA 2BFOA 5A7HA 4E5NA 1U3LA 2FZCA 4FJ0A 4GZLA 5JBIA 4JJZA 3ZMVA 4C88A 1H9AA 4QXQA 2EIJB 3A4VA 5DK4A 1QHHA 3F0DA 4LK3A 2NO1A 3CCMF 1H0HA 2XE6A 5EUBA 3O4HA 1IY0A 1K2WA 3C1UA 3GT3A 3QU4A 3VU0A 5BYAA 1KH3A 2DH5A 3CO5A 3K3WA 5LHHA 1NC3A 3S2YA 4KUGA 2ZJFA 4N39A 1SUCA 4GQAA 4P7JA 1P0PA 5TGTA 3BWYA 1QPZA 3I76A 4HNUA 1BKYA 3NMUC 2ZIGA 2XB2A 2FW6A 2ZS7A 3I58A 4FB4A 3NJRA 1TAEA 3DJFA 4F3KA 1N2JA 2XVMA 3C7KA 3ZH2A 4MVRA 4BV9A 5FI0B 3GVXA 3A2KA 4AKHA 2HZ7A 5DMHA 2RG7A 5SY6A 4L8VA 3U37A 2PJRA 3UYLA 4CIYA 2C95A 2IYVA 3JYCA 2ZYTX 1ZAUA 4KK3A 4H1VA 2OPBA 2EZ8A 3PICA 4JJGA 4FJCC 1WB8A 1VE9A 3P3PA 2VT2A 3O21A 4E08A 5B1NA 2X86A 1JQ0A 4KXXA 4MRAA 1T4DA 1R0WA 3AF5A 1ULAA 5K3FB 3DDUA 4MJLA 5KCMA 4MRRA 2GFIA 1WCV1 1ISGA 2OB1A 2DYRC 3M1XA 2IYAA 1XSEA 3MTEA 3HAXD 1E1RA 3S68A 5ILOA 3OQJA 3JATB 3MHHC 1DCTA 1Q0PA 1TGVA 3PJDA 3FYUC 1Z18A 4FMBB 4HX5A 3KJQA 5AOVA 3RUIA 4C9BA 2AT1A 1Y98A 3K8ZA 1DAPA 3IEVA 3K9SA 3BB3A 1TAQA 5ILQA 3G02A 1PHPA 2B35A 1G8GA 5T4BA 3CMAF 2CHTA 3A7DA 3ENKA 3KVYA 1Y63A 4JEHA 2CUNA 2B99A 3MEQA 2PBLA 4R2IA 4LSGA 1PEAA 4EA9A 8LDHA 2NXCA 1QQAA 3GNSA 4LWSB 1SCBA 4HQ6A 4W5TA 1XRQA 2LFRA 2WUDA 1FY2A 1FFSA 4WK6A 4XBFA 2DQ3A 1IZYA 2ESRA 3IUYA 1KO5A 3FYUB 5FFMA 3RVBA 4ALIA 3CF4A 3OO1A 1R5BA 2PSSA 3ORRA 1LPMA 2ATIA 4DKJA 1ADJA 3OTOB 1EAMA 1HTTA 1T0UA 2FDRA 4XLTA 1KB9F 2EGHA 3PV0A 4OOFA 3FMVA 1OAPA 4P1ZA 5KYXA 4CH5A 1I32A 1GGVA 1M1KW 4JYCA 4H1UA 3LRPA 2Q1WA 3HI6A 4DM4A 1TKCA 1PT9A 5ICEA 1SDSA 4H1WA 4C0BA 2F1HA 3VJRA 9MHTA 1R0ZA 2ZCUA 3IXQA 5KTTA 4KMSA 4L3VA 4EDHA 3QFTA 3CMMA 5DYTA 2H18A 3MXTA 2PIAA 3EVEA 4RL4A 3STWA 3F7NA 3T7TA 1BVHA 1FNBA 1VA4A 3D59A 2BUBA 3D3KA 3I05A 3T4UA 2IYUA 3UXHA 4BASA 2V6MA 2O5CA 4EWLA 1VQ9F 2HMAA 3MQ2A 1FLVA 1EDDA 2QD1A 3HZHA 1WY5A 1U0EA 4HWKA 4TZKA 5D2CA 2QF7A 2O5RA 4OXNA 2ADQB 1CQPA 5JJBA 3KQLA 3P5SA 2FWBA 1FJGB 2B69A 3NB0A 3W3ZB 2Q9AA 1GA6A 2XYQA 3BWVA 2FQWA 3TFQA 4IW3B 2CWWA 2O14A 2X0DA 1QORA 4Y2RA 3MB5A 2JJ2A 4EQ6A 1FX0B 2FGJA 4MVCA 3F4LA 3PDHA 4ZHYB 4W5QA 1XEWX 5E6RA 4OI1A 3EEIA 3QPCA 1NTRA 4L72A 3VYSB 2KWIA 4EJ6A 1HDOA 2XMPA 5A62A 1SNYA 2P9GA 1CFZA 2X15A 2FF7A 4LZAA 5TF0A 3U61B 4FXPA 5I7WA 1GFZA 1C1DB 2WAXA 2V55B 3KXIA 4HNSA 1BE3H 2HPZA 2B7LA 2G07A 3OTIA 3ONEA 4J07A 2ZB7A 4C78A 3C9SA 3FPIA 4JP8A 3U56A 2A59A 5EE9A 2EGGA 4FD2A 2P3QA 3FVQA 4R40A 5ER6A 4YWJA 2C59A 1TM2A 3T5CA 3U81A 4E22A 4ASUA 4MVZA 1LV7A 2HH9A 5DX8A 1Z56C 5REQA 5C8VA 5KTYA 4HDRA 3OTQA 3LMEA 2Y1EA 1JDVA 3AESB 3CMEF 2O1XA 3DM9B 3H84A 4GYYA 3X1MA 1U4NA 2I6FA 2N1BA 3RKSA 2XE8A 3BXZA 2ZYWX 3PGJA 2H07A 4UPVA 2F43B 4ZRMA 2J59A 1SBYA 1DOZA 2WJ4A 3L9XA 4URZR 1YL6A 2I66A 3CT6A 4INZA 4OUDB 1QCEA 2F4VB 3CZ9A 3I0ZA 3LUCA 3TLZA 4S05A 1YCHA 3QEBZ 2G63A 4OA8A 3I4LA 4GX5A 1KI7A 2PZJA 3EEQA 3SI7A 3RVMA 3COPA 5AK6A 2WD8A 3RGWS 1A1SA 2F9FA 3F5MA 3LFHA 4CXMA 1LTHR 121PA 2CNWA 1W36D 4OAPA 3IDQA 3H1PA 4CF3A 3HEAA 3I2GA 1W30A 4DR6B 3MQWA 3P0IA 3TJZA 4AF8A 5C52B 1S3GA 4UAJA 3ZD9A 3FFQA 3RSZA 4HZIA 4U7PB 3S4YA 4A3SA 4YY3O 5KUMA 2A1TR 3LQQA 4FVTA 4R54A 4DQLA 2IBTA 4LYGA 4C4RA 5LKRA 3ZQ6A 3U60B 1EVKA 1EVQA 4K3UA 2AC7A 2B20A 1EVYA 1M0SA 1SXGA 1K8AH 3ETCA 4LCBA 4KXNA 2H48A 1ZD9A 2JHFA 2PQ2A 4L4XA 1U97A 4TLEA 4X6YA 4XM0A 3VDRA 1HFWA 3VKWA 4AK9A 5AVUA 3EW7A 2DWQA 4B08A 3LWDA 3TNFA 4GD3Q 2QI2A 2A1TS 5IVIA 4M3NA 4KXWA 4KODA 3QO8A 3CQ9A 2BSKA 3CPWF 4TL6A 3S44A 2NVOA 3IVAA 3ZN1A 3RYHA 1TYEB 3I8XA 2H2AA 2WHXA 1H93A 2RMKA 3QXCA 4TTAA 5F7ZA 2OC4A 3V4PB 4KV9A 2IV7A 1AN0A 4QYIB 1NP7A 4JLAA 5DGHA 4Z9YA 5IAGA 3FYEB 1XKXA 1FJGO 1Y1SA 3BMNA 1RLOA 4XOUA 4NMWA 2B78A 2EX1A 2J6BA 3T2MA 4D7AA 1U7PA 2Q7XA 1B3QA 5IY5C 1MJGM 1APBA 3ABMC 1JN0A 3M1IA 4YJGB 4IGEA 1BA2A 3K03A 3QF4B 2VJAA 5H80A 4XDZA 1LPAB 1R4ZA 1R9NA 2HBRA 3REQA 1VCHA 2P4QA 3D4BA 5TIIA 2A5DA 2GK3A 3KYCB 4JVNA 3H6KA 4UBOA 3VHXA 4YMLA 2PI5A 2ZBRA 1NXSA 1TKAA 1E2PA 4EGSA 1M57C 4X92A 2EULA 4LZNA 4L8JA 1QFXA 2HREA 1WR8A 1C9YA 4ZO4A 1H2BA 4W6ZA 3PUJA 4XOIA 4B6FA 3HFJA 5HFAA 3V1TC 3A4IA 2WTXA 4DZZA 1PJBA 3D3EA 3CVOA 3EY9A 4JUAA 3JQAA 3K2IA 2P69A 4K0KO 1F0PA 5HX7A 1JKJB 1DBWA 1LVUA 3KALA 4JUFA 1G4HA 1D2EA 4EUEA 1XGKA 1TUEB 2PL3A 5J2UA 1E2UA 1Z0JA 2CL5A 2BUCA 3KWJA 1KOLA 3BE8A 3AR5A 4KAXA 5K2MA 3W7BA 1AN9A 4BRWA 1UEIA 2AN5A 2BEVB 1E0KA 1M1YA 3CE2A 1Z33A 1JR3D 2J48A 2VF8A 3A58B 3BSYA 4PLVA 2FSIA 4PX3A 1OPXA 4FW8A 3TL6A 5JS7A 4EG3A 2A6PA 4B62A 4DS3A 4YMSA 5HJ7A 3IMGA 5B7GA 4IIJB 4DUYO 1XE3A 4F8YA 1WLSA 4TL8A 2X40A 4TS1A 5DW0A 3TUIC 4BS9A 4KXYA 2BR3A 3I32A 3MCUA 4AILC 1AB3A 1B0PA 1K7CA 4C05A 4ZKEA 5CDTA 1EGHA 5EHQA 3OTGA 3IC9A 1RHKA 4ZKIA 3FVTA 3O91A 4N8SA 3O8BA 1VHAA 4NBUA 5L7WA 4HC4A 1TI7A 2LBXA 3X1KA 3CC4F 3KQNA 3B2QA 3WNBA 1O97D 2O3JA 2PNFA 2QL5A 4OY3A 3N2ZB 3H9CA 1EFVB 3IA7A 3KU1A 3KEMA 1H2SB 2CL6X 2OCCB 2G40A 2C04A 1Y1QA 2NV0A 3GJYA 3OUZA 4Q03A 3T6KA 3THXA 3M6LA 4C7OB 4BKOA 4HEA1 3EWNA 4P93A 3C7AA 5H9WA 2VF5X 3SJQC 1RYFA 2CYBA 5E1BA 1BSVA 1U2SA 3M6FA 4D9GA 4R9NA 3CVWA 3UMVA 4CBCA 3FF4A 4NAUA 4MKRA 4FWTA 2V7UA 4Y2XA 3J81M 5DISB 5J23A 3JTEA 2PRIA 3AR7A 4DOMA 5CA1A 1XJWA 4QO8A 1W57A 3QY9A 7ADHA 3LUDA 2X0RA 4KRGA 4EHIA 2LGJA 2WWTA 4CL0A 1O3YA 1ZLYA 2J3IA 2JBHA 4OUDA 5AK5A 3OAAD 1E6KA 4O4JB 1GTL1 1XMJA 1KC8H 1WU8A 2OT5A 2YQ5A 3N6VA 4FDVA 4IX1A 4QPJC 1WU7A 2I3BA 3GRVA 4ZEWA 3SXPA 1OLUB 3V8RA 1SXJB 4FBGA 2C42A 3BCRA 2WE7A 3KV3O 2I6RA 1H5NA 1NRJB 1ZVKA 1MG0A 1KL7A 4JBWA 4TQAA 1XB2A 3DC7A 3EXIA 1SCIA 4JASB 4M87A 3RC3A 3Q8KA 3UC5A 1GNQA 4P9OA 3T1HO 1QRRA 1JAYA 2FZKA 2XI4A 3SEFA 1U3DA 3ZS8A 3ZZ0A 4KAJA 2WP8J 2A5GA 2J0QA 3KZOA 3UTDA 4FMDF 1DO0A 2C5SA 3L1KA 5GZ3A 5HF5A 1LDMA 2EQBA 4B2LA 1EN4A 1LS6A 4QC2A 1BGYH 3CEIA 2AJ8A 2XVYA 2X8JA 3KQMA 4YP1A 3J81k 4OHCA 5IZ4A 4XLLA 3SHFA 2NQ2C 3K0BA 1H65A 2H8CA 2LWIA 2VJNA 2P4HX 4K28A 5CLHA 1M2FA 1U98A 3N2KA 4K6MA 1JDBB 1L7NA 1DEOA 3PKZA 4PWYA 2YWRA 4YJ2F 1F51A 1I3NA 4YMIA 3TQTA 5FT9A 4ZJZA 1JEAA 1MNQA 3IT2A 5FL7A 2M6LA 1O6BA 2QGZA 1RWVA 4DJJA 4OX9Y 3PWZA 2N05A 4IH9A 1SUPA 4KN9S 3V4DA 1V3QE 1CX9B 1MX1A 5HXUA 1EB9A 3NCTA 4JQZA 2BZ0A 3D02A 4AJJA 4OVKA 4EHJA 4KJZA 1VYVA 3O82A 3RS7A 4Q4HA 1M3SA 2EQAA 5IC4A 3ABZA 3L0SA 2RJOA 1W46A 3MTJA 1RWWA 4UTZA 4WACA 4DG5A 1EESA 1KJJA 3ZDDA 2BR4A 2KGWA 4PSUA 5JJLA 3RVZA 3HYLA 2C83A 2DX7A 2PIDA 4BPBA 5GJWC 5JC8A 3EXG1 4H6XA 1PV1A 5CDGA 2JCXA 1J95A 3HKBB 3Q88A 4ERHA 2LTAA 2DJVA 1CS0A 1PJ8A 4MK4A 3ZU4A 5EIEA 3CJQA 3PXBA 4GOND 4F21A 5DSTA 4OQEA 2DTEA 4KGXA 4CV3A 4OHRA 1WTAA 5A4MS 2IBSA 4L76A 3PF9A 1OLSB 4GKKO 3LCJA 1UP7A 3LWZA 3D0OA 3HABA 1Z7GA 2IY7A 1Q82H 4RZSA 5EINA 3KJJA 1U6IA 5BMVF 3V8PA 1D9XA 2YJ6A 1EFRD 3NANA 3II6X 4HGZA 3U80A 1YVEI 1K4DC 3O65A 3PJGA 1MZPA 2E4VA 2VP9A 4LRXA 1NBEA 1GUAA 1LLFA 2VDNB 5D51S 1MG5A 4YRTA 4XDHA 3GRCA 1NVPB 3TSCA 1JE0A 2M9MA 4Y7DA 1GKYA 2UAGA 5IXJA 4MS3B 1N5MA 3CCRF 4L75A 2X0IA 1QH1A 2HNAA 5AKHA 3H1JH 2D2CB 4R9SA 3L73H 4JLVA 5JFGA 3UMJA 1W44A 2D2VA 4MYDA 2EP5A 1XZQA 2FQQA 5FPRA 1ZU5A 3EDMA 3P2JA 4IUYA 2A3QA 2NN3C 2OBLA 3A27A 5B37A 1KYIA 4EF4A 2OGZA 1EXVA 3O95A 5BN1A 3DSRA 4K3VA 4R7ZA 3CC2F 2G0TA 3KYDA 4JUBA 2Z2YA 2Z01A 1WXGA 1Y1PA 1XZAA 4ZMSA 4BP9A 2Q69A 2YZ7A 3IAM1 2ZINA 1A4UA 3E8SA 3O7WA 4J91A 4MUGA 3RFVA 2YN0A 1W25A 4IS3A 1OHHD 2ZRKA 5G40A 4LOHA 3F73A 2AN4A 2GAFA 1YF2A 4WFGA 1QLJA 3ZY4A 5FYQA 4C6HA 2BRUC 3OO0A 4EG6A 5BORA 4A8HA 2IQQA 2RIPA 2FR8A 5DPMA 3ZI0A 4MWTA 1IATA 1XEQA 1DC5A 1EX9A 2OKCA 4JI1B 2VCHA 3C3MA 3MF4A 4QGBA 2NTJA 4GVLA 2J9GA 4AKGA 2IUTA 3R6GA 1P17A 1SEVA 1SMKA 3LOQA 1SUFA 4TRNA 1D2GA 4V3CA 4XGIA 5LLSA 4E3ZA 2HT1A 2ERCA 1VQVA 4CMEA 3C3XA 2GUWA 4L0DA 1QF6A 3OW2F 1YJ9F 4OUKX 1G3QA 2HDOA 3OZIA 3V4ZA 4YCJA 3AJDA 1G5IA 3L41A 4A73A 3UPTA 1WDKA 2IXEA 2JCGA 4AX4A 1CFJA 4I1UA 1HSZA 1N1DA 4JH0A 1H6DA 3WGLA 2PD3A 2C5HA 4LY9A 5FXMA 2FPWA 2ZSHA 3FVVA 3RSFA 2QLTA 5HQTA 3J81A 1KAQA 3UT5A 4TGLA 3UATA 1PNRA 2H2FA 4B47A 5K3OA 5CIWA 3V2HA 4J75A 4O29A 1Z63A 1EFAA 5DHQA 1CJTC 1MC8A 4QM6A 4EGFA 2ZUUA 5KYUA 4AJNA 3VU8A 1YASA 3HRKA 4LQDA 1F8GA 4UVAA 1EWTA 1JIJA 2YXPX 3LF1A 1E18A 3ONVA 4B09A 3EIQA 3DLPX 4B4DA 1GAXA 3QBTA 6REQA 4BFSA 4WGGA 1XZGA 1X1QA 2P9YA 1KK2A 4YROA 4WMLA 4DR6O 4XXHA 3IQGX 4YP7A 4GQBA 4EKDA 1NULA 4CI9A 3CX6A 5KNBH 1YD7A 3VDMA 2DFVA 1LH0A 4AM8A 4FC6A 4PDLA 3RCBA 2QM7A 1ONBA 3DZIA 2NYRA 2J6CA 1IBRA 3LKZA 2AEJA 1OHHG 2GKSA 1Y76B 3BICA 3O4JA 1QYIA 4NQRA 3PPXA 3JAMN 1KOJA 3VSEA 4ZYWA 4GP9A 5EC8A 1IZ0A 3BMXA 3VR3D 1COWA 5HM8A 3WK9A 1DJNA 5EFOA 1W36B 1QBZA 1N6KA 3EAFA 1PR6A 3R09A 4KLZA 5I8WA 1Q15A 4WA7A 2WI8A 1K3FA 4V0NA 3JWHA 1CUBA 3G0HA 1CUUA 3QE0A 1AF4A 2QTNA 1DDIA 4NPCA 4D79A 4DXHA 4MCHA 5KTKA 4BUJA 1L3IA 1JZTA 2WWHA 1WMDA 2J3EA 3R4VA 3WL4A 4S12A 2BDUA 3KOZA 3HC7A 1ZR2A 1SHKA 4J7KA 3CU5A 3RSQA 2AXQA 4DR4B 2R5NA 5EJGA 1TCUA 4WOCA 1H2NA 2Q1TA 4NS4A 4ZHQA 1L4EA 5E9QA 3TSZA 1G8YA 3JARB 6LDHA 3K71B 4NIMA 2TMDA 1T2FA 1YTLA 1DVRA 2C1ZA 2C78A 1YVUA 3DE3X 3FWKA 3H8SA 3I6YA 3SEAA 3VR3A 4C5AA 2YRWA 4RQAA 5E6SB 3H7AA 4IOLA 4UV8A 2WE8A 1M10A 3H2ZA 3OMAB 1SC6A 4TV8A 1XQXA 3QUSA 2Y99A 1PGQA 1UKZA 2BISA 2OGTA 3GLHA 4NTYA 1E1CB 4OOEA 2GD6A 4UDYX 3P2EA 4ZO9A 4DVGA 1KQ3A 2RI6A 2CB0A 4C0LA 4DIEA 4UBKA 2J4DA 1PO7A 5JYDA 2QZJA 5K0SA 5AVMA 1ZP6A 3IIKA 4A92A 4B31A 1RM5A 3PC8C 3AW9A 4C21A 1EPUA 1OZGA 3C3CA 1OXVA 4AJ4A 4US2R 5JECA 1NQVA 1ULTA 1A82A 5CGZA 3K0AA 3GW8A 3ESAA 3QA3E 1T5IA 4DLNA 2E55A 3EFHA 3VBBA 3AUJB 4Q5IA 5CXXA 3ACBA 2XCQA 4LWPA 4MS3A 3B1VA 4G2NA 1VIAA 5IDVA 4DQUA 4YRAA 3TG2A 1A8IA 3K4HA 4EENA 3WLRA 2VYNA 1JEYA 3H17A 2RAVA 3UUGA 1IUPA 1M8FA 1J0EA 2C2MA 2V9PA 3A6GA 1NXQA 4W5NA 1HT2E 1N2HA 3R0JA 4K0RA 2DYKA 2KM1A 3PYLA 5KA6A 2YN2A 3AVQA 4JNCA 5KTRA 1Y4AE 3DV0B 1JPXA 4URFA 2Y05A 4X1IB 4DZTA 3B53X 3UTCA 4CIXA 2ZAMA 4QEKA 5K6AA 3AB8A 2P40A 3OOJA 1R0YA 4P3OA 4N3BA 4XIJA 3DF7A 2GNPA 4DEXA 2VBFA 4W99A 5EI5A 2N46A 1BYUA 1C1YA 4PLCA 3PZRA 3QITA 4R8SA 1EK1A 5L3SB 1RMTA 4IDBA 5CX1B 3QLUC 1YDWA 4B9AA 1RQPA 4G36A 1XXHA 4C3VA 2QMHA 4WKPA 5LYYA 5U4QA 3A10A 4OB6A 2FNAA 1LLCA 5G4KA 5B4TA 1ZESA 3JQFA 1OKKA 2NYUA 3B9PA 1GV0A 1XR3A 1XTUA 2KTUA 3B3GA 5AO9A 5LB2A 4BTLA 1KRWA 4MUAA 4NDNE 3ZWQA 5K0BA 3VYUC 3TSOA 1VRWA 1ZBQA 2EL9A 2HU5A 2OV2A 2UUOA 4GKJB 2HGSA 1RYZA 1UODA 1X7ZB 3WYFA 4MUKA 1S01A 2VRCA 3QPUA 4JAAA 5DNAA 3UHJA 4PVCA 3AQ4A 4MP8A 4V0OA 2PV7A 3HUTA 4QZVA 2ZYSA 1Z4KA 3B3AA 3EULA 4OHMA 2YIBA 4NX2A 5CNIA 5ECGC 3D2AA 4EP1A 1O87A 4L07A 3FWZA 4ABYA 1PGPA 2OHVA 3CLTD 4LZOA 2QVGA 1C80A 4OHYA 4OQQA 3BM5A 4GLBA 3W8DA 3KQQA 3LLVA 8ADHA 1JDSA 5TT0A 4DNPA 4G41A 4FCCA 1ID8A 2HVKC 1VQMV 5F4BA 5L3ZA 2BDEA 1USUA 3PFFA 2UUAB 1JYEA 5TGDA 3EXG2 5KTSA 4BU1A 1EXNA 4TM7A 4DANA 1Q0RA 3G9QA 1UBGA 1OV6A 1I8TA 4FD3A 4QDTA 2BFBB 3T3HA 5I4CA 2IXAA 1A1VA 5FLEX 2NVUB 1KORA 3DEHA 5IF9A 3DC2A 1QR6A 1NPYA 3B89A 2GJ8A 4GWLA 1PS8A 3LDEA 1I4WA 2E0IA 2GI4A 3KWMA 5ENDA 3R76A 2GBLA 3W5JA 2GDSA 3HJHA 1JU4A 1BCSB 4F86A 3PKIA 4RYLA 1KEWA 6NULA 3ZJVA 1P4JA 1ZLXA 4GYJA 4XSGA 3T1YB 3ZR4B 1PR0A 1DJPA 2PO5A 4GF5A 1K4CC 3KCXA 4B33A 2UVPB 3LLSA 1XNRO 2IZZA 1KYZA 3ZZNA 1HRDA 2RAFA 3O4GA 2UYCA 1FDSA 5DM4A 2YMQA 4KBGA 4PJ0Z 3ZHSA 1E5LA 1N34B 2CFIA 2HCJB 1B8UA 2CVOA 2HA3A 2XUHA 3BXOA 3Q2IA 4ZQFA 3HNOA 1Z2CA 3ROFA 2QTPA 1P29A 4LWZA 1WCIA 3MD0A 1M4UA 3D01A 3KIPA 1PD3A 5HZKA 3DFIA 3B6NA 4I55F 4R0NA 4BIMA 2OHHA 5GPBA 2ZQMA 2FPGB 2VP4A 3KXPA 3ROXA 1XCPA 4EHDA 2QTBA 4LHYA 2OFXA 1QUFA 1AKQA 4UW9A 2K1SA 4C0KA 4BP8A 3ELYA 2AB0A 4FGZA 4G3XA 4WKCA 5TE9A 1P49A 2AMLA 3WV4A 4XVRA 4UPDA 4C14A 3MWGA 1L8DA 3PUWA 3OCZA 3FDZB 4G1EB 4XB2A 5EGNA 2Q67A 5EKUA 4B3IA 3U4MA 3WJAA 2GCOB 4IVQA 2IW1A 1KYWA 3CZCA 4KR6A 1MNGA 4LXUA 2M1ZA 1VQ6V 1C3LA 4DV1O 3CXRA 3DE5X 3DT8A 1LR1A 3UXEA 4RK0A 4L5CA 3OUSA 1QH9A 2CXRA 1AHNA 3BQNB 3USES 2B3TA 2BM9A 3ELUA 2LVBA 3N2LA 3QBVA 4DCUA 3L77A 2X9QA 3QVWA 4FQ7A 5AVZA 4M36A 2C9BA 3QPDA 4BTEA 3VOAA 4YMUA 4ZOQI 2MSLA 2JIZD 3EQ2A 4ITVA 5IH7A 4ARAA 1K8ZB 4BFCA 3VC2A 2AN9A 4YTEA 2Z4SA 5E7QA 1VHWA 2A1UA 3RVRA 3V9PA 1Z62A 2NVWA 4M37A 1E3WA 3E18A 4WZBA 4KVFA 1VPVA 1YDFA 4NNOA 2AG1A 4QFDA 2G88A 4AY6A 4JUCA 1TO6A 5KVCA 5GM1A 4JTCB 1I08A 1M1UA 1NYQA 4DSTA 2C88A 1ODIA 4OP3A 3ZGVA 1M7HA 1NPTO 4CG0A 4TTSA 4OKNA 3LY8A 2PHNA 3AK2A 3VX3A 4KUMA 1AY0A 4U7JA 1JEQA 2FG5A 3Q7QA 3G0OA 3LUPA 3GRRA 4D92A 1V39A 3WZ2A 1QHTA 2OV1A 3PSAA 4JOSA 3G6KA 4TT3A 2SCUA 4DQKA 2NSHA 4S3MA 1IULA 1S3SA 3AR8A 1T2VA 2KJQA 2PO7A 4E88A 3C3JA 3JCUZ 1FTSA 4B5CA 3DTNA 1FRFS 2IEBA 3RC9A 3TR5A 4EG0A 5AVKA 2WNSA 2P2ZA 4F92B 1WW2A 3QV1A 4TZ6A 3ILHA 3RFCA 3HN7A 3PAFA 3F67A 5JV5A 2O8EB 2XA1A 1KGSA 1NNUA 4HDSA 4ON9A 1KPIA 4FX5A 3QU2A 3SLKA 4M1WA 3ZW7A 3OBIA 4Z4EA 4OQLA 1PG2A 1S2NA 1UMCA 1M7BA 4WKBA 1XC7A 2ZAGA 2AEMA 3S29A 4GU5A 5D87A 4R1LA 1ZD8A 2FEMA 1PFVA 3LSQA 5E0KB 3RASA 5D7BA 4AL4A 4BP1A 4EJSC 2X8WA 3HCBA 4NHOA 1ZNZA 5LGTA 3ZK8A 1VRCA 2VVTA 1W34A 3WQRA 4EEZA 2D7DA 1E7MA 2ST1A 1G20A 1WRBA 2W6ZA 1XZCA 1LC3A 3RK1A 1CTQA 2WD7B 4BE7B 3VZQA 1K7FB 4BJHB 4IXTA 3HADA 3QJYA 3UJCA 1UJMA 4PNHA 2CZGA 1NVXQ 4IDFA 2ORYA 1SS3A 5L3CA 3CCUF 2GYVA 2QTWB 5CA3A 4MW5A 4P38A 2G76A 3C3PA 4DJ5X 1KYQA 2PH7A 5JE8A 3N8NA 5YASA 5LQAA 5LP6F 4XQ9A 4ZOEA 4CFYA 1H6BA 1JS1X 1UM9A 1VG9B 1MUUA 1QH0A 1PR4A 1U4SA 3CIFA 4LVUA 4WK2B 5DIFA 3TRDA 1W49A 4RIHA 1Q20A 3AGQA 4B76A 3LFOA 1Q95A 1KKDA 2ATVA 1MZEA 3OZXA 3F1KA 4P3PA 4UFZA 1GG2A 4HX9A 4KAAA 2FSGA 3FKSA 4IIDA 4IMPA 4MS4B 4OBBA 2O57A 1ENVA 3F90A 4FEEA 1M1NB 1DKMA 3CC4V 1U4OA 4KFSA 2Y4TA 3W7SA 3SPJA 3JAKA 3MJCA 3AEQA 3SF0A 4EFLA 6YASA 1B0AA 4H17A 4RVOA 1LZKA 1V5IA 3OX3A 3NTLA 4WNIA 3TNJA 3Q11A 2LIVA 1H4VB 3SQXA 3C1OA 1JDBC 3CPJB 3MELA 5F3DA 2BFAA 5HCNA 1Y1RA 1EEHA 3AT1A 1THTA 3BH6A 4G4IA 3C0KA 3TD9A 3UG7A 2EW1A 3RD5A 1I3KA 1VJCA 4DY4A 1ZK2A 2YV5A 3AJRA 3QPBA 4K9LA 5LBTA 5JSZA 5IS2A 1XA3A 4JI0O 1SUAA 4NEGA 2XOXA 2P6JA 1FTQA 1UKAA 4G88A 4OLBA 1J06A 4X7RA 4EIWA 4BVEA 1RCUA 1B8NA 1CYDA 821PA 5KYKA 3TOCA 4YCBA 4WIAA 1Y67A 5G41A 3ELCA 1J8YF 2Q3EA 2V98A 3IEIA 4G0MA 4CCSA 4O8ZA 3R66A 1NJ1A 3EHEA 3TF5A 1JECA 1VLJA 3SIXA 1V4VA 3B8NA 3R44A 1VH8A 4XRGA 3NC1C 4HO1X 5GINE 5LD2B 1Z74A 3BQMB 2P9EA 4UMFA 1E3TA 3QELA 4MROA 3ROZA 3HU3A 1XNQO 3WRYA 5CB8A 2R0QC 4JI5O 5D5HA 4J6FA 5CB4A 1UAAA 3QFSA 4PPGA 4BAYA 1C7ZA 1W88B 4Q93A 1IXSB 3P2KA 1KQSU 3RRZA 5KSOA 1KC1A 2VRBA 3MAAC 3IIMA 2ZIUB 3MCWA 2I78A 3PRYA 4IL5A 2P9HA 5KQPA 4B7AA 2JLUA 1W55A 4BKPA 3O4VA 2FPPB 1U9YA 2WR8A 2OWDA 4JJ6A 4LK2A 5CVEA 5JDIA 2ASVA 1J70A 3P8ZA 4G4YA 4BVHA 5IVHA 2P6YA 1K6MA 4IUDS 4K2AA 3PIIA 2ZAIA 4DR1O 4CEJA 4K35A 2GN6A 3Q40A 4ODIA 1R6TA 3DVRX 3GJTA 5KNBD 3N70A 5EXTA 2II6A 3T3DA 3FJOA 3SXJA 5GGYA 3AIKA 4MV8A 5DCWA 1BMTA 4BDTA 4L08A 4OJMX 3NEJA 4UHCA 3DLTA 4NH0A 4NYIQ 2QK4A 1UK8A 4Q37A 5PGMA 1Y7PA 2O2CA 4II3A 5T4EA 3ZBTA 2PG3A 5AD1A 2A9JA 1IQPA 1I4EB 1L4HA 3IAS1 4XPZA 2F17A 3T1HB 3M2TA 2UZ0A 3TZEA 1SURA 4D6XA 4LDZA 3WG7B 1PD1A 5AR1A 3X1JA 1DCMA 2AI1A 5K8CA 4ZVLA 2DEUA 1TJNA 3MIZA 5IM5A 3WAKA 4Q66C 3OCWA 4F1WA 3O4IA 4FILA 4TMYA 3GX1A 1BCRB 2ID8A 3P9CA 4UMVA 3GXBA 4GOXA 5DGIA 2VS0A 4OHVA 3WDSA 4DSAA 1C3VA 2IBMA 1K0FA 3W5VA 3A36A 2B8NA 1NSTA 1WUHS 3TB6A 4G01B 3KOUA 5CYFA 1FFBA 4GYCB 3M49A 1QG2A 1FDRA 2KHZA 2ZRHA 5F98A 5CAEA 4KFTA 4PGHA 3VZCA 1M67A 3OOEA 5TC4A 1BWPA 5HTKA 1RP1A 4O5OA 5ALYA 1E3QA 1FVOA 2PKQO 2WJ6A 3LZDA 3RS9A 1N34O 1L4MA 1BDHA 5JZVA 3B20A 4CEIB 2BW0A 3PRKE 1MQ9A 1YSCA 3AV0B 4B80A 3N75A 4GLJA 4E1AA 2WUVA 5BN5B 4RKEA 5EMNA 3S02A 1U8EA 2AI2A 2WU1A 2FZVA 2LGQA 1K73W 1LDYA 3IKFA 2QQFA 5A4IS 4TV9B 1CG6A 1TU3A 2XNSA 3MOIA 2WU4A 2P9JA 2ZSJA 4B6EA 1I0ZA 4GSYA 1IURA 2Z04A 3M9LA 4AMUA 2YFKA 2B1GA 4JFAA 5JY6A 5KJ1A 2Q3FA 4N40A 1VQOV 4LYHA 1Y6ZA 3K79A 5FFFA 1TC1A 4HFRA 5J43A 1KQFA 5CU7A 1Z45A 3W7WA 1PWYE 1Y5RA 3QKWA 1JB1A 1GKUB 1XD2B 2RHBA 1R16A 1ZICA 1AC5A 2BGTA 4G56A 1W5TA 1DGSA 2PF4E 5KQSA 4IIXA 2G1PA 2L2QA 2PEZA 1N0WA 4PX2A 1PSWA 3L0IB 1II9A 3W78A 4DJFC 1V8FA 2HLDG 1RBYA 2AG8A 3AEQB 3PQ3A 4L6IA 5GTIZ 2DU8A 3KYCA 2CLCX 1U7XA 2QRVA 2HKOA 3E4CA 3K5PA 2AD1A 1U1DA 4IOMA 3AKEA 5HCUA 1LW6E 2X58A 1CZOA 3GMTA 3T34A 1TA8A 1M75A 1H69A 1AKWA 3DOCA 1PYOA 1E1QA 1RIIA 8ATCA 2FPXA 1GPMA 1L4GA 1KI8A 3LU1A 4HQNA 4JLJA 5JTTA 1Z5VA 1D2HA 3KKYA 2BC9A 2ERYA 4M22A 1NBWB 4UC0A 5HILA 4UCVA 3SJBA 4EFDA 4IJMA 1NVDA 2R1TA 2UYYA 4RKYA 1Q11A 2P6PA 4JJIA 3F9RA 5J4KA 3CVXA 1GM9A 3RBZA 4XD7A 3G8BA 1NJIW 3MUFA 2BE9A 2QHXA 4JB3A 3F6RA 3B85A 2QZ9A 4LCEA 3SPIA 6PFKA 1GGNA 1VHDA 2FX2A 2NPOA 1P3Y1 3PBKA 1K3UB 2QNRA 1YEWA 3OPYA 4X3CA 4ZVSA 3SF8B 3SJCA 3UV6A 1QU7A 1T5EA 3QELB 2Q6OA 3B1KA 3FHLA 3I4CA 3K4PA 1ZQ1A 3VQVA 2NT4A 1YHQV 4FT2A 4TWJA 2XTAA 1ES9A 4O4HB 5BWBA 4KREA 3TLKA 1O5OA 1RAEA 1RAAA 4LKOA 4WCVA 2JIRA 4WKOA 4AMGA 4DV4O 2XNDG 3NBAA 3RFUA 2VG8A 4TUYB 2Y1XA 4S1TA 2R5FA 5LZ2A 4B6GA 3RT3C 3BABA 3NIDB 3K57A 5I4KA 1E4VA 1UKVY 3OEHA 4Q34A 2R1VA 1H8HD 1U31A 5AM4A 2ADMA 3HA5A 1OWOA 4MRNA 4XA8A 2A06H 3OH8A 3WJ7A 4I1SA 4UDOA 1SCDA 1KZ9A 4UUQA 3KK0A 1C7FA 2CJFA 5DGDA 1YRHA 2PUHA 4ACBA 1Y6JA 2ECKA 2GARA 2I99A 1EM1A 3DGFC 4LJ7A 2ZRDA 1FAFA 2C97A 4PO8A 3RYTC 1KYYA 3FWNA 1BD4A 4WTOA 1Z0UA 4BMPB 5EJEA 3VBCA 4XDKA 1KSFX 2G71A 4KZPA 1HDJA 1U2EA 4FN4A 2XCRB 3FOFC 2HQSC 1OSNA 2DBVO 2PUEA 2SECE 4JCCA 3HUEA 3QOYA 1Z0IA 1DBSA 4WZZA 3OX1A 1F0NA 3CBGA 3O03A 1NI3A 4AWBA 1IK6A 1RQRA 1SUDA 1X7WB 1QVGF 1YOVA 3U11A 2Q07A 3R6TA 4Z7JA 1V7PC 2WAOA 1JJ7A 5IJWA 2XKJE 3HYRA 4OLJA 2YFHA 4DIKA 4TMXA 3PPIA 1TT5A 2Y0EA 3WC4A 3ZHYA 2NU6B 2IEZA 1X19A 4UV9A 5A7GA 4FM9A 5CIYA 4IYIA 4Z9AA 3IXLA 1XHLA 2HSWA 4OHWA 1XT6A 4OK5A 2R9IA 3DUFA 4P8RA 3MFYA 1I2BA 2Q5IA 4F1KA 3PPYA 4J4HA 5AM0A 5DYIA 2XB8A 4CLRA 2RH5A 2AV6A 4CS2A 3I0NA 1UBLS 3AG3B 1J9GA 1NBAA 1TA0A 4BLTA 4D44A 3EF1A 4ENTA 2JFUA 4KRYA 1WMAA 2JHGA 2GQ0A 3R0IA 4FYIA 3KJFA 5HJEA 4LQLA 1ORDA 2Z2IA 1HG0A 2YCLA 4DR4O 4ZHVA 2YEVB 1D5NA 1YRBA 3AHHA 2N74A 4B2YA 3NOVA 2W37A 1JI3A 4NCHA 3M89A 5SZKB 3KOYA 4HGNA 5FJJA 1N1EA 5F4ZA 4BX9A 2YDYA 3IUBA 5DLDA 4EMBA 5IDWA 2XWJI 3CCQF 1D4FA 2G09A 5E3JA 4LXXA 3DYBA 4UDXX 1FOEB 1ST2A 3TZ6A 5E1AC 2V7QG 3SE7A 4YYZA 2FWJA 1FUYB 4XIYA 5I7VA 1YHYA 2PZAA 5BRNA 1XU9A 1NNEA 4OGFA 3PLNA 4EUSA 1V8OA 2NUPA 4WFFA 2B5WA 3JYQA 2BE7A 5IVDA 4D4GA 4DDVA 5F3WB 2GESA 4RPHA 3SZLA 2VJDA 3DMPA 3MN1A 5JJEB 1Y9EA 3ZS9A 3Q3CA 4RV5A 3K9BA 1Z5GA 4JZGA 2G36A 3W04A 2OCLA 5ELMA 2C2BA 1C2YA 4YRIA 3K6SA 2ITCC 1OZ0A 3JWGA 4R71A 5AT1A 1TCAA 4JLSA 3D6AA 4GBED 2HDWA 3UAWA 3WSVA 4W7HA 2ZP1A 1YJ5A 4PONA 3R5XA 4TWKA 4XUGB 5A5FA 4AI6A 5BQFA 2HMYB 2IV3A 4PFJA 3QLTA 4NBSA 3TSYA 2DYRB 1RYMA 3OGIB 2NU7A 5KU1A 3L93A 3ST7A 3I7TA 3BMQB 3P20A 4BNKA 5HRUA 4ZYLA 4AKEA 2RHLA 3D6TB 4N76A 2V58A 5BOVA 3RG8A 1KWKA 1PFWA 4GRAA 6CHYA 1UR5A 2GETA 4YMWA 4PQGA 3DZBA 3IR5A 3V3TA 1BHSA 1UJCA 3OZUA 3PG5A 3JALA 4HNAA 1USVA 2CXSA 4HPWA 1FYDA 4OLHA 1VE6A 2Q4PA 3GO4A 2KYRA 3SVZA 5CN0A 4BZPA 2P27A 4QRIA 4BKMA 2C9MA 1HE4A 2N42A 3N8GA 2OWEA 3QTYA 1CR4A 1W4RA 1Y3CE 1KXJA 2BRUA 1YB6A 2FMUA 2IPMA 2TECE 3D5TA 4FKZA 4GMDA 3ND8A 5B6PA 1L7RA 1LQUA 1YH3A 4YPOA 2G1AA 3CC8A 3NEAA 5EQFA 4BT4A 1QIDA 3UENA 4BEWA 5HOEA 4Y98A 5ICFA 4XH9B 3BGVA 5A03A 4F7DA 2AOVA 1XCJA 3RQIA 2Y1LA 3QE4A 3CRAA 3NXKA 1Y8QB 2CF6A 4B3SO 1C30B 1DTWB 3BFKA 3IQXA 4BNJA 1W59A 4FK8A 2Y0PA 4DV5B 4DR3O 2RAPA 1UWKA 1P1JA 4OAOA 2WSIA 3KKOA 3S40A 2WA3A 1FMFA 4PXYA 4TUYA 4EYOA 3JVDA 5F64A 4CM4A 4PHTA 4WEQA 4RELA 4XYLA 1QQ7A 3FRJA 4IJ5A 2GSDA 3BRCA 2EZ4A 4OGLA 1ONIA 1P4RA 1ZMOA 1E4YA 1TM3E 2CZQA 4B6JA 4WN3A 4WXPA 3KQKA 1D04A 2Q1SA 5FV7A 5JCOC 2HX1A 3PL1A 4LMPA 1UJ4A 2FLKA 5BMOA 2CVHA 1DFIA 4HXFB 4R1TA 3SR4A 4Q9KA 2NXWA 4PC7A 2QIOA 2WFZA 1JNYA 1KE1A 4B5LA 2W6JA 3KQUA 1U3UA 2ZVJA 2QRMA 1CE8B 3F4BA 2O4CA 4PIPA 6ADHA 1GV1A 5FEUA 3B5IA 1BXGA 1T15A 1XDCA 2UXBO 1X1CA 3VH1A 5B58C 3ZVNA 5CNMA 1UK6A 4OQDA 3WRVA 1L5HB 4IYRA 3S28A 1WA8B 1C1XA 2Z58A 3BL6A 4CF5A 2FN4A 3HY6A 1GLVA 3VYSC 3T7EA 4B4WA 3IUQA 1JRLA 4TTVA 4ZRDA 3C90A 5AKZA 4TS9A 1EUDB 4RX1A 4MH0R 1NE7A 4DV6B 5I7EA 1P7ZA 3WO1A 2NU6A 3FCXA 2FMFA 3M7MX 4CCYA 3FNHA 1W0JG 2GWHA 3GQBB 4BLWA 1FL9A 2XB4A 1YKGA 2F1JA 3OIFA 1OFIA 3PDCA 5CW2A 4YASA 2WVJA 3GAFA 4OQPA 3T9DA 4Z49A 1QGZA 3EIHA 3DDZX 4G1BA 4YREA 5BR8B 2D3OW 2JARA 5CVVA 4HYEA 2FGYA 3UW3A 4NKRA 4PZPA 4JDPA 4PFSA 3ROGA 4Q3CA 3SYNA 3IHKA 2UVQA 1Q0UA 4ZKDA 2FUG6 3F6PA 1U0TA 2JH8A 1XZIA 3I1JA 1JHYA 4IPTA 1KDYA 1P0CA 1X1SA 2XUKA 3QX9A 1E94E 3LX8A 4LHSA 1KSGA 2G77B 1PJ3A 3WJ1A 5HZGA 5A0TA 4JQOA 1G42A 2PGAA 3QVMA 1KZ4A 2ILMA 3FFXA 4UAGA 3SNHA 1ZM3A 4BGDA 3K5LA 4O4JA 2HMVA 2RGUA 4LOAA 4ME6A 1G7TA 5JJNB 2DPMA 1FX1A 2BFNA 3KE1A 3G80A 1FYJA 1TJ4A 1SUSA 3WWZA 5JZMA 4K6OA 1ZEMA 1U8UA 4R5MA 3SYOA 2FPLA 4LOLA 5ALHA 5HS6A 2FZ5A 2C2YA 1A5ZA 2JFVA 1U90A 4JASA 3JVVA 3JYLA 4GUDA 1UJ5A 3AEUA 2C8LA 2ZATA 4N9QA 4KWEA 4ZRNA 5GV8A 3UZUA 3A4YA 3ETJA 1IE3A 1X7XB 4A5OA 5AW1A 1NMZA 2XHZA 2YMLA 1DZIA 2B37A 1OPRA 2UU9O 4IVPA 1QQBA 2O59A 1QIIA 1AO3A 1L0BA 3AXSA 3QTTA 2ZPAA 3WMFA 5AKIA 4BW9A 1TVKB 5EWLB 4A26A 2VRCD 3M6WA 3OCJA 3G1UA 3J7AC 3CD6F 3HTNA 4RV4A 3KZXA 1JA8A 3ISVA 5E8JA 3I3SR 3K6SB 4ZQIA 4I4NA 4QUKA 1VE5A 1ZEJA 2HSDA 2QLFA 3AVPA 3FPKA 3MWLA 4RWEA 4S2UA 2YIBD 5H3LA 4EJSA 3CRW1 4ZEXA 2MJLA 2ZI5A 1QWSA 2FPUA 3IKMB 3L1JA 4ZVRA 2EINB 2QPAA 4O2AF 4DDHA 4ZJPA 1JMYA 1MEOA 3G68A 4OBEA 2OCCC 3RU2A 1TF7A 3CE9A 3LHKA 3O73A 4GG1A 3M5PA 4HDKB 4DYDA 3D5QA 2Q6VA 2BGLA 3T1YO 5K03A 3ZUPA 1LWOA 3EXEA 3H2IA 4NVPA 1U0HC 4JHXA 4WT7A 5GZ6A 3ASYA 1U94A 4TSRA 4RMHA 1A2OA 4JLDA 5KWSA 1H8HG 1YAHA 1U0GA 1YRAA 5CJ2A 1TOAA 4RA6B 4PNEA 3LWQC 5JASA 4PGAA 4PDMA 3GNLA 2XDQB 3I73A 5D1HA 4ZT3A 2BFCB 3L6EA 4OI2A 5BV8A 1CR2A 5AJWA 4WUTA 5B12A 3E8FA 3ZHOA 1BT8A 1FNCA 2QZZA 1O0BA 5FUMA 2PX8A 2K4MA 5EA2A 4C4XA 5CH5A 4RPCA 4AZSA 1XEXA 3K05A 2DPYA 4BCCA 2FL4A 4HRXA 4CMAA 1DKRA 1LQTA 4BWAA 1RVV1 5FCDA 3KQWA 4C0HA 5GTHZ 3LCVB 2VSFA 2QUAA 1SQFA 5CK4A 2H7YA 3AWIA 1IUNA 2ZM5A 1HDZA 1C30A 1KU6A 1Y5NA 2WIKA 1NG1A 3H1GA 5H81A 3H1BA 3SLGA 2P22C 4LFBB 1GO1A 3E81A 2ZJAA 3GGSA 5HGJA 3S7TA 3NHFA 2WF5A 4F5ZA 1M1KH 3EZ7A 5HIJA 4C3ZA 3A8TA 3D43A 3LGXA 3RU7A 2Z8XA 1IDOA 4FUQA 2CLMB 2XKKA 1ZGAA 5AJVB 2Y1WA 5J5VA 1X94A 2ZSDA 1K5DA 4UCFA 2ZZMA 1XDWA 4IWNA 1SHTX 1CIVA 3R9WA 1QUEA 4AYXA 3OQ1A 3L71H 4HAVA 5MN6A 5IM4A 4KUHA 2OORA 4G5XA 3HLYA 3MCZA 4KC0A 1NJGA 1U1GA 1LPBB 1QGED 1ETHA 2WY2D 4MZXA 3SVLA 1KJQA 2W98A 4ND3A 1T9CA 1SXPA 1W85A 4RM3A 3HWUA 2GNAA 4RACA 2VDQB 4E5YA 1YRYE 3QUQA 3GPIA 1YUBA 2R9VA 2JFZA 4XUEA 3W5SA 3CRMA 1C41A 3QMVA 4NJEB 1KI4A 1KMNA 2QRNA 4JI6B 3N3BC 4NR0A 2WTUA 1ZMTA 4BHTA 4XRRA 5ENZA 4DR7O 3ZRVA 1DRVA 4A8JA 1RWXA 4DRYA 3KOMA 4RUKA 1OB5A 1MHTA 4JDUA 2WPDA 3GFOA 2GBOA 2UZHA 4Y67A 4Q9JA 3P2OA 3QKSA 421PA 4PG4A 3TB4A 3EWIA 1USKA 5FLXM 2FQYA 2OUKA 4Q7KA 1NVAA 2M6YA 4QOEA 3DVAA 4LF5B 3EXHC 3G82C 5AHKA 3ZWOA 4U3FH 5AQ1A 1RP7A 5KYVA 4LI3X 1E79D 3HCNA 3BH7A 9LDBA 1A8HA 1UZAA 2VKQA 3HFGA 3TM4A 4YRNA 3MOSA 4ZOLA 4HWOA 1KMIY 3DBHA 3D8NA 4ER3A 3FBTA 2I4IA 3U4QB 3G71F 3CUVA 1WOYA 1RVDA 3QGMA 5LFAA 4LAFA 1X8LA 4KI0A 3K9AA 1MQAA 3NVIB 3OKFA 4KO3S 2VF4X 2W2LA 1GGKA 3NIBA 4H7HA 4Z4HA 2NNUA 1QHIA 1GPJA 4ZDIA 3CRRA 3GZ4A 3EEFA 1RQNA 2GPJA 4CC5A 4XCQA 3WLKX 1OXSC 4NBNA 3JWJA 4DLZA 3MA0A 1ZCZA 1Y9JA 3LM8A 3AVOA 5KYUB 2VHUA 4DXDA 2XMRA 1QTIA 2UXBB 3T7IA 5LHIA 2I1VB 4QBKA 5EZYF 3WFIA 3NC4A 2E9SA 1NU1H 3DULA 3IURA 1G98A 4GPZA 2ZKOA