5KMGB

Near-atomic cryo-em structure of prc1 bound to the microtubule
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
431
structure length
431
Chain Sequence
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Near-atomic cryo-EM structure of PRC1 bound to the microtubule.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Tubulin alpha-1B chain
total genus 176
structure length 431
sequence length 431
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 5kmgB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 5kmgB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 5kmgB01
4TV9B 4HNAA 4TV8A 5J2UA 3JATA 3HKBA 3JASB 4TUYB 3UT5B 5CB4A 4B45A 4F6RA 5CB4B 1FFXB 3R4VA 3JAWB 4O4JB 4YJ2B 4O2BB 5MN4A 4FFBB 5LOVB 4ZI7B 3VPAA 1TVKB 4LNUA 3VO9A 1TVKA 4ZOLB 5ITZB 5CA0A 4O4IB 5EZYB 4I55B 3RYHB 4I4TA 5JH7A 5EZYA 5EYPB 2RHOA 5C8YB 4O4IA 1W5FA 2RHLA 4X1YA 3WGKA 3UT5A 3VOBA 3HKBB 3HKDA 3ZBPA 5J2UB 3HKEA 5IYZB 4TV9A 5JVDA 3HKEB 1W581 3JAWA 4O4JA 5J2TB 3RB8A 4YJ3A 5J2TA 5IJ9B 5JCOC 3JARA 4B46A 4IIJA 4X20A 4IHJA 5CA0B 3JALA 4EI7A 3JALB 5KMGA 1JFFB 5C8YA 5LYJA 3C8LA 3M89A 5EIBD 3RYIB 5JH7B 4X1KB 4M8IA 1SA0A 1W59A 4EI8A 3E22A 3CB2A 4I50A 4O4HB 5LXTA 5GONA 5IJ0B 3N2KA 3WGNA 4TUYA 4O2AA 5KX5B 3N2GB 4IHJB 5JVDB 5BMVA 5IYZA 4DXDA 4YJ2A 3M8KA 2XKBA 5KX5A 5IJ9A 4EB6A 3JAKA 1TUBB 4O4LB 4U3JB 4ZHQB 5LA6A 5LP6B 4YJ3B 1OFUA 3VO8A 4U3JA 3ZIDA 3JAKB 4ZHQA 5M7EA 3E22B 5FNVA 2R6R1 3RYHA 3RYIA 2R751 4HNAB 4TV8B 4KWEA 5LYJB 3ZBQA 5MN6A 2XKAA 5JQGA 3N2KB 4X1YB 1RLUA 5GONB 5MN5A 4O4HA 5CA1B 1SA0B 3VOAA 4X1KA 3JARB 2Q1YA 1FFXA 4DRXB 1W5BA 1RQ7A 4O4LA 3WGLA 4EB6B 4ZI7A 5JCOA 2VAPA 5BMVB 1W5EA 4IIJB 4X20B 3RYFA 5FNVB 4XCQA 2VAMA 4WBNA 3V3TA 3WGMA 4F6RB 5LP6A 1W5AA 2Q1XA 4I50B 4X1IB 4WBNB 2VXYA 3JASA 5EYPA 3JATB 4E6EA 4U39A 3HKCB 5CA1A 3RYCA 2RHJA 3N2GA 2BTQB 2RHHA 3HKDB 5LP6C 5JQGB 4O2AB 2BTOA 4LNUB 5IJ0A 2BTQA 4EI9A 1Z5WA 5LXTB 4FFBA 3HKCA 4DRXA 5LOVA 4O2BA 3RYCB 4I4TB 4I55A 1FSZA 4X1IA 2GVIA 2VAWA 1JFFA 1Z5VA 5LA6B 5ITZA 4ZOLA 5KMGB 1TUBA 1RQ2A 3WGJA 3RYFB 5EIBC
chains in the Genus database with same CATH superfamily
1PK7A 5FBKA 4DSNA 4DOMA 2I1QA 1URPA 3W3AD 2IPXA 1CLIA 4BJ5A 5C5CA 5ICCA 1RBQA 4D5GA 5K01A 5FYDA 5BURA 1LV7A 4D92A 5ILGA 1U99A 3FMGA 4JYAB 1QCZA 5GADl 1EB9A 2GUGA 3FOWA 3IQHX 4I8XA 2VRZA 2I2XB 2VRCA 1NVWQ 4TV9F 5FQOA 2ECQA 2Q62A 4UKDA 5ALHA 1YHYA 3R6WA 3ETJA 3UH1A 3AL2A 3PQFA 1LJUA 4AU1A 1KWGA 2K2QB 4H1UA 3W5UA 5EZYB 2ANBA 4BE9A 2ZIXA 1FDUA 1KO1A 1RAEA 2ZYAA 4E5VA 3H1BA 4JD5A 4NENA 4FHZA 4IZOA 4RJTA 3IPRA 5G1PA 1IEQA 1BDIA 1BYUA 3M6WA 3HJFA 3GRFA 1J8YF 1FOEB 2ZR0A 4GLLA 3TE6A 2ZVZA 3DEHA 1P2GA 4NMMA 3ZCSA 3E8XA 5L6MB 4A8JC 2AR0A 3VKHA 1VQ6V 4NABA 2FWAA 4CS2A 2C2GA 4GAEA 1P2TA 1L4LA 3A1TA 3GG2A 4I1YA 1KDZA 4YP1A 4FILA 3T80A 1WDKA 1Z25A 4HLCA 5H8WA 1A2KC 1ZC4A 3K2XA 4DMFA 2ERYA 5LMUO 4LY0A 1IEXA 4LXHA 3BFRA 2CXOA 2DCMA 1NP6A 4JOCA 3QY0A 3ZCXA 4DAOA 3ZDRA 2EFEB 2HTFA 3C3YA 1J2UA 2W2TA 1KMIZ 4OREX 1JXQA 4QU8A 4YP9A 2XQVA 2P68A 1M56C 3BMNB 5KX5F 2H4ZA 2FP4B 3L8GA 3MQWA 4X90A 3A6HA 3SE0A 2VT2A 3BRWD 4R8RA 2E21A 4KQWA 4GFDA 1JR9A 2Y1FA 4CZ2A 3KETA 2WM3A 1RZVA 1CT9A 2XWQA 3O03A 4LRSB 4BFVA 4BAGA 3T3MB 1IY8A 2PMCA 3DZGA 3KHSA 3ZQ4A 3TGLA 2DKOA 4Q03A 3T3HA 5ICEA 4UBJA 3C74A 3BSWA 3TQCA 3UYLA 1L5FA 1ZAYA 1M75A 1AKYA 2BCEA 3T54A 3U13A 2DVMA 1UMCB 1V6SA 3QE3A 3QVUA 3ZU4A 4KL1A 4RBNA 4XFKA 1SC4A 3CKKA 5DN6D 1SQGA 1ECJA 1F48A 1UXJA 4DLBA 3H5OA 5K99A 2EBOA 1O94D 4GDMA 2A79B 2VH2A 3F96A 3FZGA 4KDEA 4P08A 5JNWA 4TMWA 2A0WA 2VP5A 5A9TA 2PMEA 3B2EA 5A4DA 3GY0A 2ZB2A 1PW5A 3GROA 4YLGA 3ABKB 4AVYA 3FNBA 3QTCA 3VIUA 1YL6A 3RFVA 3G1WA 5IWAB 5GTHZ 3LPAA 2GCPA 4JC8A 1YRLA 5F2NA 3KEMA 1E2BA 4ZWNA 5G4KB 3G0GA 1U7UA 4H60A 3D6HA 1NQ3A 2IW3A 4ALKA 2YWJA 1ZK3A 3W8DA 1XMXA 3MRVA 4OHVA 3HB5X 1KKCA 2VL7A 2FQYA 2XX3A 1BJRE 3BWDD 3IAM6 1YCIA 1SN7A 3DAOA 3BPSA 3OKAA 4L6AA 4L9RA 4OV6B 4B87A 3WJRA 3S0JA 4C2BA 1FA9A 2PCJA 3DCJA 4KYVA 3NVDA 2COUA 5CA1A 2H4HA 4LJ8A 1F3OA 2QTBA 4MVJA 4RNDB 4BO9A 1HFKA 3SKXA 5CFNA 3PFNA 1II8B 4ZARA 4KO2S 2ZDIA 3H4TA 1XLTA 4BWVA 1JN0A 1SKVA 1FB5A 3T3EA 3ZPXA 1GCUA 1TXGA 2C7PA 1B15A 1LPMA 1H66A 4IYJA 3RVDA 4OKNA 1W25A 4BW9A 5AJYA 3TO5A 1Q11A 1IBSA 1SU6A 1GNQA 1T9GR 1VPDA 4DLWA 1H6BA 4UCUA 3I73A 3Q0IA 2O57A 1DCKA 1K6XA 3T1YB 1X1TA 2C8JA 2XRMA 3COVA 4ZYLA 5L4SA 3D6UA 2FTKA 3RUIA 2HA6A 5AVYA 1AXRA 3M84A 5LZ9A 1P3Y1 4MINA 1SBYA 2DMXA 3BL6A 2H07A 1TTQB 5L3VA 3IRVA 2CDRA 2JGAA 1CIVA 1QKJA 2IE8A 4ZAWA 2OOKA 2QSUA 1NRJB 2WIKA 1Z28A 3H5NA 3ORRA 3RS0A 3TNDA 5JJEB 1AZSC 2VQ3A 5LB4A 4FFVA 3ZX4A 3O3CA 4Z2YA 3L04A 2ZJOA 2FUEA 4UCFA 2IOYA 4N6OA 1LF5A 3J7TA 5DYYA 1Z8FA 3K6JA 1QHIA 5EY5B 3UJDA 4FUTA 3HLTA 3PENA 3H2ZA 3ODPA 4DA0A 5JNSA 5EHGA 4MKZA 1BA2A 1QGUB 2PD4A 5AVVA 1L5OA 1PWZA 2I6GA 2JBWA 1X7YA 1BFKA 3FXAA 3ITNA 4GWGA 2BOVA 1YTFB 1A5ZA 3L7YA 2CMKA 4JYCA 4M55A 3X1DA 4DNPA 1I13A 4P84A 1IN8A 1UK9A 5FWXA 5M2QA 2G38A 5H3LA 5K3BA 3U3MA 1COWA 1RMTA 3HGMA 2QM4A 2X5KO 4D8TA 2QJ1A 1JAIA 1UIRA 1VIAA 3JZFA 1Z0IA 3LUGA 4LJAA 1N33B 2O3QA 5KU1A 2H2IA 1E2QA 4FOOA 5CCEA 2M1XA 1ISSA 4NBTA 3LWQC 5JTUA 1EFHA 2HX1A 2JLWA 4RA6B 1CUCA 1JEDA 2AMJA 2X1VA 1QX3A 2ILVA 1CY8A 1F4MA 4HATA 4ND1A 2ZZMA 1P33A 1KZGB 4AG5A 1VF6C 3I4FA 4KN9S 2CJWB 3LYBA 2DR0A 3OHSX 4QGSA 2P6JA 5KJFA 4C8EA 3H5VA 2ZREA 3U7QA 3OFNG 3OM3B 1W9MA 3DTVB 4DV7B 1Q57A 1OCRC 1CQXA 4N9QA 1YQEA 2YN4A 3SQXA 4GMFA 2ZCEA 3L9DA 4FLWA 1GAXA 3DT6A 1LNSA 2G7ZA 4L76A 3VYVA 3CX3A 5DF1A 3ZIDA 3VFDA 3PC7A 4GI7A 3OOEA 2EG5A 3DP9A 3R6LA 3LT4A 3PQ6A 1PXWA 3PFGA 4LFAB 4HNAB 1GAWA 1YFKA 3LV8A 4L3OA 2B4TO 3QO8A 2ADQB 4P4UA 4QM7A 1HF3A 1ISIA 5A04A 1OR8A 1YJBA 1NXQA 2Y68A 2ZGVA 4JIGA 4X95A 4IXWA 4ZI7F 1CFJA 1TUEA 1U2GA 4CQNA 5BUCA 3DLBA 3JARB 5FR2A 4JGBA 1LK7A 1MG5A 1H5UA 3QU9A 3S0HA 3WGLA 1EGAA 2PS1A 3B5EA 4GHWA 5C7OO 2ZRAA 3R5HA 3H1HH 5IH7A 2CDBA 4HEA6 1C7IA 3OEYA 3SJBA 5C51B 2CLHB 2WT4A 1GTSA 2BGNA 4K35A 2AR7A 4PXYA 3BEHA 4CIDA 1NU8A 4RZ2A 3HO1A 5ENDA 3BE8A 2QSJA 1N5OX 1M2EA 1ENPA 3HQ4O 4ESEA 3JSLA 3CNHA 3B4SA 1KRXA 2JCXA 2XMDA 1BC5A 3Q7TA 4AUNA 3GU3A 1B2RA 4DBZA 1LU9A 3GT0A 3HMQA 3QF7A 2VUHB 3KKPA 1IX9A 1EXDA 1Y3DE 2FP3A 2MHCA 3NEYA 4XSHA 3CVYA 4NCKA 4OX9Y 1VK3A 2IQ5A 2NUAA 3W4IA 1HZJA 1PJ2A 1YHQV 1T3GA 2AZ0A 5F3RA 1UBNA 2C2KA 5D3KA 1Z0UA 3NQ41 1O9GA 3KKKA 2Q7DA 2YV2A 3WRXC 3IMFA 3S1LA 2B36A 2OHFA 4C0HA 1A8QA 3TN7A 5EJIA 4ID9A 4ZP1A 1TYEB 4KVGA 4LYGA 2F43G 1NAIA 1UEIA 3MJTA 3PWZA 1NY5A 4OMCA 3RWOA 3SDSA 2C92A 3TXQA 5J2TF 4AG3A 2XCTB 4U7PB 1ZRSA 2CWJA 2ID8A 1VQ9F 4LJKA 3HXTA 2QSAA 3CJHA 5K4GA 4L5IA 4M8SA 4TZ6A 2PG3A 4KGXA 1FEZA 2HPAA 5BR8O 5H16A 2I6XA 2PO5A 2FEPA 4D96A 1DUIA 1O97D 1TCBA 2QMEA 2Z9CA 1QRTA 2W6JG 5AKGA 4GR9A 4KRFA 5ESDA 4O4IB 1XL1A 5BN3B 2AZXA 4QVIA 2N74A 2ZIZA 4J1SA 4MZDA 2ZITA 4I55B 4HB4A 5A6VA 5BV0A 1WUJS 1K7XB 1EK1A 1JY8A 3D01A 5DBHX 2DWPA 3UANA 2YV4A 3ICXA 2GJ8A 5BQXA 3HKBB 2QV7A 3FTPA 4JYMA 4UEOA 1PR5A 3WHIA 1GVNB 3OX2A 4BMVA 2HFKA 3R2JA 5AVZA 1XJ5A 2YVQA 3EEBA 3K8YA 2QW8A 2R47A 1T4CA 3QW2A 5KOHB 2XUZA 4G4SO 1N6LA 4AC9A 2AG6A 3S4YA 2VEDA 3O1IC 4N47A 1WP7A 5ALUA 3TOXA 1YCFA 3SF8A 3MUNA 1EQUA 2QQ0A 1NRXA 2PI4A 3CSDA 1C80A 3HEBA 5H70A 4FPPA 1EVQA 3PFKA 4H3VA 4ZVQA 3Q11A 3RVPA 9GPBA 1Y6GA 5FOWA 1YE8A 1LLUA 1X77A 5LQCA 2EATA 3ICPA 3ZWCA 1TZCA 4HDKB 4KQ1A 4BP3A 4CKYA 1S9DA 4IH4A 4DG9A 3HGQA 4FCCA 3W6NA 1GO3F 3CSUA 4CMHA 3P0EA 1DOHA 1XZEA 3CUEF 3FYIB 3GQVA 1PVOA 1W59A 4MV9A 2MOKA 4L0MA 5IBCA 4BZXA 1HDRA 2W7TA 3C8MA 1WMFA 1DXYA 4DR6B 2JFPA 3PFIA 3O3MB 3ZCRA 5KNCH 5KVAA 4U8HA 5F9MA 3N2GB 1HDJA 2NVBA 2OD7A 2WUVA 1MABG 4XCVA 4EJ6A 1M7HA 1VIYA 4FGZA 3NONA 1BE3H 3R44A 4AF6A 3E8SA 5KWSA 1EEHA 2N05A 3C45A 3G3EA 1X7PA 4ZHVA 2C7BA 2GTIA 2NWQA 3KWLA 2V1XA 1Q6HA 2FMIA 2W5UA 4HDAA 5EE3A 5FNVA 3X2EA 1DPGA 3UT6A 3T1OA 3ZKAA 2OORC 4WK2B 5DM60 2FZWA 3K2IA 1OHHG 2F3TA 4KWEA 1GLVA 1KJZA 3LPDA 3UHJA 2HL6A 1TC1A 3BHPA 4DVJA 1TAEA 2FW7A 3VV3A 1QGZA 2ZUSA 5J23A 3GMTA 3TZLA 1WETA 4KMSA 3W8RA 2EQAA 4Y9DA 3ANNA 3CNOA 4H37A 1KXZA 1FDTA 3EY4A 5CRIA 4TKMA 1K2VN 2GA8A 5AMXA 1LRJA 1VB3A 4M9ZA 4P35A 4RGBA 2ZS8A 5EHQA 5BOSB 3ZV5A 4C43A 1S1CA 5FWXB 3UJAA 2XCSB 3LK7A 1JJIA 4JP3A 4IHQA 4G8CA 5JCOA 4MOWA 4YCLA 5KDOA 1PG0A 3HUFA 1UZNA 4ZOAA 4ZRMA 3P26A 2VAMA 4QNRA 5A62A 3X1ZA 4GUNA 2IPOA 3V48A 1T9BA 2C57A 1PT7A 1QG2A 1B8VA 1U6JA 3I28A 5T6MA 2OC9A 5SZHB 1GUDA 5JC8A 5JS7A 2OR3A 3FWKA 1E2PA 1QNFA 3KQSA 3LLMA 5B7NA 3PGLA 5F1KA 3AUKA 1J7JA 1N5JA 1ODCA 1HSZA 2BE9A 4CJXA 1K7CA 1XXHB 2WB2A 1RFLA 4I1UA 5FA6A 2R62A 1RPTA 3ETGA 3JQ7A 3OEHA 5DNCA 1CF2O 1H4VB 1ONOA 3LW7A 4NPHA 3Q7EA 4YAOA 3WYBA 4R0MA 1DG1G 4JA2A 1DV1A 1Z5VA 5H02A 1NI4A 5B1SA 4DHWA 3P4UA 4DWOA 1NV8A 2I29A 3ONFA 5FBZA 2J08A 3UCSC 1EVIA 1SCDA 2BC9A 1TD9A 2QLBA 1J0CA 3PJDA 1L8QA 4IXDA 4PYRA 4XIFA 2IIPA 5BT8A 3AR2A 4BC1A 2RGAA 3STLC 1ZMOA 3K0AA 1SXJA 4MS3A 3D0RA 5G1OA 4NI5A 2WDPA 4ZO9A 1MFZA 2IYXA 1GDHA 2J0UA 1VRVA 2PKQO 1HE4A 4CIWA 1JYEA 2GASA 1VRWA 3PA8A 4NFLA 1KBOA 3GGGA 4DLPA 5JNRA 2XUQA 3DDHA 4BMCA 1XDZA 2DLDA 4S2EA 2F3SA 3DT8A 4GPIB 3ZCTA 4C4OA 3D4PA 1C1HA 1SCJA 4IS2A 2A1TS 1F8UA 2PZ8A 2ZFUA 3GEEA 4UQLA 2GX6A 3WGKA 1JLLA 4JSYA 5B1DA 1WHSA 4J0CA 2B61A 5C0OE 1K0UA 3VJLA 1LS6A 3WI7A 1XREA 4MPTA 1Q83A 4BNVA 2ZVQX 4XYEA 5JR3A 3MQFA 4N7MA 4E32A 5EWJA 4CTMA 4OI0A 3HCCA 4V0ME 1ZL2A 3ENWA 1OC4A 5DYTA 4FGUA 1D8TA 5IUKC 4D8VA 1N0JA 3L0PA 3ZE1B 3OMIB 3DFUA 2NUAB 1J21A 1JRLA 4U7HA 2ZI4A 4KQIA 4HFRA 4CV0A 3UAGA 4U5QA 1TKAA 4M60A 4DYHA 4WV3A 5COBA 3RWRD 4KLAA 2D1RA 3HLYA 4OJQA 5GJCA 5HWSA 5JZSA 3GRZA 4EYOA 1ZHOA 4A0QA 1RYNA 3QVLA 1GU0A 2LD4A 5HCIA 5HF9A 3HR4A 1IM2A 3OD1A 3K92A 1JZTA 4YRTA 2VPYA 4L27A 4DV2O 4OB8A 4QELA 4B6PA 5A1JA 4G9EA 4S1TA 5HY4A 4J80A 2D62A 4HR7A 4PHZA 2PIDA 1HDCA 1GD1O 3B1YA 5EP1A 3PDCA 3NEAA 4YUVA 4BVRA 4TMXA 4Y9RA 3FZNA 1SXPA 4RO2A 3ID6C 1TYCA 3CZ5A 4G5XA 1Z2OX 3DLAA 1CUSA 3ISJA 2KKWA 4KWTA 4LKOA 4OATA 5K5EA 3DE5X 2Z4RA 4M49A 5H82A 1N32O 4OGFA 3N53A 4RIGA 4JVMA 3MWDA 3PSHA 4BW0B 1BMFD 4KRXA 2P6YA 3PE3A 1U0SY 1WO8A 4O1HA 3T99A 4OX9B 1AV7A 1CS0B 2DTXA 1WL8A 2Y0EA 2PTMA 1MQAA 3QXXA 4QVKA 3K12A 3AG2C 3D8RA 3ZI0A 2GB4A 4BQSA 4EKYA 3CC2F 1D4OA 2BY4A 4I46A 4M37A 3FAVA 4XJSA 2J30A 2OT3B 4BTLA 4ZYXA 3CF6R 3OTWA 3ZY4A 3R66A 2WLJA 4RYDA 5EO3A 1M2GA 2NXCA 3QELB 1NN1A 4IDFA 3DOOA 4GBJA 1AC5A 3RF7A 3X0DA 2WWVD 2RGEA 2G1PA 1IM5A 1IXKA 2H2HA 2IOHA 5HIKA 3TDMA 4EFMA 5A1TA 5KOJB 4LWOA 4C6SA 2PL3A 1XMJA 1XELA 1E4YA 3AF0A 1YDEA 4ARVA 3WK7A 1TGVA 3NHMA 2DFVA 3RFTA 4BO7A 5CVUA 1MG1A 4LDRA 4K87A 4UB8Z 2Q5ZA 2ZWAA 3C16C 5AI4A 3N5CA 3N6VA 1J1IA 3WGIA 1MRZA 1ODIA 2OV1A 3IBCA 2E4UA 2ZXWB 3D2LA 2XKJE 4B82A 2HS4A 3CCSF 2IYFA 1AJPA 4MK4A 3NHJA 4JROA 1QIDA 1J9ZA 1RCTE 5FPSA 3UWPA 1PLLA 4OK6A 4BX2A 1MD9A 2ZXUA 5KHLB 1WE2A 3RAFC 3LDHA 2WYVA 4DMMA 3DLTA 1L7QA 1SQQH 2IYTA 4KKVA 3VSAA 4PWTA 3ESQA 3PR1A 3BK7A 2ZBVA 1BS9A 4F3NA 3K9NA 4ASUG 4FSXA 1LGYA 1QHHA 1EEXB 2BW0A 2YBEA 5AKXA 2F43B 4XB6B 4TXNA 1D4FA 4A92A 4UUQA 4F6RA 1C81A 2JIMA 2XGSA 4WK0B 5AP9A 2O0JA 1WP8A 5EQDA 1GAJA 4DA7A 3TW0A 2WA4A 5JECA 1H3EA 1JIKA 5K8IA 1TM5E 4HDQB 2GZ1A 1TZBA 5D7NA 4MQMA 3RSCA 2EIMC 1JLMA 1VQ7V 3RYTC 4EGCB 3I9MA 1Z68A 3NG1A 1Z2CA 1U2GC 3LDUA 1KAHA 1Q0HA 3A2FA 5BSFA 4G0NA 1YEWA 2LTAA 5A2QA 1S2OA 2HJ9A 2JEXA 2WJJA 3BYZA 3AY0A 4I0WB 4E0BA 3KQLA 1BE8A 1OUMA 1T5DX 3T6KA 2DM6A 2OZLA 4JQCA 1Z45A 2Y4OA 1NN0A 3GLKA 5CX1B 4F1WA 1U8CB 5HQTA 4BB0A 3PJSK 1S3GA 2O0KA 4L4RA 1DXOA 5H9CA 4CKCB 3EXHA 2IJJA 4GXNA 5L3CA 4HXEB 2NP7A 1AKMA 3SFTA 3B3GA 3FD9A 3SPJA 3TFQA 3WDLA 3FGNA 2G88A 1QLWA 1AK1A 5G0SA 5EWJB 4YDRA 1WCV1 3GUYA 4OGQB 4UCOA 3CZ9A 4GF5A 2K1EA 5TDHA 5BSHA 1DJLA 3QNMA 3A7DA 5A4JA 5EUQB 1GILA 1FYJA 2W4QA 3V1TC 4URXR 4OBEA 4TMVA 3T3OA 1WLYA 2FUCA 3RASA 3S2EA 3WIBA 1D2AA 5L3QA 4M8IA 4PV7A 1M2VA 4G65A 4NZPA 4L7VA 4MIYA 3WR5A 1T29A 3QLEA 2HYDA 3QLUC 4BNZA 1GU7A 2VSOA 3QA9A 4Q37A 4TWRA 1D6MA 1R6UA 7ABPA 4HGPA 5DEIA 5JU6A 1MABB 1FRFS 3ICQB 3Q0EA 2LJ2A 3H9JA 4G1EB 3AXTA 2GKSA 3AEUB 2BMFA 3PE4A 1VSBA 1EVYA 5MFZA 1CUVA 2D2FA 3L1VA 3ML0A 1X7GA 3H01A 2ZI7A 4NDZA 3ZNOA 3ZWBA 4CU5A 3B5IA 2QX4A 4Z0HO 1EVZA 2WFLB 4G0VA 3V4SA 3EUAA 4BQQA 2VDPB 3LHFA 4OXRA 6NULA 5LD2B 5KKAA 2YS6A 3MJ4A 3R0PA 1CS0A 1RS0A 2HCBA 4HNHA 5HCUA 1T43A 4YCNA 4KXUA 4PLCA 1C3VA 2WM2A 3WHPA 3KKQA 4WVLA 4B85A 2XKKA 4QPZA 3ZI4A 5CFLA 1CP9A 3G02A 2NZ8A 4KX5A 5H68A 1CRPA 1SIBE 4DBLC 4JKYA 3RRMA 5B3JA 1FMTA 1AB5A 4LSGA 4N48A 4RV9A 3BT7A 4CEJB 1OHHA 3KHTA 1M8JA 3P52A 3ESJA 3ZLTA 4AUKA 3KSUA 4BPRA 1BU8A 4JBXA 2ATEA 4JLWA 1IV2A 3E9QA 2Z8XA 4LZOA 1Y89A 3AOEA 1QLEB 3AR9A 4EG4A 3TD6A 4G86A 3HC7A 2QWOB 1VEWA 1FSFA 1P2DA 3BK1A 1XLTC 2JAXA 2QR4A 2HMYB 3HVJA 5J3JA 4X65O 2NU7A 1W7AA 4UE3S 4XPIB 1C3OB 2VAWA 2KB0A 3PQDA 4QUKA 1E2FA 3ODGA 4FM0A 4DR3B 1VQLV 1GUFA 1SULA 2YC4C 5P21A 2W8ZA 2IS2A 4XX1A 4NJMB 3EW9A 5DSZA 1GTL1 2H3HA 3FJYA 4K6OA 3LCMA 4L28A 4R0VA 3NEJA 1JP7A 3AX6A 2WDZA 1OZAA 2XBMA 2IH1C 4DR1B 2ODNA 3UCXA 2EFHB 1VSTA 1NF3A 2WJAA 3VR0A 4OK5A 3S2FA 3OJ0A 2NXJA 1BVYF 4EF5A 4QUEA 2ONCA 2NU9B 2CAZC 1XXHE 3D3JA 2PKYX 1Y9DA 3BKXA 4TM7A 1VCOA 3TVTA 2P2ZA 3AERA 1U6KA 1PX0A 3R1IA 4J03A 3ND7A 2WKWA 4ER3A 4DR7O 2QT0A 4UXJA 4Y6RA 3UG6A 5ITZB 1S8FA 2H08A 2VCHA 3ZRWB 3BH7A 2FWJA 2IYZA 3H9QA 3O9VA 3R3WA 3T12A 3GCWA 4DIDA 3F73A 1UKCA 1MZEA 1EWKA 1CSEE 2UUCO 1FNMA 3K7EA 3WDSA 4CLXA 5BYAA 5LN1A 3K09A 3UO2A 4ODIA 3SQLA 1BE6A 1LX7A 2IE0A 3ETLA 4M88A 1ZWLA 2CCKA 1LTKA 3FNGA 1U63A 1EP1B 2GQ0A 2WZQA 4L08A 3EFOA 4V0RA 5DIFA 5E4TA 3VBEA 3W2FA 5I4CA 3FOFC 5AJVB 3OTIA 4P4LA 1NTMH 3E9ZA 4R51A 4O4JA 1PNTA 4W5TA 1A9XA 3PDJA 1SZJG 4QBHA 3WXMA 2YJ4A 2FVYA 5AK6A 4XUCA 3KZOA 4JAVA 1RU3A 3C85A 2A1IA 5CB4F 5IVHA 3R9KA 4S12A 1H2SB 2OGZA 2VJDA 4NJEA 5JMTA 1HO3A 2UUBB 4K0RA 8ATCA 2HSWA 4A73A 5A4FS 3I62A 1E6UA 5IDQA 4AJKA 3GA5A 4LJRA 3JALB 4RCYA 4UQPA 2XUFA 4B2IA 2V0CA 1AUVA 3TRFA 4R4JA 3K04A 1XFDA 2ASVA 2O8CA 3AU8A 4WA7A 3ETQA 4FZVA 1VQ4V 2YJGA 5JQWA 2UU9O 2C0CA 1AGPA 1T4CB 1LEHA 1D4ZA 2WJWA 1W44A 2ONKA 3E48A 4C05A 3OJOA 4UHHA 3TPCA 1OMOA 2XUOA 3O47A 1DC5A 5A5GA 1NSFA 1OFUA 3O38A 1H2GA 3ZY5A 4E2YA 3OICA 3BPZA 2XD4A 1LDEA 4KR7A 2C9YA 1Q7YH 3G0IA 2PS0A 1DRUA 3CCEV 2HU5A 4Q7KA 1OBCA 4J2TA 5IAJA 2R86A 1XCJA 4DNXA 2BFOA 1JH8A 4IL6Z 2EL9A 3EY9A 4K8ZA 1YVWA 2ZUBA 4LJ6A 3OUSA 1KY2A 3CR7A 3O9ZA 3K70C 1S5LZ 3SYCA 4DK1A 4UOQA 2NQ2C 3QYPA 2X42A 2GVNA 4ZPJA 4G2TA 1CUJA 4BZPA 3GBVA 3VPGA 3C3TA 1E0JA 4WKPA 5DX0A 1Y4MA 1YC2A 1FNCA 1GX1A 3GUVA 1XZLA 3C6XA 3ZW7A 1ENZA 1PWHA 3KB1A 2HIMA 3D0OA 2CCJA 4MAAA 3NLLA 4IO1A 3Q85A 4OCZA 5HX7A 3V2UA 3ZMTA 5K8VA 1VQ5F 4UXNA 2L26A 3FVQA 3BH6A 4CPDA 5JYBA 1MA3A 4Q4HB 5KYUB 2Z1EA 4KFUA 1QLJA 2QL6A 2GBLC 4LQCA 5AJHA 4WK6A 3U80A 2FMXA 5EGSA 4RK5A 4D0LB 1IURA 2GYWA 2FP4A 1KOFA 3OQHA 4CGYA 1XLVA 1FYFA 3EGDB 3V1YA 1G3MA 2VG8A 4IKEA 2B5WA 2AK2A 3KQOA 4J1TC 3CONA 1FSZA 2EAUA 1Z4KA 2QTHA 4WASA 4D42A 3CCUF 3WRXA 4E22A 3A11A 1EJ0A 3ROTA 3A4TA 1ISFA 3OUTA 3IAAA 2IXBA 3PD1A 4ZEOA 1WUHS 5A6SA 3E5HA 4HHEA 1XAIA 2LPMA 1P1KA 3M1LA 4BYMA 3PWTA 2G40A 5ES4B 5HS4A 1AU9A 3HKBA 3CLTC 5FPQA 5EWMB 1J8QA 2RHTA 4FIPC 3WIOA 1DFHA 4LECA 5CB4B 1K75A 5C52B 1IZZA 3U60B 1NXSA 2DY0A 4HMPA 1GK9A 2RB5A 1NUAA 1OYVA 2VZEA 2ZTHA 3AB3A 3DBHB 4OJMX 3WE7A 3PR3A 3THXA 2PZMA 4Z1MD 1K5SA 3QJ5A 1VKOA 5EA2A 4HD8A 2H8CA 1ICEA 2VT3A 3L0DA 4YDSA 3VRHA 4ME6A 1F23A 1QVVA 4KACA 3T3GA 3P97A 3CNLA 2NAFA 2RGYA 2UZ3A 5EZYA 1SQSA 2PL1A 5E2BA 4ZVSA 1NJ2A 1GZ0A 4PLGA 3EORA 1NBMG 1ZI8A 2ZJ6A 2XYRA 3WYNA 2QZJA 2J9FB 3PNKA 4RJJA 3SYMA 5HYVA 1DQPA 1BX0A 3KSAC 2G5PA 4YRMA 3M1YA 1OV4A 3DQQA 3QENA 3CISA 2QVZX 1U1FA 3BKWA 1THZA 3LQKA 4QA9A 1ITZA 2XHZA 2JK5C 1H8ED 3PHHA 2XUAA 4MP8A 5AM5A 1D6JA 1VE3A 4JZGA 2NU7B 2PZAA 2XNJA 2ZR8A 4I9UA 5DULA 1CJMA 1WB9A 4QHTA 4OH7A 2DBYA 2AJ8A 1X1QA 3PEWA 3EVFA 5JSYA 1OD6A 1SBQA 4HGZA 4AKEA 5GJBA 2GBIA 3KLNA 1NRIA 3MYRA 5D3QA 1SWWA 2XT9A 1I33A 1T5OA 4EM6A 1AQLA 5T4FA 1AP5A 2B4RO 4HQNA 2QRPA 5KTPA 3U7GA 3IBTA 4LVOA 1OU4A 3UMYA 4RADA 2FMUA 4XYBA 2DR2A 1CZKA 2P9CA 2O06A 2FR8A 1YKFA 2XKBA 4K8XA 3PLAC 1NXPA 1G6HA 1PJ3A 4CCWA 1QYIA 1D0IA 4FQ8A 4DR4O 4OHOA 4RGYA 2DR3A 3LP8A 1NFFA 4X54A 3TX6A 4BFXA 2Q5IA 2XUIA 5I8PA 5CTJA 4P0TA 4ZO8A 2AXTZ 2I91A 3VKGA 1Y1LA 1G4HA 1XQVA 2WA1A 3NFRA 2ZSBA 1SGWA 1PFQA 1ZN9A 2O07A 3GC6A 4GYJA 4NV0A 1EZZA 4IHJF 5CVVA 1VGQA 4BECA 1K6MA 3FSGD 1R00A 1U0LA 2AYYA 2HSZA 4EUKA 5KC8A 1ATIA 2P6OA 3SPIA 3FNQA 4F3KA 3RN4A 3CC7F 3DC7A 2H4WA 3HY4A 2FHPA 1DAPA 1E62A 3CCRV 1Z56C 4A0SA 1FS6A 2E9SA 3OQJA 5JQGF 2J41A 1J2RA 2GNPA 2VRCD 2XXBA 1TX4B 4HC4A 3E0QA 2BMJA 2F00A 3GPCA 4UCXA 1IG0A 1SUDA 2OMEA 1DDIA 5EERA 4EMBA 1G8FA 1LVUA 4ZA2A 3MJEA 3V00A 2X9VA 2OEPA 4DCVA 1W4ZA 4H7PA 4EARA 5C5EA 2DEUA 4NZMA 4AJ4A 4FK5C 1TJNA 2CXRA 4JJAA 3WVNA 3WLKX 4FZ3A 5JXIA 1B23P 3U37A 4B3HA 3AG3B 3ABUA 1C9DB 3CCBA 4GGMX 4N0EA 4DR6O 2DMRA 3OZBA 1CXZA 3K57A 1HK7A 5ALRA 3RVMA 1I4EB 1YDHA 4AZTA 1VDZA 4CVNA 3W7WA 1OYWA 2XBUA 4DR3O 1Q6YA 5B3SB 4YGXB 1SCKA 4BMZA 2RB9A 1G2PA 5IEJA 2RE8A 1H0HA 1U2ZA 5FNZA 1JTFA 4BL5A 4MCJA 1WCXA 1VQ8F 2F48A 1V9PA 1Z6GA 4L2IA 1PJZA 1L2TA 4OFXA 1QZXA 2VLIA 2CMFA 3CO5A 1XDSA 4FZ5A 3MAAC 1FSGA 3IB3A 4IJWA 4I3HA 2QM3A 3QFRA 2DPXA 2GWRA 4KI7A 3DHYA 2X1HA 3JD4A 1CC1S 2JFFA 1FS0G 5JWHA 2F1JA 3C8DA 3DG9A 1XKLA 3ZGOA 3VYWA 4URHA 3OAAA 2H3EA 2QR2A 2TMKA 4KU4A 1GPKA 4J0FA 4K3AA 4QYSA 5KNCA 1FMCA 5HXAA 4D26A 3KUUA 4Q6BA 3LYAA 3CM0A 3I9OA 4MRRA 2NNUA 2ZVJA 4NH4A 2XRFA 3JW8A 1KQFA 3KKYA 4D0NA 3GRUA 1N6KA 4LVNA 5DBFA 2BGJA 1NTOA 1W8IA 4JJKA 5JJJB 2IP2A 2OZBA 3OURA 4S3MA 1OYYA 3HDGA 4JNKA 2BSKA 4N23A 1ODJA 4UOEA 1KIAA 5FUVA 1FXKA 1CK4A 3DE4X 2VQ6A 2PUEA 3TNFA 3EQ2A 4MP6A 2WVJA 4B46A 1AKTA 2C59A 1X4TA 2C2ZA 2C5AA 4LA4A 4ED9A 4Q6GA 5AT1A 2CE4A 2D7DA 3LH5A 1KS9A 1KTIA 3FHLA 3TPFA 1TU4A 1R6NA 3DFMA 3DZCA 4JKOA 5TT1A 4UBMA 2ZZNA 2PUGA 1XPUA 4CS3A 1RZ3A 3A1WA 3FLBA 4CHTA 2V7QD 4X1KB 1XWWA 4M99A 3FFQA 4B0OA 1CQJA 4I99A 3ME5A 2WWTA 1TIKA 1ZW1A 2BI8A 2MSCB 1YIAA 3HYRA 3MS4A 2ZKIA 4BNKA 3K59A 3CF4G 3QEJA 5JLJA 3PDWA 3WK6A 2WVGA 4WFGA 4IGGA 3GJ4A 3STXA 2IZOA 2ZVYA 2O4UX 3M8KA 3CCVF 3ZDXB 4EY3A 2XWSA 3QHQA 1VJ5A 1U9YA 4IIGA 1U7OA 5BUSA 2MIIA 5BSVA 1ZRNA 1QDEA 1C3OA 3C8ZA 3ENZA 2WZDA 4EEKA 4X45A 1X1EA 4YRDA 1Z0SA 1SVNA 2F4VO 3AEXA 4B3BA 3UXYA 1YCGA 2YZNA 3G2MA 2CHFA 2ODEA 3SXUA 4YT4A 3R9XB 1U9JA 2D8MA 5DHPA 1KDPA 3NDPA 3W7XA 2IHNA 3MOSA 3B38A 4XWGA 3IAM1 3N2ZB 4X7BA 1E20A 2H1IA 4IVQA 4BDTA 4F4DA 5B1OA 4LOHA 2GN9A 3GUZA 2CDNA 2PN1A 3GEGA 1NUSA 4L73A 5D8DA 1O0BA 2DTEA 4JP1A 1JEYB 3FYUB 1UBLS 4JS0A 1Q16A 2AFIE 3L7OA 1UWCA 2X0FA 2R00C 5EMJA 1VQOF 5ALPA 2O5EA 3QE9Y 2VBFA 2YNMA 1VQ1A 2CC2A 2WD7A 3IH5A 4KUEA 3SVLA 4PO3X 2HU7A 4EFNA 3OIWA 3LCUA 3P2YA 4XIYA 4U2CA 2VKQA 4EA8A 4E6EA 1NW5A 1NPTO 1P9LA 1E6LA 3VI4B 1U7ZA 5DPMA 2OHWA 1UR5A 4KNVA 4C7KA 4G27B 4LF6B 2KI5A 1AR4A 3BULA 3QLVA 4UZEA 1GFSA 1ESNA 1HNNA 1W4LA 3WNZA 4J9ZB 4I4TB 1U3FA 4NCAA 1M2NA 1IZ0A 1SO8A 3N0WA 1CXZB 1J33A 2RDCA 3OTOB 5KMGB 2B3DA 4KP7A 3ZJ5A 1M1ZA 3B2QA 1KI2A 3OF5A 3ZVNA 2CV1A 1ZI6A 3RS5A 1V45E 4BVFA 1KEZA 4BKRA 1P1RA 1WBJB 3E8FA 1PR1A 4S0ZA 5T57A 1DAMA 3FHCB 3OZDA 3ZS8C 1TVCA 3BM5A 4AJPA 2OBMA 3WP0A 1NX6A 3KB2A 4CV2A 2DH6A 2O2IA 1XL6A 2HMUA 1JQ5A 4G4IA 1FZQA 1RM1B 2C2XA 3O65A 1KD1H 1EIWA 2GN8A 1NH2B 2YIAA 2YEVA 1T9DA 2PBZA 3BCRA 3FCOA 1VE7A 3JTEA 3O8BA 4C08A 3BIJA 3WB2A 4D56A 4X8AA 4QJ3A 4Q16A 1NFQA 4EB8A 1V35A 1U3UA 1NZFA 3OEEG 1A9SA 1J2JA 2A5FA 2ISQA 2VXOA 1MORA 3MK31 3WYDA 4Y18A 1QYRA 1A4XA 2V59A 3N8HA 4JBWA 3FCYA 3IP5A 2ZJ5A 3MS7A 3WJAA 1CKEA 1TO6A 1IUNA 2WYUA 1YJNV 3GNTA 3QVGA 1H2ZA 4M4SA 4NX2A 4YT2A 3VR6A 5KSYA 2XTZA 3N4YA 4QUJA 1W75A 2BJWA 2AI2A 4IGEA 2G9ZA 1TKCA 1UMBA 3M34A 4JEMA 1UI9A 2I1WA 3FVTA 2J1LA 4XVQA 1GR0A 3UXMA 1W73A 3OZIA 1C50A 3CX7A 5TMDA 1VCMA 2O05A 1L3IA 3F6SA 2K5UA 5EZ5A 1KKDA 1P8AA 3FA2A 4I66A 1LK0A 3WMGA 1KZ6A 1IB6A 1WN7A 3ABOB 4D3SA 3OZAA 2R7AA 3PYXA 1QNMA 3AETA 3LQ4A 3OPVA 1C4XA 2YYYA 4LP8A 1A9OA 1HTTA 1QGAA 1AZWA 2YZMA 1ZD8A 3DVLA 4JVOA 3VHRA 4E94A 3LFOA 4NDAA 4BGIA 1TCUA 3WAJA 3B1VA 4CODB 5J4LA 4QQKA 2ZJAA 5C18A 1AB6A 3U5ZB 1H2KA 1N3BA 3IDZA 1HRKA 2QUBA 3H9GA 1U8EA 1CBUA 3KZKA 1QVZA 5I9LA 2Y1LA 5KYGA 3AKZA 5I8ZA 1C3XA 1XRMA 2JCVA 5DNAA 1OBFO 1V7CA 1OFTA 4IXTA 1P45A 3ZGLA 3SZOA 4JJ8A 2GO1A 2WSBA 5GVRA 2MQEA 3P9YA 5I4BA 5MN6A 1JHMA 1ONSA 3GEDA 4R9NA 4WK4B 5CHYA 3TQIA 1LA2A 1MB3A 2AW9A 3KVVA 1KD1W 3UMFA 4EJMA 4GKJO 3L8HA 3OCUA 5JSQA 2E87A 4X62B 2Z4SA 1PF5A 3CWBH 2IHUA 1ESZA 4B73A 2VJLA 1NXXA 4K6HA 1O6BA 4H3HB 4RPGA 2H6LA 4KYTA 2I62A 4P32A 1WPRA 3T38A 3TLAA 3U4QB 3VKFA 3WK4A 4QJ4A 4CFYA 1IBKB 4EJFA 4K9DA 1L0LH 3UTCA 3GAMA 1RYEA 4YJFB 3DB2A 4J9YB 3GH1A 4Y30A 4BAUA 5DEOA 1XRQA 3BXFA 2Z5LA 4FFPA 4WDRA 3U44B 4YJHB 1YCHA 2IDMA 5H4HA 4G1VA 1RPAA 1UF9A 3ADOA 2FOXA 2VDLB 3A27A 5DYNA 2XXAB 4RETA 5EKUA 1ZD9A 3TCXB 3U4GA 3DYIA 3SPGA 2QR5A 4OKIA 5TQ2B 1MJGA 1ZRHA 3BILA 3L41A 2J0SA 5HXZA 2H29A 4GLBA 4QGBA 1I3LA 1EWTA 3LDTA 1W85B 2DN9A 2FRVA 4PS1A 3VO1A 3ZE8A 5A4KA 2R8YA 2VA8A 2E75B 1L9XA 1JR4A 5AI8A 2WZBA 5THQA 3COPA 4EHBA 5IM5A 2HLDA 4HQ0A 3OM8A 1ISJA 4ZCQA 3T9DA 5BVGB 2XADA 2XZOA 3OLQA 1K7EB 3EASA 1ZJWA 4IDAA 2PUAA 3PNVA 3K2QA 1ZUNA 1HR0O 1Z18A 2RC6A 2LRHA 3AP3A 2FSPA 3PPIA 1TQDA 1ST2A 3F90A 1RQXA 2XQGA 4D6YA 2ZYDA 3UW1A 3C98A 1QS0A 2P7HA 3MDSA 4MHOA 1QP0A 1XEFA 3GRCA 3AESA 3JQAD 4L75A 2FXVA 2Q0SA 5CM8B 4CF3A 4ENVA 3KJHA 5IRCD 2WSMA 3TGUH 5AW2A 5CBFA 3MERA 5E8RA 3LGXA 3P5SA 3RRXA 3H9VA 1Q1AA 1U7WA 2FLVA 2WJIA 5IYCO 1N2ZA 4WXRA 3S2IA 3MQ4A 1ZR2A 3JQBA 1FKAO 4L4XA 4ZN6A 2W6IA 3WG7C 1B7GO 1NE2A 2ZJYA 1E7SA 2Q4OA 2QJTA 1B0ZA 3E3AA 3O3OB 4OXIA 4JYZA 2A9FA 2FMLA 2BFCA 1CQZA 1HE2A 4IFIA 4DW0A 1YO6A 3SN6A 2C3MA 4LJ4A 2P65A 1NHGA 2PR7A 1FDWA 2XDYA 4QJ5A 4CEIA 4IF6A 3B8EA 2PUDA 2XE8A 4X65B 1LVHA 3R7DA 1H0RA 4RMIA 4WZZA 2VNAA 4M87A 2M7WA 2CJPA 4NCBA 2IPMA 1QONA 3EVTA 4RD2A 1Y1PA 3ZU3A 1DP4A 1KKMA 1CDOA 1IHXA 2QG4A 3DMNA 3R3YA 4HNVA 5GOZA 2QU8A 1X14A 1K0FA 4HJRA 2PRSA 3BBLA 1VL6A 2YIJA 3PDUA 4Z86A 3KVYA 3MMZA 3ZJ4A 3ZS9A 4C4ZA 2R3SA 1L8AA 4QBFA 3SIUA 4RLQA 2WWRA 1SXJC 2Z98A 4WNCA 3TIIA 1PZNA 6REQB 2ZOSA 1QTQA 2H7YA 3QTYA 4CR7A 4RTNA 2OP0A 1GKYA 1XTPA 3R8XA 2JCYA 2JS7A 3G2NA 1QFSA 3CNEA 4UE2A 3OU7A 3SF8B 4TL7A 1T0KB 4U7TB 4YHHB 1FXUA 3LNMB 3PJEA 1AQIA 5HJ2A 3H1JH 4MTOA 5L3FA 1XZCA 2LE0A 3GJ6A 1PGJA 4U2BA 2NVUB 4B8ZA 1VQKV 2P75A 3I45A 3PC2A 1PEAA 3WA6A 4DPKA 2HP0B 3HCDA 2FWIA 1RXSA 1TUIA 2B21A 2ACKA 1HYQA 5EAZA 2GKOA 3LECA 2I6TA 3E1SA 3T7JA 2BBOA 3KKZA 5CCDA 4D9IA 1Z12A 3SEQA 4J4HA 2QY6A 2WQ6A 4IJ5A 4CDGA 5I7RA 4W4KA 3ZUGA 5DLQC 2EX1A 3ZHUA 5KQSA 3U7EB 4NBUA 3RTDA 2IJIA 2MINB 3CVUA 1I6KA 5BPHA 5M3BA 3F1KA 3T5CA 1IK4A 4Z2WA 1KDOA 1QCEA 3Q3VA 3A36A 4MW4A 3QUWA 3GLQA 3ICWA 3PQ4A 3J7AU 2F8LA 4A9AA 2OCXA 1YKSA 4RV5A 2PYZA 4RZXA 1E9FA 1Q0TA 1IJKA 2V6FA 1VKJA 1POXA 2FG7C 3NKFA 1RRCA 2HWXA 3BORA 1YQNA 1ULUA 3HMKA 3KBBA 4KE6A 3WL6A 3RAEC 2FFQA 4MVWA 2GLXA 2RGDA 2GJAA 2O6LA 3B78A 3MELA 4KYIB 2YHBA 4MUAA 4Y1EA 4AS3A 5IE9A 1UPTA 1Y8CA 1XD8A 3S99A 4TV8A 1E7KA 3FSGA 3SFZA 4BE7B 5KOJA 4DV2B 1C7EA 2JFNA 1V8ZA 1T8YA 2IYUA 4WKOA 5BVHA 1W5SA 2ZR3A 2XAQA 4KZPA 1PL8A 5CCBA 4J0QA 3T1HO 1QG4A 4D6PA 1ZD3A 5B30A 4C4RA 2B2XA 1P77A 1SVLA 2I78A 4A8PA 2FUKA 4JX9A 2XD9A 1RQGA 1TVKB 2HQRA 1XKTA 1PV4A 1DWUA 1XZKA 3PEVA 3A9SA 3M6LA 3GXOA 3N7AA 3DL7A 5TGZA 1CUXA 3FHOA 1Y80A 1RWXA 2QZ4A 1KC8H 1AKWA 3NHZA 2MDTA 2NN3C 3ETDA 1WXGA 3DULA 4WY8A 5JAQA 2FWPA 3SYKA 1DBRA 4JYPA 3ASNC 5C7LO 4CEJA 3T35A 2XVMA 3EA5A 5ECYA 5J2UB 4ZEXA 2Z95A 3I9LA 4OLJA 3JSNA 1LUVA 3O8LA 4Q18A 1LUWA 1RSOA 1EGMB 4S1NA 4XQEA 1IEWA 2QX8A 4ZCSA 4EUFA 1S72V 2N3ZA 2NVOA 3FYUA 2H3OA 5EMNA 1QGED 1RHQA 1WY5A 2B7CA 3R7BA 1JHXA 2P9ZA 4MUIA 2YV5A 3IDAA 1RQLA 4PC6A 3I52A 3T5AA 1HDEA 2QE7D 4CM3A 2PTHA 5DK4A 2PAFA 2CK3D 1T1GA 4LBYA 1SKYE 1SZPA 4W7IA 3ZGYA 5CDSA 1RI4A 1T1EA 1OCCC 1VLJA 2ZJ7A 3ZIUA 2Q99A 4EKIA 4EO9A 3ENVA 3BN3A 4G26A 5JSFA 2BTEA 2O8FA 2PFKA 4K7JA 2G1JA 1SRRA 5IDVA 1G1XB 1CEYA 5I5GA 2I9PA 2Q07A 5G41A 1IN7A 1NX9A 5AW0A 3GEPA 3TUZC 2J87A 3D3WA 3F5TA 1ZUWA 1IV4A 4YP5A 3OY7A 2G1AA 5ECGC 2KLHA 3GNQA 3PX7A 3X43A 2X3FA 2JAQA 4PO9A 2HJGA 3V33A 3THWB 4RF5A 5E6UA 2QKSA 2NLOA 2OCKA 2QPTA 4Z1MG 4P3YA 1E5QA 3AR8A 5FL7A 1U1EA 4OL9A 1LY1A 1EHYA 4DIUA 4KP4A 4C3VA 2Z5GA 4CFZA 2A3NA 3HHEA 1R0XA 2RGRA 1T0HB 4UVHA 4UM5A 1U2SA 3IS3A 3UHFA 4DF3A 1FIUA 4X9QA 5HIMA 4O4HA 3NCHA 1OREA 121PA 3TZEA 4Z3OA 3ZHTA 4I9FA 4TWZA 4PGMA 621PA 4WNAB 1RCUA 1EFTA 3ASVA 2WG1A 1XXHA 1I0IA 1TM7E 3CCRF 4ZAXA 5B6JA 1EFRA 4QOFA 1OYOA 3CC7V 3VMFA 2ZKLA 1VHTA 1Y4DE 2VZ0A 2YQ4A 3B60A 3FPBA 2I1LA 3WQRA 1GM8A 1GVHA 2OZLB 3PPWA 1HUQA 1WAZA 2UZHA 2FE4A 3EVAA 2A4MA 3G13A 2W0MA 2XMRA 3I2IA 3WLFA 4BEJA 3OU2A 3G6KA 1K7FB 3A6KA 3RT1A 1E58A 2NSJA 1F1BA 2XAAA 3DDNA 3QKRA 5HKLA 7YASA 4IZ6A 4MX8A 3W3AH 9LDTA 3PVCA 2FB9A 2HJHA 5J4HA 4MA5A 5GINE 3QVSA 1JEAA 2W2XA 3UOGA 2VNSA 3OR6C 4I55A 1GA4A 1N6OA 1QLHA 2OXRA 2QD3A 1HDXA 2WLKA 1E2JA 1PWYE 2F67A 2Y8EA 1V6CA 2C07A 3QP9A 2HBRA 4KGZA 4C21A 2FUNB 4L22A 4TGLA 5J2UF 2ATXA 5AVKA 2JBAA 4PPQA 4A2QA 5MF6A 5DO9A 3UBTA 3ZLVA 4I8IA 3ER6A 3ZR4B 5ENVA 2NSLA 2QRQA 4Y0VA 1RHKA 3TGPA 4OYHA 3CUWA 3ZOKA 1KK3A 2EF1A 4YO8A 5LFAA 2Q4PA 4NFYA 5EZSA 1R5BA 3V4ZA 2Q7HA 4N41A 5IT9M 1EQ2A 2AG1A 3TEJA 2FEAA 1QZ3A 2RG1A 3C24A 2O1WA 1IULA 1N9GB 3P9XA 3QBDA 3QWIA 5HKAA 5J59A 2YNMC 3K5NA 1CJUC 2CFIA 3KXPA 1W40A 1LFAA 3NYIA 4NR1A 5FL7G 3RYHB 1HE3A 2WAAA 3PGMA 1R6KA 5FBLB 1V3VA 2W58A 1P3JA 3LVQE 1C41A 1QCDA 3E5RA 1YC5A 4MQ5A 5HKOA 2P2CA 4XFDA 5PGMA 3EVBA 4L74A 4D9JA 1XRSB 4G8JA 1PJSA 1H7MA 2C61A 4CEHA 2YVLA 2FMFA 3CN9A 1Z3IX 3OM0A 1M1NB 2GEDA 3MC1A 4WQMA 3W5IA 4EGJA 1QU7A 3S8YA 5BNTA 1BXGB 1RYBA 3CNNA 3EZFA 4G81A 3O8CA 3DTUB 2UXDO 3DXFA 1S01A 3FKSD 3OE7G 1CNEA 3KR2A 4AMBA 4C4YA 4ETIA 4R9VA 3LD9A 1AUPA 2W90A 3ROMA 3SSNA 3ZS8A 3ZWYA 5LHGA 1FNBA 4Q93A 3C15C 2XOKD 1YH3A 4NG5A 2C5EA 3STYA 4R6XA 1DQRA 4EBFA 2J6BA 3S7TA 3WWYA 1YJ9F 4WIAA 5IXSA 3TM5A 1JNYA 1GZDA 3OE5A 1E5VA 3DAYA 2YR0A 1QGDA 2FEOA 1BS2A 1MOPA 2QX6A 1P7PA 1N5LA 1VJ0A 3RS7A 4PY2A 1YAHA 2POCA 4TRMA 2V97A 4JQSA 1RLTA 3D1VA 4GI3A 2AXNA 1PG2A 3QMPA 4F2GA 3PPVA 2FZGA 2CN1A 3DZBA 2GV9A 3WBFA 2Q73A 2QD2A 3HI4A 4MSWC 1J2TA 2IIBA 1WHSB 3AVUA 3U3OA 1E9EA 3QVVA 4NNJA 4Q4AA 2JFQA 4Y9TA 5TXGA 1GZ4A 1H9CA 2W6IG 2Q46A 4C5BA 4XVCA 1Z06A 3COWA 4UZFA 1L7RA 1I2BA 4PLPA 5FBQB 2R1TA 4FM9A 3AG1B 5FFFA 1FNDA 1QCCA 3PUVA 2YIMA 1IE3A 2GJ9A 4UREA 4B7KA 2EWMA 3ZN1A 2QI2A 4LRWA 2VQFO 4CLHA 1P0PA 4J1TA 4DCUA 2EJTA 3L1JA 2VP0A 2X9LA 2FOLA 3H04A 5T3UA 1CDDA 4B8WA 5K05A 2YJNA 1N8TA 4JP8A 3LDEA 4PAWA 3WYGA 2CWDA 4E4YA 5JI3E 3JV7A 3RUDA 1N2JA 4XLTA 3GGDA 4Y2RA 5IBRA 5TE9A 1BJKA 5EJ4A 5KZMB 2EZTA 5LZ8A 2JLUA 1UM9B 3K58A 1I2MA 3HDTA 3RC9A 1YS6A 3M6FA 3TSAA 1SQFA 2RHJA 3IB6A 2A9PA 2EJRA 3CCEF 1VIDA 3DAFA 3QKUA 4QXMA 4LCUC 3ZZ0A 4HJXA 1NKVA 4MYDA 1L5LA 1Z5WA 4Z49A 3H4IA 4UHFA 3QXGA 1C1XA 2ZIAA 4YAIA 4F0JA 5C9ZA 1YOBA 3NHYA 4CF4A 1H93A 2ZBPA 4PDRA 3B3AA 4MV7A 4RYLA 3TMKA 4TQFA 3HVHA 3IQZA 4CN9A 1H38A 1KY3A 1H65A 1FYVA 1Z15A 1VQ4F 4DXWA 4FIZA 1BQ4A 2OKCA 3D6MA 3GGSA 4X60A 3S40A 4X7PA 3BE6A 2DJ5A 2ZJ2A 1Z29A 1T4GA 1DT9A 4LRTB 1XTRA 5CT8A 4FIDA 1TO1E 5I5EA 2ZWMA 3RLFA 1W87A 2R6AA 4G5HA 3SC4A 5THXA 1KO5A 4XJTA 2DQSA 2HMSA 3KU1A 2H0AA 4BVHA 3VVBA 3LWPC 1CVLA 3I3SR 3LTEA 2HVJC 2VNKA 4AP6A 2Y66A 3IUMA 2I2BA 4OMUA 4DA6A 2Z1NA 1JR3A 3A1SA 1GN3A 2EIKC 3BIOA 4TS1A 2XDQB 3B82A 3IHLA 3CEHA 3THWA 1KAOA 4KC0A 1D2DA 4YP6A 3LQFA 5LQJA 3T95A 4JI4O 2JIZD 2ARHA 3P0FA 1A3CA 3HJWC 3VC1A 4ZIRB 4K6GA 1JALA 3HKEA 4AN1A 1QC5A 3TZQA 2FK7A 1YZYA 2HSJA 5EJ5A 1RP3B 2GZLA 4MVJG 5H9WA 1IXMA 4KIUA 1GITA 1QJCA 4YJ3A 4C5CA 2WIFA 4CMEC 1JX9A 3CXCF 4MWGA 3OAAG 3Q12A 2X4DA 3EZ2A 2Q29A 1VJ1A 3IIMA 1WSBA 3HUUA 3DE3X 2PE5A 3SHVA 3AB7A 4ZZ0A 4E2LA 2ICAA 5LKRA 3LQ2A 3D5EA 4QLOA 5DKFA 2Z2XA 3OTOO 4RSRA 3L6RA 3UJPA 1Q3TA 4FNGA 3LLCA 4RGQA 4C87A 2DQKA 2IODA 4UFNA 3URMA 5IAOA 4INPA 2H51A 3VU0A 1QYDA 3ABLC 1W2GA 4WPGA 2KB1A 1H5NA 1FP6A 3QUBA 1VQLF 3T3NA 5AJXA 2X6BA 4JVSB 3E61A 1O6ZA 4C20A 1TA9A 1D0VA 2FF5A 3ZQUA 1F6BA 1E59A 2AZTA 1MXHA 2OQVA 3S6JA 3WBKA 1UKZA 2OO3A 4LXQA 1FUEA 1XFAA 1FP2A 2ZANA 4F5WA 4NMLA 3MBIA 3OONA 3QLVC 3RFCA 1UAGA 4ZHQA 3ZWXA 1EESA 2CYAA 1XQ8A 3VNAA 4M1QA 2O5CA 4QG7A 1B1AA 5JJNB 1BROA 2ZRKA 2FPXA 1X8XA 2IGTA 2GXSA 1G8MA 2IXFA 2CHEA 4KK3A 4RQUA 4MPJA 3GFPA 1NW3A 3NRBA 4WFIA 1XV2A 1UPFA 3W9BA 4CNQA 1GQOA 3IL2A 2R9IA 1PNQA 1I5EA 3V4DA 1TPYA 3NXSA 3H1IH 3CF4A 2HHHO 1ZJ4A 1VZ2A 2AJCA 3WP1B 4ZAZA 4B9AA 3E2MA 2RHCA 3WNVA 2BEWB 3R7WB 1F9EA 3B77A 2I6RA 1DLBA 1G5RA 1Z0KA 4G2NA 1I1HA 2EZ4A 5G0TA 3NC4A 2PSFA 2WF6A 2RQ6A 1ZO8A 1R4MB 3I37X 2A67A 2PZLA 4B83A 1HKUA 2OTCA 1R6VA 2UYQA 2DFLA 3EW7A 2WUEA 2AC2A 4DZTA 5DH9A 1NVMB 2D5BA 3IJEB 1NULA 1DHTA 2AEEA 1SUBA 2OFPA 3LSTA 1ZUHA 3QFFA 4ILEA 4HZIA 5TC4A 4LW8A 4FONA 4BKMA 1LLFA 1R0RE 3PNOA 4HNGA 2VBGA 1INLA 2ZIOA 3GMIA 1JIUA 2OBYA 4UUNA 4F5EA 1QANA 2WHYA 1BKYA 1GY8A 3WMXA 3NS7A 3CRMA 2ZIVB 4LCEA 1KQSU 3QVXA 3FTEA 4AJEA 3VH3A 5IM4A 5CFMA 2GRAA 3OUZA 1AR1B 3IVGA 4GKAA 3KT8A 4FC7A 2WHRA 3M5CA 1OV6A 1I2CA 2ZRPA 4JQZA 4M7WA 1A2OA 1RJ9B 4P3PA 4RAQA 3UVEA 4C1NA 4CQMB 4TV9B 3K71B 2GM9A 1GGNA 1HSOA 2CBGA 2VWQA 3OX3A 4ZOLF 3I05A 3RJMA 3SEZA 4P0QB 1LJ8A 4OI4A 3JQAA 1J5XA 3HB4X 2W2VA 3EF3A 4YBZA 3PCTA 3LQ1A 4AKGA 2Z01A 4EG7A 4YJ2B 2A0YA 2UZ0A 1B0AA 2G17A 3BA6A 1BH2A 2E85A 4YUAA 1AMNA 3DH0A 3NIDB 1ENVA 4C0BA 1JH9A 4C7OB 3QXHA 4J41A 2HLPA 3ND9A 4P5PA 5JD5A 1JR3E 1XEAA 1I94B 3R4CA 4KSYA 2X6RA 2ZD9A 1QV9A 5H6RA 3UAYA 3CKYA 2FSVA 1Q74A 2GBLA 1TT5B 1R3JC 1UK6A 4X7RA 3I1IA 3IFSA 3NR7A 3IELA 3K70B 5IYZB 2Q1UA 5ERGB 1FQOA 3RNLA 1OILA 4XTRA 2X6CA 4MV5A 2ODWA 4V3CA 2CCGA 2GYVA 4ZKDA 4H18A 3QOXA 1CR6A 2JGIA 4BATA 1H9BA 4DLZA 3Q2OA 5K0EA 4WFEA 1KA9H 4LHEA 3R24A 3MPUA 2V03A 2L18A 3IBFA 1MAHA 3VXKA 1NJ6A 3PLAE 3KYBA 1CQPA 2AVDA 3IR9A 1T4MA 3O0DA 4UASA 3RANA 1QB8A 4R5HA 3EOBI 5DHAA 4DV6O 3A7EA 3CT6A 3GMSA 4H08A 2ZYIA 2ZIMA 1N5RA 1ZWZA 4C81A 2PQ0A 1F51E 4JZYA 2WF8A 4B6EA 1DKUA 5HM8A 1MT3A 2P11A 3CR3C 3B6JA 2M6LA 3KJFA 4FFMA 5DGTA 4O3MA 2ZYVX 2GBGA 1IIRA 3OZSA 3X44A 1H05A 2Q41A 3A9VA 4MKGA 1DWPA 2DC1A 4BKOA 2AQHA 4B4DA 3DHNA 4L4YA 4ENQA 2L35A 1BCRA 3SHOA 4NU0A 3WFVA 1FPOA 1YRAA 1GKFA 1ZOOA 3CCSV 4GWKA 3MRSA 4KXXA 3AGKA 1U7TA 2WAYA 2QRHA 4WDQA 4ASUD 3DDSA 2UZ4A 4N7BA 2H1FA 2XH8A 3WV4A 1CRWG 3Q2KA 3UMVA 3P27A 3FOCA 2WTAA 1H4QA 2DXIA 2P6NA 3BX1A 3G89A 3K5WA 3TSCA 4IOMA 5B7PA 1M8PA 3NIWA 3D8CA 2M6SA 3DBHA 4P83A 4V0MA 1SB8A 4INAA 1BL8A 4UV9A 2PLAA 2QGNA 4PCLA 2VQFB 1FJXA 4NAUA 1AS2A 2B98A 2W6NA 3JD1A 1KFKB 1PNLA 3CH5A 5EMHA 4L3WA 5C80A 1YR8A 3TD4A 1DX4A 2D1FA 2VQSA 1UWLA 4RLFA 4KQ2A 5CYFA 2V3WA 5H83A 1Z63A 5TS2A 1J2YA 3FNEA 3F6CA 4LDAA 1H85A 2J5BA 3CC2V 1MPXA 3NRJA 4J0EA 1E2GA 2GCOA 1XMIA 4QLBA 3N8KA 4WLUA 5DHFA 1V96A 3KM0A 3PN1A 3TFOA 1GPMA 5EJGA 3Q4GA 4PINA 1T4DA 1J8DA 3RYCA 1DRWA 1JU3A 1ZVKA 4LC1A 2GK4A 2P3LA 1D0SA 3DE7X 3O94A 4FFOA 4HZUA 3TG2A 2VTVA 2XB6A 2H48A 4PFJA 3H0EA 1XMQO 3AHJA 1CNMA 2G1KA 4HPJB 4Q39A 5CYGA 5KB3A 3HKCA 2XVXA 3FMVA 4WNAA 4QQNA 3APQA 1I0HA 3X1MA 4KH0A 4HAIA 1E2EA 3LHSA 2YIBA 1L4YA 2DHEA 4RY0A 3RGWS 4NULA 5BN3A 4B3GA 3QKWA 5KSZA 1T2EA 1J2EA 2DQZA 2AR9A 3ANMA 4JASA 1RC8A 3R65A 1YB4A 3WLQA 1WEKA 3L0CA 2WTEA 4TLBA 3P5BA 3MWGA 4ZD6A 2OBNA 4IMJB 4L8LA 3NNSA 2RGNC 2DY1A 5IP5A 4CI9A 3DDWA 2FSFA 4FFRA 2FPPB 5L3QB 1MMMA 2PSSA 4G3XA 6ABPA 1XN4A 2OSBA 1JDNA 1T9AA 5C8VA 4P9OA 3HVUA 1XMOB 1G41A 3AUAA 3K6KA 5FDFA 5F7ZA 4KUMA 1XLWA 1G8JA 2V7BA 1Q5PA 2VWHA 3CNQS 1O95A 3NALA 1YVDA 5LMNO 4IO0A 1O0SA 3C3JA 3UICA 4LGYA 5EIAA 1VSVA 5HY0A 1YMQA 2F3PA 4I4TA 5A3JA 1V25A 2PJZA 4D3FA 1WB7A 1X0XA 2XTNA 5T64A 1Y8ZA 1MJGM 1Q3HA 1W57A 4HV4A 1EFVB 5IABA 3RVLA 4FW9A 7GPBA 3AC0A 1BRMA 5B1HA 4I19A 5IKXA 2YN2A 3IUYA 2QTOA 2GAAA 3CEJA 1JPNA 1UDRA 1N5DA 1YE5A 4DIEA 1JAXA 1CUWA 3PNPA 1OE0A 4NOLA 4I4LA 5KOYA 1QE0A 4FMDB 4LUCA 4U7FA 3BWXA 3NNDA 5HFAA 5I4KA 1U8ZA 4ZKIA 1HGXA 3N87A 2Z08A 4AZ0A 2GBOA 1FFGA 1O9BA 1X70A 2J5XA 1NVXQ 3SY8A 4ZOEA 5A6SB 1KF0A 1A8UA 1PQYA 4IINA 5BT9A 4UTPA 2WINI 5BNFA 5EINA 1XVIA 2C0PA 2YNMD 5COQA 1W42A 4YT5A 3R8CA 2IBSA 3ZW8A 4BIOA 2HA4A 4O4HB 4J9UE 1GTVA 5DXJA 5FJIA 1POWA 3AEIA 3DKKA 4FE3A 1OFGA 3DGEA 1WVGA 2J3JA 4PELA 4D0RA 3MJDA 1VE6A 4C2AA 4EH1A 2NZUG 1IOVA 4BN4A 5CFOA 2FQWA 1SXGA 3HGTA 2V6MA 4QASA 4IVPA 1GV1A 2WM9B 3V8QA 1K7YA 4I50F 3VU9B 3ZBTA 3CVWA 2ILMA 1GFZA 4U3JA 4NXMO 1VPVA 2YCLA 2DRIA 3JWGA 4FHEA 2NU8B 4IOJA 5REQB 4OXQA 4F97A 3RFRA 3A1CA 3LIPA 4IZHA 4R2WA 4B9EA 4EA9A 4UUMA 3SHWA 4GPZA 1D2MA 1XAHA 2J9FA 2ZOVA 3IHWA 4CUZA 4ZYTA 1E3IA 3SBDA 4WEOA 3SNKA 5JNVA 3DM5A 3OP1A 1Y67A 5ED0A 2BF7A 5FI1B 5ELMA 5AKZA 2C7RA 3GJ7A 3GK3A 1QHFA 1DTWA 2ESRA 4UUPA 2GN6A 1NR7A 5BW4A 3BFPA 2KWIA 4Y2UA 1PS9A 2OECA 4KPGA 5KCZA 1KZHA 1GO1A 4KV9A 5HP4A 4I5DA 4EHLA 4A8JA 1HQYE 3UM7A 2ZTMA 3LVFO 4L8WB 5FNVB 2ITDC 1XDWA 2G8LA 4OXYA 2GPTA 4CKWA 4HO1X 4F46A 1PV2A 2VXYA 2EX0A 1LQ2A 4WX2B 5AI5A 4AN0A 2YZ7A 4IH1A 3I6MA 4LDNA 3GQBB 4INZA 3WRYC 4R05A 4MKHA 2R44A 1ST3A 3JVDA 5JPIA 4HVLA 3F8TA 4PN7A 5BW5A 1I9GA 4JI8O 1YQQA 4QREA 1XA4A 5HZMA 1KVUA 4JBHA 3OFSA 2MMCA 4QUBA 3EIXA 3NUGA 3P2MA 1A82A 4FT4A 4OMFG 3RYCB 4DCJA 5JSUA 3NHFA 4BP1A 4K5QA 3F6RA 4PLTA 3RC1A 1FTQA 2GEUA 2AZMA 3AK1A 3WHKA 4MQFB 3QBVA 4NP6A 3Q7IA 5JV5A 1OJLA 2Q0HA 3KLBA 4P4SB 3ZHBA 1G8GA 3BRSA 1NDUA 4EB3A 4Q34A 4BZQA 1YWGO 2GWHA 2YWDA 1ZY2A 1TQ6A 4M1YA 1IZ8A 4GVPA 3UAXA 1OTYA 3O4VA 4N3GA 3M99B 4HUQA 2FTKE 4KUHA 3U17A 1SVKA 1IBRA 1CTQA 1OVGA 2MSEB 3F7TA 1OXUA 3K20A 3VR4D 4D25A 4D2IA 3V1NA 2R9RB 4UV8A 3A04A 4FN5A 4R8VA 4G4JA 4BBAA 1RYZA 2D3TA 3W3AA 4NEHB 2Q45A 4Y6GB 3Q4HB 3JAMN 3GFSA 3LCVB 4KIGA 5FF9A 1UJBA 4EVSA 1ZJYA 2HRBA 4XX0B 1E3DA 2WJPA 2G9VA 2YHIB 1AY0A 3LPMA 3Q3EA 1E3WA 2NGRA 3ZBUA 2RHLA 1PNVA 2J07A 1I6WA 5F23A 2GPYA 1BDBA 4WZBB 3DMTA 4HAXA 1UPGA 4QU9A 2NU6A 3SPHA 4BVQA 3IQDB 3ZMUA 1VL2A 3D5TA 4MQBA 5JO9A 3RA6A 3I2JA 3MEQA 3MW8A 5LHHA 3EZGA 1SD2A 4LKRA 3G9QA 4NY1A 3ZWVA 2ZR7A 2ZK7A 2I4MA 4BPBA 4W6QA 2VF8A 2JK0A 4FW8A 3F9RA 2GF0A 3C3KA 1VQ9V 4KZKA 1G8YA 1WXEA 3HY3A 2RHBA 3CJQA 2RCYA 2P35A 4CTJA 4L5CA 1G6OA 1AILA 3C8LA 1NASA 4EHJA 4FMCB 4YV1A 4MR7B 1AGRA 3INNA 3IIKA 4AMGA 3VZQA 2PMBA 3D00A 1PFYA 2YUAA 1EWRA 1FJ2A 3L6OO 2ZE8A 1EDDA 2OV2A 3AB8A 3GZTB 3C1UA 1B6QA 4OFWA 3HXQA 2RCVA 3EDMA 4E46A 1E89A 3CKMA 4HRYA 2DWCA 3TW6A 4ZHQB 3DMRA 1TYBE 3HU3A 3P94A 1AQJA 1QYWA 5FTNA 3FPKA 3LDGA 1R4NB 2F7SA 1ZVVA 4TMYA 5LP6F 4TRNA 3IV6A 3WY9A 2OAEA 3LY8A 1K4KA 4DN6A 5LP1A 3W4JA 3D1LA 4PU0A 4BU1A 2ZRQA 2PUBA 3HTXA 3DTVD 1JB9A 1CE8A 1KEVA 3QY9A 4HQRA 1YU9A 4MSUA 3E05A 5SV2A 4DYVA 1I7DA 1BQEA 1GTJ1 1H8EA 4TM8A 1GPDG 2ORVA 2BMAA 2PU5A 4PR3A 5FQNA 4ZC1A 2VYNA 1E1LA 2WYOA 1BEUB 1FSPA 1H48A 2JAHA 3MWLA 1GZ5A 5IKOA 3RK0A 3FN4A 4J7JA 1Z0DA 4TKLA 5AVTA 1EFDN 1GPBA 1PJBA 2RC5A 1W5EA 4JV5O 4L2IB 4DJJA 2CWWA 5JZMA 1YULA 1YFLA 2HQSA 3HY6A 1TRKA 4RA9B 4TXLA 4E1VA 1OH6A 5LMCA 4X1IB 3BGIA 2E7ZA 4GRIA 3OJFA 1W47A 1KE1A 2X7JA 2NO4A 2IUYA 4MR8A 5U1PA 3TTSA 2GZHA 1X1BA 4OA5A 3FUXA 1GNLA 3A6GA 5EHZA 2ET6A 1XZDA 4A6PA 3OJCA 3ICOA 3OFNA 3W78A 5K6AA 5KO2A 2JDIG 2CLFB 1VHLA 2E48A 3RFUA 4KBYA 3UUFA 1SKAA 4DKJA 3MMSA 4QQFA 2MW2B 2IUTA 3L82B 3ZHXA 4Y2PA 1NBOA 1G42A 4RE5A 2ZPUA 3LPNA 5F52A 2E5LO 3PSAA 1IHUA 1A50B 5DGXA 3QUTA 3RSSA 3GFBA 4HQKA 3WBJA 4IF4A 4JI5B 4N39A 4K8RB 3VAZA 3S03A 4S35A 2YH2A 3KSBC 3LY5A 4UB6Z 2HSGA 1EG2A 4NATA 3LFHA 4QOIA 3EEFA 1A77A 3LOQA 3ZGZA 3QPDA 1QLNA 2PHNA 4G5QA 2X9QA 4KMOA 4WNIA 4WN9B 1KWKA 1BVUA 3PJRA 2XQKA 2QYOA 3MTIA 4R31A 4N12A 2DFPA 3PFWO 4CV1A 1JIXA 1CJBA 1KC8W 1JVBA 2AFHA 4K9KA 3DWIA 4W7HA 4HEHA 4JUFA 4S2UA 2ZQMA 2FETA 1QSGA 3O8NA 4TWAA 2OILA 2EXXA 3WJ1A 3CPSA 4A0HA 3IJRA 3WLPA 2XNDD 5BWCA 1OFVA 1S6YA 1KJYA 2X7RB 2CLDX 4ND8A 1W0JA 3W04A 3VC2A 1QYVA 2B78A 4AI6A 2CXSA 4P30A 2CE7A 2IEDA 1ORVA 3EVEA 3CPJB 3NBQA 3PBKA 5FTWA 3S2YA 1FY2A 3BSFA 3WLIA 2LBXA 2PLRA 5B1YA 1JNXX 5EWLA 1NG1A 3UMSA 1CVIA 3L0OA 4LS3A 1LXCA 3MCAB 2WIAA 1R6BX 3FVRA 3CS5A 5FCDA 1UBHS 4KXFB 5DISB 3ZHZA 3LY7A 4BO5A 1GXSB 5C2JB 5IX8A 5EIXA 4C7OA 1UDXA 4M0CA 5KAPA 1LS1A 4W6ZA 5T4BA 2ZRGA 5C8YA 1LPSA 2H85A 4PNHA 1HP8A 5ARCA 5EIOA 1JXOA 4D4MA 2BFWA 2YWCA 1UWVA 3FBAA 4OPMA 3LDDA 1N2CA 5A05A 1ZSVA 4CGZA 4ID3A 1KDVA 5F5XA 5A5VA 2GM5A 3HZZA 1XL4A 1TYDE 4W8GA 1FFBA 2FL4A 4DCMA 3EPKA 4HG2A 3LBYA 5BMVA 2B1RA 4HADA 4NYMR 3RI3A 1VA4A 3LZCA 4ZPXA 1EDZA 1QQTA 2F2TA 3KZCA 5DYGA 4DJTA 4U3JB 3IIIA 3T7EA 1M1YE 3RTEA 1O0CA 1E2MA 4K9OA 1DEAA 2QXYA 3EYAA 2BCGY 3GHZA 1R0ZA 3NH6A 5FLEX 1VMIA 2ONZA 4UHEA 1ZD1A 4RH0A 4R40A 4G25A 3TPZA 3QEBZ 3QEOA 3NTVA 4G4GA 3LUPA 2WMOB 3H97A 3W5HA 3EGEA 4H0LB 3K0SA 3T1HB 2VJNA 2VYCA 4C7VA 2F1IA 5AIAA 1ZUNB 2OCCC 3HCOA 4RC9A 4QXOA 3ZJUA 1MB2A 2GTPA 1YRWA 3EMBA 3T4UA 1GFIA 2CTQA 1ISGA 4JJGA 4TTPA 3VZCA 4DVGA 1PT9A 4JB3A 4BNXA 3K5MA 2GPNA 1BGWA 3KJKA 2ZAIA 4BP9A 3RS8A 4WKBA 1C7ZA 4EJ2A 3IRUA 2CSLA 3D02A 2BGIA 1OLUB 1HYGA 2AXEA 2QRMA 4NQZA 5BQPA 4AJHA 2GCOB 5C3MA 5ADHA 2ZYHA 2A2ZA 2UAGA 2WJ3A 4KH1A 3IBSA 4QPJC 3BEDA 1L7AA 2VWKA 2PHZA 3OC6A 2PZFA 3R09A 5L8VA 3I04M 3BVOA 4YCMA 4NYMQ 5MGNA 2GSDA 2BGGA 2A0KA 1NW8A 4ACAA 4UFZA 3N0XA 5KHHA 1YS2X 2WE8A 1MDFA 2ZSKA 1OTHA 1XL0A 3WGZA 3T5MA 2CBZA 3IUPA 1E79G 4X6LA 1UT5A 2B37A 2CFRA 2EHJA 1FDVA 2J9XB 1G6KA 2CNKA 3G0OA 3ZRWA 4PBRA 1E63A 5KNDD 1M6VB 1QFZA 4ZJPA 1VL5A 3QE0A 4P3XA 1A4RA 2QS9A 3FPJA 4ZI2A 1T6XA 3FUVA 3MAQA 4JPRA 3QVGB 2ZB7A 3DOEA 3ET5A 3UTDA 1QO9A 1GR1A 1RJWA 2P78A 3T41A 3WRWA 3V97A 4P31A 4UTXA 5KCMA 3H0CA 1K9SA 1RZUA 2VYQA 5KYTA 5DEDA 1OQAA 1Z5OA 4BKQA 2IM9A 1NF8A 3D3WB 4MDFA 3GFVA 1LKZA 1N0UA 4L16A 2EIXA 1SZDA 2QN3A 3AEYA 2IYWA 2JKZA 3G8BA 5IEBA 5KHGA 1PK8A 4QUDA 1KK2A 2QLJA 2YHIA 3LSQA 1IL0A 4U2FA 3VZSA 4C88A 2F17A 3UJ6A 3EFEA 4EW3A 3G2KA 3LDAA 3VYRB 3E3OA 3D7KA 2XT6A 4WXEA 2LKDA 3GA7A 4TKVB 3S2GA 4BV9A 3IKTA 2HJSA 1M56B 5DCWA 2LV8A 1YXMA 1OPXA 4Q1VA 4YUZA 4OLFA 3A4IA 5EIFA 3GZJA 5HBGA 4YMTA 3OMWA 3LF2A 3JQQA 4RESA 3GBSA 4DDUA 3O8RA 4B3FX 4ESVA 1ACLA 2QI9C 3OLYA 3GT4A 1NGSA 4JUAA 2O3UA 4ZANA 2A5LA 5FUYA 3GVIA 3ZH2A 4CT5A 4GYKA 2VNJA 4B08A 1EUYA 2XA1A 1SKYB 3NVAA 3OOWA 3EPPA 3DNPA 4QQRA 5DM4A 3DVSX 3PF8A 2VGMA 1A7KA 2FI1A 5FAKA 1L0BA 4R1MA 4ZHYB 1UZAA 2FN4A 2PY6A 4YCAA 2CJYA 5FUWA 2VCEA 2VDRB 4MUGA 2VQEB 1BHQ1 3C87A 3ZE6A 5KYNA 4WGFA 2I6QA 5KUKA 5I7UA 1IEVA 4CKEB 2V6IA 4QU0A 2YWRA 4MWDA 5FYQA 1S3JA 1YFJA 1ZH2A 4YA6A 2UXNA 5JZOA 1DGSA 2W22A 1SK9A 4GOLD 3RREA 4P93A 1MO2A 1VJRA 4NWIA 3HFGA 3VKWA 3AEUA 5KYXA 5M7EA 1QG6A 2V3CC 4KFMA 1KMHA 1XU9A 4H16A 5L3EA 5KYWB 4TV8B 2PGLA 1BVRA 3G0CA 3Q87B 4N8DA 4REMA 1Y4ZA 4ALLA 3PK0A 5ECDA 4V1CB 5HHTA 3AP1A 2FWRA 5IUJC 3HXMA 4EP1A 1SG0A 1NUHA 2NX2A 4G37A 1RBMA 4I1OA 1XAGA 1PD1A 1T8UA 4U00A 3V7WA 3ZLBA 3BXHA 1JECA 4A26A 4BMNA 4CCYB 4GX2A 3IP1A 1BMFG 2WLHA 3ABKC 1UANA 2AV6A 5DOZA 4BWYA 2IIQA 1J6UA 3IDFA 1UQTA 1ISRA 2R84A 4BVKA 3H7IA 2HRYA 1VIMA 3DFIA 3ONVA 4IDPA 5IAGA 1U8XX 3LS2A 4F3CA 1EXVA 1UMDA 4P6VF 3EK2A 5IAKA 3JVHA 4PIPA 3LSSA 2BFFB 5DI3B 1E3WB 1WW8A 2HEPA 3N2YA 3WNBA 4EA6A 3RVOA 2PYDA 3T1NA 2C4UA 4D4HA 3TR6A 4JNCA 5TJ9A 3S0WA 3CLRD 4O2AB 1DRJA 1YZUA 3P2EA 3LYLA 4LI0A 4BC0A 1XD2B 2AQIA 4FYKA 3AEZA 5HSGA 2RKBA 3PJFA 4UTVA 4A8HA 2A7QA 1P5RA 5HS6A 3FFMA 2FX3A 3ZDZB 5EWLB 4H1HA 4IS3A 3T5TA 3D31A 5ISMA 1G4AE 3EUWA 5I4IA 1SOMA 2J4CA 2YWGA 1BZYA 4WLEA 3LI2A 2PANA 3FMPB 1L4UA 2BFDB 2QMYA 4JJEA 4JU9A 3U4CA 5ITSA 2NVUA 3ANLA 4UM9B 4MVCA 3WBBA 2P62A 4DV3B 2CXPA 2H1SA 4ENUA 1QAQA 1LBIA 3KYDB 1SOWA 3VQYA 2A59A 4NCXA 3J80A 1NWHA 2AHRA 4WGGA 3RVSA 3QU7A 4OJNA 4MKFA 2RHMA 4G0OA 2PH5A 4V2IA 2DWQA 2P1ZA 2ZAMA 4I3FA 1V9SA 2IYQA 2KX7A 1JDBC 1IRIA 1J1UA 4C01A 1S2MA 2C9CA 1LPNA 2A35A 2W2KB 3DJFA 1EXNA 5ARDA 4ENSA 5L51A 3EC7A 1VLZA 3CTMA 1AUXA 3H2HA 4NYKA 3JRXA 3A3KA 3MXTA 2R70A 1PGOA 4AURA 4NS4A 3NANA 3AF6A 4QPCA 2O2XA 1N2HA 4Y2GA 5HP8A 4AP5A 1XGKA 4GT1A 3QQ5A 2XITA 1GQRA 3IKVA 4K86A 4MLCA 4PR0A 2VDMB 1UL1X 3DHEA 1N4DA 2O0LA 2V74B 5LKAA 1BDHA 3N5KA 4WKGA 4FMBB 3CU5A 1CJKC 1PGQA 4IMRA 3FYSA 4PGGA 3AG2B 3D36C 4JAAA 2J7PD 2REQB 1GGMA 2WR8A 3CE9A 5I3ZA 4MGHA 5JS1A 3QO5A 3MMNA 3CYFA 3I92A 4KLZA 2H7VA 2HRZA 3V3KA 1M6YA 2Y1WA 5EKSA 5FPYA 3WDMA 4AS1A 3WTCA 2JEZA 1KH3A 2WE7A 9ABPA 3N0RA 1RA4A 3OIDA 4F96A 3TSZA 1T13A 4OYYA 4QRHA 4K0KB 4C0SA 2DX7A 3DMHA 2I8LA 1AGYA 5H6QA 1T9GS 2HA2A 3HU5A 1MKYA 4UNQA 3VR4A 1W0JG 1X92A 4IUDS 1RAFA 4Q7LA 1WXHA 1I4DD 4XM2A 4EPVA 2FEXA 1CN7A 4BN0A 2BSKB 2F1HA 1D1QA 2GBPA 2V58A 3JY6A 4TLMB 1O4WA 3I2HA 4F92B 2XR1A 1BO6A 1SEPA 1LVGA 1QUEA 3P9IA 2AF3C 4QIHA 2YWFA 3ZWDA 1YVEI 2N1BA 1EINA 3M1XA 2P91A 5EKTA 3O9MA 3KR0A 1TAQA 5H59A 3VMFB 3RYIA 4NEGA 4FQ5A 1XEWY 2E37A 1MX1A 4RHFA 3FWZA 2L0XA 5L3ZA 2H65A 2I2FA 2IITA 2LW7A 2OSVA 1GYQA 2QN9A 4GKJB 3HG7A 4QTZA 3IBGA 1TAUA 2QTFA 3ETNA 3R3XA 3QJYA 1GTG1 4DMGA 1ZCBA 4NG4A 1PVVA 4C07A 2F8MA 1MOSA 3FOBA 1Q7CA 4UDOA 1W36D 1S5JA 1X7WB 2JK1A 1A2BA 4LXYA 5FLXA 5SY9A 1KJIA 1XD2A 5F7XA 1ZEMA 4DDMA 4E07A 4XEUA 4AO7A 2GAFA 4RZHA 1VG8A 1UKAA 3WIVA 3PZBA 3Q8WA 5CYPA 2QXTA 4FN4A 1Y3CE 4HXYA 2F64A 2AOTA 1NMYA 4RHEA 4CF7A 4Y8VA 5JAUA 4YVFA 3EVGA 4N65A 3RHTA 1JJ2F 2CK3G 3MA0A 2WAXA 4IOKA 4CM9D 1UFIA 1Q1QA 3TLZA 2LCIA 2FXIA 1JSLA 2I55A 4L02A 4PDLA 1P1JA 3BZBA 1VMGA 4P34A 5K6RA 2NXWA 4S1PA 1VQPV 3H3FA 1NU1H 1KXJA