5KMPA

The structure of g164e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
394
structure length
394
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAEFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLIDMRYLYLIGGLSLVLKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
total genus 110
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmpA00
3T14A 4GAPA 5KMQA 3T2KA 4G6GA 3HYXA 3SY4A 5KMSA 3HYWA 4G74A 4GAVA 3T31A 4G73A 4G9KA 3SZWA 3SZCA 3SZ0A 3T2YA 3HYVA 3T0KA 3T2ZA 4G6HA 3SX6A 5KMPA 3SYIA 3SXIA 4NWZA 5KMRA 3SZFA 3KPKA
chains in the Genus database with same CATH superfamily
2YM1A 5KWFA 2C70A 2YQUA 1CHUA 2E1MA 2E4GA 1Y0PA 1GRHA 3K7TA 3DJDA 2BC0A 3NYEA 4J2WA 4REKA 2UZZA 2EQ7A 1ZY8A 1LQTA 4JN9A 3QVRA 2PHHA 2VRLA 3UKLA 4NZHA 1IUTA 2YR6A 1DJNA 3CPJG 5HY5A 1PBEA 4K8DA 1JRXA 1E1KA 2JAEA 4CCQA 3G5RA 1D4CA 2WETA 2I0ZA 4CNJA 2C73A 4Z2RA 2J3NA 4C3XA 4YSXA 3SYIA 3BI5A 1GRGA 4II2A 3CNPA 3VRDB 4B68A 5KOXA 2XLUA 3T14A 1HYUA 4GAPA 2IIDA 4Y4LA 2V61A 5KMQA 4BURA 1TDOA 3P4PA 1H86A 3PO7A 3AE8A 5FS9A 1NHSA 2R0GA 3F8DA 4JNAA 2FJBA 1K4QA 4H4TA 3GSIA 5TR3A 3QSEA 1GALA 2VZ2A 3NYFA 3ADAB 1BGNA 3CN8A 1BZLA 2X99A 1B5QA 4B63A 4LU6A 3QFBA 1LV0A 2C76A 2GB0A 3QVPA 3ZYXA 3BNMA 2V6OA 4EMJA 2APGA 3K7QX 3T37A 2YLXA 1ZKQA 2R0CA 1X31B 4BK2A 4Y4MA 2A87A 4TLXA 1CJ4A 1OJ9A 1DODA 3AE6A 2AR8A 4YSZA 4C74A 5EOWA 5FS6A 4EM3A 4G6GA 1TRBA 1EL8A 3DH9A 1KNRA 3HYXA 5L46A 1YQ3A 1FL2A 1QLBA 1H6VA 1S3EA 3GYXA 4RG3A 3VRBA 4YKGA 4BJYA 2GEWA 3AEAA 4FDCB 2Z5XA 3EPTA 4GR1A 1RP0A 2XDOA 2CFYA 3NHOX 4BV6A 3UKPA 3M13A 1IUWA 3EF6A 2XFOA 2NPXA 1N4UA 3AYJA 3Q9TA 4M52A 1CJCA 2YR5A 3SZWA 2YVGA 1CC2A 4OVIA 1CF3A 2PYXA 1OJCA 1D5TA 1ZMCA 3AD7B 3E1TA 1NG3A 3IF9A 3S61A 4BK3A 1ZOVA 2FJEA 1LJ1A 3ITJA 3AE5A 3LZXA 4Y4NA 3M12A 2Q7VA 4U2LA 5KOWA 3Q6JA 3FG2P 1H84A 3P1WA 2BXSA 3NT6A 1NPXA 4ZCDA 1CBOA 3ICTA 1H82A 4H2PA 5EB5A 3GDNA 4CRTA 1M6IA 3LB8A 1JEHA 2DKHA 3NNEA 4II3A 1N4WA 1PJ7A 2C65A 1M64A 1TDNA 3NK2X 3NGCX 1GOSA 4U8NA 1BKWA 3ABVA 1SEZA 3ATQA 3V76A 3AYIA 3QSMA 3FBSA 1NHPA 4IVMB 4A9WA 4AOXA 3ISHA 1ONFA 4U8OA 2GR0A 1E1NA 5J7XA 5HYMA 3GYIA 2F5ZA 3WE0A 4CCRA 2YLSA 4HA6A 4EMIA 3SX6A 3UCLA 3CPHG 4K5RA 3AWIA 2Y6RA 2YAUA 4JY3A 4B66A 3NK1X 3AE1A 3LJPA 4A6NB 4ADWA 2BK5A 3KPKA 3BI2A 4A6NA 2XVIA 2VVMA 2B76A 4JY2A 4YT0A 3B6DA 2GAHB 3B3RA 1LPFA 2EQ9A 1RYIA 3UTFA 2BS3A 4G74A 3UTGA 2QA1A 1O94A 4Z2UA 1D7YA 2YLZA 1CL0A 1EL9A 1UKVG 4Z24A 4DSGA 5JCMA 4NTCA 1E6EA 2JB1A 2JKCA 2OLNA 2R45A 4D04A 2GF3A 3GDPA 4OPGA 2CVJA 2YLWA 3GYJA 5CKUA 2DKIA 5JCKA 1TYPA 1TYTA 2V5ZA 3LOVA 1GRTA 3GMBA 3NTDA 4U8KA 4X4JA 3VR8A 4CY8A 4OCGA 5KMPA 4TLZA 3ATRA 1JOAA 2GV8A 3DA1A 4J36A 4XWRA 4EMWA 5BUKA 2V60A 2GMJA 1GRFA 1S2QA 1W4XA 3C4NA 3O0HA 1F3PA 2GR2A 3IHMA 1VG9A 2TMDA 4H4YA 4U2TA 1E7PA 2A89A 4OPTA 2XVHA 3VRAA 3QFAA 5HHFA 1K0LA 4H4RA 3PS9A 4H4XA 3UTEA 3SGLA 4D03A 4AT0A 3GRSA 4E0VA 4J57A 1KDGA 1NG4A 1K0JA 1ZOYA 3RP6A 3AB1A 3HYVA 4J34A 1Q1RA 2GAGB 2XCGA 4FK1A 2C3CA 2YLTA 3DK4A 3DK8A 4FK1C 4G6HA 4TM0A 5KVIA 3UOZA 1PJ5A 2XYOA 1DOEA 3SZFA 2C7GA 3URHA 5KXJA 1PBBA 2BA9A 3AE4A 2CULA 2Q0LA 4EQSA 3P4QA 1PJ6A 3CNDA 3UP5A 2JB3A 2VQ7A 1REOA 4EQRA 2V3AA 1OJDA 4OPLA 1IUUA 4A5LA 1XPQA 1PXAA 1YQ4A 2RABA 4EM4A 3II4A 5M10A 2WPCA 2WBAA 1PXCA 3DGZA 3UOXA 1GSNA 1E39A 1NENA 2WOVA 2WP9A 4C3YA 4YSHA 1VG0A 3REDA 5BVAA 4I59A 5BULA 1GPEA 1KSUA 2ZZ0A 4G9KA 5DBJA 2ZZBA 1NDAA 3SZ0A 2X8CA 2AAQA 1NEKA 4OPIA 2GMHA 1GREA 2Q0KA 1F8WA 2E5VA 4U8LA 2QCUA 4J31A 1GTHA 2JBVA 3SQPA 1DNCA 1PN0A 3AEFA 1Q1WA 4K2XA 3NIXA 1L9DA 4USQA 2XVFA 4KX6A 1H7WA 1N4VA 4YTNA 1YKJA 4WCTA 3H4KA 5BRTA 1KSSA 5U1OA 1VDCA 2OALA 2YG4A 4C77A 4Z43A 1XHCA 4ZN0A 2X8GA 3BNUA 3VQRA 4C5OA 2RGOA 2WEUA 1GT8A 3M0OA 4G73A 1TDEA 1RSGA 1TDFA 4GCMA 5FS7A 4ZCCA 3SFEA 3UTHA 4OPCA 2OAMA 1MXTA 1MO9A 2RGJA 3T2YA 4AP1A 2VVLG 3CGDA 3CNSA 3R9UA 4PABA 4LA1A 1VRQB 1F8RA 4BJZA 1B4VA 5KMRA 1PS9A 4U8JA 5JCLA 2YLRA 2WQYA 4H7UA 4U8IA 3GWDA 2V3BA 3AE2A 2B7SA 3UOVA 2FJDA 3DMEA 1P2HA 2BS2A 3KU9A 3NRNA 2GQWA 3L8KA 3DK9A 3G5QA 1PBFA 4EQWA 4AT2A 2C3DA 1BF3A 2YVJA 3NLCA 4H4ZA 5JCIA 2C67A 2HQMA 3AEGA 3T0KA 2GQFA 1XANA 1KF6A 1NHQA 1PBCA 2XLPA 3I3LA 4NEWA 1B37A 4Z25A 4N9XA 5HXIA 1O95A 3COXA 3GRTA 2YWLA 4H50A 3NN6X 4U2SA 2TPRA 3AEEA 4RG4A 1GRAA 4GF7A 4IVOB 2QAEA 4Z26A 1BWCA 1PHHA 5LV9A 1O5WA 4OPUA 4LIIA 3FIMB 2C66A 4UP3A 4H4QA 5KMSA 4YSYA 3AE7A 2C64A 4B65A 1FOHA 2BCGG 1Z6LA 2VQBA 3GD4A 3H8LA 3FPZA 3OZ2A 3CNJA 1P2EA 2JK6A 5ER0A 3SFDA 2VRMA 2WOWA 2H89A 4B1BA 4X9MA 2A8XA 1IUVA 4YTPA 3RNMA 4J56A 2WDQA 3AE3A 4U8PA 3T2ZA 2C75A 2BABA 2O9ZA 3P4SA 2GR3A 1ZK7A 1GEUA 1IUSA 1QO8A 1S2YA 4TM1A 2QA2A 5FMHA 2XVJA 5GSNA 2YG5A 3UKHA 2WOIA 5EBKA 1OJAA 3AECA 3RP7A 1PBDA 4MJWA 2XVEA 4AOSA 1PDHA 2BYBA 1QJDA 1JNRA 2BRYA 4O5UA 4OPDA 2WPFA 1MOKA 2YG7A 1Y56A 3GMCA 1B8SA 1Y56B 1GV4A 4FX9A 4HB9A 2GR1A 4RSLA 2WP5A 3V3NA 4IA5A 4DNAA 5FS8A 1GRBA 3CIRA 5C3JA 5U25A 1H83A 5KVHA 4UDQA 3CGCA 2XLSA 3NTAA 1E1LA 3ALJA 2BACA 4H4SA 3D8XA 2ARDA 3GD3A 1ELIA 2BCPA 2R46A 4EQXA 3UP4A 3C4AA 1K0IA 2XFQA 1H7XA 1PXBA 2WDVA 2YVFA 2YR4A 3GWFA 3ICSA 3SXIA 2BK4A 1KFYA 2YM2A 2ZBWA 1NHRA 2XLRA 3KKJA 3KPFA 5EB4A 3LXDA 4YWOA 2VVLA 1V59A 2Q6UA 1ZP0A 2R4JA 2Y6QA 4J33A 3CNTA 5C2TA 2R4EA 2C4CA 4KPRA 4K7ZA 3FMWA 2R0PA 4H2QA 3V3OA 1D4DA 3ALLA 4U8MA 3NYCA 4GUVA 4YXDA 5CQFA 3BHKA 1NAAA 4CNKA 5JCNA 3AE9A 1YY5A 3SZCA 4APNA 1EL7A 1DXLA 4WX1A 4B67A 3ZDNA 1EBDA 2IVEA 1GETA 2EQ6A 1JRZA 3UKAA 4UDPA 4DGKA 4ECHA 2X50A 4NNJA 4B69A 4GDEA 3AD8B 1FCDA 3C96A 4A7AA 3RHAA 2VOUA 3IHGA 3NH3X 3CPIG 3LZWA 1S3BA 2BC1A 4ICYA 1F6MA 3AXBA 2ZZCA 4TM4A 3SY4A 3AEBA 3BI4A 1JRYA 5KRQA 3HYWA 2EQ8A 3KD9A 1L9EA 1LQUA 1DJQA 3AD9B 1E1MA 4EIQA 4IA6A 3S5WA 1XDIA 4K22A 3EANA 4H4UA 3L1RA 4X9NA 3NK0X 3LADA 4H4WA 4H4PA 3AYLA 2Z5YA 2ACZA 4GDPA 4P9SA 3UKFA 4B64A 3NG7X 4TM3A 1VQWA 2WU5A 1N1PA 4YTMA 3DJEA 4BK1A 4A65A 1BGJA 4PAAA 2XFNA 3CTYA 3EAOA 3UOYA 3T2KA 1DOBA 3JSKA 1CJ3A 4CBQA 1F8SA 3NN0X 1FEAA 2XLTA 1L9CA 4JQ9A 1CC6A 4DSHA 2BK3A 3CMMA 3T31A 1FECA 2B9WA 2W0HA 2BS4A 2GVCA 2CDUA 3K7MX 4K5SA 4NTEA 4XXGA 1L0VA 1JNZA 5J60A 4USRA 4EIPA 1GESA 4H2RA 1CC4A 2BRAA 3BHFA 1Q9IA 3KVEA 2RGHA 2FJAA 4UDRA 3QJ4A 1GNDA 1FEBA 3AEDA 1COYA 3F8PA 3UKKA 1CJ2A 3DGHA 2X8HA 2NVKX 3F8RA 1GXFA 1KNPA 3P9UA 2B9YA 1JU2A 3IWAA 5IQ1A 2WS3A 5M0ZA 5IQ4A 2WU2A 2WPEA 3KLJA 3VR9A 4AP3A 3NKSA 3RP8A 4CY6A 3KA7A 4NEVA 1GERA 1ZMDA 2H88A 1D7LA 2IVDA 1DOCA 4H2NA 3DJJA 1EL5A 2OLOA 4I58A 2YG3A 4A79A 1AOGA 2FBWA 2WHDA 4JNQA 1IJHA 4GRTA 5IPYA 2WP6A 2B7RA 3DJGX 4NWZA 4YKFA 2GH5A 2WESA 3PVCA 5KNLA 5GRTA 3IC9A 3CGEA 5U63A 4NTDA 3K30A 1GTEA 3D1CA 1LVLA 3H8IA 1OJTA 2XFUA 2YG6A 1YQZA 4Z2TA 3UKQA 3ALMA 4GAVA 1H81A 3P4RA 2WDRA 4H4VA 3QSSA 1D4EA 1ZX9A 2X3NA 2XFPA 4A99A 3OC4A 1IUXA 2B9XA 2JB2A 4XWZA 3SM8A 1TDKA 2C72A 3G5SA 3HZLA 1ZDLA 4O5QA 2GRTA 3I6DA 4IV9A 2R9ZA 3ICRA 4JDRA 3CGBA 2BXRA 4Z44A 2AQJA 2OA1A 1LTXR
chains in the Genus database with same CATH topology
2YM1A 5KWFA 2C70A 2YQUA 1CHUA 2E1MA 2E4GA 1Y0PA 1GRHA 3K7TA 3DJDA 2BC0A 3NYEA 4J2WA 4REKA 2UZZA 2EQ7A 1ZY8A 1LQTA 4JN9A 3QVRA 2PHHA 2VRLA 3UKLA 4NZHA 1IUTA 2YR6A 1DJNA 3CPJG 5HY5A 1PBEA 4K8DA 1JRXA 1E1KA 2JAEA 4CCQA 3G5RA 1D4CA 2WETA 2I0ZA 4CNJA 2C73A 4Z2RA 2J3NA 4C3XA 4YSXA 3SYIA 3BI5A 1GRGA 4II2A 3CNPA 3VRDB 4B68A 5KOXA 2XLUA 3T14A 1HYUA 4GAPA 2IIDA 4Y4LA 2V61A 5KMQA 4BURA 1TDOA 3P4PA 1H86A 3PO7A 3AE8A 5FS9A 1NHSA 2R0GA 3F8DA 4JNAA 2FJBA 1K4QA 4H4TA 3GSIA 5TR3A 3QSEA 1GALA 2VZ2A 3NYFA 3ADAB 1BGNA 3CN8A 1BZLA 2X99A 1B5QA 4B63A 4LU6A 3QFBA 1LV0A 2C76A 2GB0A 3QVPA 3ZYXA 3BNMA 2V6OA 4EMJA 2APGA 3K7QX 3T37A 2YLXA 1ZKQA 2R0CA 1X31B 4BK2A 4Y4MA 2A87A 4TLXA 1CJ4A 1OJ9A 1DODA 3AE6A 2AR8A 4YSZA 4C74A 5EOWA 5FS6A 4EM3A 4G6GA 1TRBA 1EL8A 3DH9A 1KNRA 3HYXA 5L46A 1YQ3A 1FL2A 1QLBA 1H6VA 1S3EA 3GYXA 4RG3A 3VRBA 4YKGA 4BJYA 2GEWA 3AEAA 4FDCB 2Z5XA 3EPTA 4GR1A 1RP0A 2XDOA 2CFYA 3NHOX 4BV6A 3UKPA 3M13A 1IUWA 3EF6A 2XFOA 2NPXA 1N4UA 3AYJA 3Q9TA 4M52A 1CJCA 2YR5A 3SZWA 2YVGA 1CC2A 4OVIA 1CF3A 2PYXA 1OJCA 1D5TA 1ZMCA 3AD7B 3E1TA 1NG3A 3IF9A 3S61A 4BK3A 1ZOVA 2FJEA 1LJ1A 3ITJA 3AE5A 3LZXA 4Y4NA 3M12A 2Q7VA 4U2LA 5KOWA 3Q6JA 3FG2P 1H84A 3P1WA 2BXSA 3NT6A 1NPXA 4ZCDA 1CBOA 3ICTA 1H82A 4H2PA 5EB5A 3GDNA 4CRTA 1M6IA 3LB8A 1JEHA 2DKHA 3NNEA 4II3A 1N4WA 1PJ7A 2C65A 1M64A 1TDNA 3NK2X 3NGCX 1GOSA 4U8NA 1BKWA 3ABVA 1SEZA 3ATQA 3V76A 3AYIA 3QSMA 3FBSA 1NHPA 4IVMB 4A9WA 4AOXA 3ISHA 1ONFA 4U8OA 2GR0A 1E1NA 5J7XA 5HYMA 3GYIA 2F5ZA 3WE0A 4CCRA 2YLSA 4HA6A 4EMIA 3SX6A 3UCLA 3CPHG 4K5RA 3AWIA 2Y6RA 2YAUA 4JY3A 4B66A 3NK1X 3AE1A 3LJPA 4A6NB 4ADWA 2BK5A 3KPKA 3BI2A 4A6NA 2XVIA 2VVMA 2B76A 4JY2A 4YT0A 3B6DA 2GAHB 3B3RA 1LPFA 2EQ9A 1RYIA 3UTFA 2BS3A 4G74A 3UTGA 2QA1A 1O94A 4Z2UA 1D7YA 2YLZA 1CL0A 1EL9A 1UKVG 4Z24A 4DSGA 5JCMA 4NTCA 1E6EA 2JB1A 2JKCA 2OLNA 2R45A 4D04A 2GF3A 3GDPA 4OPGA 2CVJA 2YLWA 3GYJA 5CKUA 2DKIA 5JCKA 1TYPA 1TYTA 2V5ZA 3LOVA 1GRTA 3GMBA 3NTDA 4U8KA 4X4JA 3VR8A 4CY8A 4OCGA 5KMPA 4TLZA 3ATRA 1JOAA 2GV8A 3DA1A 4J36A 4XWRA 4EMWA 5BUKA 2V60A 2GMJA 1GRFA 1S2QA 1W4XA 3C4NA 3O0HA 1F3PA 2GR2A 3IHMA 1VG9A 2TMDA 4H4YA 4U2TA 1E7PA 2A89A 4OPTA 2XVHA 3VRAA 3QFAA 5HHFA 1K0LA 4H4RA 3PS9A 4H4XA 3UTEA 3SGLA 4D03A 4AT0A 3GRSA 4E0VA 4J57A 1KDGA 1NG4A 1K0JA 1ZOYA 3RP6A 3AB1A 3HYVA 4J34A 1Q1RA 2GAGB 2XCGA 4FK1A 2C3CA 2YLTA 3DK4A 3DK8A 4FK1C 4G6HA 4TM0A 5KVIA 3UOZA 1PJ5A 2XYOA 1DOEA 3SZFA 2C7GA 3URHA 5KXJA 1PBBA 2BA9A 3AE4A 2CULA 2Q0LA 4EQSA 3P4QA 1PJ6A 3CNDA 3UP5A 2JB3A 2VQ7A 1REOA 4EQRA 2V3AA 1OJDA 4OPLA 1IUUA 4A5LA 1XPQA 1PXAA 1YQ4A 2RABA 4EM4A 3II4A 5M10A 2WPCA 2WBAA 1PXCA 3DGZA 3UOXA 1GSNA 1E39A 1NENA 2WOVA 2WP9A 4C3YA 4YSHA 1VG0A 3REDA 5BVAA 4I59A 5BULA 1GPEA 1KSUA 2ZZ0A 4G9KA 5DBJA 2ZZBA 1NDAA 3SZ0A 2X8CA 2AAQA 1NEKA 4OPIA 2GMHA 1GREA 2Q0KA 1F8WA 2E5VA 4U8LA 2QCUA 4J31A 1GTHA 2JBVA 3SQPA 1DNCA 1PN0A 3AEFA 1Q1WA 4K2XA 3NIXA 1L9DA 4USQA 2XVFA 4KX6A 1H7WA 1N4VA 4YTNA 1YKJA 4WCTA 3H4KA 5BRTA 1KSSA 5U1OA 1VDCA 2OALA 2YG4A 4C77A 4Z43A 1XHCA 4ZN0A 2X8GA 3BNUA 3VQRA 4C5OA 2RGOA 2WEUA 1GT8A 3M0OA 4G73A 1TDEA 1RSGA 1TDFA 4GCMA 5FS7A 4ZCCA 3SFEA 3UTHA 4OPCA 2OAMA 1MXTA 1MO9A 2RGJA 3T2YA 4AP1A 2VVLG 3CGDA 3CNSA 3R9UA 4PABA 4LA1A 1VRQB 1F8RA 4BJZA 1B4VA 5KMRA 1PS9A 4U8JA 5JCLA 2YLRA 2WQYA 4H7UA 4U8IA 3GWDA 2V3BA 3AE2A 2B7SA 3UOVA 2FJDA 3DMEA 1P2HA 2BS2A 3KU9A 3NRNA 2GQWA 3L8KA 3DK9A 3G5QA 1PBFA 4EQWA 4AT2A 2C3DA 1BF3A 2YVJA 3NLCA 4H4ZA 5JCIA 2C67A 2HQMA 3AEGA 3T0KA 2GQFA 1XANA 1KF6A 1NHQA 1PBCA 2XLPA 3I3LA 4NEWA 1B37A 4Z25A 4N9XA 5HXIA 1O95A 3COXA 3GRTA 2YWLA 4H50A 3NN6X 4U2SA 2TPRA 3AEEA 4RG4A 1GRAA 4GF7A 4IVOB 2QAEA 4Z26A 1BWCA 1PHHA 5LV9A 1O5WA 4OPUA 4LIIA 3FIMB 2C66A 4UP3A 4H4QA 5KMSA 4YSYA 3AE7A 2C64A 4B65A 1FOHA 2BCGG 1Z6LA 2VQBA 3GD4A 3H8LA 3FPZA 3OZ2A 3CNJA 1P2EA 2JK6A 5ER0A 3SFDA 2VRMA 2WOWA 2H89A 4B1BA 4X9MA 2A8XA 1IUVA 4YTPA 3RNMA 4J56A 2WDQA 3AE3A 4U8PA 3T2ZA 2C75A 2BABA 2O9ZA 3P4SA 2GR3A 1ZK7A 1GEUA 1IUSA 1QO8A 1S2YA 4TM1A 2QA2A 5FMHA 2XVJA 5GSNA 2YG5A 3UKHA 2WOIA 5EBKA 1OJAA 3AECA 3RP7A 1PBDA 4MJWA 2XVEA 4AOSA 1PDHA 2BYBA 1QJDA 1JNRA 2BRYA 4O5UA 4OPDA 2WPFA 1MOKA 2YG7A 1Y56A 3GMCA 1B8SA 1Y56B 1GV4A 4FX9A 4HB9A 2GR1A 4RSLA 2WP5A 3V3NA 4IA5A 4DNAA 5FS8A 1GRBA 3CIRA 5C3JA 5U25A 1H83A 5KVHA 4UDQA 3CGCA 2XLSA 3NTAA 1E1LA 3ALJA 2BACA 4H4SA 3D8XA 2ARDA 3GD3A 1ELIA 2BCPA 2R46A 4EQXA 3UP4A 3C4AA 1K0IA 2XFQA 1H7XA 1PXBA 2WDVA 2YVFA 2YR4A 3GWFA 3ICSA 3SXIA 2BK4A 1KFYA 2YM2A 2ZBWA 1NHRA 2XLRA 3KKJA 3KPFA 5EB4A 3LXDA 4YWOA 2VVLA 1V59A 2Q6UA 1ZP0A 2R4JA 2Y6QA 4J33A 3CNTA 5C2TA 2R4EA 2C4CA 4KPRA 4K7ZA 3FMWA 2R0PA 4H2QA 3V3OA 1D4DA 3ALLA 4U8MA 3NYCA 4GUVA 4YXDA 5CQFA 3BHKA 1NAAA 4CNKA 5JCNA 3AE9A 1YY5A 3SZCA 4APNA 1EL7A 1DXLA 4WX1A 4B67A 3ZDNA 1EBDA 2IVEA 1GETA 2EQ6A 1JRZA 3UKAA 4UDPA 4DGKA 4ECHA 2X50A 4NNJA 4B69A 4GDEA 3AD8B 1FCDA 3C96A 4A7AA 3RHAA 2VOUA 3IHGA 3NH3X 3CPIG 3LZWA 1S3BA 2BC1A 4ICYA 1F6MA 3AXBA 2ZZCA 4TM4A 3SY4A 3AEBA 3BI4A 1JRYA 5KRQA 3HYWA 2EQ8A 3KD9A 1L9EA 1LQUA 1DJQA 3AD9B 1E1MA 4EIQA 4IA6A 3S5WA 1XDIA 4K22A 3EANA 4H4UA 3L1RA 4X9NA 3NK0X 3LADA 4H4WA 4H4PA 3AYLA 2Z5YA 2ACZA 4GDPA 4P9SA 3UKFA 4B64A 3NG7X 4TM3A 1VQWA 2WU5A 1N1PA 4YTMA 3DJEA 4BK1A 4A65A 1BGJA 4PAAA 2XFNA 3CTYA 3EAOA 3UOYA 3T2KA 1DOBA 3JSKA 1CJ3A 4CBQA 1F8SA 3NN0X 1FEAA 2XLTA 1L9CA 4JQ9A 1CC6A 4DSHA 2BK3A 3CMMA 3T31A 1FECA 2B9WA 2W0HA 2BS4A 2GVCA 2CDUA 3K7MX 4K5SA 4NTEA 4XXGA 1L0VA 1JNZA 5J60A 4USRA 4EIPA 1GESA 4H2RA 1CC4A 2BRAA 3BHFA 1Q9IA 3KVEA 2RGHA 2FJAA 4UDRA 3QJ4A 1GNDA 1FEBA 3AEDA 1COYA 3F8PA 3UKKA 1CJ2A 3DGHA 2X8HA 2NVKX 3F8RA 1GXFA 1KNPA 3P9UA 2B9YA 1JU2A 3IWAA 5IQ1A 2WS3A 5M0ZA 5IQ4A 2WU2A 2WPEA 3KLJA 3VR9A 4AP3A 3NKSA 3RP8A 4CY6A 3KA7A 4NEVA 1GERA 1ZMDA 2H88A 1D7LA 2IVDA 1DOCA 4H2NA 3DJJA 1EL5A 2OLOA 4I58A 2YG3A 4A79A 1AOGA 2FBWA 2WHDA 4JNQA 1IJHA 4GRTA 5IPYA 2WP6A 2B7RA 3DJGX 4NWZA 4YKFA 2GH5A 2WESA 3PVCA 5KNLA 5GRTA 3IC9A 3CGEA 5U63A 4NTDA 3K30A 1GTEA 3D1CA 1LVLA 3H8IA 1OJTA 2XFUA 2YG6A 1YQZA 4Z2TA 3UKQA 3ALMA 4GAVA 1H81A 3P4RA 2WDRA 4H4VA 3QSSA 1D4EA 1ZX9A 2X3NA 2XFPA 4A99A 3OC4A 1IUXA 2B9XA 2JB2A 4XWZA 3SM8A 1TDKA 2C72A 3G5SA 3HZLA 1ZDLA 4O5QA 2GRTA 3I6DA 4IV9A 2R9ZA 3ICRA 4JDRA 3CGBA 2BXRA 4Z44A 2AQJA 2OA1A 1LTXR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T14 A;  4GAP A;  5KMQ A;  3T2K A;  4G6G A;  3HYX A;  3SY4 A;  5KMS A;  3HYW A;  4G74 A;  4GAV A;  3T31 A;  4G73 A;  4G9K A;  3SZW A;  3SZC A;  3SZ0 A;  3T2Y A;  3HYV A;  3T0K A;  3T2Z A;  4G6H A;  3SX6 A;  5KMP A;  3SYI A;  3SXI A;  4NWZ A;  5KMR A;  3SZF A;  3KPK A; 
#chains in the Genus database with same CATH topology
 2YM1 A;  5KWF A;  2C70 A;  2YQU A;  1CHU A;  2E1M A;  2E4G A;  1Y0P A;  1GRH A;  3K7T A;  3DJD A;  2BC0 A;  3NYE A;  4J2W A;  4REK A;  2UZZ A;  2EQ7 A;  1ZY8 A;  1LQT A;  4JN9 A;  3QVR A;  2PHH A;  2VRL A;  3UKL A;  4NZH A;  1IUT A;  2YR6 A;  1DJN A;  3CPJ G;  5HY5 A;  1PBE A;  4K8D A;  1JRX A;  1E1K A;  2JAE A;  4CCQ A;  3G5R A;  1D4C A;  2WET A;  2I0Z A;  4CNJ A;  2C73 A;  4Z2R A;  2J3N A;  4C3X A;  4YSX A;  3SYI A;  3BI5 A;  1GRG A;  4II2 A;  3CNP A;  3VRD B;  4B68 A;  5KOX A;  2XLU A;  3T14 A;  1HYU A;  4GAP A;  2IID A;  4Y4L A;  2V61 A;  5KMQ A;  4BUR A;  1TDO A;  3P4P A;  1H86 A;  3PO7 A;  3AE8 A;  5FS9 A;  1NHS A;  2R0G A;  3F8D A;  4JNA A;  2FJB A;  1K4Q A;  4H4T A;  3GSI A;  5TR3 A;  3QSE A;  1GAL A;  2VZ2 A;  3NYF A;  3ADA B;  1BGN A;  3CN8 A;  1BZL A;  2X99 A;  1B5Q A;  4B63 A;  4LU6 A;  3QFB A;  1LV0 A;  2C76 A;  2GB0 A;  3QVP A;  3ZYX A;  3BNM A;  2V6O A;  4EMJ A;  2APG A;  3K7Q X;  3T37 A;  2YLX A;  1ZKQ A;  2R0C A;  1X31 B;  4BK2 A;  4Y4M A;  2A87 A;  4TLX A;  1CJ4 A;  1OJ9 A;  1DOD A;  3AE6 A;  2AR8 A;  4YSZ A;  4C74 A;  5EOW A;  5FS6 A;  4EM3 A;  4G6G A;  1TRB A;  1EL8 A;  3DH9 A;  1KNR A;  3HYX A;  5L46 A;  1YQ3 A;  1FL2 A;  1QLB A;  1H6V A;  1S3E A;  3GYX A;  4RG3 A;  3VRB A;  4YKG A;  4BJY A;  2GEW A;  3AEA A;  4FDC B;  2Z5X A;  3EPT A;  4GR1 A;  1RP0 A;  2XDO A;  2CFY A;  3NHO X;  4BV6 A;  3UKP A;  3M13 A;  1IUW A;  3EF6 A;  2XFO A;  2NPX A;  1N4U A;  3AYJ A;  3Q9T A;  4M52 A;  1CJC A;  2YR5 A;  3SZW A;  2YVG A;  1CC2 A;  4OVI A;  1CF3 A;  2PYX A;  1OJC A;  1D5T A;  1ZMC A;  3AD7 B;  3E1T A;  1NG3 A;  3IF9 A;  3S61 A;  4BK3 A;  1ZOV A;  2FJE A;  1LJ1 A;  3ITJ A;  3AE5 A;  3LZX A;  4Y4N A;  3M12 A;  2Q7V A;  4U2L A;  5KOW A;  3Q6J A;  3FG2 P;  1H84 A;  3P1W A;  2BXS A;  3NT6 A;  1NPX A;  4ZCD A;  1CBO A;  3ICT A;  1H82 A;  4H2P A;  5EB5 A;  3GDN A;  4CRT A;  1M6I A;  3LB8 A;  1JEH A;  2DKH A;  3NNE A;  4II3 A;  1N4W A;  1PJ7 A;  2C65 A;  1M64 A;  1TDN A;  3NK2 X;  3NGC X;  1GOS A;  4U8N A;  1BKW A;  3ABV A;  1SEZ A;  3ATQ A;  3V76 A;  3AYI A;  3QSM A;  3FBS A;  1NHP A;  4IVM B;  4A9W A;  4AOX A;  3ISH A;  1ONF A;  4U8O A;  2GR0 A;  1E1N A;  5J7X A;  5HYM A;  3GYI A;  2F5Z A;  3WE0 A;  4CCR A;  2YLS A;  4HA6 A;  4EMI A;  3SX6 A;  3UCL A;  3CPH G;  4K5R A;  3AWI A;  2Y6R A;  2YAU A;  4JY3 A;  4B66 A;  3NK1 X;  3AE1 A;  3LJP A;  4A6N B;  4ADW A;  2BK5 A;  3KPK A;  3BI2 A;  4A6N A;  2XVI A;  2VVM A;  2B76 A;  4JY2 A;  4YT0 A;  3B6D A;  2GAH B;  3B3R A;  1LPF A;  2EQ9 A;  1RYI A;  3UTF A;  2BS3 A;  4G74 A;  3UTG A;  2QA1 A;  1O94 A;  4Z2U A;  1D7Y A;  2YLZ A;  1CL0 A;  1EL9 A;  1UKV G;  4Z24 A;  4DSG A;  5JCM A;  4NTC A;  1E6E A;  2JB1 A;  2JKC A;  2OLN A;  2R45 A;  4D04 A;  2GF3 A;  3GDP A;  4OPG A;  2CVJ A;  2YLW A;  3GYJ A;  5CKU A;  2DKI A;  5JCK A;  1TYP A;  1TYT A;  2V5Z A;  3LOV A;  1GRT A;  3GMB A;  3NTD A;  4U8K A;  4X4J A;  3VR8 A;  4CY8 A;  4OCG A;  5KMP A;  4TLZ A;  3ATR A;  1JOA A;  2GV8 A;  3DA1 A;  4J36 A;  4XWR A;  4EMW A;  5BUK A;  2V60 A;  2GMJ A;  1GRF A;  1S2Q A;  1W4X A;  3C4N A;  3O0H A;  1F3P A;  2GR2 A;  3IHM A;  1VG9 A;  2TMD A;  4H4Y A;  4U2T A;  1E7P A;  2A89 A;  4OPT A;  2XVH A;  3VRA A;  3QFA A;  5HHF A;  1K0L A;  4H4R A;  3PS9 A;  4H4X A;  3UTE A;  3SGL A;  4D03 A;  4AT0 A;  3GRS A;  4E0V A;  4J57 A;  1KDG A;  1NG4 A;  1K0J A;  1ZOY A;  3RP6 A;  3AB1 A;  3HYV A;  4J34 A;  1Q1R A;  2GAG B;  2XCG A;  4FK1 A;  2C3C A;  2YLT A;  3DK4 A;  3DK8 A;  4FK1 C;  4G6H A;  4TM0 A;  5KVI A;  3UOZ A;  1PJ5 A;  2XYO A;  1DOE A;  3SZF A;  2C7G A;  3URH A;  5KXJ A;  1PBB A;  2BA9 A;  3AE4 A;  2CUL A;  2Q0L A;  4EQS A;  3P4Q A;  1PJ6 A;  3CND A;  3UP5 A;  2JB3 A;  2VQ7 A;  1REO A;  4EQR A;  2V3A A;  1OJD A;  4OPL A;  1IUU A;  4A5L A;  1XPQ A;  1PXA A;  1YQ4 A;  2RAB A;  4EM4 A;  3II4 A;  5M10 A;  2WPC A;  2WBA A;  1PXC A;  3DGZ A;  3UOX A;  1GSN A;  1E39 A;  1NEN A;  2WOV A;  2WP9 A;  4C3Y A;  4YSH A;  1VG0 A;  3RED A;  5BVA A;  4I59 A;  5BUL A;  1GPE A;  1KSU A;  2ZZ0 A;  4G9K A;  5DBJ A;  2ZZB A;  1NDA A;  3SZ0 A;  2X8C A;  2AAQ A;  1NEK A;  4OPI A;  2GMH A;  1GRE A;  2Q0K A;  1F8W A;  2E5V A;  4U8L A;  2QCU A;  4J31 A;  1GTH A;  2JBV A;  3SQP A;  1DNC A;  1PN0 A;  3AEF A;  1Q1W A;  4K2X A;  3NIX A;  1L9D A;  4USQ A;  2XVF A;  4KX6 A;  1H7W A;  1N4V A;  4YTN A;  1YKJ A;  4WCT A;  3H4K A;  5BRT A;  1KSS A;  5U1O A;  1VDC A;  2OAL A;  2YG4 A;  4C77 A;  4Z43 A;  1XHC A;  4ZN0 A;  2X8G A;  3BNU A;  3VQR A;  4C5O A;  2RGO A;  2WEU A;  1GT8 A;  3M0O A;  4G73 A;  1TDE A;  1RSG A;  1TDF A;  4GCM A;  5FS7 A;  4ZCC A;  3SFE A;  3UTH A;  4OPC A;  2OAM A;  1MXT A;  1MO9 A;  2RGJ A;  3T2Y A;  4AP1 A;  2VVL G;  3CGD A;  3CNS A;  3R9U A;  4PAB A;  4LA1 A;  1VRQ B;  1F8R A;  4BJZ A;  1B4V A;  5KMR A;  1PS9 A;  4U8J A;  5JCL A;  2YLR A;  2WQY A;  4H7U A;  4U8I A;  3GWD A;  2V3B A;  3AE2 A;  2B7S A;  3UOV A;  2FJD A;  3DME A;  1P2H A;  2BS2 A;  3KU9 A;  3NRN A;  2GQW A;  3L8K A;  3DK9 A;  3G5Q A;  1PBF A;  4EQW A;  4AT2 A;  2C3D A;  1BF3 A;  2YVJ A;  3NLC A;  4H4Z A;  5JCI A;  2C67 A;  2HQM A;  3AEG A;  3T0K A;  2GQF A;  1XAN A;  1KF6 A;  1NHQ A;  1PBC A;  2XLP A;  3I3L A;  4NEW A;  1B37 A;  4Z25 A;  4N9X A;  5HXI A;  1O95 A;  3COX A;  3GRT A;  2YWL A;  4H50 A;  3NN6 X;  4U2S A;  2TPR A;  3AEE A;  4RG4 A;  1GRA A;  4GF7 A;  4IVO B;  2QAE A;  4Z26 A;  1BWC A;  1PHH A;  5LV9 A;  1O5W A;  4OPU A;  4LII A;  3FIM B;  2C66 A;  4UP3 A;  4H4Q A;  5KMS A;  4YSY A;  3AE7 A;  2C64 A;  4B65 A;  1FOH A;  2BCG G;  1Z6L A;  2VQB A;  3GD4 A;  3H8L A;  3FPZ A;  3OZ2 A;  3CNJ A;  1P2E A;  2JK6 A;  5ER0 A;  3SFD A;  2VRM A;  2WOW A;  2H89 A;  4B1B A;  4X9M A;  2A8X A;  1IUV A;  4YTP A;  3RNM A;  4J56 A;  2WDQ A;  3AE3 A;  4U8P A;  3T2Z A;  2C75 A;  2BAB A;  2O9Z A;  3P4S A;  2GR3 A;  1ZK7 A;  1GEU A;  1IUS A;  1QO8 A;  1S2Y A;  4TM1 A;  2QA2 A;  5FMH A;  2XVJ A;  5GSN A;  2YG5 A;  3UKH A;  2WOI A;  5EBK A;  1OJA A;  3AEC A;  3RP7 A;  1PBD A;  4MJW A;  2XVE A;  4AOS A;  1PDH A;  2BYB A;  1QJD A;  1JNR A;  2BRY A;  4O5U A;  4OPD A;  2WPF A;  1MOK A;  2YG7 A;  1Y56 A;  3GMC A;  1B8S A;  1Y56 B;  1GV4 A;  4FX9 A;  4HB9 A;  2GR1 A;  4RSL A;  2WP5 A;  3V3N A;  4IA5 A;  4DNA A;  5FS8 A;  1GRB A;  3CIR A;  5C3J A;  5U25 A;  1H83 A;  5KVH A;  4UDQ A;  3CGC A;  2XLS A;  3NTA A;  1E1L A;  3ALJ A;  2BAC A;  4H4S A;  3D8X A;  2ARD A;  3GD3 A;  1ELI A;  2BCP A;  2R46 A;  4EQX A;  3UP4 A;  3C4A A;  1K0I A;  2XFQ A;  1H7X A;  1PXB A;  2WDV A;  2YVF A;  2YR4 A;  3GWF A;  3ICS A;  3SXI A;  2BK4 A;  1KFY A;  2YM2 A;  2ZBW A;  1NHR A;  2XLR A;  3KKJ A;  3KPF A;  5EB4 A;  3LXD A;  4YWO A;  2VVL A;  1V59 A;  2Q6U A;  1ZP0 A;  2R4J A;  2Y6Q A;  4J33 A;  3CNT A;  5C2T A;  2R4E A;  2C4C A;  4KPR A;  4K7Z A;  3FMW A;  2R0P A;  4H2Q A;  3V3O A;  1D4D A;  3ALL A;  4U8M A;  3NYC A;  4GUV A;  4YXD A;  5CQF A;  3BHK A;  1NAA A;  4CNK A;  5JCN A;  3AE9 A;  1YY5 A;  3SZC A;  4APN A;  1EL7 A;  1DXL A;  4WX1 A;  4B67 A;  3ZDN A;  1EBD A;  2IVE A;  1GET A;  2EQ6 A;  1JRZ A;  3UKA A;  4UDP A;  4DGK A;  4ECH A;  2X50 A;  4NNJ A;  4B69 A;  4GDE A;  3AD8 B;  1FCD A;  3C96 A;  4A7A A;  3RHA A;  2VOU A;  3IHG A;  3NH3 X;  3CPI G;  3LZW A;  1S3B A;  2BC1 A;  4ICY A;  1F6M A;  3AXB A;  2ZZC A;  4TM4 A;  3SY4 A;  3AEB A;  3BI4 A;  1JRY A;  5KRQ A;  3HYW A;  2EQ8 A;  3KD9 A;  1L9E A;  1LQU A;  1DJQ A;  3AD9 B;  1E1M A;  4EIQ A;  4IA6 A;  3S5W A;  1XDI A;  4K22 A;  3EAN A;  4H4U A;  3L1R A;  4X9N A;  3NK0 X;  3LAD A;  4H4W A;  4H4P A;  3AYL A;  2Z5Y A;  2ACZ A;  4GDP A;  4P9S A;  3UKF A;  4B64 A;  3NG7 X;  4TM3 A;  1VQW A;  2WU5 A;  1N1P A;  4YTM A;  3DJE A;  4BK1 A;  4A65 A;  1BGJ A;  4PAA A;  2XFN A;  3CTY A;  3EAO A;  3UOY A;  3T2K A;  1DOB A;  3JSK A;  1CJ3 A;  4CBQ A;  1F8S A;  3NN0 X;  1FEA A;  2XLT A;  1L9C A;  4JQ9 A;  1CC6 A;  4DSH A;  2BK3 A;  3CMM A;  3T31 A;  1FEC A;  2B9W A;  2W0H A;  2BS4 A;  2GVC A;  2CDU A;  3K7M X;  4K5S A;  4NTE A;  4XXG A;  1L0V A;  1JNZ A;  5J60 A;  4USR A;  4EIP A;  1GES A;  4H2R A;  1CC4 A;  2BRA A;  3BHF A;  1Q9I A;  3KVE A;  2RGH A;  2FJA A;  4UDR A;  3QJ4 A;  1GND A;  1FEB A;  3AED A;  1COY A;  3F8P A;  3UKK A;  1CJ2 A;  3DGH A;  2X8H A;  2NVK X;  3F8R A;  1GXF A;  1KNP A;  3P9U A;  2B9Y A;  1JU2 A;  3IWA A;  5IQ1 A;  2WS3 A;  5M0Z A;  5IQ4 A;  2WU2 A;  2WPE A;  3KLJ A;  3VR9 A;  4AP3 A;  3NKS A;  3RP8 A;  4CY6 A;  3KA7 A;  4NEV A;  1GER A;  1ZMD A;  2H88 A;  1D7L A;  2IVD A;  1DOC A;  4H2N A;  3DJJ A;  1EL5 A;  2OLO A;  4I58 A;  2YG3 A;  4A79 A;  1AOG A;  2FBW A;  2WHD A;  4JNQ A;  1IJH A;  4GRT A;  5IPY A;  2WP6 A;  2B7R A;  3DJG X;  4NWZ A;  4YKF A;  2GH5 A;  2WES A;  3PVC A;  5KNL A;  5GRT A;  3IC9 A;  3CGE A;  5U63 A;  4NTD A;  3K30 A;  1GTE A;  3D1C A;  1LVL A;  3H8I A;  1OJT A;  2XFU A;  2YG6 A;  1YQZ A;  4Z2T A;  3UKQ A;  3ALM A;  4GAV A;  1H81 A;  3P4R A;  2WDR A;  4H4V A;  3QSS A;  1D4E A;  1ZX9 A;  2X3N A;  2XFP A;  4A99 A;  3OC4 A;  1IUX A;  2B9X A;  2JB2 A;  4XWZ A;  3SM8 A;  1TDK A;  2C72 A;  3G5S A;  3HZL A;  1ZDL A;  4O5Q A;  2GRT A;  3I6D A;  4IV9 A;  2R9Z A;  3ICR A;  4JDR A;  3CGB A;  2BXR A;  4Z44 A;  2AQJ A;  2OA1 A;  1LTX R; 
#chains in the Genus database with same CATH homology
 2YM1 A;  5KWF A;  2C70 A;  2YQU A;  1CHU A;  2E1M A;  2E4G A;  1Y0P A;  1GRH A;  3K7T A;  3DJD A;  2BC0 A;  3NYE A;  4J2W A;  4REK A;  2UZZ A;  2EQ7 A;  1ZY8 A;  1LQT A;  4JN9 A;  3QVR A;  2PHH A;  2VRL A;  3UKL A;  4NZH A;  1IUT A;  2YR6 A;  1DJN A;  3CPJ G;  5HY5 A;  1PBE A;  4K8D A;  1JRX A;  1E1K A;  2JAE A;  4CCQ A;  3G5R A;  1D4C A;  2WET A;  2I0Z A;  4CNJ A;  2C73 A;  4Z2R A;  2J3N A;  4C3X A;  4YSX A;  3SYI A;  3BI5 A;  1GRG A;  4II2 A;  3CNP A;  3VRD B;  4B68 A;  5KOX A;  2XLU A;  3T14 A;  1HYU A;  4GAP A;  2IID A;  4Y4L A;  2V61 A;  5KMQ A;  4BUR A;  1TDO A;  3P4P A;  1H86 A;  3PO7 A;  3AE8 A;  5FS9 A;  1NHS A;  2R0G A;  3F8D A;  4JNA A;  2FJB A;  1K4Q A;  4H4T A;  3GSI A;  5TR3 A;  3QSE A;  1GAL A;  2VZ2 A;  3NYF A;  3ADA B;  1BGN A;  3CN8 A;  1BZL A;  2X99 A;  1B5Q A;  4B63 A;  4LU6 A;  3QFB A;  1LV0 A;  2C76 A;  2GB0 A;  3QVP A;  3ZYX A;  3BNM A;  2V6O A;  4EMJ A;  2APG A;  3K7Q X;  3T37 A;  2YLX A;  1ZKQ A;  2R0C A;  1X31 B;  4BK2 A;  4Y4M A;  2A87 A;  4TLX A;  1CJ4 A;  1OJ9 A;  1DOD A;  3AE6 A;  2AR8 A;  4YSZ A;  4C74 A;  5EOW A;  5FS6 A;  4EM3 A;  4G6G A;  1TRB A;  1EL8 A;  3DH9 A;  1KNR A;  3HYX A;  5L46 A;  1YQ3 A;  1FL2 A;  1QLB A;  1H6V A;  1S3E A;  3GYX A;  4RG3 A;  3VRB A;  4YKG A;  4BJY A;  2GEW A;  3AEA A;  4FDC B;  2Z5X A;  3EPT A;  4GR1 A;  1RP0 A;  2XDO A;  2CFY A;  3NHO X;  4BV6 A;  3UKP A;  3M13 A;  1IUW A;  3EF6 A;  2XFO A;  2NPX A;  1N4U A;  3AYJ A;  3Q9T A;  4M52 A;  1CJC A;  2YR5 A;  3SZW A;  2YVG A;  1CC2 A;  4OVI A;  1CF3 A;  2PYX A;  1OJC A;  1D5T A;  1ZMC A;  3AD7 B;  3E1T A;  1NG3 A;  3IF9 A;  3S61 A;  4BK3 A;  1ZOV A;  2FJE A;  1LJ1 A;  3ITJ A;  3AE5 A;  3LZX A;  4Y4N A;  3M12 A;  2Q7V A;  4U2L A;  5KOW A;  3Q6J A;  3FG2 P;  1H84 A;  3P1W A;  2BXS A;  3NT6 A;  1NPX A;  4ZCD A;  1CBO A;  3ICT A;  1H82 A;  4H2P A;  5EB5 A;  3GDN A;  4CRT A;  1M6I A;  3LB8 A;  1JEH A;  2DKH A;  3NNE A;  4II3 A;  1N4W A;  1PJ7 A;  2C65 A;  1M64 A;  1TDN A;  3NK2 X;  3NGC X;  1GOS A;  4U8N A;  1BKW A;  3ABV A;  1SEZ A;  3ATQ A;  3V76 A;  3AYI A;  3QSM A;  3FBS A;  1NHP A;  4IVM B;  4A9W A;  4AOX A;  3ISH A;  1ONF A;  4U8O A;  2GR0 A;  1E1N A;  5J7X A;  5HYM A;  3GYI A;  2F5Z A;  3WE0 A;  4CCR A;  2YLS A;  4HA6 A;  4EMI A;  3SX6 A;  3UCL A;  3CPH G;  4K5R A;  3AWI A;  2Y6R A;  2YAU A;  4JY3 A;  4B66 A;  3NK1 X;  3AE1 A;  3LJP A;  4A6N B;  4ADW A;  2BK5 A;  3KPK A;  3BI2 A;  4A6N A;  2XVI A;  2VVM A;  2B76 A;  4JY2 A;  4YT0 A;  3B6D A;  2GAH B;  3B3R A;  1LPF A;  2EQ9 A;  1RYI A;  3UTF A;  2BS3 A;  4G74 A;  3UTG A;  2QA1 A;  1O94 A;  4Z2U A;  1D7Y A;  2YLZ A;  1CL0 A;  1EL9 A;  1UKV G;  4Z24 A;  4DSG A;  5JCM A;  4NTC A;  1E6E A;  2JB1 A;  2JKC A;  2OLN A;  2R45 A;  4D04 A;  2GF3 A;  3GDP A;  4OPG A;  2CVJ A;  2YLW A;  3GYJ A;  5CKU A;  2DKI A;  5JCK A;  1TYP A;  1TYT A;  2V5Z A;  3LOV A;  1GRT A;  3GMB A;  3NTD A;  4U8K A;  4X4J A;  3VR8 A;  4CY8 A;  4OCG A;  5KMP A;  4TLZ A;  3ATR A;  1JOA A;  2GV8 A;  3DA1 A;  4J36 A;  4XWR A;  4EMW A;  5BUK A;  2V60 A;  2GMJ A;  1GRF A;  1S2Q A;  1W4X A;  3C4N A;  3O0H A;  1F3P A;  2GR2 A;  3IHM A;  1VG9 A;  2TMD A;  4H4Y A;  4U2T A;  1E7P A;  2A89 A;  4OPT A;  2XVH A;  3VRA A;  3QFA A;  5HHF A;  1K0L A;  4H4R A;  3PS9 A;  4H4X A;  3UTE A;  3SGL A;  4D03 A;  4AT0 A;  3GRS A;  4E0V A;  4J57 A;  1KDG A;  1NG4 A;  1K0J A;  1ZOY A;  3RP6 A;  3AB1 A;  3HYV A;  4J34 A;  1Q1R A;  2GAG B;  2XCG A;  4FK1 A;  2C3C A;  2YLT A;  3DK4 A;  3DK8 A;  4FK1 C;  4G6H A;  4TM0 A;  5KVI A;  3UOZ A;  1PJ5 A;  2XYO A;  1DOE A;  3SZF A;  2C7G A;  3URH A;  5KXJ A;  1PBB A;  2BA9 A;  3AE4 A;  2CUL A;  2Q0L A;  4EQS A;  3P4Q A;  1PJ6 A;  3CND A;  3UP5 A;  2JB3 A;  2VQ7 A;  1REO A;  4EQR A;  2V3A A;  1OJD A;  4OPL A;  1IUU A;  4A5L A;  1XPQ A;  1PXA A;  1YQ4 A;  2RAB A;  4EM4 A;  3II4 A;  5M10 A;  2WPC A;  2WBA A;  1PXC A;  3DGZ A;  3UOX A;  1GSN A;  1E39 A;  1NEN A;  2WOV A;  2WP9 A;  4C3Y A;  4YSH A;  1VG0 A;  3RED A;  5BVA A;  4I59 A;  5BUL A;  1GPE A;  1KSU A;  2ZZ0 A;  4G9K A;  5DBJ A;  2ZZB A;  1NDA A;  3SZ0 A;  2X8C A;  2AAQ A;  1NEK A;  4OPI A;  2GMH A;  1GRE A;  2Q0K A;  1F8W A;  2E5V A;  4U8L A;  2QCU A;  4J31 A;  1GTH A;  2JBV A;  3SQP A;  1DNC A;  1PN0 A;  3AEF A;  1Q1W A;  4K2X A;  3NIX A;  1L9D A;  4USQ A;  2XVF A;  4KX6 A;  1H7W A;  1N4V A;  4YTN A;  1YKJ A;  4WCT A;  3H4K A;  5BRT A;  1KSS A;  5U1O A;  1VDC A;  2OAL A;  2YG4 A;  4C77 A;  4Z43 A;  1XHC A;  4ZN0 A;  2X8G A;  3BNU A;  3VQR A;  4C5O A;  2RGO A;  2WEU A;  1GT8 A;  3M0O A;  4G73 A;  1TDE A;  1RSG A;  1TDF A;  4GCM A;  5FS7 A;  4ZCC A;  3SFE A;  3UTH A;  4OPC A;  2OAM A;  1MXT A;  1MO9 A;  2RGJ A;  3T2Y A;  4AP1 A;  2VVL G;  3CGD A;  3CNS A;  3R9U A;  4PAB A;  4LA1 A;  1VRQ B;  1F8R A;  4BJZ A;  1B4V A;  5KMR A;  1PS9 A;  4U8J A;  5JCL A;  2YLR A;  2WQY A;  4H7U A;  4U8I A;  3GWD A;  2V3B A;  3AE2 A;  2B7S A;  3UOV A;  2FJD A;  3DME A;  1P2H A;  2BS2 A;  3KU9 A;  3NRN A;  2GQW A;  3L8K A;  3DK9 A;  3G5Q A;  1PBF A;  4EQW A;  4AT2 A;  2C3D A;  1BF3 A;  2YVJ A;  3NLC A;  4H4Z A;  5JCI A;  2C67 A;  2HQM A;  3AEG A;  3T0K A;  2GQF A;  1XAN A;  1KF6 A;  1NHQ A;  1PBC A;  2XLP A;  3I3L A;  4NEW A;  1B37 A;  4Z25 A;  4N9X A;  5HXI A;  1O95 A;  3COX A;  3GRT A;  2YWL A;  4H50 A;  3NN6 X;  4U2S A;  2TPR A;  3AEE A;  4RG4 A;  1GRA A;  4GF7 A;  4IVO B;  2QAE A;  4Z26 A;  1BWC A;  1PHH A;  5LV9 A;  1O5W A;  4OPU A;  4LII A;  3FIM B;  2C66 A;  4UP3 A;  4H4Q A;  5KMS A;  4YSY A;  3AE7 A;  2C64 A;  4B65 A;  1FOH A;  2BCG G;  1Z6L A;  2VQB A;  3GD4 A;  3H8L A;  3FPZ A;  3OZ2 A;  3CNJ A;  1P2E A;  2JK6 A;  5ER0 A;  3SFD A;  2VRM A;  2WOW A;  2H89 A;  4B1B A;  4X9M A;  2A8X A;  1IUV A;  4YTP A;  3RNM A;  4J56 A;  2WDQ A;  3AE3 A;  4U8P A;  3T2Z A;  2C75 A;  2BAB A;  2O9Z A;  3P4S A;  2GR3 A;  1ZK7 A;  1GEU A;  1IUS A;  1QO8 A;  1S2Y A;  4TM1 A;  2QA2 A;  5FMH A;  2XVJ A;  5GSN A;  2YG5 A;  3UKH A;  2WOI A;  5EBK A;  1OJA A;  3AEC A;  3RP7 A;  1PBD A;  4MJW A;  2XVE A;  4AOS A;  1PDH A;  2BYB A;  1QJD A;  1JNR A;  2BRY A;  4O5U A;  4OPD A;  2WPF A;  1MOK A;  2YG7 A;  1Y56 A;  3GMC A;  1B8S A;  1Y56 B;  1GV4 A;  4FX9 A;  4HB9 A;  2GR1 A;  4RSL A;  2WP5 A;  3V3N A;  4IA5 A;  4DNA A;  5FS8 A;  1GRB A;  3CIR A;  5C3J A;  5U25 A;  1H83 A;  5KVH A;  4UDQ A;  3CGC A;  2XLS A;  3NTA A;  1E1L A;  3ALJ A;  2BAC A;  4H4S A;  3D8X A;  2ARD A;  3GD3 A;  1ELI A;  2BCP A;  2R46 A;  4EQX A;  3UP4 A;  3C4A A;  1K0I A;  2XFQ A;  1H7X A;  1PXB A;  2WDV A;  2YVF A;  2YR4 A;  3GWF A;  3ICS A;  3SXI A;  2BK4 A;  1KFY A;  2YM2 A;  2ZBW A;  1NHR A;  2XLR A;  3KKJ A;  3KPF A;  5EB4 A;  3LXD A;  4YWO A;  2VVL A;  1V59 A;  2Q6U A;  1ZP0 A;  2R4J A;  2Y6Q A;  4J33 A;  3CNT A;  5C2T A;  2R4E A;  2C4C A;  4KPR A;  4K7Z A;  3FMW A;  2R0P A;  4H2Q A;  3V3O A;  1D4D A;  3ALL A;  4U8M A;  3NYC A;  4GUV A;  4YXD A;  5CQF A;  3BHK A;  1NAA A;  4CNK A;  5JCN A;  3AE9 A;  1YY5 A;  3SZC A;  4APN A;  1EL7 A;  1DXL A;  4WX1 A;  4B67 A;  3ZDN A;  1EBD A;  2IVE A;  1GET A;  2EQ6 A;  1JRZ A;  3UKA A;  4UDP A;  4DGK A;  4ECH A;  2X50 A;  4NNJ A;  4B69 A;  4GDE A;  3AD8 B;  1FCD A;  3C96 A;  4A7A A;  3RHA A;  2VOU A;  3IHG A;  3NH3 X;  3CPI G;  3LZW A;  1S3B A;  2BC1 A;  4ICY A;  1F6M A;  3AXB A;  2ZZC A;  4TM4 A;  3SY4 A;  3AEB A;  3BI4 A;  1JRY A;  5KRQ A;  3HYW A;  2EQ8 A;  3KD9 A;  1L9E A;  1LQU A;  1DJQ A;  3AD9 B;  1E1M A;  4EIQ A;  4IA6 A;  3S5W A;  1XDI A;  4K22 A;  3EAN A;  4H4U A;  3L1R A;  4X9N A;  3NK0 X;  3LAD A;  4H4W A;  4H4P A;  3AYL A;  2Z5Y A;  2ACZ A;  4GDP A;  4P9S A;  3UKF A;  4B64 A;  3NG7 X;  4TM3 A;  1VQW A;  2WU5 A;  1N1P A;  4YTM A;  3DJE A;  4BK1 A;  4A65 A;  1BGJ A;  4PAA A;  2XFN A;  3CTY A;  3EAO A;  3UOY A;  3T2K A;  1DOB A;  3JSK A;  1CJ3 A;  4CBQ A;  1F8S A;  3NN0 X;  1FEA A;  2XLT A;  1L9C A;  4JQ9 A;  1CC6 A;  4DSH A;  2BK3 A;  3CMM A;  3T31 A;  1FEC A;  2B9W A;  2W0H A;  2BS4 A;  2GVC A;  2CDU A;  3K7M X;  4K5S A;  4NTE A;  4XXG A;  1L0V A;  1JNZ A;  5J60 A;  4USR A;  4EIP A;  1GES A;  4H2R A;  1CC4 A;  2BRA A;  3BHF A;  1Q9I A;  3KVE A;  2RGH A;  2FJA A;  4UDR A;  3QJ4 A;  1GND A;  1FEB A;  3AED A;  1COY A;  3F8P A;  3UKK A;  1CJ2 A;  3DGH A;  2X8H A;  2NVK X;  3F8R A;  1GXF A;  1KNP A;  3P9U A;  2B9Y A;  1JU2 A;  3IWA A;  5IQ1 A;  2WS3 A;  5M0Z A;  5IQ4 A;  2WU2 A;  2WPE A;  3KLJ A;  3VR9 A;  4AP3 A;  3NKS A;  3RP8 A;  4CY6 A;  3KA7 A;  4NEV A;  1GER A;  1ZMD A;  2H88 A;  1D7L A;  2IVD A;  1DOC A;  4H2N A;  3DJJ A;  1EL5 A;  2OLO A;  4I58 A;  2YG3 A;  4A79 A;  1AOG A;  2FBW A;  2WHD A;  4JNQ A;  1IJH A;  4GRT A;  5IPY A;  2WP6 A;  2B7R A;  3DJG X;  4NWZ A;  4YKF A;  2GH5 A;  2WES A;  3PVC A;  5KNL A;  5GRT A;  3IC9 A;  3CGE A;  5U63 A;  4NTD A;  3K30 A;  1GTE A;  3D1C A;  1LVL A;  3H8I A;  1OJT A;  2XFU A;  2YG6 A;  1YQZ A;  4Z2T A;  3UKQ A;  3ALM A;  4GAV A;  1H81 A;  3P4R A;  2WDR A;  4H4V A;  3QSS A;  1D4E A;  1ZX9 A;  2X3N A;  2XFP A;  4A99 A;  3OC4 A;  1IUX A;  2B9X A;  2JB2 A;  4XWZ A;  3SM8 A;  1TDK A;  2C72 A;  3G5S A;  3HZL A;  1ZDL A;  4O5Q A;  2GRT A;  3I6D A;  4IV9 A;  2R9Z A;  3ICR A;  4JDR A;  3CGB A;  2BXR A;  4Z44 A;  2AQJ A;  2OA1 A;  1LTX R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...