5KMQA

The structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
393
structure length
393
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLEDMRYLYLIGGLSLVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
molecule tags Oxidoreductase
total genus 118
structure length 393
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmqA00
3T2YA 3HYVA 4G74A 3HYXA 3T2ZA 4GAPA 5KMPA 3T0KA 5KMQA 3T31A 3KPKA 3SY4A 3HYWA 3SZWA 4G9KA 3SX6A 3SYIA 3T14A 4GAVA 5KMRA 3T2KA 3SZCA 3SZFA 3SXIA 5KMSA 4G6GA 4G73A 4G6HA 4NWZA 3SZ0A
chains in the Genus database with same CATH superfamily
3T2YA 1EBDA 2OAMA 1F8SA 4G74A 2C76A 1QLBA 1CC2A 2H89A 1VG9A 2O9ZA 2YG4A 3R9UA 2XFUA 2Q6UA 3SFDA 4ECHA 1K0JA 3GWFA 3T31A 2WP5A 3UKHA 2WU2A 2R0CA 3UCLA 1EL7A 1DOEA 2YG5A 2WESA 1LTXR 2BCPA 4DGKA 4OPUA 2YR5A 3CIRA 1YKJA 3BHFA 4IVOB 2GRTA 3REDA 3ATRA 1PBDA 1TRBA 1GRHA 3UTFA 1D4CA 4K8DA 1H84A 1H7XA 3H4KA 5GSNA 4EIPA 5KOXA 1EL9A 1D7YA 1PDHA 4RSLA 3AEEA 4NTEA 3E1TA 5M10A 1NDAA 2GR3A 1CJ4A 4EM3A 3FBSA 4GF7A 3Q9TA 3KLJA 4H4XA 5KRQA 1TDKA 1ZMDA 1JOAA 3DGHA 2GMJA 3DJJA 1NHQA 4OPGA 3AE3A 2VQBA 4Z44A 4Z25A 3HYWA 4H2NA 1B5QA 1NENA 4U8JA 5KVHA 4P9SA 5U25A 2CDUA 1P2EA 4REKA 3NN6X 1ZOVA 2CFYA 4JY3A 1GEUA 4AOXA 5DBJA 4YKGA 1E6EA 2YLXA 3ICTA 1JNZA 3SQPA 3LADA 2EQ6A 2IIDA 5LV9A 1IUSA 3D1CA 3GYXA 1NG3A 4XXGA 3KU9A 5JCIA 2R4JA 4ICYA 2FJAA 2C67A 2BS2A 1ZY8A 3AE6A 4G6HA 3UP4A 4BK2A 1DXLA 2E4GA 3JSKA 3UOXA 4MJWA 4U8OA 2H88A 1XPQA 2BYBA 3AEDA 2Y6QA 1PJ5A 3D8XA 2GB0A 3UKPA 3AB1A 3NTDA 2FBWA 1DODA 1N4WA 1TDFA 1YY5A 4Z43A 1E39A 3NN0X 3VRAA 4NTCA 5KXJA 2YG3A 5ER0A 1COYA 3IHMA 4H4PA 4E0VA 5JCKA 4II3A 1OJ9A 2A8XA 5FS9A 2C3CA 3UP5A 1H7WA 1E1MA 2C66A 4I58A 1RP0A 3OZ2A 4A99A 1DJQA 2A87A 1GXFA 2R9ZA 1V59A 1KSSA 3SXIA 1L9DA 3ISHA 4YSYA 4USQA 4IA5A 1GRFA 2WBAA 4DNAA 4FX9A 1KFYA 3P1WA 4JNAA 4CCQA 4HB9A 2WP6A 4UDRA 3EAOA 1N4VA 3PS9A 3DK9A 4UDPA 1QJDA 1VQWA 2VZ2A 1JEHA 1S3EA 1Q9IA 4TM0A 2VVMA 3FG2P 4YSZA 1FECA 4Y4NA 4AT0A 3NYEA 1NHPA 3K7MX 5KNLA 4G9KA 2BK4A 1DOBA 3GYIA 4J31A 5JCLA 2X8CA 4GDEA 5CQFA 1BGJA 3T14A 2R0GA 2XLUA 2C7GA 4A6NA 2ACZA 4Z24A 2V3AA 1GPEA 1CJ3A 2XDOA 3H8IA 4H2RA 1NAAA 2GAGB 4O5QA 4Z26A 4RG3A 1GNDA 5TR3A 3AE1A 1OJAA 4EQWA 2OALA 3QFAA 3K30A 3AYLA 4GAPA 4NEWA 2X3NA 5BVAA 4Z2UA 1LJ1A 1PS9A 3CGEA 3UTHA 2JKCA 1GOSA 1Y56A 2CULA 4B66A 4WCTA 3GMBA 3I3LA 1GSNA 2WETA 3K7TA 1LQTA 1PBEA 1CL0A 1E1KA 3GRSA 1L9CA 2XLTA 1LVLA 3BHKA 3GYJA 4OPLA 4B1BA 1GTEA 1ZP0A 2HQMA 3AE2A 3BI5A 3NIXA 1KSUA 1AOGA 1F8WA 2VQ7A 3FIMB 3DGZA 4IA6A 1FEBA 1Q1WA 4C5OA 1PHHA 2C70A 3AE5A 2GF3A 4LA1A 3P4RA 3VRDB 1S2QA 1VG0A 1B37A 1PJ7A 2Q7VA 2R45A 1DNCA 2BXSA 2BK5A 2XVJA 4X9MA 1X31B 2YR6A 4EQRA 2GEWA 1E1NA 1CC4A 3Q6JA 1O94A 4HA6A 2GR1A 3P4PA 3NTAA 2YLRA 1DOCA 5U63A 1XANA 4JN9A 4C3XA 1F8RA 3QSEA 4H2QA 3NYFA 1PXCA 2YLWA 5KVIA 3WE0A 3DMEA 4KPRA 4WX1A 2Z5XA 4OPTA 4EM4A 5CKUA 4YT0A 1GRTA 3NK2X 3CTYA 4J57A 4AP3A 4UDQA 3P4SA 1L0VA 3CGBA 3NKSA 1BKWA 1M6IA 1O95A 5KMSA 2YLZA 1D7LA 4LU6A 1ELIA 1MXTA 1NHSA 4NWZA 4CY8A 4D03A 3LZXA 1MOKA 3ABVA 3KPFA 4GCMA 3CGDA 1CJ2A 1NPXA 2RGJA 1O5WA 3AXBA 3NK0X 4DSGA 3UKKA 2EQ7A 3UTGA 4OVIA 4C74A 4CNJA 1PXBA 2QCUA 3M0OA 3KA7A 1FL2A 4JNQA 4H50A 4YSHA 5C2TA 4K22A 1VRQB 3NNEA 2NVKX 3SYIA 2C75A 3RP6A 1CF3A 2XVFA 1GRAA 1TDOA 5EB5A 4GR1A 4NTDA 1LQUA 1PN0A 2PYXA 1XDIA 3NYCA 1H82A 3L1RA 2W0HA 4C77A 4EMIA 3UKLA 4AP1A 2OA1A 4BJZA 3COXA 1JRXA 2GMHA 2XVIA 5JCMA 1GRBA 2C72A 2Q0LA 2YVGA 2ZBWA 2XLSA 3NK1X 1DJNA 2XFOA 1BF3A 4I59A 3BNMA 1D4EA 2A89A 2JB1A 2WPCA 3OC4A 3NG7X 4IVMB 3ICRA 4EMJA 4CCRA 4D04A 4YTMA 2PHHA 3F8PA 2FJDA 5KWFA 3AE8A 3VR9A 1KDGA 4CNKA 1OJDA 5HXIA 5BULA 2BACA 3O0HA 3SZFA 4XWZA 2XVEA 2FJBA 3DA1A 3LOVA 2XFQA 4X4JA 1QO8A 5EB4A 3T2ZA 5IQ4A 3UKAA 4TLZA 1MO9A 2ZZBA 2YAUA 5HHFA 4K5SA 2XLPA 3DJGX 2UZZA 4U2SA 3HYXA 3NH3X 1D5TA 1JU2A 5FS6A 1K0LA 2ZZ0A 2RGHA 2WOVA 1UKVG 3GDPA 2OLNA 3CPHG 2GQWA 3CNDA 2YM1A 3S61A 2Z5YA 3ATQA 1GETA 3SX6A 1REOA 4A65A 4RG4A 1GRGA 1PJ6A 2BC1A 1K4QA 2R46A 3F8DA 2TPRA 1N4UA 3ADAB 4IV9A 3M12A 1OJCA 2C3DA 3QSMA 5BUKA 4PABA 1ZX9A 5BRTA 1BWCA 2V61A 3SZ0A 3BI4A 4J34A 2OLOA 2ZZCA 3AWIA 3AYIA 2WQYA 3AE4A 4EQXA 2GAHB 1GALA 3IWAA 1H83A 1OJTA 3RHAA 4O5UA 2YWLA 3EANA 4A7AA 2WOIA 2CVJA 4OPCA 5KMQA 2QA2A 3KPKA 3IC9A 4OPDA 2XFPA 4ZCDA 1ZKQA 2VOUA 2TMDA 2AAQA 2JK6A 2BK3A 4Z2TA 1XHCA 4GAVA 4TM1A 3URHA 4BK1A 2YQUA 2WOWA 5HYMA 3ITJA 2BABA 2B9XA 2V60A 4H4TA 3RP7A 4BV6A 1JRZA 2WU5A 3AE9A 2V3BA 4TM3A 1YQ3A 1ZOYA 3QVPA 3VR8A 2GVCA 1S2YA 2V6OA 2YM2A 1NHRA 3AEAA 5JCNA 1VDCA 3QFBA 4J56A 3UOYA 1Z6LA 4H4UA 3AYJA 3CNTA 1L9EA 1NG4A 3I6DA 3ALJA 3G5QA 2R4EA 1HYUA 4UP3A 3PO7A 3UOVA 2XCGA 1IUWA 4FDCB 2WEUA 2JB3A 3CMMA 3QSSA 1CC6A 4J36A 2I0ZA 4H4SA 2BA9A 4B67A 2E5VA 1SEZA 2EQ9A 2B7RA 2GR2A 2J3NA 3GSIA 4PAAA 3SZCA 4H7UA 2WPFA 3ICSA 3DJEA 2BXRA 4Y4MA 2AQJA 2C65A 2X8HA 1TYPA 2XFNA 5FS8A 3S5WA 3L8KA 4BK3A 4FK1C 4H4YA 4NEVA 3BI2A 2Q0KA 4GRTA 3HZLA 1IJHA 2GH5A 2C64A 1FOHA 2RGOA 5J60A 1CBOA 2WPEA 5EBKA 4A9WA 1B8SA 2V5ZA 3SY4A 1F6MA 1Q1RA 4NZHA 4ADWA 3IF9A 2C73A 2B76A 3NT6A 3DJDA 1GERA 2VVLA 4H4VA 2NPXA 3G5SA 3UKQA 4CRTA 4BJYA 3GDNA 1KNPA 4TLXA 4B63A 4USRA 2YR4A 2WDRA 3T2KA 5C3JA 4EMWA 4G6GA 2FJEA 5HY5A 5FS7A 4AT2A 1W4XA 1FCDA 4U8NA 1IUUA 1PXAA 1E1LA 2APGA 2DKHA 2YLSA 4ZN0A 1YQZA 2Y6RA 3NGCX 4B65A 3AECA 2JB2A 2WP9A 2X8GA 3GD4A 4CY6A 1M64A 4J2WA 3B3RA 2WS3A 1CJCA 3V76A 3C4NA 2YG6A 3AE7A 3DK8A 4K7ZA 3LZWA 4EIQA 2BC0A 3C4AA 3M13A 3H8LA 4YWOA 4NNJA 1GTHA 1ZMCA 2X99A 2XVHA 2GR0A 1GESA 1PBCA 3DK4A 3AD7B 3GRTA 4OPIA 5M0ZA 3V3OA 1H86A 4YKFA 1RYIA 1NEKA 2VVLG 2B9WA 2IVDA 4A5LA 2EQ8A 4LIIA 5KOWA 2F5ZA 5EOWA 5FMHA 1F3PA 3IHGA 4A79A 3V3NA 4YXDA 4GUVA 2YLTA 1FEAA 2BS4A 1EL8A 4APNA 2BRYA 3CPIG 2WHDA 3NRNA 4U2LA 3GWDA 3HYVA 3CNPA 2B9YA 3G5RA 5U1OA 1B4VA 1LV0A 4B68A 4AOSA 4B64A 5KMPA 1JNRA 1KNRA 2BRAA 3BNUA 3EPTA 5IQ1A 3SFEA 1IUVA 3AEFA 1YQ4A 1IUXA 3LXDA 5L46A 2X50A 2IVEA 4Y4LA 3ZDNA 3AEBA 3KD9A 2WDQA 4U8KA 2R0PA 3VQRA 3SGLA 4K2XA 4H2PA 2C4CA 2JBVA 2RABA 4JY2A 4M52A 3CPJG 3LB8A 4XWRA 4B69A 3AEGA 5KMRA 4CBQA 2ARDA 4Z2RA 1ZDLA 3FPZA 3NHOX 5J7XA 3QJ4A 1D4DA 1GREA 5IPYA 3ZYXA 1EL5A 3II4A 4II2A 3K7QX 3VRBA 3T37A 3UKFA 1E7PA 4C3YA 3RNMA 1GV4A 3ALMA 4TM4A 2XLRA 1S3BA 3SM8A 4YTPA 3SZWA 1GT8A 3EF6A 3UOZA 4H4RA 3P4QA 4BURA 1TYTA 4JQ9A 4A6NB 4YTNA 3F8RA 2VRMA 1Y0PA 3KVEA 3PVCA 1ONFA 2QAEA 4JDRA 1P2HA 1BZLA 2DKIA 2GQFA 4H4WA 2JAEA 3CGCA 4G73A 4J33A 4U8PA 3FMWA 3LJPA 4U8MA 1BGNA 3UTEA 5GRTA 1PBBA 4YSXA 3DH9A 1IUTA 1ZK7A 3C96A 2YVJA 3CN8A 3GMCA 2WDVA 2B7SA 4U8IA 4U2TA 4N9XA 4DSHA 3T0KA 1Y56B 1PBFA 1JRYA 3GD3A 1TDEA 3QVRA 2AR8A 4H4QA 2YVFA 3NLCA 3AD8B 4U8LA 4KX6A 1KF6A 1K0IA 1RSGA 3CNSA 4OCGA 4X9NA 3B6DA 4H4ZA 4EQSA 4GDPA 2GV8A 1H81A 1TDNA 1N1PA 1H6VA 2VRLA 2XYOA 2BS3A 3AD9B 3RP8A 2YG7A 1CHUA 2BCGG 1LPFA 2QA1A 3CNJA 3P9UA 4FK1A 3KKJA 4K5RA 2E1MA 4ZCCA 3ALLA
chains in the Genus database with same CATH topology
3T2YA 1EBDA 2OAMA 1F8SA 4G74A 2C76A 1QLBA 1CC2A 2H89A 1VG9A 2O9ZA 2YG4A 3R9UA 2XFUA 2Q6UA 3SFDA 4ECHA 1K0JA 3GWFA 3T31A 2WP5A 3UKHA 2WU2A 2R0CA 3UCLA 1EL7A 1DOEA 2YG5A 2WESA 1LTXR 2BCPA 4DGKA 4OPUA 2YR5A 3CIRA 1YKJA 3BHFA 4IVOB 2GRTA 3REDA 3ATRA 1PBDA 1TRBA 1GRHA 3UTFA 1D4CA 4K8DA 1H84A 1H7XA 3H4KA 5GSNA 4EIPA 5KOXA 1EL9A 1D7YA 1PDHA 4RSLA 3AEEA 4NTEA 3E1TA 5M10A 1NDAA 2GR3A 1CJ4A 4EM3A 3FBSA 4GF7A 3Q9TA 3KLJA 4H4XA 5KRQA 1TDKA 1ZMDA 1JOAA 3DGHA 2GMJA 3DJJA 1NHQA 4OPGA 3AE3A 2VQBA 4Z44A 4Z25A 3HYWA 4H2NA 1B5QA 1NENA 4U8JA 5KVHA 4P9SA 5U25A 2CDUA 1P2EA 4REKA 3NN6X 1ZOVA 2CFYA 4JY3A 1GEUA 4AOXA 5DBJA 4YKGA 1E6EA 2YLXA 3ICTA 1JNZA 3SQPA 3LADA 2EQ6A 2IIDA 5LV9A 1IUSA 3D1CA 3GYXA 1NG3A 4XXGA 3KU9A 5JCIA 2R4JA 4ICYA 2FJAA 2C67A 2BS2A 1ZY8A 3AE6A 4G6HA 3UP4A 4BK2A 1DXLA 2E4GA 3JSKA 3UOXA 4MJWA 4U8OA 2H88A 1XPQA 2BYBA 3AEDA 2Y6QA 1PJ5A 3D8XA 2GB0A 3UKPA 3AB1A 3NTDA 2FBWA 1DODA 1N4WA 1TDFA 1YY5A 4Z43A 1E39A 3NN0X 3VRAA 4NTCA 5KXJA 2YG3A 5ER0A 1COYA 3IHMA 4H4PA 4E0VA 5JCKA 4II3A 1OJ9A 2A8XA 5FS9A 2C3CA 3UP5A 1H7WA 1E1MA 2C66A 4I58A 1RP0A 3OZ2A 4A99A 1DJQA 2A87A 1GXFA 2R9ZA 1V59A 1KSSA 3SXIA 1L9DA 3ISHA 4YSYA 4USQA 4IA5A 1GRFA 2WBAA 4DNAA 4FX9A 1KFYA 3P1WA 4JNAA 4CCQA 4HB9A 2WP6A 4UDRA 3EAOA 1N4VA 3PS9A 3DK9A 4UDPA 1QJDA 1VQWA 2VZ2A 1JEHA 1S3EA 1Q9IA 4TM0A 2VVMA 3FG2P 4YSZA 1FECA 4Y4NA 4AT0A 3NYEA 1NHPA 3K7MX 5KNLA 4G9KA 2BK4A 1DOBA 3GYIA 4J31A 5JCLA 2X8CA 4GDEA 5CQFA 1BGJA 3T14A 2R0GA 2XLUA 2C7GA 4A6NA 2ACZA 4Z24A 2V3AA 1GPEA 1CJ3A 2XDOA 3H8IA 4H2RA 1NAAA 2GAGB 4O5QA 4Z26A 4RG3A 1GNDA 5TR3A 3AE1A 1OJAA 4EQWA 2OALA 3QFAA 3K30A 3AYLA 4GAPA 4NEWA 2X3NA 5BVAA 4Z2UA 1LJ1A 1PS9A 3CGEA 3UTHA 2JKCA 1GOSA 1Y56A 2CULA 4B66A 4WCTA 3GMBA 3I3LA 1GSNA 2WETA 3K7TA 1LQTA 1PBEA 1CL0A 1E1KA 3GRSA 1L9CA 2XLTA 1LVLA 3BHKA 3GYJA 4OPLA 4B1BA 1GTEA 1ZP0A 2HQMA 3AE2A 3BI5A 3NIXA 1KSUA 1AOGA 1F8WA 2VQ7A 3FIMB 3DGZA 4IA6A 1FEBA 1Q1WA 4C5OA 1PHHA 2C70A 3AE5A 2GF3A 4LA1A 3P4RA 3VRDB 1S2QA 1VG0A 1B37A 1PJ7A 2Q7VA 2R45A 1DNCA 2BXSA 2BK5A 2XVJA 4X9MA 1X31B 2YR6A 4EQRA 2GEWA 1E1NA 1CC4A 3Q6JA 1O94A 4HA6A 2GR1A 3P4PA 3NTAA 2YLRA 1DOCA 5U63A 1XANA 4JN9A 4C3XA 1F8RA 3QSEA 4H2QA 3NYFA 1PXCA 2YLWA 5KVIA 3WE0A 3DMEA 4KPRA 4WX1A 2Z5XA 4OPTA 4EM4A 5CKUA 4YT0A 1GRTA 3NK2X 3CTYA 4J57A 4AP3A 4UDQA 3P4SA 1L0VA 3CGBA 3NKSA 1BKWA 1M6IA 1O95A 5KMSA 2YLZA 1D7LA 4LU6A 1ELIA 1MXTA 1NHSA 4NWZA 4CY8A 4D03A 3LZXA 1MOKA 3ABVA 3KPFA 4GCMA 3CGDA 1CJ2A 1NPXA 2RGJA 1O5WA 3AXBA 3NK0X 4DSGA 3UKKA 2EQ7A 3UTGA 4OVIA 4C74A 4CNJA 1PXBA 2QCUA 3M0OA 3KA7A 1FL2A 4JNQA 4H50A 4YSHA 5C2TA 4K22A 1VRQB 3NNEA 2NVKX 3SYIA 2C75A 3RP6A 1CF3A 2XVFA 1GRAA 1TDOA 5EB5A 4GR1A 4NTDA 1LQUA 1PN0A 2PYXA 1XDIA 3NYCA 1H82A 3L1RA 2W0HA 4C77A 4EMIA 3UKLA 4AP1A 2OA1A 4BJZA 3COXA 1JRXA 2GMHA 2XVIA 5JCMA 1GRBA 2C72A 2Q0LA 2YVGA 2ZBWA 2XLSA 3NK1X 1DJNA 2XFOA 1BF3A 4I59A 3BNMA 1D4EA 2A89A 2JB1A 2WPCA 3OC4A 3NG7X 4IVMB 3ICRA 4EMJA 4CCRA 4D04A 4YTMA 2PHHA 3F8PA 2FJDA 5KWFA 3AE8A 3VR9A 1KDGA 4CNKA 1OJDA 5HXIA 5BULA 2BACA 3O0HA 3SZFA 4XWZA 2XVEA 2FJBA 3DA1A 3LOVA 2XFQA 4X4JA 1QO8A 5EB4A 3T2ZA 5IQ4A 3UKAA 4TLZA 1MO9A 2ZZBA 2YAUA 5HHFA 4K5SA 2XLPA 3DJGX 2UZZA 4U2SA 3HYXA 3NH3X 1D5TA 1JU2A 5FS6A 1K0LA 2ZZ0A 2RGHA 2WOVA 1UKVG 3GDPA 2OLNA 3CPHG 2GQWA 3CNDA 2YM1A 3S61A 2Z5YA 3ATQA 1GETA 3SX6A 1REOA 4A65A 4RG4A 1GRGA 1PJ6A 2BC1A 1K4QA 2R46A 3F8DA 2TPRA 1N4UA 3ADAB 4IV9A 3M12A 1OJCA 2C3DA 3QSMA 5BUKA 4PABA 1ZX9A 5BRTA 1BWCA 2V61A 3SZ0A 3BI4A 4J34A 2OLOA 2ZZCA 3AWIA 3AYIA 2WQYA 3AE4A 4EQXA 2GAHB 1GALA 3IWAA 1H83A 1OJTA 3RHAA 4O5UA 2YWLA 3EANA 4A7AA 2WOIA 2CVJA 4OPCA 5KMQA 2QA2A 3KPKA 3IC9A 4OPDA 2XFPA 4ZCDA 1ZKQA 2VOUA 2TMDA 2AAQA 2JK6A 2BK3A 4Z2TA 1XHCA 4GAVA 4TM1A 3URHA 4BK1A 2YQUA 2WOWA 5HYMA 3ITJA 2BABA 2B9XA 2V60A 4H4TA 3RP7A 4BV6A 1JRZA 2WU5A 3AE9A 2V3BA 4TM3A 1YQ3A 1ZOYA 3QVPA 3VR8A 2GVCA 1S2YA 2V6OA 2YM2A 1NHRA 3AEAA 5JCNA 1VDCA 3QFBA 4J56A 3UOYA 1Z6LA 4H4UA 3AYJA 3CNTA 1L9EA 1NG4A 3I6DA 3ALJA 3G5QA 2R4EA 1HYUA 4UP3A 3PO7A 3UOVA 2XCGA 1IUWA 4FDCB 2WEUA 2JB3A 3CMMA 3QSSA 1CC6A 4J36A 2I0ZA 4H4SA 2BA9A 4B67A 2E5VA 1SEZA 2EQ9A 2B7RA 2GR2A 2J3NA 3GSIA 4PAAA 3SZCA 4H7UA 2WPFA 3ICSA 3DJEA 2BXRA 4Y4MA 2AQJA 2C65A 2X8HA 1TYPA 2XFNA 5FS8A 3S5WA 3L8KA 4BK3A 4FK1C 4H4YA 4NEVA 3BI2A 2Q0KA 4GRTA 3HZLA 1IJHA 2GH5A 2C64A 1FOHA 2RGOA 5J60A 1CBOA 2WPEA 5EBKA 4A9WA 1B8SA 2V5ZA 3SY4A 1F6MA 1Q1RA 4NZHA 4ADWA 3IF9A 2C73A 2B76A 3NT6A 3DJDA 1GERA 2VVLA 4H4VA 2NPXA 3G5SA 3UKQA 4CRTA 4BJYA 3GDNA 1KNPA 4TLXA 4B63A 4USRA 2YR4A 2WDRA 3T2KA 5C3JA 4EMWA 4G6GA 2FJEA 5HY5A 5FS7A 4AT2A 1W4XA 1FCDA 4U8NA 1IUUA 1PXAA 1E1LA 2APGA 2DKHA 2YLSA 4ZN0A 1YQZA 2Y6RA 3NGCX 4B65A 3AECA 2JB2A 2WP9A 2X8GA 3GD4A 4CY6A 1M64A 4J2WA 3B3RA 2WS3A 1CJCA 3V76A 3C4NA 2YG6A 3AE7A 3DK8A 4K7ZA 3LZWA 4EIQA 2BC0A 3C4AA 3M13A 3H8LA 4YWOA 4NNJA 1GTHA 1ZMCA 2X99A 2XVHA 2GR0A 1GESA 1PBCA 3DK4A 3AD7B 3GRTA 4OPIA 5M0ZA 3V3OA 1H86A 4YKFA 1RYIA 1NEKA 2VVLG 2B9WA 2IVDA 4A5LA 2EQ8A 4LIIA 5KOWA 2F5ZA 5EOWA 5FMHA 1F3PA 3IHGA 4A79A 3V3NA 4YXDA 4GUVA 2YLTA 1FEAA 2BS4A 1EL8A 4APNA 2BRYA 3CPIG 2WHDA 3NRNA 4U2LA 3GWDA 3HYVA 3CNPA 2B9YA 3G5RA 5U1OA 1B4VA 1LV0A 4B68A 4AOSA 4B64A 5KMPA 1JNRA 1KNRA 2BRAA 3BNUA 3EPTA 5IQ1A 3SFEA 1IUVA 3AEFA 1YQ4A 1IUXA 3LXDA 5L46A 2X50A 2IVEA 4Y4LA 3ZDNA 3AEBA 3KD9A 2WDQA 4U8KA 2R0PA 3VQRA 3SGLA 4K2XA 4H2PA 2C4CA 2JBVA 2RABA 4JY2A 4M52A 3CPJG 3LB8A 4XWRA 4B69A 3AEGA 5KMRA 4CBQA 2ARDA 4Z2RA 1ZDLA 3FPZA 3NHOX 5J7XA 3QJ4A 1D4DA 1GREA 5IPYA 3ZYXA 1EL5A 3II4A 4II2A 3K7QX 3VRBA 3T37A 3UKFA 1E7PA 4C3YA 3RNMA 1GV4A 3ALMA 4TM4A 2XLRA 1S3BA 3SM8A 4YTPA 3SZWA 1GT8A 3EF6A 3UOZA 4H4RA 3P4QA 4BURA 1TYTA 4JQ9A 4A6NB 4YTNA 3F8RA 2VRMA 1Y0PA 3KVEA 3PVCA 1ONFA 2QAEA 4JDRA 1P2HA 1BZLA 2DKIA 2GQFA 4H4WA 2JAEA 3CGCA 4G73A 4J33A 4U8PA 3FMWA 3LJPA 4U8MA 1BGNA 3UTEA 5GRTA 1PBBA 4YSXA 3DH9A 1IUTA 1ZK7A 3C96A 2YVJA 3CN8A 3GMCA 2WDVA 2B7SA 4U8IA 4U2TA 4N9XA 4DSHA 3T0KA 1Y56B 1PBFA 1JRYA 3GD3A 1TDEA 3QVRA 2AR8A 4H4QA 2YVFA 3NLCA 3AD8B 4U8LA 4KX6A 1KF6A 1K0IA 1RSGA 3CNSA 4OCGA 4X9NA 3B6DA 4H4ZA 4EQSA 4GDPA 2GV8A 1H81A 1TDNA 1N1PA 1H6VA 2VRLA 2XYOA 2BS3A 3AD9B 3RP8A 2YG7A 1CHUA 2BCGG 1LPFA 2QA1A 3CNJA 3P9UA 4FK1A 3KKJA 4K5RA 2E1MA 4ZCCA 3ALLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2Y A;  3HYV A;  4G74 A;  3HYX A;  3T2Z A;  4GAP A;  5KMP A;  3T0K A;  5KMQ A;  3T31 A;  3KPK A;  3SY4 A;  3HYW A;  3SZW A;  4G9K A;  3SX6 A;  3SYI A;  3T14 A;  4GAV A;  5KMR A;  3T2K A;  3SZC A;  3SZF A;  3SXI A;  5KMS A;  4G6G A;  4G73 A;  4G6H A;  4NWZ A;  3SZ0 A; 
#chains in the Genus database with same CATH topology
 3T2Y A;  1EBD A;  2OAM A;  1F8S A;  4G74 A;  2C76 A;  1QLB A;  1CC2 A;  2H89 A;  1VG9 A;  2O9Z A;  2YG4 A;  3R9U A;  2XFU A;  2Q6U A;  3SFD A;  4ECH A;  1K0J A;  3GWF A;  3T31 A;  2WP5 A;  3UKH A;  2WU2 A;  2R0C A;  3UCL A;  1EL7 A;  1DOE A;  2YG5 A;  2WES A;  1LTX R;  2BCP A;  4DGK A;  4OPU A;  2YR5 A;  3CIR A;  1YKJ A;  3BHF A;  4IVO B;  2GRT A;  3RED A;  3ATR A;  1PBD A;  1TRB A;  1GRH A;  3UTF A;  1D4C A;  4K8D A;  1H84 A;  1H7X A;  3H4K A;  5GSN A;  4EIP A;  5KOX A;  1EL9 A;  1D7Y A;  1PDH A;  4RSL A;  3AEE A;  4NTE A;  3E1T A;  5M10 A;  1NDA A;  2GR3 A;  1CJ4 A;  4EM3 A;  3FBS A;  4GF7 A;  3Q9T A;  3KLJ A;  4H4X A;  5KRQ A;  1TDK A;  1ZMD A;  1JOA A;  3DGH A;  2GMJ A;  3DJJ A;  1NHQ A;  4OPG A;  3AE3 A;  2VQB A;  4Z44 A;  4Z25 A;  3HYW A;  4H2N A;  1B5Q A;  1NEN A;  4U8J A;  5KVH A;  4P9S A;  5U25 A;  2CDU A;  1P2E A;  4REK A;  3NN6 X;  1ZOV A;  2CFY A;  4JY3 A;  1GEU A;  4AOX A;  5DBJ A;  4YKG A;  1E6E A;  2YLX A;  3ICT A;  1JNZ A;  3SQP A;  3LAD A;  2EQ6 A;  2IID A;  5LV9 A;  1IUS A;  3D1C A;  3GYX A;  1NG3 A;  4XXG A;  3KU9 A;  5JCI A;  2R4J A;  4ICY A;  2FJA A;  2C67 A;  2BS2 A;  1ZY8 A;  3AE6 A;  4G6H A;  3UP4 A;  4BK2 A;  1DXL A;  2E4G A;  3JSK A;  3UOX A;  4MJW A;  4U8O A;  2H88 A;  1XPQ A;  2BYB A;  3AED A;  2Y6Q A;  1PJ5 A;  3D8X A;  2GB0 A;  3UKP A;  3AB1 A;  3NTD A;  2FBW A;  1DOD A;  1N4W A;  1TDF A;  1YY5 A;  4Z43 A;  1E39 A;  3NN0 X;  3VRA A;  4NTC A;  5KXJ A;  2YG3 A;  5ER0 A;  1COY A;  3IHM A;  4H4P A;  4E0V A;  5JCK A;  4II3 A;  1OJ9 A;  2A8X A;  5FS9 A;  2C3C A;  3UP5 A;  1H7W A;  1E1M A;  2C66 A;  4I58 A;  1RP0 A;  3OZ2 A;  4A99 A;  1DJQ A;  2A87 A;  1GXF A;  2R9Z A;  1V59 A;  1KSS A;  3SXI A;  1L9D A;  3ISH A;  4YSY A;  4USQ A;  4IA5 A;  1GRF A;  2WBA A;  4DNA A;  4FX9 A;  1KFY A;  3P1W A;  4JNA A;  4CCQ A;  4HB9 A;  2WP6 A;  4UDR A;  3EAO A;  1N4V A;  3PS9 A;  3DK9 A;  4UDP A;  1QJD A;  1VQW A;  2VZ2 A;  1JEH A;  1S3E A;  1Q9I A;  4TM0 A;  2VVM A;  3FG2 P;  4YSZ A;  1FEC A;  4Y4N A;  4AT0 A;  3NYE A;  1NHP A;  3K7M X;  5KNL A;  4G9K A;  2BK4 A;  1DOB A;  3GYI A;  4J31 A;  5JCL A;  2X8C A;  4GDE A;  5CQF A;  1BGJ A;  3T14 A;  2R0G A;  2XLU A;  2C7G A;  4A6N A;  2ACZ A;  4Z24 A;  2V3A A;  1GPE A;  1CJ3 A;  2XDO A;  3H8I A;  4H2R A;  1NAA A;  2GAG B;  4O5Q A;  4Z26 A;  4RG3 A;  1GND A;  5TR3 A;  3AE1 A;  1OJA A;  4EQW A;  2OAL A;  3QFA A;  3K30 A;  3AYL A;  4GAP A;  4NEW A;  2X3N A;  5BVA A;  4Z2U A;  1LJ1 A;  1PS9 A;  3CGE A;  3UTH A;  2JKC A;  1GOS A;  1Y56 A;  2CUL A;  4B66 A;  4WCT A;  3GMB A;  3I3L A;  1GSN A;  2WET A;  3K7T A;  1LQT A;  1PBE A;  1CL0 A;  1E1K A;  3GRS A;  1L9C A;  2XLT A;  1LVL A;  3BHK A;  3GYJ A;  4OPL A;  4B1B A;  1GTE A;  1ZP0 A;  2HQM A;  3AE2 A;  3BI5 A;  3NIX A;  1KSU A;  1AOG A;  1F8W A;  2VQ7 A;  3FIM B;  3DGZ A;  4IA6 A;  1FEB A;  1Q1W A;  4C5O A;  1PHH A;  2C70 A;  3AE5 A;  2GF3 A;  4LA1 A;  3P4R A;  3VRD B;  1S2Q A;  1VG0 A;  1B37 A;  1PJ7 A;  2Q7V A;  2R45 A;  1DNC A;  2BXS A;  2BK5 A;  2XVJ A;  4X9M A;  1X31 B;  2YR6 A;  4EQR A;  2GEW A;  1E1N A;  1CC4 A;  3Q6J A;  1O94 A;  4HA6 A;  2GR1 A;  3P4P A;  3NTA A;  2YLR A;  1DOC A;  5U63 A;  1XAN A;  4JN9 A;  4C3X A;  1F8R A;  3QSE A;  4H2Q A;  3NYF A;  1PXC A;  2YLW A;  5KVI A;  3WE0 A;  3DME A;  4KPR A;  4WX1 A;  2Z5X A;  4OPT A;  4EM4 A;  5CKU A;  4YT0 A;  1GRT A;  3NK2 X;  3CTY A;  4J57 A;  4AP3 A;  4UDQ A;  3P4S A;  1L0V A;  3CGB A;  3NKS A;  1BKW A;  1M6I A;  1O95 A;  5KMS A;  2YLZ A;  1D7L A;  4LU6 A;  1ELI A;  1MXT A;  1NHS A;  4NWZ A;  4CY8 A;  4D03 A;  3LZX A;  1MOK A;  3ABV A;  3KPF A;  4GCM A;  3CGD A;  1CJ2 A;  1NPX A;  2RGJ A;  1O5W A;  3AXB A;  3NK0 X;  4DSG A;  3UKK A;  2EQ7 A;  3UTG A;  4OVI A;  4C74 A;  4CNJ A;  1PXB A;  2QCU A;  3M0O A;  3KA7 A;  1FL2 A;  4JNQ A;  4H50 A;  4YSH A;  5C2T A;  4K22 A;  1VRQ B;  3NNE A;  2NVK X;  3SYI A;  2C75 A;  3RP6 A;  1CF3 A;  2XVF A;  1GRA A;  1TDO A;  5EB5 A;  4GR1 A;  4NTD A;  1LQU A;  1PN0 A;  2PYX A;  1XDI A;  3NYC A;  1H82 A;  3L1R A;  2W0H A;  4C77 A;  4EMI A;  3UKL A;  4AP1 A;  2OA1 A;  4BJZ A;  3COX A;  1JRX A;  2GMH A;  2XVI A;  5JCM A;  1GRB A;  2C72 A;  2Q0L A;  2YVG A;  2ZBW A;  2XLS A;  3NK1 X;  1DJN A;  2XFO A;  1BF3 A;  4I59 A;  3BNM A;  1D4E A;  2A89 A;  2JB1 A;  2WPC A;  3OC4 A;  3NG7 X;  4IVM B;  3ICR A;  4EMJ A;  4CCR A;  4D04 A;  4YTM A;  2PHH A;  3F8P A;  2FJD A;  5KWF A;  3AE8 A;  3VR9 A;  1KDG A;  4CNK A;  1OJD A;  5HXI A;  5BUL A;  2BAC A;  3O0H A;  3SZF A;  4XWZ A;  2XVE A;  2FJB A;  3DA1 A;  3LOV A;  2XFQ A;  4X4J A;  1QO8 A;  5EB4 A;  3T2Z A;  5IQ4 A;  3UKA A;  4TLZ A;  1MO9 A;  2ZZB A;  2YAU A;  5HHF A;  4K5S A;  2XLP A;  3DJG X;  2UZZ A;  4U2S A;  3HYX A;  3NH3 X;  1D5T A;  1JU2 A;  5FS6 A;  1K0L A;  2ZZ0 A;  2RGH A;  2WOV A;  1UKV G;  3GDP A;  2OLN A;  3CPH G;  2GQW A;  3CND A;  2YM1 A;  3S61 A;  2Z5Y A;  3ATQ A;  1GET A;  3SX6 A;  1REO A;  4A65 A;  4RG4 A;  1GRG A;  1PJ6 A;  2BC1 A;  1K4Q A;  2R46 A;  3F8D A;  2TPR A;  1N4U A;  3ADA B;  4IV9 A;  3M12 A;  1OJC A;  2C3D A;  3QSM A;  5BUK A;  4PAB A;  1ZX9 A;  5BRT A;  1BWC A;  2V61 A;  3SZ0 A;  3BI4 A;  4J34 A;  2OLO A;  2ZZC A;  3AWI A;  3AYI A;  2WQY A;  3AE4 A;  4EQX A;  2GAH B;  1GAL A;  3IWA A;  1H83 A;  1OJT A;  3RHA A;  4O5U A;  2YWL A;  3EAN A;  4A7A A;  2WOI A;  2CVJ A;  4OPC A;  5KMQ A;  2QA2 A;  3KPK A;  3IC9 A;  4OPD A;  2XFP A;  4ZCD A;  1ZKQ A;  2VOU A;  2TMD A;  2AAQ A;  2JK6 A;  2BK3 A;  4Z2T A;  1XHC A;  4GAV A;  4TM1 A;  3URH A;  4BK1 A;  2YQU A;  2WOW A;  5HYM A;  3ITJ A;  2BAB A;  2B9X A;  2V60 A;  4H4T A;  3RP7 A;  4BV6 A;  1JRZ A;  2WU5 A;  3AE9 A;  2V3B A;  4TM3 A;  1YQ3 A;  1ZOY A;  3QVP A;  3VR8 A;  2GVC A;  1S2Y A;  2V6O A;  2YM2 A;  1NHR A;  3AEA A;  5JCN A;  1VDC A;  3QFB A;  4J56 A;  3UOY A;  1Z6L A;  4H4U A;  3AYJ A;  3CNT A;  1L9E A;  1NG4 A;  3I6D A;  3ALJ A;  3G5Q A;  2R4E A;  1HYU A;  4UP3 A;  3PO7 A;  3UOV A;  2XCG A;  1IUW A;  4FDC B;  2WEU A;  2JB3 A;  3CMM A;  3QSS A;  1CC6 A;  4J36 A;  2I0Z A;  4H4S A;  2BA9 A;  4B67 A;  2E5V A;  1SEZ A;  2EQ9 A;  2B7R A;  2GR2 A;  2J3N A;  3GSI A;  4PAA A;  3SZC A;  4H7U A;  2WPF A;  3ICS A;  3DJE A;  2BXR A;  4Y4M A;  2AQJ A;  2C65 A;  2X8H A;  1TYP A;  2XFN A;  5FS8 A;  3S5W A;  3L8K A;  4BK3 A;  4FK1 C;  4H4Y A;  4NEV A;  3BI2 A;  2Q0K A;  4GRT A;  3HZL A;  1IJH A;  2GH5 A;  2C64 A;  1FOH A;  2RGO A;  5J60 A;  1CBO A;  2WPE A;  5EBK A;  4A9W A;  1B8S A;  2V5Z A;  3SY4 A;  1F6M A;  1Q1R A;  4NZH A;  4ADW A;  3IF9 A;  2C73 A;  2B76 A;  3NT6 A;  3DJD A;  1GER A;  2VVL A;  4H4V A;  2NPX A;  3G5S A;  3UKQ A;  4CRT A;  4BJY A;  3GDN A;  1KNP A;  4TLX A;  4B63 A;  4USR A;  2YR4 A;  2WDR A;  3T2K A;  5C3J A;  4EMW A;  4G6G A;  2FJE A;  5HY5 A;  5FS7 A;  4AT2 A;  1W4X A;  1FCD A;  4U8N A;  1IUU A;  1PXA A;  1E1L A;  2APG A;  2DKH A;  2YLS A;  4ZN0 A;  1YQZ A;  2Y6R A;  3NGC X;  4B65 A;  3AEC A;  2JB2 A;  2WP9 A;  2X8G A;  3GD4 A;  4CY6 A;  1M64 A;  4J2W A;  3B3R A;  2WS3 A;  1CJC A;  3V76 A;  3C4N A;  2YG6 A;  3AE7 A;  3DK8 A;  4K7Z A;  3LZW A;  4EIQ A;  2BC0 A;  3C4A A;  3M13 A;  3H8L A;  4YWO A;  4NNJ A;  1GTH A;  1ZMC A;  2X99 A;  2XVH A;  2GR0 A;  1GES A;  1PBC A;  3DK4 A;  3AD7 B;  3GRT A;  4OPI A;  5M0Z A;  3V3O A;  1H86 A;  4YKF A;  1RYI A;  1NEK A;  2VVL G;  2B9W A;  2IVD A;  4A5L A;  2EQ8 A;  4LII A;  5KOW A;  2F5Z A;  5EOW A;  5FMH A;  1F3P A;  3IHG A;  4A79 A;  3V3N A;  4YXD A;  4GUV A;  2YLT A;  1FEA A;  2BS4 A;  1EL8 A;  4APN A;  2BRY A;  3CPI G;  2WHD A;  3NRN A;  4U2L A;  3GWD A;  3HYV A;  3CNP A;  2B9Y A;  3G5R A;  5U1O A;  1B4V A;  1LV0 A;  4B68 A;  4AOS A;  4B64 A;  5KMP A;  1JNR A;  1KNR A;  2BRA A;  3BNU A;  3EPT A;  5IQ1 A;  3SFE A;  1IUV A;  3AEF A;  1YQ4 A;  1IUX A;  3LXD A;  5L46 A;  2X50 A;  2IVE A;  4Y4L A;  3ZDN A;  3AEB A;  3KD9 A;  2WDQ A;  4U8K A;  2R0P A;  3VQR A;  3SGL A;  4K2X A;  4H2P A;  2C4C A;  2JBV A;  2RAB A;  4JY2 A;  4M52 A;  3CPJ G;  3LB8 A;  4XWR A;  4B69 A;  3AEG A;  5KMR A;  4CBQ A;  2ARD A;  4Z2R A;  1ZDL A;  3FPZ A;  3NHO X;  5J7X A;  3QJ4 A;  1D4D A;  1GRE A;  5IPY A;  3ZYX A;  1EL5 A;  3II4 A;  4II2 A;  3K7Q X;  3VRB A;  3T37 A;  3UKF A;  1E7P A;  4C3Y A;  3RNM A;  1GV4 A;  3ALM A;  4TM4 A;  2XLR A;  1S3B A;  3SM8 A;  4YTP A;  3SZW A;  1GT8 A;  3EF6 A;  3UOZ A;  4H4R A;  3P4Q A;  4BUR A;  1TYT A;  4JQ9 A;  4A6N B;  4YTN A;  3F8R A;  2VRM A;  1Y0P A;  3KVE A;  3PVC A;  1ONF A;  2QAE A;  4JDR A;  1P2H A;  1BZL A;  2DKI A;  2GQF A;  4H4W A;  2JAE A;  3CGC A;  4G73 A;  4J33 A;  4U8P A;  3FMW A;  3LJP A;  4U8M A;  1BGN A;  3UTE A;  5GRT A;  1PBB A;  4YSX A;  3DH9 A;  1IUT A;  1ZK7 A;  3C96 A;  2YVJ A;  3CN8 A;  3GMC A;  2WDV A;  2B7S A;  4U8I A;  4U2T A;  4N9X A;  4DSH A;  3T0K A;  1Y56 B;  1PBF A;  1JRY A;  3GD3 A;  1TDE A;  3QVR A;  2AR8 A;  4H4Q A;  2YVF A;  3NLC A;  3AD8 B;  4U8L A;  4KX6 A;  1KF6 A;  1K0I A;  1RSG A;  3CNS A;  4OCG A;  4X9N A;  3B6D A;  4H4Z A;  4EQS A;  4GDP A;  2GV8 A;  1H81 A;  1TDN A;  1N1P A;  1H6V A;  2VRL A;  2XYO A;  2BS3 A;  3AD9 B;  3RP8 A;  2YG7 A;  1CHU A;  2BCG G;  1LPF A;  2QA1 A;  3CNJ A;  3P9U A;  4FK1 A;  3KKJ A;  4K5R A;  2E1M A;  4ZCC A;  3ALL A; 
#chains in the Genus database with same CATH homology
 3T2Y A;  1EBD A;  2OAM A;  1F8S A;  4G74 A;  2C76 A;  1QLB A;  1CC2 A;  2H89 A;  1VG9 A;  2O9Z A;  2YG4 A;  3R9U A;  2XFU A;  2Q6U A;  3SFD A;  4ECH A;  1K0J A;  3GWF A;  3T31 A;  2WP5 A;  3UKH A;  2WU2 A;  2R0C A;  3UCL A;  1EL7 A;  1DOE A;  2YG5 A;  2WES A;  1LTX R;  2BCP A;  4DGK A;  4OPU A;  2YR5 A;  3CIR A;  1YKJ A;  3BHF A;  4IVO B;  2GRT A;  3RED A;  3ATR A;  1PBD A;  1TRB A;  1GRH A;  3UTF A;  1D4C A;  4K8D A;  1H84 A;  1H7X A;  3H4K A;  5GSN A;  4EIP A;  5KOX A;  1EL9 A;  1D7Y A;  1PDH A;  4RSL A;  3AEE A;  4NTE A;  3E1T A;  5M10 A;  1NDA A;  2GR3 A;  1CJ4 A;  4EM3 A;  3FBS A;  4GF7 A;  3Q9T A;  3KLJ A;  4H4X A;  5KRQ A;  1TDK A;  1ZMD A;  1JOA A;  3DGH A;  2GMJ A;  3DJJ A;  1NHQ A;  4OPG A;  3AE3 A;  2VQB A;  4Z44 A;  4Z25 A;  3HYW A;  4H2N A;  1B5Q A;  1NEN A;  4U8J A;  5KVH A;  4P9S A;  5U25 A;  2CDU A;  1P2E A;  4REK A;  3NN6 X;  1ZOV A;  2CFY A;  4JY3 A;  1GEU A;  4AOX A;  5DBJ A;  4YKG A;  1E6E A;  2YLX A;  3ICT A;  1JNZ A;  3SQP A;  3LAD A;  2EQ6 A;  2IID A;  5LV9 A;  1IUS A;  3D1C A;  3GYX A;  1NG3 A;  4XXG A;  3KU9 A;  5JCI A;  2R4J A;  4ICY A;  2FJA A;  2C67 A;  2BS2 A;  1ZY8 A;  3AE6 A;  4G6H A;  3UP4 A;  4BK2 A;  1DXL A;  2E4G A;  3JSK A;  3UOX A;  4MJW A;  4U8O A;  2H88 A;  1XPQ A;  2BYB A;  3AED A;  2Y6Q A;  1PJ5 A;  3D8X A;  2GB0 A;  3UKP A;  3AB1 A;  3NTD A;  2FBW A;  1DOD A;  1N4W A;  1TDF A;  1YY5 A;  4Z43 A;  1E39 A;  3NN0 X;  3VRA A;  4NTC A;  5KXJ A;  2YG3 A;  5ER0 A;  1COY A;  3IHM A;  4H4P A;  4E0V A;  5JCK A;  4II3 A;  1OJ9 A;  2A8X A;  5FS9 A;  2C3C A;  3UP5 A;  1H7W A;  1E1M A;  2C66 A;  4I58 A;  1RP0 A;  3OZ2 A;  4A99 A;  1DJQ A;  2A87 A;  1GXF A;  2R9Z A;  1V59 A;  1KSS A;  3SXI A;  1L9D A;  3ISH A;  4YSY A;  4USQ A;  4IA5 A;  1GRF A;  2WBA A;  4DNA A;  4FX9 A;  1KFY A;  3P1W A;  4JNA A;  4CCQ A;  4HB9 A;  2WP6 A;  4UDR A;  3EAO A;  1N4V A;  3PS9 A;  3DK9 A;  4UDP A;  1QJD A;  1VQW A;  2VZ2 A;  1JEH A;  1S3E A;  1Q9I A;  4TM0 A;  2VVM A;  3FG2 P;  4YSZ A;  1FEC A;  4Y4N A;  4AT0 A;  3NYE A;  1NHP A;  3K7M X;  5KNL A;  4G9K A;  2BK4 A;  1DOB A;  3GYI A;  4J31 A;  5JCL A;  2X8C A;  4GDE A;  5CQF A;  1BGJ A;  3T14 A;  2R0G A;  2XLU A;  2C7G A;  4A6N A;  2ACZ A;  4Z24 A;  2V3A A;  1GPE A;  1CJ3 A;  2XDO A;  3H8I A;  4H2R A;  1NAA A;  2GAG B;  4O5Q A;  4Z26 A;  4RG3 A;  1GND A;  5TR3 A;  3AE1 A;  1OJA A;  4EQW A;  2OAL A;  3QFA A;  3K30 A;  3AYL A;  4GAP A;  4NEW A;  2X3N A;  5BVA A;  4Z2U A;  1LJ1 A;  1PS9 A;  3CGE A;  3UTH A;  2JKC A;  1GOS A;  1Y56 A;  2CUL A;  4B66 A;  4WCT A;  3GMB A;  3I3L A;  1GSN A;  2WET A;  3K7T A;  1LQT A;  1PBE A;  1CL0 A;  1E1K A;  3GRS A;  1L9C A;  2XLT A;  1LVL A;  3BHK A;  3GYJ A;  4OPL A;  4B1B A;  1GTE A;  1ZP0 A;  2HQM A;  3AE2 A;  3BI5 A;  3NIX A;  1KSU A;  1AOG A;  1F8W A;  2VQ7 A;  3FIM B;  3DGZ A;  4IA6 A;  1FEB A;  1Q1W A;  4C5O A;  1PHH A;  2C70 A;  3AE5 A;  2GF3 A;  4LA1 A;  3P4R A;  3VRD B;  1S2Q A;  1VG0 A;  1B37 A;  1PJ7 A;  2Q7V A;  2R45 A;  1DNC A;  2BXS A;  2BK5 A;  2XVJ A;  4X9M A;  1X31 B;  2YR6 A;  4EQR A;  2GEW A;  1E1N A;  1CC4 A;  3Q6J A;  1O94 A;  4HA6 A;  2GR1 A;  3P4P A;  3NTA A;  2YLR A;  1DOC A;  5U63 A;  1XAN A;  4JN9 A;  4C3X A;  1F8R A;  3QSE A;  4H2Q A;  3NYF A;  1PXC A;  2YLW A;  5KVI A;  3WE0 A;  3DME A;  4KPR A;  4WX1 A;  2Z5X A;  4OPT A;  4EM4 A;  5CKU A;  4YT0 A;  1GRT A;  3NK2 X;  3CTY A;  4J57 A;  4AP3 A;  4UDQ A;  3P4S A;  1L0V A;  3CGB A;  3NKS A;  1BKW A;  1M6I A;  1O95 A;  5KMS A;  2YLZ A;  1D7L A;  4LU6 A;  1ELI A;  1MXT A;  1NHS A;  4NWZ A;  4CY8 A;  4D03 A;  3LZX A;  1MOK A;  3ABV A;  3KPF A;  4GCM A;  3CGD A;  1CJ2 A;  1NPX A;  2RGJ A;  1O5W A;  3AXB A;  3NK0 X;  4DSG A;  3UKK A;  2EQ7 A;  3UTG A;  4OVI A;  4C74 A;  4CNJ A;  1PXB A;  2QCU A;  3M0O A;  3KA7 A;  1FL2 A;  4JNQ A;  4H50 A;  4YSH A;  5C2T A;  4K22 A;  1VRQ B;  3NNE A;  2NVK X;  3SYI A;  2C75 A;  3RP6 A;  1CF3 A;  2XVF A;  1GRA A;  1TDO A;  5EB5 A;  4GR1 A;  4NTD A;  1LQU A;  1PN0 A;  2PYX A;  1XDI A;  3NYC A;  1H82 A;  3L1R A;  2W0H A;  4C77 A;  4EMI A;  3UKL A;  4AP1 A;  2OA1 A;  4BJZ A;  3COX A;  1JRX A;  2GMH A;  2XVI A;  5JCM A;  1GRB A;  2C72 A;  2Q0L A;  2YVG A;  2ZBW A;  2XLS A;  3NK1 X;  1DJN A;  2XFO A;  1BF3 A;  4I59 A;  3BNM A;  1D4E A;  2A89 A;  2JB1 A;  2WPC A;  3OC4 A;  3NG7 X;  4IVM B;  3ICR A;  4EMJ A;  4CCR A;  4D04 A;  4YTM A;  2PHH A;  3F8P A;  2FJD A;  5KWF A;  3AE8 A;  3VR9 A;  1KDG A;  4CNK A;  1OJD A;  5HXI A;  5BUL A;  2BAC A;  3O0H A;  3SZF A;  4XWZ A;  2XVE A;  2FJB A;  3DA1 A;  3LOV A;  2XFQ A;  4X4J A;  1QO8 A;  5EB4 A;  3T2Z A;  5IQ4 A;  3UKA A;  4TLZ A;  1MO9 A;  2ZZB A;  2YAU A;  5HHF A;  4K5S A;  2XLP A;  3DJG X;  2UZZ A;  4U2S A;  3HYX A;  3NH3 X;  1D5T A;  1JU2 A;  5FS6 A;  1K0L A;  2ZZ0 A;  2RGH A;  2WOV A;  1UKV G;  3GDP A;  2OLN A;  3CPH G;  2GQW A;  3CND A;  2YM1 A;  3S61 A;  2Z5Y A;  3ATQ A;  1GET A;  3SX6 A;  1REO A;  4A65 A;  4RG4 A;  1GRG A;  1PJ6 A;  2BC1 A;  1K4Q A;  2R46 A;  3F8D A;  2TPR A;  1N4U A;  3ADA B;  4IV9 A;  3M12 A;  1OJC A;  2C3D A;  3QSM A;  5BUK A;  4PAB A;  1ZX9 A;  5BRT A;  1BWC A;  2V61 A;  3SZ0 A;  3BI4 A;  4J34 A;  2OLO A;  2ZZC A;  3AWI A;  3AYI A;  2WQY A;  3AE4 A;  4EQX A;  2GAH B;  1GAL A;  3IWA A;  1H83 A;  1OJT A;  3RHA A;  4O5U A;  2YWL A;  3EAN A;  4A7A A;  2WOI A;  2CVJ A;  4OPC A;  5KMQ A;  2QA2 A;  3KPK A;  3IC9 A;  4OPD A;  2XFP A;  4ZCD A;  1ZKQ A;  2VOU A;  2TMD A;  2AAQ A;  2JK6 A;  2BK3 A;  4Z2T A;  1XHC A;  4GAV A;  4TM1 A;  3URH A;  4BK1 A;  2YQU A;  2WOW A;  5HYM A;  3ITJ A;  2BAB A;  2B9X A;  2V60 A;  4H4T A;  3RP7 A;  4BV6 A;  1JRZ A;  2WU5 A;  3AE9 A;  2V3B A;  4TM3 A;  1YQ3 A;  1ZOY A;  3QVP A;  3VR8 A;  2GVC A;  1S2Y A;  2V6O A;  2YM2 A;  1NHR A;  3AEA A;  5JCN A;  1VDC A;  3QFB A;  4J56 A;  3UOY A;  1Z6L A;  4H4U A;  3AYJ A;  3CNT A;  1L9E A;  1NG4 A;  3I6D A;  3ALJ A;  3G5Q A;  2R4E A;  1HYU A;  4UP3 A;  3PO7 A;  3UOV A;  2XCG A;  1IUW A;  4FDC B;  2WEU A;  2JB3 A;  3CMM A;  3QSS A;  1CC6 A;  4J36 A;  2I0Z A;  4H4S A;  2BA9 A;  4B67 A;  2E5V A;  1SEZ A;  2EQ9 A;  2B7R A;  2GR2 A;  2J3N A;  3GSI A;  4PAA A;  3SZC A;  4H7U A;  2WPF A;  3ICS A;  3DJE A;  2BXR A;  4Y4M A;  2AQJ A;  2C65 A;  2X8H A;  1TYP A;  2XFN A;  5FS8 A;  3S5W A;  3L8K A;  4BK3 A;  4FK1 C;  4H4Y A;  4NEV A;  3BI2 A;  2Q0K A;  4GRT A;  3HZL A;  1IJH A;  2GH5 A;  2C64 A;  1FOH A;  2RGO A;  5J60 A;  1CBO A;  2WPE A;  5EBK A;  4A9W A;  1B8S A;  2V5Z A;  3SY4 A;  1F6M A;  1Q1R A;  4NZH A;  4ADW A;  3IF9 A;  2C73 A;  2B76 A;  3NT6 A;  3DJD A;  1GER A;  2VVL A;  4H4V A;  2NPX A;  3G5S A;  3UKQ A;  4CRT A;  4BJY A;  3GDN A;  1KNP A;  4TLX A;  4B63 A;  4USR A;  2YR4 A;  2WDR A;  3T2K A;  5C3J A;  4EMW A;  4G6G A;  2FJE A;  5HY5 A;  5FS7 A;  4AT2 A;  1W4X A;  1FCD A;  4U8N A;  1IUU A;  1PXA A;  1E1L A;  2APG A;  2DKH A;  2YLS A;  4ZN0 A;  1YQZ A;  2Y6R A;  3NGC X;  4B65 A;  3AEC A;  2JB2 A;  2WP9 A;  2X8G A;  3GD4 A;  4CY6 A;  1M64 A;  4J2W A;  3B3R A;  2WS3 A;  1CJC A;  3V76 A;  3C4N A;  2YG6 A;  3AE7 A;  3DK8 A;  4K7Z A;  3LZW A;  4EIQ A;  2BC0 A;  3C4A A;  3M13 A;  3H8L A;  4YWO A;  4NNJ A;  1GTH A;  1ZMC A;  2X99 A;  2XVH A;  2GR0 A;  1GES A;  1PBC A;  3DK4 A;  3AD7 B;  3GRT A;  4OPI A;  5M0Z A;  3V3O A;  1H86 A;  4YKF A;  1RYI A;  1NEK A;  2VVL G;  2B9W A;  2IVD A;  4A5L A;  2EQ8 A;  4LII A;  5KOW A;  2F5Z A;  5EOW A;  5FMH A;  1F3P A;  3IHG A;  4A79 A;  3V3N A;  4YXD A;  4GUV A;  2YLT A;  1FEA A;  2BS4 A;  1EL8 A;  4APN A;  2BRY A;  3CPI G;  2WHD A;  3NRN A;  4U2L A;  3GWD A;  3HYV A;  3CNP A;  2B9Y A;  3G5R A;  5U1O A;  1B4V A;  1LV0 A;  4B68 A;  4AOS A;  4B64 A;  5KMP A;  1JNR A;  1KNR A;  2BRA A;  3BNU A;  3EPT A;  5IQ1 A;  3SFE A;  1IUV A;  3AEF A;  1YQ4 A;  1IUX A;  3LXD A;  5L46 A;  2X50 A;  2IVE A;  4Y4L A;  3ZDN A;  3AEB A;  3KD9 A;  2WDQ A;  4U8K A;  2R0P A;  3VQR A;  3SGL A;  4K2X A;  4H2P A;  2C4C A;  2JBV A;  2RAB A;  4JY2 A;  4M52 A;  3CPJ G;  3LB8 A;  4XWR A;  4B69 A;  3AEG A;  5KMR A;  4CBQ A;  2ARD A;  4Z2R A;  1ZDL A;  3FPZ A;  3NHO X;  5J7X A;  3QJ4 A;  1D4D A;  1GRE A;  5IPY A;  3ZYX A;  1EL5 A;  3II4 A;  4II2 A;  3K7Q X;  3VRB A;  3T37 A;  3UKF A;  1E7P A;  4C3Y A;  3RNM A;  1GV4 A;  3ALM A;  4TM4 A;  2XLR A;  1S3B A;  3SM8 A;  4YTP A;  3SZW A;  1GT8 A;  3EF6 A;  3UOZ A;  4H4R A;  3P4Q A;  4BUR A;  1TYT A;  4JQ9 A;  4A6N B;  4YTN A;  3F8R A;  2VRM A;  1Y0P A;  3KVE A;  3PVC A;  1ONF A;  2QAE A;  4JDR A;  1P2H A;  1BZL A;  2DKI A;  2GQF A;  4H4W A;  2JAE A;  3CGC A;  4G73 A;  4J33 A;  4U8P A;  3FMW A;  3LJP A;  4U8M A;  1BGN A;  3UTE A;  5GRT A;  1PBB A;  4YSX A;  3DH9 A;  1IUT A;  1ZK7 A;  3C96 A;  2YVJ A;  3CN8 A;  3GMC A;  2WDV A;  2B7S A;  4U8I A;  4U2T A;  4N9X A;  4DSH A;  3T0K A;  1Y56 B;  1PBF A;  1JRY A;  3GD3 A;  1TDE A;  3QVR A;  2AR8 A;  4H4Q A;  2YVF A;  3NLC A;  3AD8 B;  4U8L A;  4KX6 A;  1KF6 A;  1K0I A;  1RSG A;  3CNS A;  4OCG A;  4X9N A;  3B6D A;  4H4Z A;  4EQS A;  4GDP A;  2GV8 A;  1H81 A;  1TDN A;  1N1P A;  1H6V A;  2VRL A;  2XYO A;  2BS3 A;  3AD9 B;  3RP8 A;  2YG7 A;  1CHU A;  2BCG G;  1LPF A;  2QA1 A;  3CNJ A;  3P9U A;  4FK1 A;  3KKJ A;  4K5R A;  2E1M A;  4ZCC A;  3ALL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...