5KMQA

The structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
393
structure length
393
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLEDMRYLYLIGGLSLVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
molecule tags Oxidoreductase
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
total genus 118
structure length 393
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmqA00
3T2YA 4G9KA 3T14A 3SZWA 3HYVA 3T0KA 4G74A 5KMSA 3HYXA 3SYIA 3T2KA 3SY4A 3HYWA 4G6GA 3T31A 4G6HA 3SZFA 3SX6A 4G73A 5KMRA 3KPKA 5KMPA 3SZ0A 3SXIA 3T2ZA 3SZCA 4GAPA 4GAVA 5KMQA 4NWZA
chains in the Genus database with same CATH superfamily
2R0CA 2GR0A 1JOAA 2R45A 3NNEA 3SFEA 2HQMA 4H4QA 4P9SA 4B69A 2C7GA 2B9WA 3SZWA 4CRTA 5JCKA 3DMEA 1BWCA 3G5SA 3PO7A 1BF3A 2C75A 3B3RA 2FJAA 3IHMA 4H50A 3T37A 2GF3A 1B4VA 2XLUA 4H4UA 2JB2A 3G5RA 3CNPA 4M52A 4N9XA 3UOVA 4B63A 1ZX9A 3UTHA 4IV9A 2E4GA 4U8PA 1H86A 1NG4A 3AYJA 4EQXA 1OJDA 2GR3A 1PBBA 3PVCA 2WETA 5EB5A 4YWOA 4A65A 2R0GA 5KMQA 1YQ3A 4O5UA 4NWZA 4XWZA 3AE4A 2YLTA 5KVHA 4Z25A 4UP3A 1CC4A 1MOKA 2C65A 3IC9A 3WE0A 1PDHA 1PBFA 1OJTA 3GD3A 1CBOA 3QJ4A 2JKCA 4XWRA 4Z44A 3EPTA 3AE1A 3BNUA 1D4EA 3PS9A 4O5QA 1D7YA 3GD4A 3NG7X 1Y56A 3C4AA 2B9XA 4FK1C 3QVPA 2GMJA 3DJEA 3FMWA 1W4XA 4H4ZA 4H2PA 1VDCA 5HYMA 4EM4A 2ZZCA 3BI2A 2IVDA 5BVAA 4H4SA 1ZP0A 2WP6A 3URHA 5KNLA 2BCPA 3NGCX 4D03A 2XFOA 4YKFA 2JB3A 3RNMA 1JRYA 1XDIA 3FPZA 3RHAA 1GRBA 2CDUA 2VRLA 4NEVA 1E7PA 3NK2X 1VG9A 4FX9A 2XCGA 1B5QA 4AT2A 1KSUA 1NHRA 1KF6A 3IF9A 4ECHA 1KFYA 1OJCA 2YLZA 2C76A 3QFAA 4RG4A 1PN0A 2JAEA 3NN0X 1PHHA 1RP0A 2ARDA 1TDNA 2JBVA 4H4WA 3RP8A 4A6NA 1BKWA 1S2QA 2XFQA 2VRMA 2XVHA 2B7SA 4B67A 2OAMA 5BUKA 4G73A 3II4A 1ZDLA 5C2TA 3EAOA 3LJPA 4TLXA 4BK1A 1K0IA 3AYIA 2CVJA 3SXIA 4Y4MA 1F8WA 2BK5A 5FS9A 3R9UA 3GYJA 4GAVA 4U8KA 4D04A 4BJZA 3UTGA 4A9WA 4GUVA 3ALMA 4EIQA 4Z2TA 5LV9A 3C96A 2BC0A 3BI4A 1GALA 4H2QA 5U63A 4YXDA 1F3PA 4C77A 2ZBWA 3UKAA 4H7UA 3P4PA 5FS7A 3LB8A 2C73A 4OCGA 2YAUA 2ZZBA 1NHQA 2WPCA 3SY4A 3UKHA 4C5OA 1REOA 2W0HA 3Q6JA 3QFBA 1GOSA 4OPCA 5ER0A 2C72A 1Y56B 3V3NA 3AD8B 5EOWA 4J36A 3GDNA 2C67A 2UZZA 3LZWA 3UCLA 5U25A 3UKKA 2YWLA 1O95A 3L8KA 3ITJA 2C64A 2OA1A 3ISHA 2J3NA 3G5QA 4CBQA 1Q9IA 1TDFA 5BULA 4USQA 3GYIA 4REKA 4YSXA 2AQJA 4Y4LA 3AXBA 3NT6A 4LA1A 1NHSA 3NIXA 1JRXA 2X3NA 1CJ2A 1CC6A 1YQZA 1X31B 2XLSA 3DGHA 1XHCA 4AOXA 2B7RA 2V3AA 2YVJA 1XANA 3AE7A 2YVGA 3SX6A 1ZK7A 3DJGX 1FECA 4U8OA 3B6DA 3AE8A 4K7ZA 4WCTA 2RGOA 1NAAA 1NPXA 4GDPA 4H4YA 3SZ0A 4GCMA 4GF7A 4H4TA 4BJYA 4H4XA 1JRZA 4J34A 3KD9A 1ZOYA 4BURA 3SZCA 1CHUA 2XFNA 4ADWA 4OPUA 3T2YA 3NYCA 4WX1A 4LU6A 2C3CA 4IA6A 3T0KA 2BABA 1QLBA 2X8CA 4B64A 1PJ6A 1VQWA 2FJBA 2V61A 3AD7B 3I3LA 3CGCA 3QSEA 1TDEA 4GR1A 4DSGA 1BZLA 3HYWA 4EMWA 2EQ8A 1D7LA 2XLTA 1DOCA 1CL0A 2XDOA 3VRDB 4JDRA 1ZMDA 2PYXA 4X9NA 2XLPA 5U1OA 2PHHA 3P9UA 1CJ3A 2X8HA 1JNRA 1MO9A 1NDAA 2GB0A 2GVCA 3NH3X 1O94A 4NNJA 1K0JA 1L0VA 5C3JA 4B65A 3AB1A 2AR8A 3UKLA 2EQ7A 3UP5A 3SFDA 3K7MX 2X50A 1FOHA 1NHPA 4IVOB 2A89A 4K5RA 3FIMB 5J7XA 1PXAA 1ONFA 1KDGA 3COXA 2VQBA 4J57A 4BK3A 1PS9A 5BRTA 1YKJA 5M0ZA 1LPFA 2YG6A 3DGZA 4J2WA 3VRBA 2H88A 3VRAA 2YM1A 4CNJA 3OC4A 4NTCA 5IQ1A 4C74A 1F8SA 3GSIA 3KPKA 3NK0X 2OLOA 1BGNA 4YSZA 1D5TA 5GSNA 3ADAB 2V60A 5KXJA 5M10A 3ZYXA 2XVEA 5TR3A 2XFPA 4UDQA 2XVFA 3GDPA 4EM3A 4YTPA 4JY2A 1N1PA 2WP5A 2BCGG 3T14A 2YR4A 2X99A 4EQRA 2Y6QA 2QCUA 5DBJA 3DK4A 4X9MA 3ABVA 2H89A 1IUSA 4DGKA 1GRFA 3S61A 4YKGA 1F8RA 1IUUA 2YLSA 1LTXR 1GRHA 4U8LA 2YLRA 2Y6RA 3T31A 3KPFA 4YT0A 4GRTA 1UKVG 3I6DA 5HHFA 5IQ4A 5EB4A 5EBKA 2WOIA 4A6NB 5HXIA 2JB1A 2XYOA 4B1BA 4BV6A 2F5ZA 1B8SA 5KMPA 5GRTA 1KNPA 4NTDA 2YVFA 1GXFA 2YR5A 1LQUA 5CKUA 3S5WA 3V3OA 4CY6A 1ZOVA 1O5WA 2VVMA 4AT0A 2BACA 3CGEA 4DSHA 1E1KA 3DJJA 2R4JA 3VR9A 4DNAA 1HYUA 2QA1A 2VQ7A 4JN9A 4FDCB 4A7AA 3GMCA 3P1WA 4U8NA 3NYFA 3K7TA 1DJNA 2Z5YA 2GR2A 4ZN0A 1GPEA 2BRAA 1D4CA 1K4QA 3AD9B 4XXGA 4J33A 1MXTA 3T2KA 3LZXA 1GNDA 4TM3A 2GRTA 2WPEA 1SEZA 4YSYA 5HY5A 5J60A 2NVKX 4GDEA 5FS6A 1ZKQA 5FMHA 3FG2P 1L9EA 1K0LA 4IVMB 4TM1A 2AAQA 1GTHA 2V3BA 3QSMA 4K22A 3LADA 4USRA 4NTEA 4BK2A 1Q1WA 3AECA 1DOBA 1VRQB 2YG3A 4GAPA 4II2A 4K2XA 2WESA 4B68A 1E1MA 3VQRA 2DKIA 3ICRA 3NHOX 1M64A 3ATQA 3D1CA 4H2RA 3ICSA 2B9YA 1CJ4A 3EANA 1GRGA 2C70A 1PXCA 3BI5A 4H4RA 1NENA 3BHFA 3GWFA 1H6VA 2CULA 4OPTA 4TM0A 3HYXA 2GQFA 2BS4A 1GERA 1Q1RA 4KX6A 1LJ1A 2BC1A 1LVLA 4NEWA 3AEGA 4J56A 2Q0KA 4OPGA 2WU5A 3AEFA 3F8RA 4NZHA 3GYXA 4H4PA 3CPJG 3DH9A 3SZFA 4C3YA 2BRYA 3M13A 1E1NA 2GR1A 2A8XA 1Z6LA 2QA2A 1KSSA 2V6OA 1RSGA 2YM2A 1KNRA 1RYIA 4H4VA 1H7WA 2I0ZA 2GEWA 4Z24A 1CC2A 1NG3A 1ZY8A 5JCIA 2BK4A 1E39A 4ICYA 3IHGA 3NTAA 1AOGA 3RP7A 1F6MA 4CY8A 3F8DA 3IWAA 4I59A 4U2TA 3EF6A 1GSNA 2YG5A 1S3EA 2ACZA 2YLXA 2WHDA 2V5ZA 3F8PA 4AP3A 2WQYA 2B76A 2EQ9A 4OVIA 2IVEA 3KA7A 3AE9A 3ICTA 4I58A 1YQ4A 3QVRA 4ZCDA 4OPDA 3AEDA 3DK9A 3KVEA 3UOZA 3CN8A 1VG0A 3O0HA 5KOWA 1GESA 3GRSA 1QJDA 3H8IA 1IJHA 3AYLA 4OPIA 5KRQA 1H83A 1LV0A 1S2YA 4X4JA 1DXLA 4OPLA 2GAGB 2XVIA 4A99A 2C66A 1IUVA 3VR8A 2DKHA 2YLWA 1JU2A 3K7QX 3AEAA 3SYIA 2XFUA 4PABA 4Z43A 2WDRA 5L46A 1EL8A 3CNDA 3AE2A 3DK8A 1V59A 1TYTA 3AE3A 2IIDA 3H8LA 5CQFA 1CJCA 2VVLA 1TDOA 1EL9A 3E1TA 4MJWA 4PAAA 4RSLA 5KMRA 3V76A 1DODA 2C3DA 3AEBA 3CNJA 3CPHG 1CF3A 3P4QA 1ZMCA 2JK6A 2OLNA 1B37A 2BXSA 2FBWA 2WU2A 1H81A 4EMIA 4TM4A 4RG3A 4EIPA 4AOSA 1OJAA 1PBEA 1GREA 1E1LA 3M12A 2YR6A 4JNQA 3UTFA 1N4UA 2WPFA 4E0VA 3CMMA 2TMDA 3CNTA 3NK1X 3RP6A 3NKSA 4JY3A 1FEBA 1ELIA 4HA6A 2GQWA 2XVJA 1IUWA 1QO8A 3H4KA 3OZ2A 2FJDA 4CNKA 2BK3A 2BYBA 2BS2A 1TYPA 2GH5A 4G6GA 3QSSA 1EBDA 1N4VA 3GWDA 1PXBA 1D4DA 4ZCCA 4C3XA 5KVIA 1FCDA 2E5VA 4EQWA 3KU9A 4TLZA 3AE5A 5KOXA 2RGHA 3FBSA 3LOVA 4JNAA 4LIIA 2R0PA 3BNMA 3GMBA 3CGBA 2WDQA 1N4WA 2Z5XA 4KPRA 3UKFA 5KMSA 5IPYA 1PBCA 4U2LA 5JCMA 2WOWA 2WOVA 4CCQA 1DJQA 1L9DA 3CNSA 4YTMA 1DNCA 2OALA 1OJ9A 1P2HA 1YY5A 4G6HA 2YG7A 4U2SA 4U8MA 2QAEA 1PJ5A 2BXRA 2ZZ0A 2GV8A 1TRBA 2WP9A 1XPQA 5KWFA 3Q9TA 4K5SA 3AWIA 3HZLA 4JQ9A 4U8IA 1GTEA 1TDKA 2RGJA 2VVLG 2APGA 1JEHA 1H84A 3NTDA 4B66A 4Z2RA 3AE6A 2GAHB 2R46A 1P2EA 3NRNA 4AP1A 3ZDNA 2EQ6A 4G9KA 3CPIG 1FL2A 2XLRA 1EL5A 2FJEA 3HYVA 2VZ2A 4UDRA 5FS8A 3NLCA 3AEEA 1JNZA 3REDA 3P4RA 1S3BA 4IA5A 1M6IA 3SQPA 3K30A 2R9ZA 3P4SA 4J31A 5JCNA 1GT8A 2VOUA 3DA1A 3L1RA 1COYA 1PBDA 3SGLA 4A5LA 1EL7A 2X8GA 4H2NA 4EMJA 4EQSA 3ATRA 2E1MA 2RABA 3KKJA 2WBAA 3SM8A 2O9ZA 2Q7VA 2YG4A 4YSHA 2R4EA 1NEKA 2TPRA 1IUXA 2BS3A 3D8XA 4U8JA 4II3A 1GEUA 2NPXA 2GMHA 1LQTA 4APNA 3LXDA 1FEAA 2A87A 3UTEA 3UOXA 4G74A 1GRTA 2WEUA 3NYEA 2C4CA 3C4NA 3UKPA 1H82A 4Z2UA 4HB9A 1E6EA 1GRAA 2WS3A 3ALLA 4Y4NA 3GRTA 3NN6X 2CFYA 3UKQA 4FK1A 3BHKA 2Q6UA 1GV4A 1PJ7A 4K8DA 4Z26A 2WDVA 3KLJA 4CCRA 3M0OA 1IUTA 3ALJA 3CGDA 3UOYA 1GETA 2Q0LA 1BGJA 3CIRA 3JSKA 3UP4A 3DJDA 1DOEA 4YTNA 1L9CA 1Y0PA 3T2ZA 1H7XA 4A79A 4UDPA 2BA9A 5JCLA 3CTYA 2YQUA
chains in the Genus database with same CATH topology
2R0CA 2GR0A 1JOAA 2R45A 3NNEA 3SFEA 2HQMA 4H4QA 4P9SA 4B69A 2C7GA 2B9WA 3SZWA 4CRTA 5JCKA 3DMEA 1BWCA 3G5SA 3PO7A 1BF3A 2C75A 3B3RA 2FJAA 3IHMA 4H50A 3T37A 2GF3A 1B4VA 2XLUA 4H4UA 2JB2A 3G5RA 3CNPA 4M52A 4N9XA 3UOVA 4B63A 1ZX9A 3UTHA 4IV9A 2E4GA 4U8PA 1H86A 1NG4A 3AYJA 4EQXA 1OJDA 2GR3A 1PBBA 3PVCA 2WETA 5EB5A 4YWOA 4A65A 2R0GA 5KMQA 1YQ3A 4O5UA 4NWZA 4XWZA 3AE4A 2YLTA 5KVHA 4Z25A 4UP3A 1CC4A 1MOKA 2C65A 3IC9A 3WE0A 1PDHA 1PBFA 1OJTA 3GD3A 1CBOA 3QJ4A 2JKCA 4XWRA 4Z44A 3EPTA 3AE1A 3BNUA 1D4EA 3PS9A 4O5QA 1D7YA 3GD4A 3NG7X 1Y56A 3C4AA 2B9XA 4FK1C 3QVPA 2GMJA 3DJEA 3FMWA 1W4XA 4H4ZA 4H2PA 1VDCA 5HYMA 4EM4A 2ZZCA 3BI2A 2IVDA 5BVAA 4H4SA 1ZP0A 2WP6A 3URHA 5KNLA 2BCPA 3NGCX 4D03A 2XFOA 4YKFA 2JB3A 3RNMA 1JRYA 1XDIA 3FPZA 3RHAA 1GRBA 2CDUA 2VRLA 4NEVA 1E7PA 3NK2X 1VG9A 4FX9A 2XCGA 1B5QA 4AT2A 1KSUA 1NHRA 1KF6A 3IF9A 4ECHA 1KFYA 1OJCA 2YLZA 2C76A 3QFAA 4RG4A 1PN0A 2JAEA 3NN0X 1PHHA 1RP0A 2ARDA 1TDNA 2JBVA 4H4WA 3RP8A 4A6NA 1BKWA 1S2QA 2XFQA 2VRMA 2XVHA 2B7SA 4B67A 2OAMA 5BUKA 4G73A 3II4A 1ZDLA 5C2TA 3EAOA 3LJPA 4TLXA 4BK1A 1K0IA 3AYIA 2CVJA 3SXIA 4Y4MA 1F8WA 2BK5A 5FS9A 3R9UA 3GYJA 4GAVA 4U8KA 4D04A 4BJZA 3UTGA 4A9WA 4GUVA 3ALMA 4EIQA 4Z2TA 5LV9A 3C96A 2BC0A 3BI4A 1GALA 4H2QA 5U63A 4YXDA 1F3PA 4C77A 2ZBWA 3UKAA 4H7UA 3P4PA 5FS7A 3LB8A 2C73A 4OCGA 2YAUA 2ZZBA 1NHQA 2WPCA 3SY4A 3UKHA 4C5OA 1REOA 2W0HA 3Q6JA 3QFBA 1GOSA 4OPCA 5ER0A 2C72A 1Y56B 3V3NA 3AD8B 5EOWA 4J36A 3GDNA 2C67A 2UZZA 3LZWA 3UCLA 5U25A 3UKKA 2YWLA 1O95A 3L8KA 3ITJA 2C64A 2OA1A 3ISHA 2J3NA 3G5QA 4CBQA 1Q9IA 1TDFA 5BULA 4USQA 3GYIA 4REKA 4YSXA 2AQJA 4Y4LA 3AXBA 3NT6A 4LA1A 1NHSA 3NIXA 1JRXA 2X3NA 1CJ2A 1CC6A 1YQZA 1X31B 2XLSA 3DGHA 1XHCA 4AOXA 2B7RA 2V3AA 2YVJA 1XANA 3AE7A 2YVGA 3SX6A 1ZK7A 3DJGX 1FECA 4U8OA 3B6DA 3AE8A 4K7ZA 4WCTA 2RGOA 1NAAA 1NPXA 4GDPA 4H4YA 3SZ0A 4GCMA 4GF7A 4H4TA 4BJYA 4H4XA 1JRZA 4J34A 3KD9A 1ZOYA 4BURA 3SZCA 1CHUA 2XFNA 4ADWA 4OPUA 3T2YA 3NYCA 4WX1A 4LU6A 2C3CA 4IA6A 3T0KA 2BABA 1QLBA 2X8CA 4B64A 1PJ6A 1VQWA 2FJBA 2V61A 3AD7B 3I3LA 3CGCA 3QSEA 1TDEA 4GR1A 4DSGA 1BZLA 3HYWA 4EMWA 2EQ8A 1D7LA 2XLTA 1DOCA 1CL0A 2XDOA 3VRDB 4JDRA 1ZMDA 2PYXA 4X9NA 2XLPA 5U1OA 2PHHA 3P9UA 1CJ3A 2X8HA 1JNRA 1MO9A 1NDAA 2GB0A 2GVCA 3NH3X 1O94A 4NNJA 1K0JA 1L0VA 5C3JA 4B65A 3AB1A 2AR8A 3UKLA 2EQ7A 3UP5A 3SFDA 3K7MX 2X50A 1FOHA 1NHPA 4IVOB 2A89A 4K5RA 3FIMB 5J7XA 1PXAA 1ONFA 1KDGA 3COXA 2VQBA 4J57A 4BK3A 1PS9A 5BRTA 1YKJA 5M0ZA 1LPFA 2YG6A 3DGZA 4J2WA 3VRBA 2H88A 3VRAA 2YM1A 4CNJA 3OC4A 4NTCA 5IQ1A 4C74A 1F8SA 3GSIA 3KPKA 3NK0X 2OLOA 1BGNA 4YSZA 1D5TA 5GSNA 3ADAB 2V60A 5KXJA 5M10A 3ZYXA 2XVEA 5TR3A 2XFPA 4UDQA 2XVFA 3GDPA 4EM3A 4YTPA 4JY2A 1N1PA 2WP5A 2BCGG 3T14A 2YR4A 2X99A 4EQRA 2Y6QA 2QCUA 5DBJA 3DK4A 4X9MA 3ABVA 2H89A 1IUSA 4DGKA 1GRFA 3S61A 4YKGA 1F8RA 1IUUA 2YLSA 1LTXR 1GRHA 4U8LA 2YLRA 2Y6RA 3T31A 3KPFA 4YT0A 4GRTA 1UKVG 3I6DA 5HHFA 5IQ4A 5EB4A 5EBKA 2WOIA 4A6NB 5HXIA 2JB1A 2XYOA 4B1BA 4BV6A 2F5ZA 1B8SA 5KMPA 5GRTA 1KNPA 4NTDA 2YVFA 1GXFA 2YR5A 1LQUA 5CKUA 3S5WA 3V3OA 4CY6A 1ZOVA 1O5WA 2VVMA 4AT0A 2BACA 3CGEA 4DSHA 1E1KA 3DJJA 2R4JA 3VR9A 4DNAA 1HYUA 2QA1A 2VQ7A 4JN9A 4FDCB 4A7AA 3GMCA 3P1WA 4U8NA 3NYFA 3K7TA 1DJNA 2Z5YA 2GR2A 4ZN0A 1GPEA 2BRAA 1D4CA 1K4QA 3AD9B 4XXGA 4J33A 1MXTA 3T2KA 3LZXA 1GNDA 4TM3A 2GRTA 2WPEA 1SEZA 4YSYA 5HY5A 5J60A 2NVKX 4GDEA 5FS6A 1ZKQA 5FMHA 3FG2P 1L9EA 1K0LA 4IVMB 4TM1A 2AAQA 1GTHA 2V3BA 3QSMA 4K22A 3LADA 4USRA 4NTEA 4BK2A 1Q1WA 3AECA 1DOBA 1VRQB 2YG3A 4GAPA 4II2A 4K2XA 2WESA 4B68A 1E1MA 3VQRA 2DKIA 3ICRA 3NHOX 1M64A 3ATQA 3D1CA 4H2RA 3ICSA 2B9YA 1CJ4A 3EANA 1GRGA 2C70A 1PXCA 3BI5A 4H4RA 1NENA 3BHFA 3GWFA 1H6VA 2CULA 4OPTA 4TM0A 3HYXA 2GQFA 2BS4A 1GERA 1Q1RA 4KX6A 1LJ1A 2BC1A 1LVLA 4NEWA 3AEGA 4J56A 2Q0KA 4OPGA 2WU5A 3AEFA 3F8RA 4NZHA 3GYXA 4H4PA 3CPJG 3DH9A 3SZFA 4C3YA 2BRYA 3M13A 1E1NA 2GR1A 2A8XA 1Z6LA 2QA2A 1KSSA 2V6OA 1RSGA 2YM2A 1KNRA 1RYIA 4H4VA 1H7WA 2I0ZA 2GEWA 4Z24A 1CC2A 1NG3A 1ZY8A 5JCIA 2BK4A 1E39A 4ICYA 3IHGA 3NTAA 1AOGA 3RP7A 1F6MA 4CY8A 3F8DA 3IWAA 4I59A 4U2TA 3EF6A 1GSNA 2YG5A 1S3EA 2ACZA 2YLXA 2WHDA 2V5ZA 3F8PA 4AP3A 2WQYA 2B76A 2EQ9A 4OVIA 2IVEA 3KA7A 3AE9A 3ICTA 4I58A 1YQ4A 3QVRA 4ZCDA 4OPDA 3AEDA 3DK9A 3KVEA 3UOZA 3CN8A 1VG0A 3O0HA 5KOWA 1GESA 3GRSA 1QJDA 3H8IA 1IJHA 3AYLA 4OPIA 5KRQA 1H83A 1LV0A 1S2YA 4X4JA 1DXLA 4OPLA 2GAGB 2XVIA 4A99A 2C66A 1IUVA 3VR8A 2DKHA 2YLWA 1JU2A 3K7QX 3AEAA 3SYIA 2XFUA 4PABA 4Z43A 2WDRA 5L46A 1EL8A 3CNDA 3AE2A 3DK8A 1V59A 1TYTA 3AE3A 2IIDA 3H8LA 5CQFA 1CJCA 2VVLA 1TDOA 1EL9A 3E1TA 4MJWA 4PAAA 4RSLA 5KMRA 3V76A 1DODA 2C3DA 3AEBA 3CNJA 3CPHG 1CF3A 3P4QA 1ZMCA 2JK6A 2OLNA 1B37A 2BXSA 2FBWA 2WU2A 1H81A 4EMIA 4TM4A 4RG3A 4EIPA 4AOSA 1OJAA 1PBEA 1GREA 1E1LA 3M12A 2YR6A 4JNQA 3UTFA 1N4UA 2WPFA 4E0VA 3CMMA 2TMDA 3CNTA 3NK1X 3RP6A 3NKSA 4JY3A 1FEBA 1ELIA 4HA6A 2GQWA 2XVJA 1IUWA 1QO8A 3H4KA 3OZ2A 2FJDA 4CNKA 2BK3A 2BYBA 2BS2A 1TYPA 2GH5A 4G6GA 3QSSA 1EBDA 1N4VA 3GWDA 1PXBA 1D4DA 4ZCCA 4C3XA 5KVIA 1FCDA 2E5VA 4EQWA 3KU9A 4TLZA 3AE5A 5KOXA 2RGHA 3FBSA 3LOVA 4JNAA 4LIIA 2R0PA 3BNMA 3GMBA 3CGBA 2WDQA 1N4WA 2Z5XA 4KPRA 3UKFA 5KMSA 5IPYA 1PBCA 4U2LA 5JCMA 2WOWA 2WOVA 4CCQA 1DJQA 1L9DA 3CNSA 4YTMA 1DNCA 2OALA 1OJ9A 1P2HA 1YY5A 4G6HA 2YG7A 4U2SA 4U8MA 2QAEA 1PJ5A 2BXRA 2ZZ0A 2GV8A 1TRBA 2WP9A 1XPQA 5KWFA 3Q9TA 4K5SA 3AWIA 3HZLA 4JQ9A 4U8IA 1GTEA 1TDKA 2RGJA 2VVLG 2APGA 1JEHA 1H84A 3NTDA 4B66A 4Z2RA 3AE6A 2GAHB 2R46A 1P2EA 3NRNA 4AP1A 3ZDNA 2EQ6A 4G9KA 3CPIG 1FL2A 2XLRA 1EL5A 2FJEA 3HYVA 2VZ2A 4UDRA 5FS8A 3NLCA 3AEEA 1JNZA 3REDA 3P4RA 1S3BA 4IA5A 1M6IA 3SQPA 3K30A 2R9ZA 3P4SA 4J31A 5JCNA 1GT8A 2VOUA 3DA1A 3L1RA 1COYA 1PBDA 3SGLA 4A5LA 1EL7A 2X8GA 4H2NA 4EMJA 4EQSA 3ATRA 2E1MA 2RABA 3KKJA 2WBAA 3SM8A 2O9ZA 2Q7VA 2YG4A 4YSHA 2R4EA 1NEKA 2TPRA 1IUXA 2BS3A 3D8XA 4U8JA 4II3A 1GEUA 2NPXA 2GMHA 1LQTA 4APNA 3LXDA 1FEAA 2A87A 3UTEA 3UOXA 4G74A 1GRTA 2WEUA 3NYEA 2C4CA 3C4NA 3UKPA 1H82A 4Z2UA 4HB9A 1E6EA 1GRAA 2WS3A 3ALLA 4Y4NA 3GRTA 3NN6X 2CFYA 3UKQA 4FK1A 3BHKA 2Q6UA 1GV4A 1PJ7A 4K8DA 4Z26A 2WDVA 3KLJA 4CCRA 3M0OA 1IUTA 3ALJA 3CGDA 3UOYA 1GETA 2Q0LA 1BGJA 3CIRA 3JSKA 3UP4A 3DJDA 1DOEA 4YTNA 1L9CA 1Y0PA 3T2ZA 1H7XA 4A79A 4UDPA 2BA9A 5JCLA 3CTYA 2YQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T2Y A;  4G9K A;  3T14 A;  3SZW A;  3HYV A;  3T0K A;  4G74 A;  5KMS A;  3HYX A;  3SYI A;  3T2K A;  3SY4 A;  3HYW A;  4G6G A;  3T31 A;  4G6H A;  3SZF A;  3SX6 A;  4G73 A;  5KMR A;  3KPK A;  5KMP A;  3SZ0 A;  3SXI A;  3T2Z A;  3SZC A;  4GAP A;  4GAV A;  5KMQ A;  4NWZ A; 
#chains in the Genus database with same CATH topology
 2R0C A;  2GR0 A;  1JOA A;  2R45 A;  3NNE A;  3SFE A;  2HQM A;  4H4Q A;  4P9S A;  4B69 A;  2C7G A;  2B9W A;  3SZW A;  4CRT A;  5JCK A;  3DME A;  1BWC A;  3G5S A;  3PO7 A;  1BF3 A;  2C75 A;  3B3R A;  2FJA A;  3IHM A;  4H50 A;  3T37 A;  2GF3 A;  1B4V A;  2XLU A;  4H4U A;  2JB2 A;  3G5R A;  3CNP A;  4M52 A;  4N9X A;  3UOV A;  4B63 A;  1ZX9 A;  3UTH A;  4IV9 A;  2E4G A;  4U8P A;  1H86 A;  1NG4 A;  3AYJ A;  4EQX A;  1OJD A;  2GR3 A;  1PBB A;  3PVC A;  2WET A;  5EB5 A;  4YWO A;  4A65 A;  2R0G A;  5KMQ A;  1YQ3 A;  4O5U A;  4NWZ A;  4XWZ A;  3AE4 A;  2YLT A;  5KVH A;  4Z25 A;  4UP3 A;  1CC4 A;  1MOK A;  2C65 A;  3IC9 A;  3WE0 A;  1PDH A;  1PBF A;  1OJT A;  3GD3 A;  1CBO A;  3QJ4 A;  2JKC A;  4XWR A;  4Z44 A;  3EPT A;  3AE1 A;  3BNU A;  1D4E A;  3PS9 A;  4O5Q A;  1D7Y A;  3GD4 A;  3NG7 X;  1Y56 A;  3C4A A;  2B9X A;  4FK1 C;  3QVP A;  2GMJ A;  3DJE A;  3FMW A;  1W4X A;  4H4Z A;  4H2P A;  1VDC A;  5HYM A;  4EM4 A;  2ZZC A;  3BI2 A;  2IVD A;  5BVA A;  4H4S A;  1ZP0 A;  2WP6 A;  3URH A;  5KNL A;  2BCP A;  3NGC X;  4D03 A;  2XFO A;  4YKF A;  2JB3 A;  3RNM A;  1JRY A;  1XDI A;  3FPZ A;  3RHA A;  1GRB A;  2CDU A;  2VRL A;  4NEV A;  1E7P A;  3NK2 X;  1VG9 A;  4FX9 A;  2XCG A;  1B5Q A;  4AT2 A;  1KSU A;  1NHR A;  1KF6 A;  3IF9 A;  4ECH A;  1KFY A;  1OJC A;  2YLZ A;  2C76 A;  3QFA A;  4RG4 A;  1PN0 A;  2JAE A;  3NN0 X;  1PHH A;  1RP0 A;  2ARD A;  1TDN A;  2JBV A;  4H4W A;  3RP8 A;  4A6N A;  1BKW A;  1S2Q A;  2XFQ A;  2VRM A;  2XVH A;  2B7S A;  4B67 A;  2OAM A;  5BUK A;  4G73 A;  3II4 A;  1ZDL A;  5C2T A;  3EAO A;  3LJP A;  4TLX A;  4BK1 A;  1K0I A;  3AYI A;  2CVJ A;  3SXI A;  4Y4M A;  1F8W A;  2BK5 A;  5FS9 A;  3R9U A;  3GYJ A;  4GAV A;  4U8K A;  4D04 A;  4BJZ A;  3UTG A;  4A9W A;  4GUV A;  3ALM A;  4EIQ A;  4Z2T A;  5LV9 A;  3C96 A;  2BC0 A;  3BI4 A;  1GAL A;  4H2Q A;  5U63 A;  4YXD A;  1F3P A;  4C77 A;  2ZBW A;  3UKA A;  4H7U A;  3P4P A;  5FS7 A;  3LB8 A;  2C73 A;  4OCG A;  2YAU A;  2ZZB A;  1NHQ A;  2WPC A;  3SY4 A;  3UKH A;  4C5O A;  1REO A;  2W0H A;  3Q6J A;  3QFB A;  1GOS A;  4OPC A;  5ER0 A;  2C72 A;  1Y56 B;  3V3N A;  3AD8 B;  5EOW A;  4J36 A;  3GDN A;  2C67 A;  2UZZ A;  3LZW A;  3UCL A;  5U25 A;  3UKK A;  2YWL A;  1O95 A;  3L8K A;  3ITJ A;  2C64 A;  2OA1 A;  3ISH A;  2J3N A;  3G5Q A;  4CBQ A;  1Q9I A;  1TDF A;  5BUL A;  4USQ A;  3GYI A;  4REK A;  4YSX A;  2AQJ A;  4Y4L A;  3AXB A;  3NT6 A;  4LA1 A;  1NHS A;  3NIX A;  1JRX A;  2X3N A;  1CJ2 A;  1CC6 A;  1YQZ A;  1X31 B;  2XLS A;  3DGH A;  1XHC A;  4AOX A;  2B7R A;  2V3A A;  2YVJ A;  1XAN A;  3AE7 A;  2YVG A;  3SX6 A;  1ZK7 A;  3DJG X;  1FEC A;  4U8O A;  3B6D A;  3AE8 A;  4K7Z A;  4WCT A;  2RGO A;  1NAA A;  1NPX A;  4GDP A;  4H4Y A;  3SZ0 A;  4GCM A;  4GF7 A;  4H4T A;  4BJY A;  4H4X A;  1JRZ A;  4J34 A;  3KD9 A;  1ZOY A;  4BUR A;  3SZC A;  1CHU A;  2XFN A;  4ADW A;  4OPU A;  3T2Y A;  3NYC A;  4WX1 A;  4LU6 A;  2C3C A;  4IA6 A;  3T0K A;  2BAB A;  1QLB A;  2X8C A;  4B64 A;  1PJ6 A;  1VQW A;  2FJB A;  2V61 A;  3AD7 B;  3I3L A;  3CGC A;  3QSE A;  1TDE A;  4GR1 A;  4DSG A;  1BZL A;  3HYW A;  4EMW A;  2EQ8 A;  1D7L A;  2XLT A;  1DOC A;  1CL0 A;  2XDO A;  3VRD B;  4JDR A;  1ZMD A;  2PYX A;  4X9N A;  2XLP A;  5U1O A;  2PHH A;  3P9U A;  1CJ3 A;  2X8H A;  1JNR A;  1MO9 A;  1NDA A;  2GB0 A;  2GVC A;  3NH3 X;  1O94 A;  4NNJ A;  1K0J A;  1L0V A;  5C3J A;  4B65 A;  3AB1 A;  2AR8 A;  3UKL A;  2EQ7 A;  3UP5 A;  3SFD A;  3K7M X;  2X50 A;  1FOH A;  1NHP A;  4IVO B;  2A89 A;  4K5R A;  3FIM B;  5J7X A;  1PXA A;  1ONF A;  1KDG A;  3COX A;  2VQB A;  4J57 A;  4BK3 A;  1PS9 A;  5BRT A;  1YKJ A;  5M0Z A;  1LPF A;  2YG6 A;  3DGZ A;  4J2W A;  3VRB A;  2H88 A;  3VRA A;  2YM1 A;  4CNJ A;  3OC4 A;  4NTC A;  5IQ1 A;  4C74 A;  1F8S A;  3GSI A;  3KPK A;  3NK0 X;  2OLO A;  1BGN A;  4YSZ A;  1D5T A;  5GSN A;  3ADA B;  2V60 A;  5KXJ A;  5M10 A;  3ZYX A;  2XVE A;  5TR3 A;  2XFP A;  4UDQ A;  2XVF A;  3GDP A;  4EM3 A;  4YTP A;  4JY2 A;  1N1P A;  2WP5 A;  2BCG G;  3T14 A;  2YR4 A;  2X99 A;  4EQR A;  2Y6Q A;  2QCU A;  5DBJ A;  3DK4 A;  4X9M A;  3ABV A;  2H89 A;  1IUS A;  4DGK A;  1GRF A;  3S61 A;  4YKG A;  1F8R A;  1IUU A;  2YLS A;  1LTX R;  1GRH A;  4U8L A;  2YLR A;  2Y6R A;  3T31 A;  3KPF A;  4YT0 A;  4GRT A;  1UKV G;  3I6D A;  5HHF A;  5IQ4 A;  5EB4 A;  5EBK A;  2WOI A;  4A6N B;  5HXI A;  2JB1 A;  2XYO A;  4B1B A;  4BV6 A;  2F5Z A;  1B8S A;  5KMP A;  5GRT A;  1KNP A;  4NTD A;  2YVF A;  1GXF A;  2YR5 A;  1LQU A;  5CKU A;  3S5W A;  3V3O A;  4CY6 A;  1ZOV A;  1O5W A;  2VVM A;  4AT0 A;  2BAC A;  3CGE A;  4DSH A;  1E1K A;  3DJJ A;  2R4J A;  3VR9 A;  4DNA A;  1HYU A;  2QA1 A;  2VQ7 A;  4JN9 A;  4FDC B;  4A7A A;  3GMC A;  3P1W A;  4U8N A;  3NYF A;  3K7T A;  1DJN A;  2Z5Y A;  2GR2 A;  4ZN0 A;  1GPE A;  2BRA A;  1D4C A;  1K4Q A;  3AD9 B;  4XXG A;  4J33 A;  1MXT A;  3T2K A;  3LZX A;  1GND A;  4TM3 A;  2GRT A;  2WPE A;  1SEZ A;  4YSY A;  5HY5 A;  5J60 A;  2NVK X;  4GDE A;  5FS6 A;  1ZKQ A;  5FMH A;  3FG2 P;  1L9E A;  1K0L A;  4IVM B;  4TM1 A;  2AAQ A;  1GTH A;  2V3B A;  3QSM A;  4K22 A;  3LAD A;  4USR A;  4NTE A;  4BK2 A;  1Q1W A;  3AEC A;  1DOB A;  1VRQ B;  2YG3 A;  4GAP A;  4II2 A;  4K2X A;  2WES A;  4B68 A;  1E1M A;  3VQR A;  2DKI A;  3ICR A;  3NHO X;  1M64 A;  3ATQ A;  3D1C A;  4H2R A;  3ICS A;  2B9Y A;  1CJ4 A;  3EAN A;  1GRG A;  2C70 A;  1PXC A;  3BI5 A;  4H4R A;  1NEN A;  3BHF A;  3GWF A;  1H6V A;  2CUL A;  4OPT A;  4TM0 A;  3HYX A;  2GQF A;  2BS4 A;  1GER A;  1Q1R A;  4KX6 A;  1LJ1 A;  2BC1 A;  1LVL A;  4NEW A;  3AEG A;  4J56 A;  2Q0K A;  4OPG A;  2WU5 A;  3AEF A;  3F8R A;  4NZH A;  3GYX A;  4H4P A;  3CPJ G;  3DH9 A;  3SZF A;  4C3Y A;  2BRY A;  3M13 A;  1E1N A;  2GR1 A;  2A8X A;  1Z6L A;  2QA2 A;  1KSS A;  2V6O A;  1RSG A;  2YM2 A;  1KNR A;  1RYI A;  4H4V A;  1H7W A;  2I0Z A;  2GEW A;  4Z24 A;  1CC2 A;  1NG3 A;  1ZY8 A;  5JCI A;  2BK4 A;  1E39 A;  4ICY A;  3IHG A;  3NTA A;  1AOG A;  3RP7 A;  1F6M A;  4CY8 A;  3F8D A;  3IWA A;  4I59 A;  4U2T A;  3EF6 A;  1GSN A;  2YG5 A;  1S3E A;  2ACZ A;  2YLX A;  2WHD A;  2V5Z A;  3F8P A;  4AP3 A;  2WQY A;  2B76 A;  2EQ9 A;  4OVI A;  2IVE A;  3KA7 A;  3AE9 A;  3ICT A;  4I58 A;  1YQ4 A;  3QVR A;  4ZCD A;  4OPD A;  3AED A;  3DK9 A;  3KVE A;  3UOZ A;  3CN8 A;  1VG0 A;  3O0H A;  5KOW A;  1GES A;  3GRS A;  1QJD A;  3H8I A;  1IJH A;  3AYL A;  4OPI A;  5KRQ A;  1H83 A;  1LV0 A;  1S2Y A;  4X4J A;  1DXL A;  4OPL A;  2GAG B;  2XVI A;  4A99 A;  2C66 A;  1IUV A;  3VR8 A;  2DKH A;  2YLW A;  1JU2 A;  3K7Q X;  3AEA A;  3SYI A;  2XFU A;  4PAB A;  4Z43 A;  2WDR A;  5L46 A;  1EL8 A;  3CND A;  3AE2 A;  3DK8 A;  1V59 A;  1TYT A;  3AE3 A;  2IID A;  3H8L A;  5CQF A;  1CJC A;  2VVL A;  1TDO A;  1EL9 A;  3E1T A;  4MJW A;  4PAA A;  4RSL A;  5KMR A;  3V76 A;  1DOD A;  2C3D A;  3AEB A;  3CNJ A;  3CPH G;  1CF3 A;  3P4Q A;  1ZMC A;  2JK6 A;  2OLN A;  1B37 A;  2BXS A;  2FBW A;  2WU2 A;  1H81 A;  4EMI A;  4TM4 A;  4RG3 A;  4EIP A;  4AOS A;  1OJA A;  1PBE A;  1GRE A;  1E1L A;  3M12 A;  2YR6 A;  4JNQ A;  3UTF A;  1N4U A;  2WPF A;  4E0V A;  3CMM A;  2TMD A;  3CNT A;  3NK1 X;  3RP6 A;  3NKS A;  4JY3 A;  1FEB A;  1ELI A;  4HA6 A;  2GQW A;  2XVJ A;  1IUW A;  1QO8 A;  3H4K A;  3OZ2 A;  2FJD A;  4CNK A;  2BK3 A;  2BYB A;  2BS2 A;  1TYP A;  2GH5 A;  4G6G A;  3QSS A;  1EBD A;  1N4V A;  3GWD A;  1PXB A;  1D4D A;  4ZCC A;  4C3X A;  5KVI A;  1FCD A;  2E5V A;  4EQW A;  3KU9 A;  4TLZ A;  3AE5 A;  5KOX A;  2RGH A;  3FBS A;  3LOV A;  4JNA A;  4LII A;  2R0P A;  3BNM A;  3GMB A;  3CGB A;  2WDQ A;  1N4W A;  2Z5X A;  4KPR A;  3UKF A;  5KMS A;  5IPY A;  1PBC A;  4U2L A;  5JCM A;  2WOW A;  2WOV A;  4CCQ A;  1DJQ A;  1L9D A;  3CNS A;  4YTM A;  1DNC A;  2OAL A;  1OJ9 A;  1P2H A;  1YY5 A;  4G6H A;  2YG7 A;  4U2S A;  4U8M A;  2QAE A;  1PJ5 A;  2BXR A;  2ZZ0 A;  2GV8 A;  1TRB A;  2WP9 A;  1XPQ A;  5KWF A;  3Q9T A;  4K5S A;  3AWI A;  3HZL A;  4JQ9 A;  4U8I A;  1GTE A;  1TDK A;  2RGJ A;  2VVL G;  2APG A;  1JEH A;  1H84 A;  3NTD A;  4B66 A;  4Z2R A;  3AE6 A;  2GAH B;  2R46 A;  1P2E A;  3NRN A;  4AP1 A;  3ZDN A;  2EQ6 A;  4G9K A;  3CPI G;  1FL2 A;  2XLR A;  1EL5 A;  2FJE A;  3HYV A;  2VZ2 A;  4UDR A;  5FS8 A;  3NLC A;  3AEE A;  1JNZ A;  3RED A;  3P4R A;  1S3B A;  4IA5 A;  1M6I A;  3SQP A;  3K30 A;  2R9Z A;  3P4S A;  4J31 A;  5JCN A;  1GT8 A;  2VOU A;  3DA1 A;  3L1R A;  1COY A;  1PBD A;  3SGL A;  4A5L A;  1EL7 A;  2X8G A;  4H2N A;  4EMJ A;  4EQS A;  3ATR A;  2E1M A;  2RAB A;  3KKJ A;  2WBA A;  3SM8 A;  2O9Z A;  2Q7V A;  2YG4 A;  4YSH A;  2R4E A;  1NEK A;  2TPR A;  1IUX A;  2BS3 A;  3D8X A;  4U8J A;  4II3 A;  1GEU A;  2NPX A;  2GMH A;  1LQT A;  4APN A;  3LXD A;  1FEA A;  2A87 A;  3UTE A;  3UOX A;  4G74 A;  1GRT A;  2WEU A;  3NYE A;  2C4C A;  3C4N A;  3UKP A;  1H82 A;  4Z2U A;  4HB9 A;  1E6E A;  1GRA A;  2WS3 A;  3ALL A;  4Y4N A;  3GRT A;  3NN6 X;  2CFY A;  3UKQ A;  4FK1 A;  3BHK A;  2Q6U A;  1GV4 A;  1PJ7 A;  4K8D A;  4Z26 A;  2WDV A;  3KLJ A;  4CCR A;  3M0O A;  1IUT A;  3ALJ A;  3CGD A;  3UOY A;  1GET A;  2Q0L A;  1BGJ A;  3CIR A;  3JSK A;  3UP4 A;  3DJD A;  1DOE A;  4YTN A;  1L9C A;  1Y0P A;  3T2Z A;  1H7X A;  4A79 A;  4UDP A;  2BA9 A;  5JCL A;  3CTY A;  2YQU A; 
#chains in the Genus database with same CATH homology
 2R0C A;  2GR0 A;  1JOA A;  2R45 A;  3NNE A;  3SFE A;  2HQM A;  4H4Q A;  4P9S A;  4B69 A;  2C7G A;  2B9W A;  3SZW A;  4CRT A;  5JCK A;  3DME A;  1BWC A;  3G5S A;  3PO7 A;  1BF3 A;  2C75 A;  3B3R A;  2FJA A;  3IHM A;  4H50 A;  3T37 A;  2GF3 A;  1B4V A;  2XLU A;  4H4U A;  2JB2 A;  3G5R A;  3CNP A;  4M52 A;  4N9X A;  3UOV A;  4B63 A;  1ZX9 A;  3UTH A;  4IV9 A;  2E4G A;  4U8P A;  1H86 A;  1NG4 A;  3AYJ A;  4EQX A;  1OJD A;  2GR3 A;  1PBB A;  3PVC A;  2WET A;  5EB5 A;  4YWO A;  4A65 A;  2R0G A;  5KMQ A;  1YQ3 A;  4O5U A;  4NWZ A;  4XWZ A;  3AE4 A;  2YLT A;  5KVH A;  4Z25 A;  4UP3 A;  1CC4 A;  1MOK A;  2C65 A;  3IC9 A;  3WE0 A;  1PDH A;  1PBF A;  1OJT A;  3GD3 A;  1CBO A;  3QJ4 A;  2JKC A;  4XWR A;  4Z44 A;  3EPT A;  3AE1 A;  3BNU A;  1D4E A;  3PS9 A;  4O5Q A;  1D7Y A;  3GD4 A;  3NG7 X;  1Y56 A;  3C4A A;  2B9X A;  4FK1 C;  3QVP A;  2GMJ A;  3DJE A;  3FMW A;  1W4X A;  4H4Z A;  4H2P A;  1VDC A;  5HYM A;  4EM4 A;  2ZZC A;  3BI2 A;  2IVD A;  5BVA A;  4H4S A;  1ZP0 A;  2WP6 A;  3URH A;  5KNL A;  2BCP A;  3NGC X;  4D03 A;  2XFO A;  4YKF A;  2JB3 A;  3RNM A;  1JRY A;  1XDI A;  3FPZ A;  3RHA A;  1GRB A;  2CDU A;  2VRL A;  4NEV A;  1E7P A;  3NK2 X;  1VG9 A;  4FX9 A;  2XCG A;  1B5Q A;  4AT2 A;  1KSU A;  1NHR A;  1KF6 A;  3IF9 A;  4ECH A;  1KFY A;  1OJC A;  2YLZ A;  2C76 A;  3QFA A;  4RG4 A;  1PN0 A;  2JAE A;  3NN0 X;  1PHH A;  1RP0 A;  2ARD A;  1TDN A;  2JBV A;  4H4W A;  3RP8 A;  4A6N A;  1BKW A;  1S2Q A;  2XFQ A;  2VRM A;  2XVH A;  2B7S A;  4B67 A;  2OAM A;  5BUK A;  4G73 A;  3II4 A;  1ZDL A;  5C2T A;  3EAO A;  3LJP A;  4TLX A;  4BK1 A;  1K0I A;  3AYI A;  2CVJ A;  3SXI A;  4Y4M A;  1F8W A;  2BK5 A;  5FS9 A;  3R9U A;  3GYJ A;  4GAV A;  4U8K A;  4D04 A;  4BJZ A;  3UTG A;  4A9W A;  4GUV A;  3ALM A;  4EIQ A;  4Z2T A;  5LV9 A;  3C96 A;  2BC0 A;  3BI4 A;  1GAL A;  4H2Q A;  5U63 A;  4YXD A;  1F3P A;  4C77 A;  2ZBW A;  3UKA A;  4H7U A;  3P4P A;  5FS7 A;  3LB8 A;  2C73 A;  4OCG A;  2YAU A;  2ZZB A;  1NHQ A;  2WPC A;  3SY4 A;  3UKH A;  4C5O A;  1REO A;  2W0H A;  3Q6J A;  3QFB A;  1GOS A;  4OPC A;  5ER0 A;  2C72 A;  1Y56 B;  3V3N A;  3AD8 B;  5EOW A;  4J36 A;  3GDN A;  2C67 A;  2UZZ A;  3LZW A;  3UCL A;  5U25 A;  3UKK A;  2YWL A;  1O95 A;  3L8K A;  3ITJ A;  2C64 A;  2OA1 A;  3ISH A;  2J3N A;  3G5Q A;  4CBQ A;  1Q9I A;  1TDF A;  5BUL A;  4USQ A;  3GYI A;  4REK A;  4YSX A;  2AQJ A;  4Y4L A;  3AXB A;  3NT6 A;  4LA1 A;  1NHS A;  3NIX A;  1JRX A;  2X3N A;  1CJ2 A;  1CC6 A;  1YQZ A;  1X31 B;  2XLS A;  3DGH A;  1XHC A;  4AOX A;  2B7R A;  2V3A A;  2YVJ A;  1XAN A;  3AE7 A;  2YVG A;  3SX6 A;  1ZK7 A;  3DJG X;  1FEC A;  4U8O A;  3B6D A;  3AE8 A;  4K7Z A;  4WCT A;  2RGO A;  1NAA A;  1NPX A;  4GDP A;  4H4Y A;  3SZ0 A;  4GCM A;  4GF7 A;  4H4T A;  4BJY A;  4H4X A;  1JRZ A;  4J34 A;  3KD9 A;  1ZOY A;  4BUR A;  3SZC A;  1CHU A;  2XFN A;  4ADW A;  4OPU A;  3T2Y A;  3NYC A;  4WX1 A;  4LU6 A;  2C3C A;  4IA6 A;  3T0K A;  2BAB A;  1QLB A;  2X8C A;  4B64 A;  1PJ6 A;  1VQW A;  2FJB A;  2V61 A;  3AD7 B;  3I3L A;  3CGC A;  3QSE A;  1TDE A;  4GR1 A;  4DSG A;  1BZL A;  3HYW A;  4EMW A;  2EQ8 A;  1D7L A;  2XLT A;  1DOC A;  1CL0 A;  2XDO A;  3VRD B;  4JDR A;  1ZMD A;  2PYX A;  4X9N A;  2XLP A;  5U1O A;  2PHH A;  3P9U A;  1CJ3 A;  2X8H A;  1JNR A;  1MO9 A;  1NDA A;  2GB0 A;  2GVC A;  3NH3 X;  1O94 A;  4NNJ A;  1K0J A;  1L0V A;  5C3J A;  4B65 A;  3AB1 A;  2AR8 A;  3UKL A;  2EQ7 A;  3UP5 A;  3SFD A;  3K7M X;  2X50 A;  1FOH A;  1NHP A;  4IVO B;  2A89 A;  4K5R A;  3FIM B;  5J7X A;  1PXA A;  1ONF A;  1KDG A;  3COX A;  2VQB A;  4J57 A;  4BK3 A;  1PS9 A;  5BRT A;  1YKJ A;  5M0Z A;  1LPF A;  2YG6 A;  3DGZ A;  4J2W A;  3VRB A;  2H88 A;  3VRA A;  2YM1 A;  4CNJ A;  3OC4 A;  4NTC A;  5IQ1 A;  4C74 A;  1F8S A;  3GSI A;  3KPK A;  3NK0 X;  2OLO A;  1BGN A;  4YSZ A;  1D5T A;  5GSN A;  3ADA B;  2V60 A;  5KXJ A;  5M10 A;  3ZYX A;  2XVE A;  5TR3 A;  2XFP A;  4UDQ A;  2XVF A;  3GDP A;  4EM3 A;  4YTP A;  4JY2 A;  1N1P A;  2WP5 A;  2BCG G;  3T14 A;  2YR4 A;  2X99 A;  4EQR A;  2Y6Q A;  2QCU A;  5DBJ A;  3DK4 A;  4X9M A;  3ABV A;  2H89 A;  1IUS A;  4DGK A;  1GRF A;  3S61 A;  4YKG A;  1F8R A;  1IUU A;  2YLS A;  1LTX R;  1GRH A;  4U8L A;  2YLR A;  2Y6R A;  3T31 A;  3KPF A;  4YT0 A;  4GRT A;  1UKV G;  3I6D A;  5HHF A;  5IQ4 A;  5EB4 A;  5EBK A;  2WOI A;  4A6N B;  5HXI A;  2JB1 A;  2XYO A;  4B1B A;  4BV6 A;  2F5Z A;  1B8S A;  5KMP A;  5GRT A;  1KNP A;  4NTD A;  2YVF A;  1GXF A;  2YR5 A;  1LQU A;  5CKU A;  3S5W A;  3V3O A;  4CY6 A;  1ZOV A;  1O5W A;  2VVM A;  4AT0 A;  2BAC A;  3CGE A;  4DSH A;  1E1K A;  3DJJ A;  2R4J A;  3VR9 A;  4DNA A;  1HYU A;  2QA1 A;  2VQ7 A;  4JN9 A;  4FDC B;  4A7A A;  3GMC A;  3P1W A;  4U8N A;  3NYF A;  3K7T A;  1DJN A;  2Z5Y A;  2GR2 A;  4ZN0 A;  1GPE A;  2BRA A;  1D4C A;  1K4Q A;  3AD9 B;  4XXG A;  4J33 A;  1MXT A;  3T2K A;  3LZX A;  1GND A;  4TM3 A;  2GRT A;  2WPE A;  1SEZ A;  4YSY A;  5HY5 A;  5J60 A;  2NVK X;  4GDE A;  5FS6 A;  1ZKQ A;  5FMH A;  3FG2 P;  1L9E A;  1K0L A;  4IVM B;  4TM1 A;  2AAQ A;  1GTH A;  2V3B A;  3QSM A;  4K22 A;  3LAD A;  4USR A;  4NTE A;  4BK2 A;  1Q1W A;  3AEC A;  1DOB A;  1VRQ B;  2YG3 A;  4GAP A;  4II2 A;  4K2X A;  2WES A;  4B68 A;  1E1M A;  3VQR A;  2DKI A;  3ICR A;  3NHO X;  1M64 A;  3ATQ A;  3D1C A;  4H2R A;  3ICS A;  2B9Y A;  1CJ4 A;  3EAN A;  1GRG A;  2C70 A;  1PXC A;  3BI5 A;  4H4R A;  1NEN A;  3BHF A;  3GWF A;  1H6V A;  2CUL A;  4OPT A;  4TM0 A;  3HYX A;  2GQF A;  2BS4 A;  1GER A;  1Q1R A;  4KX6 A;  1LJ1 A;  2BC1 A;  1LVL A;  4NEW A;  3AEG A;  4J56 A;  2Q0K A;  4OPG A;  2WU5 A;  3AEF A;  3F8R A;  4NZH A;  3GYX A;  4H4P A;  3CPJ G;  3DH9 A;  3SZF A;  4C3Y A;  2BRY A;  3M13 A;  1E1N A;  2GR1 A;  2A8X A;  1Z6L A;  2QA2 A;  1KSS A;  2V6O A;  1RSG A;  2YM2 A;  1KNR A;  1RYI A;  4H4V A;  1H7W A;  2I0Z A;  2GEW A;  4Z24 A;  1CC2 A;  1NG3 A;  1ZY8 A;  5JCI A;  2BK4 A;  1E39 A;  4ICY A;  3IHG A;  3NTA A;  1AOG A;  3RP7 A;  1F6M A;  4CY8 A;  3F8D A;  3IWA A;  4I59 A;  4U2T A;  3EF6 A;  1GSN A;  2YG5 A;  1S3E A;  2ACZ A;  2YLX A;  2WHD A;  2V5Z A;  3F8P A;  4AP3 A;  2WQY A;  2B76 A;  2EQ9 A;  4OVI A;  2IVE A;  3KA7 A;  3AE9 A;  3ICT A;  4I58 A;  1YQ4 A;  3QVR A;  4ZCD A;  4OPD A;  3AED A;  3DK9 A;  3KVE A;  3UOZ A;  3CN8 A;  1VG0 A;  3O0H A;  5KOW A;  1GES A;  3GRS A;  1QJD A;  3H8I A;  1IJH A;  3AYL A;  4OPI A;  5KRQ A;  1H83 A;  1LV0 A;  1S2Y A;  4X4J A;  1DXL A;  4OPL A;  2GAG B;  2XVI A;  4A99 A;  2C66 A;  1IUV A;  3VR8 A;  2DKH A;  2YLW A;  1JU2 A;  3K7Q X;  3AEA A;  3SYI A;  2XFU A;  4PAB A;  4Z43 A;  2WDR A;  5L46 A;  1EL8 A;  3CND A;  3AE2 A;  3DK8 A;  1V59 A;  1TYT A;  3AE3 A;  2IID A;  3H8L A;  5CQF A;  1CJC A;  2VVL A;  1TDO A;  1EL9 A;  3E1T A;  4MJW A;  4PAA A;  4RSL A;  5KMR A;  3V76 A;  1DOD A;  2C3D A;  3AEB A;  3CNJ A;  3CPH G;  1CF3 A;  3P4Q A;  1ZMC A;  2JK6 A;  2OLN A;  1B37 A;  2BXS A;  2FBW A;  2WU2 A;  1H81 A;  4EMI A;  4TM4 A;  4RG3 A;  4EIP A;  4AOS A;  1OJA A;  1PBE A;  1GRE A;  1E1L A;  3M12 A;  2YR6 A;  4JNQ A;  3UTF A;  1N4U A;  2WPF A;  4E0V A;  3CMM A;  2TMD A;  3CNT A;  3NK1 X;  3RP6 A;  3NKS A;  4JY3 A;  1FEB A;  1ELI A;  4HA6 A;  2GQW A;  2XVJ A;  1IUW A;  1QO8 A;  3H4K A;  3OZ2 A;  2FJD A;  4CNK A;  2BK3 A;  2BYB A;  2BS2 A;  1TYP A;  2GH5 A;  4G6G A;  3QSS A;  1EBD A;  1N4V A;  3GWD A;  1PXB A;  1D4D A;  4ZCC A;  4C3X A;  5KVI A;  1FCD A;  2E5V A;  4EQW A;  3KU9 A;  4TLZ A;  3AE5 A;  5KOX A;  2RGH A;  3FBS A;  3LOV A;  4JNA A;  4LII A;  2R0P A;  3BNM A;  3GMB A;  3CGB A;  2WDQ A;  1N4W A;  2Z5X A;  4KPR A;  3UKF A;  5KMS A;  5IPY A;  1PBC A;  4U2L A;  5JCM A;  2WOW A;  2WOV A;  4CCQ A;  1DJQ A;  1L9D A;  3CNS A;  4YTM A;  1DNC A;  2OAL A;  1OJ9 A;  1P2H A;  1YY5 A;  4G6H A;  2YG7 A;  4U2S A;  4U8M A;  2QAE A;  1PJ5 A;  2BXR A;  2ZZ0 A;  2GV8 A;  1TRB A;  2WP9 A;  1XPQ A;  5KWF A;  3Q9T A;  4K5S A;  3AWI A;  3HZL A;  4JQ9 A;  4U8I A;  1GTE A;  1TDK A;  2RGJ A;  2VVL G;  2APG A;  1JEH A;  1H84 A;  3NTD A;  4B66 A;  4Z2R A;  3AE6 A;  2GAH B;  2R46 A;  1P2E A;  3NRN A;  4AP1 A;  3ZDN A;  2EQ6 A;  4G9K A;  3CPI G;  1FL2 A;  2XLR A;  1EL5 A;  2FJE A;  3HYV A;  2VZ2 A;  4UDR A;  5FS8 A;  3NLC A;  3AEE A;  1JNZ A;  3RED A;  3P4R A;  1S3B A;  4IA5 A;  1M6I A;  3SQP A;  3K30 A;  2R9Z A;  3P4S A;  4J31 A;  5JCN A;  1GT8 A;  2VOU A;  3DA1 A;  3L1R A;  1COY A;  1PBD A;  3SGL A;  4A5L A;  1EL7 A;  2X8G A;  4H2N A;  4EMJ A;  4EQS A;  3ATR A;  2E1M A;  2RAB A;  3KKJ A;  2WBA A;  3SM8 A;  2O9Z A;  2Q7V A;  2YG4 A;  4YSH A;  2R4E A;  1NEK A;  2TPR A;  1IUX A;  2BS3 A;  3D8X A;  4U8J A;  4II3 A;  1GEU A;  2NPX A;  2GMH A;  1LQT A;  4APN A;  3LXD A;  1FEA A;  2A87 A;  3UTE A;  3UOX A;  4G74 A;  1GRT A;  2WEU A;  3NYE A;  2C4C A;  3C4N A;  3UKP A;  1H82 A;  4Z2U A;  4HB9 A;  1E6E A;  1GRA A;  2WS3 A;  3ALL A;  4Y4N A;  3GRT A;  3NN6 X;  2CFY A;  3UKQ A;  4FK1 A;  3BHK A;  2Q6U A;  1GV4 A;  1PJ7 A;  4K8D A;  4Z26 A;  2WDV A;  3KLJ A;  4CCR A;  3M0O A;  1IUT A;  3ALJ A;  3CGD A;  3UOY A;  1GET A;  2Q0L A;  1BGJ A;  3CIR A;  3JSK A;  3UP4 A;  3DJD A;  1DOE A;  4YTN A;  1L9C A;  1Y0P A;  3T2Z A;  1H7X A;  4A79 A;  4UDP A;  2BA9 A;  5JCL A;  3CTY A;  2YQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...