5KMQA

The structure of i379e variant of type ii nadh dehydrogenase from caldalkalibacillus thermarum
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
393
structure length
393
Chain Sequence
KPSIVILGAGYGGIVAALGLQKRLNYNEADITLVNKNDYHYITTELHQPAAGTMHHDQARVGIKELIDEKKIKFVKDTVVAIDREQQKVTLQNGELHYDYLVVGLGSEPETFGIEGLREHAFSINSINSVRIIRQHIEYQFAKFAAEPERTDYLTIVVGGAGFTGIEFVGELADRMPELCAEYDVDPKLVRIINVEAAPTVLPGFDPALVNYAMDVLGGKGVEFKIGTPIKRCTPEGVVIEVDGEEEEIKAATVVWTGGVRGNSIVEKSGFETMRGRIKVDPYLRAPGHENIFIVGDCALIINEENNRPYPPTAQIAIQHGENVAANLAALIRGGSMTPFKPHIRGTVASLGRNDAIGIVGGRKVYGHAASWLKKLEDMRYLYLIGGLSLVLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAD-dependent pyridine nucleotide-disulfide oxidoreductase
publication title The mechanism of catalysis by type-II NADH:quinone oxidoreductases.
pubmed doi rcsb
source organism Caldalkalibacillus thermarum ta2.a1
molecule tags Oxidoreductase
total genus 118
structure length 393
sequence length 393
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.100 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 5kmqA00
4GAVA 3KPKA 4G6HA 3SZCA 3HYWA 5KMQA 3T31A 3SZWA 4G9KA 5KMRA 3SY4A 4G74A 3HYXA 3SZ0A 3T2YA 3HYVA 3SZFA 3SXIA 5KMPA 3T14A 4G6GA 3SX6A 5KMSA 4GAPA 3T0KA 4NWZA 4G73A 3SYIA 3T2KA 3T2ZA
chains in the Genus database with same CATH superfamily
1E1LA 2APGA 3QFBA 4CY6A 1MO9A 1ZP0A 2FJBA 4H4QA 2WPEA 2YWLA 3KLJA 4H4SA 4OCGA 1NHSA 3K30A 1O5WA 2OAMA 4OPTA 4OPIA 5JCIA 4OPLA 2XFQA 2Y6QA 1ZKQA 2VVMA 1F8RA 3SZFA 1NPXA 4O5QA 2X99A 1EL9A 1XPQA 2R0PA 2XFUA 1D5TA 4NTEA 4FK1A 3AB1A 3COXA 3NYCA 1IUVA 2EQ6A 2ARDA 1TDNA 2YLXA 2X50A 4NTCA 4NWZA 5JCLA 1JRXA 3SYIA 3FG2P 1F8WA 1VDCA 2GQWA 3KKJA 1RSGA 4GAVA 4USQA 5IQ4A 3CGDA 1GREA 2WU2A 2YVJA 4CBQA 4REKA 3ALMA 2XLRA 3HZLA 3NLCA 1D4CA 1F8SA 1KNRA 2JB3A 3E1TA 5DBJA 2GMJA 2WP6A 3V3NA 2BRAA 3B6DA 3GDPA 4BJZA 3EANA 2XVJA 4UDPA 5BVAA 3DGZA 1QLBA 3DJEA 3SZ0A 4Z2UA 5JCKA 1Q1WA 1E7PA 3AYIA 5KMPA 1GRGA 2BS4A 4J36A 1CF3A 3UTGA 1OJAA 3ICSA 1N4VA 2JB2A 3FBSA 1PBEA 2OLNA 2NPXA 1NENA 2R4JA 3CNJA 3EF6A 4H4ZA 4A79A 4OVIA 2IVDA 2XFNA 2V3AA 3D8XA 5EBKA 5BUKA 1EBDA 1EL7A 3K7TA 1COYA 2GF3A 5HYMA 4Z2RA 3UOXA 2BK5A 3KU9A 3PO7A 3DK4A 1GESA 2E5VA 1TRBA 1Q1RA 2WESA 1PBDA 4FK1C 2H88A 2C75A 3GMCA 3BHKA 5KRQA 1KSSA 2XVHA 3NYEA 1OJDA 3AE5A 2BK4A 3FIMB 2C3CA 1CJ4A 2UZZA 3AD9B 2PYXA 1ONFA 1S3BA 3UKHA 4B63A 1FOHA 3BI5A 1GTEA 4EQRA 1E1KA 4U8OA 5HXIA 4U8KA 5CKUA 2RGJA 1GSNA 3NT6A 4YKFA 1XDIA 1CHUA 3ALLA 3NG7X 2XFOA 4Z26A 1JNRA 2C4CA 5IPYA 2IIDA 2V5ZA 2BA9A 3GMBA 4U8NA 2C76A 2BACA 3LADA 5BULA 2DKIA 5KVIA 3KVEA 1TDEA 1S2YA 1D4EA 2CDUA 1OJ9A 3H8LA 1DJQA 1KNPA 3CPIG 4H4RA 3AEBA 2B7SA 3T14A 4EM4A 4G6GA 3G5RA 3B3RA 4OPGA 4LU6A 4DSGA 4IA6A 1PBFA 3RNMA 2C7GA 2GAGB 2ZZBA 3AEDA 2Q0KA 4U8LA 3SX6A 1NHRA 2WOVA 3GRSA 2QA2A 3O0HA 3RHAA 4JN9A 5GSNA 3GYJA 1L0VA 4HA6A 3DA1A 1RYIA 2H89A 1KDGA 3DK8A 1GALA 3GD4A 1DXLA 3NYFA 1K0LA 4APNA 3NRNA 5KMQA 1LPFA 1N4WA 4YWOA 5C3JA 1CJCA 2BC1A 3AE2A 1ZDLA 2XDOA 1GOSA 2XLTA 2Q6UA 1W4XA 1H7WA 3LZXA 2XFPA 4JY3A 2WHDA 3SGLA 3GWFA 4AT2A 1H81A 1CC6A 3F8RA 3AE3A 3VRAA 2C67A 1NEKA 4JDRA 1PDHA 1BZLA 2YG7A 4YTNA 3SQPA 2X8HA 4C3XA 3UKKA 5GRTA 4ZN0A 4CCRA 4JQ9A 1GTHA 1JRZA 2O9ZA 1GRAA 4YSYA 1F3PA 2BXRA 4II3A 1MXTA 2YG6A 1IJHA 3NTDA 1TYTA 3UTHA 4BURA 1AOGA 1KF6A 2ACZA 1BKWA 5KXJA 1PXCA 4H4VA 1B37A 3ABVA 3IC9A 1PXBA 4A7AA 5BRTA 3AD8B 3SFEA 4A9WA 2V6OA 4AOXA 1LQUA 2WDRA 3K7QX 1Y56A 4OPCA 5KMSA 2CULA 2EQ8A 4EM3A 2WBAA 2XYOA 4TM3A 4U8IA 1XANA 2GMHA 2J3NA 1LTXR 4B65A 1ZMCA 4GDPA 4A65A 4EIPA 3QJ4A 1P2HA 3ADAB 4H4PA 3OC4A 1ELIA 2YR6A 1TDFA 4FDCB 2QCUA 2WQYA 2BS3A 4G74A 3M12A 1IUWA 1PJ7A 1VQWA 3QSSA 4DNAA 1SEZA 3T2YA 4EQXA 2AAQA 2VRMA 2JKCA 4Z25A 1NG4A 3KD9A 2OALA 4B69A 3CN8A 4YTMA 2VVLG 4TM4A 2W0HA 4EQWA 3CMMA 2NVKX 3NN0X 3ITJA 2WEUA 3CNTA 3R9UA 1B4VA 1OJCA 4AT0A 1FEAA 1GT8A 4B68A 2Y6RA 2XCGA 2ZZCA 3KPKA 1K0IA 4I59A 3P1WA 2BABA 3KPFA 4AP3A 4AOSA 3HYWA 3AEGA 4MJWA 2VQBA 3NGCX 3VR8A 1FEBA 1S2QA 2GVCA 2JAEA 3DJJA 1GRBA 2YLWA 3T37A 1PJ5A 1PBBA 1CL0A 3GRTA 4X9MA 1LQTA 1TDOA 2GV8A 3NN6X 3S61A 2JB1A 2X8CA 4CNJA 1P2EA 1FECA 2C73A 2VZ2A 4II2A 1PJ6A 2R46A 5LV9A 2Z5YA 2R45A 2C70A 2PHHA 3AYJA 3JSKA 3M13A 5HHFA 4IVOB 2YLSA 3CPHG 2YR4A 3G5QA 1D7YA 1DNCA 2EQ7A 3AECA 4NEVA 3REDA 3VRDB 1ZOYA 2BRYA 2E4GA 1KSUA 5TR3A 3RP7A 2RGHA 4TM0A 5EB5A 3UTFA 1PXAA 2A89A 3ICRA 4CY8A 3CNDA 3AYLA 4GR1A 2XVEA 4H7UA 2Q7VA 3IHGA 3NIXA 2V60A 2B76A 2YLTA 4GRTA 4TM1A 2A87A 1RP0A 3CNPA 5L46A 2GB0A 4Z2TA 2ZZ0A 4A6NA 2Q0LA 1GEUA 4KX6A 1E1MA 4K7ZA 1BF3A 3PS9A 2X3NA 2YQUA 3UKLA 3H8IA 3C4AA 2GQFA 3Q9TA 1UKVG 5C2TA 1N1PA 4C74A 1TYPA 3CGBA 4GDEA 2GR1A 4JY2A 5FS6A 1D7LA 1PHHA 1YQ4A 3QSEA 3SZCA 1CJ2A 4B64A 1E39A 2GR0A 4C5OA 3D1CA 2X8GA 3LB8A 5CQFA 1VG9A 4Z24A 3V76A 2RABA 3NK2X 3NH3X 2WDVA 3URHA 4H2NA 1Y56B 3ATRA 2R0CA 1CC4A 4U8MA 2DKHA 4D04A 3PVCA 5KNLA 3NNEA 3UKQA 4DGKA 2WOIA 1EL5A 1H82A 3GDNA 2GH5A 2E1MA 3LOVA 4J31A 4TLXA 1TDKA 4C77A 1JU2A 1PN0A 2JK6A 4H4YA 3DMEA 4P9SA 2OA1A 4NEWA 3QVRA 1BGNA 2ZBWA 3SFDA 3UTEA 2YLRA 3T2ZA 3AEEA 4DSHA 2XLSA 1ZK7A 1H6VA 3CIRA 4G6HA 1IUXA 1JRYA 1OJTA 3CNSA 4CRTA 3ALJA 4EMJA 2WETA 2YVFA 3AE9A 2B9YA 1GRHA 1YQZA 5U1OA 3NKSA 3T31A 1H83A 4LA1A 1M64A 2XVIA 4YTPA 1MOKA 2GRTA 1V59A 4X9NA 3II4A 4G9KA 1GNDA 5M0ZA 4XXGA 3SY4A 3EAOA 3AE8A 1HYUA 3OZ2A 4OPUA 3DJDA 2C3DA 5EB4A 5J60A 3F8DA 2C72A 3ICTA 4GF7A 2C65A 3BHFA 4OPDA 1B5QA 2VQ7A 2YM1A 4H4XA 1K0JA 2I0ZA 3GD3A 3CPJG 1BGJA 2A8XA 1JEHA 2BC0A 4A99A 4IV9A 3VR9A 2GR2A 3UOZA 2YG4A 4K5SA 5M10A 5U63A 1CJ3A 1S3EA 1Z6LA 3CGEA 4AP1A 1DOEA 3LJPA 4B67A 1ZOVA 3AD7B 1O95A 4IVMB 3NK0X 1VG0A 2RGOA 3C4NA 5FS8A 4EIQA 4YKGA 1B8SA 3SZWA 3UKFA 1IUUA 4Y4LA 4Z43A 3C96A 4H2RA 3ZDNA 4WCTA 5FMHA 5KOWA 3UKPA 4RG4A 3RP8A 1GERA 3DH9A 4U2TA 4K5RA 4EMWA 3AE4A 4UP3A 3VRBA 4YXDA 4YSHA 4A5LA 1LJ1A 4G73A 3P4PA 4JNAA 4EQSA 2GAHB 3T2KA 2WP9A 4YSXA 3FPZA 1DOBA 4JNQA 4UDRA 4XWRA 3QFAA 1YQ3A 4ADWA 2XLPA 1GRTA 3QVPA 1O94A 3UCLA 4J2WA 1K4QA 2AQJA 2QA1A 2VOUA 4H4WA 4K8DA 3BNUA 4M52A 4A6NB 4NTDA 4X4JA 2GEWA 2YLZA 3CGCA 3G5SA 1GPEA 3IHMA 5J7XA 5KMRA 1PBCA 4B66A 1LV0A 3F8PA 3P9UA 2JBVA 2VRLA 1L9EA 1PS9A 2BCGG 4Y4MA 3RP6A 4ECHA 4K2XA 1FL2A 5IQ1A 1REOA 1ZMDA 1JNZA 1CC2A 1ZX9A 3CTYA 4NNJA 1H86A 5EOWA 5ER0A 4N9XA 1H84A 2BK3A 3AEAA 4GAPA 2CVJA 2WP5A 4IA5A 1H7XA 1LVLA 2YAUA 3GSIA 3P4SA 4BK3A 4ZCDA 2B9XA 1Q9IA 1IUTA 2WS3A 5JCMA 1BWCA 2AR8A 1F6MA 1GXFA 2R4EA 5U25A 4H50A 4BJYA 1IUSA 2FJAA 3AE1A 4C3YA 2OLOA 3AWIA 3S5WA 4PABA 4D03A 2C64A 4BK1A 2VVLA 1GRFA 2R9ZA 2V61A 4HB9A 1DOCA 2TPRA 3AXBA 4I58A 4J34A 4WX1A 3AE7A 3HYVA 1NHPA 3SXIA 4B1BA 4USRA 5KWFA 2FBWA 3ATQA 4LIIA 4J56A 2TMDA 2QAEA 4PAAA 4J33A 3UP4A 4BK2A 2BCPA 2FJEA 4CNKA 4K22A 4UDQA 3NHOX 3IF9A 2B9WA 2WDQA 1E6EA 3T0KA 2WU5A 2WPFA 2CFYA 1N4UA 4KPRA 3V3OA 4E0VA 1XHCA 4YT0A 4ICYA 2IVEA 3DGHA 3P4RA 3L8KA 3L1RA 3WE0A 4H2QA 4CCQA 1NG3A 3I3LA 1EL8A 1GETA 2YM2A 1CBOA 1YKJA 4RSLA 5FS9A 2BXSA 3GYIA 3SM8A 4GUVA 1QJDA 5JCNA 1ZY8A 2XVFA 3NTAA 3HYXA 3Q6JA 2WPCA 2F5ZA 2GR3A 3NK1X 4RG3A 5KVHA 2YG3A 1L9CA 1X31B 4NZHA 1NDAA 4U8JA 2HQMA 4ZCCA 2XLUA 5HY5A 1M6IA 3UOVA 4YSZA 2YVGA 3FMWA 3K7MX 1DJNA 3IWAA 4FX9A 3M0OA 1DODA 2EQ9A 2Z5XA 3LZWA 3VQRA 3GWDA 3H4KA 1KFYA 4U2LA 5FS7A 1GV4A 2R0GA 3QSMA 3UKAA 2BYBA 1E1NA 1QO8A 1D4DA 1JOAA 3EPTA 1Y0PA 3UOYA 3BI4A 4Z44A 3BNMA 1NAAA 2C66A 3P4QA 4Y4NA 4EMIA 3DJGX 3I6DA 4XWZA 4H4TA 1NHQA 2B7RA 2WOWA 4TLZA 3UP5A 3LXDA 4J57A 4H2PA 3ISHA 1YY5A 2YG5A 2BS2A 3BI2A 3ZYXA 4H4UA 4O5UA 4BV6A 2FJDA 2YR5A 4U2SA 3AEFA 5KOXA 4GCMA 1L9DA 3AE6A 3KA7A 4U8PA 1VRQB 3GYXA 2V3BA 1FCDA 3DK9A
chains in the Genus database with same CATH topology
1E1LA 2APGA 3QFBA 4CY6A 1MO9A 1ZP0A 2FJBA 4H4QA 2WPEA 2YWLA 3KLJA 4H4SA 4OCGA 1NHSA 3K30A 1O5WA 2OAMA 4OPTA 4OPIA 5JCIA 4OPLA 2XFQA 2Y6QA 1ZKQA 2VVMA 1F8RA 3SZFA 1NPXA 4O5QA 2X99A 1EL9A 1XPQA 2R0PA 2XFUA 1D5TA 4NTEA 4FK1A 3AB1A 3COXA 3NYCA 1IUVA 2EQ6A 2ARDA 1TDNA 2YLXA 2X50A 4NTCA 4NWZA 5JCLA 1JRXA 3SYIA 3FG2P 1F8WA 1VDCA 2GQWA 3KKJA 1RSGA 4GAVA 4USQA 5IQ4A 3CGDA 1GREA 2WU2A 2YVJA 4CBQA 4REKA 3ALMA 2XLRA 3HZLA 3NLCA 1D4CA 1F8SA 1KNRA 2JB3A 3E1TA 5DBJA 2GMJA 2WP6A 3V3NA 2BRAA 3B6DA 3GDPA 4BJZA 3EANA 2XVJA 4UDPA 5BVAA 3DGZA 1QLBA 3DJEA 3SZ0A 4Z2UA 5JCKA 1Q1WA 1E7PA 3AYIA 5KMPA 1GRGA 2BS4A 4J36A 1CF3A 3UTGA 1OJAA 3ICSA 1N4VA 2JB2A 3FBSA 1PBEA 2OLNA 2NPXA 1NENA 2R4JA 3CNJA 3EF6A 4H4ZA 4A79A 4OVIA 2IVDA 2XFNA 2V3AA 3D8XA 5EBKA 5BUKA 1EBDA 1EL7A 3K7TA 1COYA 2GF3A 5HYMA 4Z2RA 3UOXA 2BK5A 3KU9A 3PO7A 3DK4A 1GESA 2E5VA 1TRBA 1Q1RA 2WESA 1PBDA 4FK1C 2H88A 2C75A 3GMCA 3BHKA 5KRQA 1KSSA 2XVHA 3NYEA 1OJDA 3AE5A 2BK4A 3FIMB 2C3CA 1CJ4A 2UZZA 3AD9B 2PYXA 1ONFA 1S3BA 3UKHA 4B63A 1FOHA 3BI5A 1GTEA 4EQRA 1E1KA 4U8OA 5HXIA 4U8KA 5CKUA 2RGJA 1GSNA 3NT6A 4YKFA 1XDIA 1CHUA 3ALLA 3NG7X 2XFOA 4Z26A 1JNRA 2C4CA 5IPYA 2IIDA 2V5ZA 2BA9A 3GMBA 4U8NA 2C76A 2BACA 3LADA 5BULA 2DKIA 5KVIA 3KVEA 1TDEA 1S2YA 1D4EA 2CDUA 1OJ9A 3H8LA 1DJQA 1KNPA 3CPIG 4H4RA 3AEBA 2B7SA 3T14A 4EM4A 4G6GA 3G5RA 3B3RA 4OPGA 4LU6A 4DSGA 4IA6A 1PBFA 3RNMA 2C7GA 2GAGB 2ZZBA 3AEDA 2Q0KA 4U8LA 3SX6A 1NHRA 2WOVA 3GRSA 2QA2A 3O0HA 3RHAA 4JN9A 5GSNA 3GYJA 1L0VA 4HA6A 3DA1A 1RYIA 2H89A 1KDGA 3DK8A 1GALA 3GD4A 1DXLA 3NYFA 1K0LA 4APNA 3NRNA 5KMQA 1LPFA 1N4WA 4YWOA 5C3JA 1CJCA 2BC1A 3AE2A 1ZDLA 2XDOA 1GOSA 2XLTA 2Q6UA 1W4XA 1H7WA 3LZXA 2XFPA 4JY3A 2WHDA 3SGLA 3GWFA 4AT2A 1H81A 1CC6A 3F8RA 3AE3A 3VRAA 2C67A 1NEKA 4JDRA 1PDHA 1BZLA 2YG7A 4YTNA 3SQPA 2X8HA 4C3XA 3UKKA 5GRTA 4ZN0A 4CCRA 4JQ9A 1GTHA 1JRZA 2O9ZA 1GRAA 4YSYA 1F3PA 2BXRA 4II3A 1MXTA 2YG6A 1IJHA 3NTDA 1TYTA 3UTHA 4BURA 1AOGA 1KF6A 2ACZA 1BKWA 5KXJA 1PXCA 4H4VA 1B37A 3ABVA 3IC9A 1PXBA 4A7AA 5BRTA 3AD8B 3SFEA 4A9WA 2V6OA 4AOXA 1LQUA 2WDRA 3K7QX 1Y56A 4OPCA 5KMSA 2CULA 2EQ8A 4EM3A 2WBAA 2XYOA 4TM3A 4U8IA 1XANA 2GMHA 2J3NA 1LTXR 4B65A 1ZMCA 4GDPA 4A65A 4EIPA 3QJ4A 1P2HA 3ADAB 4H4PA 3OC4A 1ELIA 2YR6A 1TDFA 4FDCB 2QCUA 2WQYA 2BS3A 4G74A 3M12A 1IUWA 1PJ7A 1VQWA 3QSSA 4DNAA 1SEZA 3T2YA 4EQXA 2AAQA 2VRMA 2JKCA 4Z25A 1NG4A 3KD9A 2OALA 4B69A 3CN8A 4YTMA 2VVLG 4TM4A 2W0HA 4EQWA 3CMMA 2NVKX 3NN0X 3ITJA 2WEUA 3CNTA 3R9UA 1B4VA 1OJCA 4AT0A 1FEAA 1GT8A 4B68A 2Y6RA 2XCGA 2ZZCA 3KPKA 1K0IA 4I59A 3P1WA 2BABA 3KPFA 4AP3A 4AOSA 3HYWA 3AEGA 4MJWA 2VQBA 3NGCX 3VR8A 1FEBA 1S2QA 2GVCA 2JAEA 3DJJA 1GRBA 2YLWA 3T37A 1PJ5A 1PBBA 1CL0A 3GRTA 4X9MA 1LQTA 1TDOA 2GV8A 3NN6X 3S61A 2JB1A 2X8CA 4CNJA 1P2EA 1FECA 2C73A 2VZ2A 4II2A 1PJ6A 2R46A 5LV9A 2Z5YA 2R45A 2C70A 2PHHA 3AYJA 3JSKA 3M13A 5HHFA 4IVOB 2YLSA 3CPHG 2YR4A 3G5QA 1D7YA 1DNCA 2EQ7A 3AECA 4NEVA 3REDA 3VRDB 1ZOYA 2BRYA 2E4GA 1KSUA 5TR3A 3RP7A 2RGHA 4TM0A 5EB5A 3UTFA 1PXAA 2A89A 3ICRA 4CY8A 3CNDA 3AYLA 4GR1A 2XVEA 4H7UA 2Q7VA 3IHGA 3NIXA 2V60A 2B76A 2YLTA 4GRTA 4TM1A 2A87A 1RP0A 3CNPA 5L46A 2GB0A 4Z2TA 2ZZ0A 4A6NA 2Q0LA 1GEUA 4KX6A 1E1MA 4K7ZA 1BF3A 3PS9A 2X3NA 2YQUA 3UKLA 3H8IA 3C4AA 2GQFA 3Q9TA 1UKVG 5C2TA 1N1PA 4C74A 1TYPA 3CGBA 4GDEA 2GR1A 4JY2A 5FS6A 1D7LA 1PHHA 1YQ4A 3QSEA 3SZCA 1CJ2A 4B64A 1E39A 2GR0A 4C5OA 3D1CA 2X8GA 3LB8A 5CQFA 1VG9A 4Z24A 3V76A 2RABA 3NK2X 3NH3X 2WDVA 3URHA 4H2NA 1Y56B 3ATRA 2R0CA 1CC4A 4U8MA 2DKHA 4D04A 3PVCA 5KNLA 3NNEA 3UKQA 4DGKA 2WOIA 1EL5A 1H82A 3GDNA 2GH5A 2E1MA 3LOVA 4J31A 4TLXA 1TDKA 4C77A 1JU2A 1PN0A 2JK6A 4H4YA 3DMEA 4P9SA 2OA1A 4NEWA 3QVRA 1BGNA 2ZBWA 3SFDA 3UTEA 2YLRA 3T2ZA 3AEEA 4DSHA 2XLSA 1ZK7A 1H6VA 3CIRA 4G6HA 1IUXA 1JRYA 1OJTA 3CNSA 4CRTA 3ALJA 4EMJA 2WETA 2YVFA 3AE9A 2B9YA 1GRHA 1YQZA 5U1OA 3NKSA 3T31A 1H83A 4LA1A 1M64A 2XVIA 4YTPA 1MOKA 2GRTA 1V59A 4X9NA 3II4A 4G9KA 1GNDA 5M0ZA 4XXGA 3SY4A 3EAOA 3AE8A 1HYUA 3OZ2A 4OPUA 3DJDA 2C3DA 5EB4A 5J60A 3F8DA 2C72A 3ICTA 4GF7A 2C65A 3BHFA 4OPDA 1B5QA 2VQ7A 2YM1A 4H4XA 1K0JA 2I0ZA 3GD3A 3CPJG 1BGJA 2A8XA 1JEHA 2BC0A 4A99A 4IV9A 3VR9A 2GR2A 3UOZA 2YG4A 4K5SA 5M10A 5U63A 1CJ3A 1S3EA 1Z6LA 3CGEA 4AP1A 1DOEA 3LJPA 4B67A 1ZOVA 3AD7B 1O95A 4IVMB 3NK0X 1VG0A 2RGOA 3C4NA 5FS8A 4EIQA 4YKGA 1B8SA 3SZWA 3UKFA 1IUUA 4Y4LA 4Z43A 3C96A 4H2RA 3ZDNA 4WCTA 5FMHA 5KOWA 3UKPA 4RG4A 3RP8A 1GERA 3DH9A 4U2TA 4K5RA 4EMWA 3AE4A 4UP3A 3VRBA 4YXDA 4YSHA 4A5LA 1LJ1A 4G73A 3P4PA 4JNAA 4EQSA 2GAHB 3T2KA 2WP9A 4YSXA 3FPZA 1DOBA 4JNQA 4UDRA 4XWRA 3QFAA 1YQ3A 4ADWA 2XLPA 1GRTA 3QVPA 1O94A 3UCLA 4J2WA 1K4QA 2AQJA 2QA1A 2VOUA 4H4WA 4K8DA 3BNUA 4M52A 4A6NB 4NTDA 4X4JA 2GEWA 2YLZA 3CGCA 3G5SA 1GPEA 3IHMA 5J7XA 5KMRA 1PBCA 4B66A 1LV0A 3F8PA 3P9UA 2JBVA 2VRLA 1L9EA 1PS9A 2BCGG 4Y4MA 3RP6A 4ECHA 4K2XA 1FL2A 5IQ1A 1REOA 1ZMDA 1JNZA 1CC2A 1ZX9A 3CTYA 4NNJA 1H86A 5EOWA 5ER0A 4N9XA 1H84A 2BK3A 3AEAA 4GAPA 2CVJA 2WP5A 4IA5A 1H7XA 1LVLA 2YAUA 3GSIA 3P4SA 4BK3A 4ZCDA 2B9XA 1Q9IA 1IUTA 2WS3A 5JCMA 1BWCA 2AR8A 1F6MA 1GXFA 2R4EA 5U25A 4H50A 4BJYA 1IUSA 2FJAA 3AE1A 4C3YA 2OLOA 3AWIA 3S5WA 4PABA 4D03A 2C64A 4BK1A 2VVLA 1GRFA 2R9ZA 2V61A 4HB9A 1DOCA 2TPRA 3AXBA 4I58A 4J34A 4WX1A 3AE7A 3HYVA 1NHPA 3SXIA 4B1BA 4USRA 5KWFA 2FBWA 3ATQA 4LIIA 4J56A 2TMDA 2QAEA 4PAAA 4J33A 3UP4A 4BK2A 2BCPA 2FJEA 4CNKA 4K22A 4UDQA 3NHOX 3IF9A 2B9WA 2WDQA 1E6EA 3T0KA 2WU5A 2WPFA 2CFYA 1N4UA 4KPRA 3V3OA 4E0VA 1XHCA 4YT0A 4ICYA 2IVEA 3DGHA 3P4RA 3L8KA 3L1RA 3WE0A 4H2QA 4CCQA 1NG3A 3I3LA 1EL8A 1GETA 2YM2A 1CBOA 1YKJA 4RSLA 5FS9A 2BXSA 3GYIA 3SM8A 4GUVA 1QJDA 5JCNA 1ZY8A 2XVFA 3NTAA 3HYXA 3Q6JA 2WPCA 2F5ZA 2GR3A 3NK1X 4RG3A 5KVHA 2YG3A 1L9CA 1X31B 4NZHA 1NDAA 4U8JA 2HQMA 4ZCCA 2XLUA 5HY5A 1M6IA 3UOVA 4YSZA 2YVGA 3FMWA 3K7MX 1DJNA 3IWAA 4FX9A 3M0OA 1DODA 2EQ9A 2Z5XA 3LZWA 3VQRA 3GWDA 3H4KA 1KFYA 4U2LA 5FS7A 1GV4A 2R0GA 3QSMA 3UKAA 2BYBA 1E1NA 1QO8A 1D4DA 1JOAA 3EPTA 1Y0PA 3UOYA 3BI4A 4Z44A 3BNMA 1NAAA 2C66A 3P4QA 4Y4NA 4EMIA 3DJGX 3I6DA 4XWZA 4H4TA 1NHQA 2B7RA 2WOWA 4TLZA 3UP5A 3LXDA 4J57A 4H2PA 3ISHA 1YY5A 2YG5A 2BS2A 3BI2A 3ZYXA 4H4UA 4O5UA 4BV6A 2FJDA 2YR5A 4U2SA 3AEFA 5KOXA 4GCMA 1L9DA 3AE6A 3KA7A 4U8PA 1VRQB 3GYXA 2V3BA 1FCDA 3DK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GAV A;  3KPK A;  4G6H A;  3SZC A;  3HYW A;  5KMQ A;  3T31 A;  3SZW A;  4G9K A;  5KMR A;  3SY4 A;  4G74 A;  3HYX A;  3SZ0 A;  3T2Y A;  3HYV A;  3SZF A;  3SXI A;  5KMP A;  3T14 A;  4G6G A;  3SX6 A;  5KMS A;  4GAP A;  3T0K A;  4NWZ A;  4G73 A;  3SYI A;  3T2K A;  3T2Z A; 
#chains in the Genus database with same CATH topology
 1E1L A;  2APG A;  3QFB A;  4CY6 A;  1MO9 A;  1ZP0 A;  2FJB A;  4H4Q A;  2WPE A;  2YWL A;  3KLJ A;  4H4S A;  4OCG A;  1NHS A;  3K30 A;  1O5W A;  2OAM A;  4OPT A;  4OPI A;  5JCI A;  4OPL A;  2XFQ A;  2Y6Q A;  1ZKQ A;  2VVM A;  1F8R A;  3SZF A;  1NPX A;  4O5Q A;  2X99 A;  1EL9 A;  1XPQ A;  2R0P A;  2XFU A;  1D5T A;  4NTE A;  4FK1 A;  3AB1 A;  3COX A;  3NYC A;  1IUV A;  2EQ6 A;  2ARD A;  1TDN A;  2YLX A;  2X50 A;  4NTC A;  4NWZ A;  5JCL A;  1JRX A;  3SYI A;  3FG2 P;  1F8W A;  1VDC A;  2GQW A;  3KKJ A;  1RSG A;  4GAV A;  4USQ A;  5IQ4 A;  3CGD A;  1GRE A;  2WU2 A;  2YVJ A;  4CBQ A;  4REK A;  3ALM A;  2XLR A;  3HZL A;  3NLC A;  1D4C A;  1F8S A;  1KNR A;  2JB3 A;  3E1T A;  5DBJ A;  2GMJ A;  2WP6 A;  3V3N A;  2BRA A;  3B6D A;  3GDP A;  4BJZ A;  3EAN A;  2XVJ A;  4UDP A;  5BVA A;  3DGZ A;  1QLB A;  3DJE A;  3SZ0 A;  4Z2U A;  5JCK A;  1Q1W A;  1E7P A;  3AYI A;  5KMP A;  1GRG A;  2BS4 A;  4J36 A;  1CF3 A;  3UTG A;  1OJA A;  3ICS A;  1N4V A;  2JB2 A;  3FBS A;  1PBE A;  2OLN A;  2NPX A;  1NEN A;  2R4J A;  3CNJ A;  3EF6 A;  4H4Z A;  4A79 A;  4OVI A;  2IVD A;  2XFN A;  2V3A A;  3D8X A;  5EBK A;  5BUK A;  1EBD A;  1EL7 A;  3K7T A;  1COY A;  2GF3 A;  5HYM A;  4Z2R A;  3UOX A;  2BK5 A;  3KU9 A;  3PO7 A;  3DK4 A;  1GES A;  2E5V A;  1TRB A;  1Q1R A;  2WES A;  1PBD A;  4FK1 C;  2H88 A;  2C75 A;  3GMC A;  3BHK A;  5KRQ A;  1KSS A;  2XVH A;  3NYE A;  1OJD A;  3AE5 A;  2BK4 A;  3FIM B;  2C3C A;  1CJ4 A;  2UZZ A;  3AD9 B;  2PYX A;  1ONF A;  1S3B A;  3UKH A;  4B63 A;  1FOH A;  3BI5 A;  1GTE A;  4EQR A;  1E1K A;  4U8O A;  5HXI A;  4U8K A;  5CKU A;  2RGJ A;  1GSN A;  3NT6 A;  4YKF A;  1XDI A;  1CHU A;  3ALL A;  3NG7 X;  2XFO A;  4Z26 A;  1JNR A;  2C4C A;  5IPY A;  2IID A;  2V5Z A;  2BA9 A;  3GMB A;  4U8N A;  2C76 A;  2BAC A;  3LAD A;  5BUL A;  2DKI A;  5KVI A;  3KVE A;  1TDE A;  1S2Y A;  1D4E A;  2CDU A;  1OJ9 A;  3H8L A;  1DJQ A;  1KNP A;  3CPI G;  4H4R A;  3AEB A;  2B7S A;  3T14 A;  4EM4 A;  4G6G A;  3G5R A;  3B3R A;  4OPG A;  4LU6 A;  4DSG A;  4IA6 A;  1PBF A;  3RNM A;  2C7G A;  2GAG B;  2ZZB A;  3AED A;  2Q0K A;  4U8L A;  3SX6 A;  1NHR A;  2WOV A;  3GRS A;  2QA2 A;  3O0H A;  3RHA A;  4JN9 A;  5GSN A;  3GYJ A;  1L0V A;  4HA6 A;  3DA1 A;  1RYI A;  2H89 A;  1KDG A;  3DK8 A;  1GAL A;  3GD4 A;  1DXL A;  3NYF A;  1K0L A;  4APN A;  3NRN A;  5KMQ A;  1LPF A;  1N4W A;  4YWO A;  5C3J A;  1CJC A;  2BC1 A;  3AE2 A;  1ZDL A;  2XDO A;  1GOS A;  2XLT A;  2Q6U A;  1W4X A;  1H7W A;  3LZX A;  2XFP A;  4JY3 A;  2WHD A;  3SGL A;  3GWF A;  4AT2 A;  1H81 A;  1CC6 A;  3F8R A;  3AE3 A;  3VRA A;  2C67 A;  1NEK A;  4JDR A;  1PDH A;  1BZL A;  2YG7 A;  4YTN A;  3SQP A;  2X8H A;  4C3X A;  3UKK A;  5GRT A;  4ZN0 A;  4CCR A;  4JQ9 A;  1GTH A;  1JRZ A;  2O9Z A;  1GRA A;  4YSY A;  1F3P A;  2BXR A;  4II3 A;  1MXT A;  2YG6 A;  1IJH A;  3NTD A;  1TYT A;  3UTH A;  4BUR A;  1AOG A;  1KF6 A;  2ACZ A;  1BKW A;  5KXJ A;  1PXC A;  4H4V A;  1B37 A;  3ABV A;  3IC9 A;  1PXB A;  4A7A A;  5BRT A;  3AD8 B;  3SFE A;  4A9W A;  2V6O A;  4AOX A;  1LQU A;  2WDR A;  3K7Q X;  1Y56 A;  4OPC A;  5KMS A;  2CUL A;  2EQ8 A;  4EM3 A;  2WBA A;  2XYO A;  4TM3 A;  4U8I A;  1XAN A;  2GMH A;  2J3N A;  1LTX R;  4B65 A;  1ZMC A;  4GDP A;  4A65 A;  4EIP A;  3QJ4 A;  1P2H A;  3ADA B;  4H4P A;  3OC4 A;  1ELI A;  2YR6 A;  1TDF A;  4FDC B;  2QCU A;  2WQY A;  2BS3 A;  4G74 A;  3M12 A;  1IUW A;  1PJ7 A;  1VQW A;  3QSS A;  4DNA A;  1SEZ A;  3T2Y A;  4EQX A;  2AAQ A;  2VRM A;  2JKC A;  4Z25 A;  1NG4 A;  3KD9 A;  2OAL A;  4B69 A;  3CN8 A;  4YTM A;  2VVL G;  4TM4 A;  2W0H A;  4EQW A;  3CMM A;  2NVK X;  3NN0 X;  3ITJ A;  2WEU A;  3CNT A;  3R9U A;  1B4V A;  1OJC A;  4AT0 A;  1FEA A;  1GT8 A;  4B68 A;  2Y6R A;  2XCG A;  2ZZC A;  3KPK A;  1K0I A;  4I59 A;  3P1W A;  2BAB A;  3KPF A;  4AP3 A;  4AOS A;  3HYW A;  3AEG A;  4MJW A;  2VQB A;  3NGC X;  3VR8 A;  1FEB A;  1S2Q A;  2GVC A;  2JAE A;  3DJJ A;  1GRB A;  2YLW A;  3T37 A;  1PJ5 A;  1PBB A;  1CL0 A;  3GRT A;  4X9M A;  1LQT A;  1TDO A;  2GV8 A;  3NN6 X;  3S61 A;  2JB1 A;  2X8C A;  4CNJ A;  1P2E A;  1FEC A;  2C73 A;  2VZ2 A;  4II2 A;  1PJ6 A;  2R46 A;  5LV9 A;  2Z5Y A;  2R45 A;  2C70 A;  2PHH A;  3AYJ A;  3JSK A;  3M13 A;  5HHF A;  4IVO B;  2YLS A;  3CPH G;  2YR4 A;  3G5Q A;  1D7Y A;  1DNC A;  2EQ7 A;  3AEC A;  4NEV A;  3RED A;  3VRD B;  1ZOY A;  2BRY A;  2E4G A;  1KSU A;  5TR3 A;  3RP7 A;  2RGH A;  4TM0 A;  5EB5 A;  3UTF A;  1PXA A;  2A89 A;  3ICR A;  4CY8 A;  3CND A;  3AYL A;  4GR1 A;  2XVE A;  4H7U A;  2Q7V A;  3IHG A;  3NIX A;  2V60 A;  2B76 A;  2YLT A;  4GRT A;  4TM1 A;  2A87 A;  1RP0 A;  3CNP A;  5L46 A;  2GB0 A;  4Z2T A;  2ZZ0 A;  4A6N A;  2Q0L A;  1GEU A;  4KX6 A;  1E1M A;  4K7Z A;  1BF3 A;  3PS9 A;  2X3N A;  2YQU A;  3UKL A;  3H8I A;  3C4A A;  2GQF A;  3Q9T A;  1UKV G;  5C2T A;  1N1P A;  4C74 A;  1TYP A;  3CGB A;  4GDE A;  2GR1 A;  4JY2 A;  5FS6 A;  1D7L A;  1PHH A;  1YQ4 A;  3QSE A;  3SZC A;  1CJ2 A;  4B64 A;  1E39 A;  2GR0 A;  4C5O A;  3D1C A;  2X8G A;  3LB8 A;  5CQF A;  1VG9 A;  4Z24 A;  3V76 A;  2RAB A;  3NK2 X;  3NH3 X;  2WDV A;  3URH A;  4H2N A;  1Y56 B;  3ATR A;  2R0C A;  1CC4 A;  4U8M A;  2DKH A;  4D04 A;  3PVC A;  5KNL A;  3NNE A;  3UKQ A;  4DGK A;  2WOI A;  1EL5 A;  1H82 A;  3GDN A;  2GH5 A;  2E1M A;  3LOV A;  4J31 A;  4TLX A;  1TDK A;  4C77 A;  1JU2 A;  1PN0 A;  2JK6 A;  4H4Y A;  3DME A;  4P9S A;  2OA1 A;  4NEW A;  3QVR A;  1BGN A;  2ZBW A;  3SFD A;  3UTE A;  2YLR A;  3T2Z A;  3AEE A;  4DSH A;  2XLS A;  1ZK7 A;  1H6V A;  3CIR A;  4G6H A;  1IUX A;  1JRY A;  1OJT A;  3CNS A;  4CRT A;  3ALJ A;  4EMJ A;  2WET A;  2YVF A;  3AE9 A;  2B9Y A;  1GRH A;  1YQZ A;  5U1O A;  3NKS A;  3T31 A;  1H83 A;  4LA1 A;  1M64 A;  2XVI A;  4YTP A;  1MOK A;  2GRT A;  1V59 A;  4X9N A;  3II4 A;  4G9K A;  1GND A;  5M0Z A;  4XXG A;  3SY4 A;  3EAO A;  3AE8 A;  1HYU A;  3OZ2 A;  4OPU A;  3DJD A;  2C3D A;  5EB4 A;  5J60 A;  3F8D A;  2C72 A;  3ICT A;  4GF7 A;  2C65 A;  3BHF A;  4OPD A;  1B5Q A;  2VQ7 A;  2YM1 A;  4H4X A;  1K0J A;  2I0Z A;  3GD3 A;  3CPJ G;  1BGJ A;  2A8X A;  1JEH A;  2BC0 A;  4A99 A;  4IV9 A;  3VR9 A;  2GR2 A;  3UOZ A;  2YG4 A;  4K5S A;  5M10 A;  5U63 A;  1CJ3 A;  1S3E A;  1Z6L A;  3CGE A;  4AP1 A;  1DOE A;  3LJP A;  4B67 A;  1ZOV A;  3AD7 B;  1O95 A;  4IVM B;  3NK0 X;  1VG0 A;  2RGO A;  3C4N A;  5FS8 A;  4EIQ A;  4YKG A;  1B8S A;  3SZW A;  3UKF A;  1IUU A;  4Y4L A;  4Z43 A;  3C96 A;  4H2R A;  3ZDN A;  4WCT A;  5FMH A;  5KOW A;  3UKP A;  4RG4 A;  3RP8 A;  1GER A;  3DH9 A;  4U2T A;  4K5R A;  4EMW A;  3AE4 A;  4UP3 A;  3VRB A;  4YXD A;  4YSH A;  4A5L A;  1LJ1 A;  4G73 A;  3P4P A;  4JNA A;  4EQS A;  2GAH B;  3T2K A;  2WP9 A;  4YSX A;  3FPZ A;  1DOB A;  4JNQ A;  4UDR A;  4XWR A;  3QFA A;  1YQ3 A;  4ADW A;  2XLP A;  1GRT A;  3QVP A;  1O94 A;  3UCL A;  4J2W A;  1K4Q A;  2AQJ A;  2QA1 A;  2VOU A;  4H4W A;  4K8D A;  3BNU A;  4M52 A;  4A6N B;  4NTD A;  4X4J A;  2GEW A;  2YLZ A;  3CGC A;  3G5S A;  1GPE A;  3IHM A;  5J7X A;  5KMR A;  1PBC A;  4B66 A;  1LV0 A;  3F8P A;  3P9U A;  2JBV A;  2VRL A;  1L9E A;  1PS9 A;  2BCG G;  4Y4M A;  3RP6 A;  4ECH A;  4K2X A;  1FL2 A;  5IQ1 A;  1REO A;  1ZMD A;  1JNZ A;  1CC2 A;  1ZX9 A;  3CTY A;  4NNJ A;  1H86 A;  5EOW A;  5ER0 A;  4N9X A;  1H84 A;  2BK3 A;  3AEA A;  4GAP A;  2CVJ A;  2WP5 A;  4IA5 A;  1H7X A;  1LVL A;  2YAU A;  3GSI A;  3P4S A;  4BK3 A;  4ZCD A;  2B9X A;  1Q9I A;  1IUT A;  2WS3 A;  5JCM A;  1BWC A;  2AR8 A;  1F6M A;  1GXF A;  2R4E A;  5U25 A;  4H50 A;  4BJY A;  1IUS A;  2FJA A;  3AE1 A;  4C3Y A;  2OLO A;  3AWI A;  3S5W A;  4PAB A;  4D03 A;  2C64 A;  4BK1 A;  2VVL A;  1GRF A;  2R9Z A;  2V61 A;  4HB9 A;  1DOC A;  2TPR A;  3AXB A;  4I58 A;  4J34 A;  4WX1 A;  3AE7 A;  3HYV A;  1NHP A;  3SXI A;  4B1B A;  4USR A;  5KWF A;  2FBW A;  3ATQ A;  4LII A;  4J56 A;  2TMD A;  2QAE A;  4PAA A;  4J33 A;  3UP4 A;  4BK2 A;  2BCP A;  2FJE A;  4CNK A;  4K22 A;  4UDQ A;  3NHO X;  3IF9 A;  2B9W A;  2WDQ A;  1E6E A;  3T0K A;  2WU5 A;  2WPF A;  2CFY A;  1N4U A;  4KPR A;  3V3O A;  4E0V A;  1XHC A;  4YT0 A;  4ICY A;  2IVE A;  3DGH A;  3P4R A;  3L8K A;  3L1R A;  3WE0 A;  4H2Q A;  4CCQ A;  1NG3 A;  3I3L A;  1EL8 A;  1GET A;  2YM2 A;  1CBO A;  1YKJ A;  4RSL A;  5FS9 A;  2BXS A;  3GYI A;  3SM8 A;  4GUV A;  1QJD A;  5JCN A;  1ZY8 A;  2XVF A;  3NTA A;  3HYX A;  3Q6J A;  2WPC A;  2F5Z A;  2GR3 A;  3NK1 X;  4RG3 A;  5KVH A;  2YG3 A;  1L9C A;  1X31 B;  4NZH A;  1NDA A;  4U8J A;  2HQM A;  4ZCC A;  2XLU A;  5HY5 A;  1M6I A;  3UOV A;  4YSZ A;  2YVG A;  3FMW A;  3K7M X;  1DJN A;  3IWA A;  4FX9 A;  3M0O A;  1DOD A;  2EQ9 A;  2Z5X A;  3LZW A;  3VQR A;  3GWD A;  3H4K A;  1KFY A;  4U2L A;  5FS7 A;  1GV4 A;  2R0G A;  3QSM A;  3UKA A;  2BYB A;  1E1N A;  1QO8 A;  1D4D A;  1JOA A;  3EPT A;  1Y0P A;  3UOY A;  3BI4 A;  4Z44 A;  3BNM A;  1NAA A;  2C66 A;  3P4Q A;  4Y4N A;  4EMI A;  3DJG X;  3I6D A;  4XWZ A;  4H4T A;  1NHQ A;  2B7R A;  2WOW A;  4TLZ A;  3UP5 A;  3LXD A;  4J57 A;  4H2P A;  3ISH A;  1YY5 A;  2YG5 A;  2BS2 A;  3BI2 A;  3ZYX A;  4H4U A;  4O5U A;  4BV6 A;  2FJD A;  2YR5 A;  4U2S A;  3AEF A;  5KOX A;  4GCM A;  1L9D A;  3AE6 A;  3KA7 A;  4U8P A;  1VRQ B;  3GYX A;  2V3B A;  1FCD A;  3DK9 A; 
#chains in the Genus database with same CATH homology
 1E1L A;  2APG A;  3QFB A;  4CY6 A;  1MO9 A;  1ZP0 A;  2FJB A;  4H4Q A;  2WPE A;  2YWL A;  3KLJ A;  4H4S A;  4OCG A;  1NHS A;  3K30 A;  1O5W A;  2OAM A;  4OPT A;  4OPI A;  5JCI A;  4OPL A;  2XFQ A;  2Y6Q A;  1ZKQ A;  2VVM A;  1F8R A;  3SZF A;  1NPX A;  4O5Q A;  2X99 A;  1EL9 A;  1XPQ A;  2R0P A;  2XFU A;  1D5T A;  4NTE A;  4FK1 A;  3AB1 A;  3COX A;  3NYC A;  1IUV A;  2EQ6 A;  2ARD A;  1TDN A;  2YLX A;  2X50 A;  4NTC A;  4NWZ A;  5JCL A;  1JRX A;  3SYI A;  3FG2 P;  1F8W A;  1VDC A;  2GQW A;  3KKJ A;  1RSG A;  4GAV A;  4USQ A;  5IQ4 A;  3CGD A;  1GRE A;  2WU2 A;  2YVJ A;  4CBQ A;  4REK A;  3ALM A;  2XLR A;  3HZL A;  3NLC A;  1D4C A;  1F8S A;  1KNR A;  2JB3 A;  3E1T A;  5DBJ A;  2GMJ A;  2WP6 A;  3V3N A;  2BRA A;  3B6D A;  3GDP A;  4BJZ A;  3EAN A;  2XVJ A;  4UDP A;  5BVA A;  3DGZ A;  1QLB A;  3DJE A;  3SZ0 A;  4Z2U A;  5JCK A;  1Q1W A;  1E7P A;  3AYI A;  5KMP A;  1GRG A;  2BS4 A;  4J36 A;  1CF3 A;  3UTG A;  1OJA A;  3ICS A;  1N4V A;  2JB2 A;  3FBS A;  1PBE A;  2OLN A;  2NPX A;  1NEN A;  2R4J A;  3CNJ A;  3EF6 A;  4H4Z A;  4A79 A;  4OVI A;  2IVD A;  2XFN A;  2V3A A;  3D8X A;  5EBK A;  5BUK A;  1EBD A;  1EL7 A;  3K7T A;  1COY A;  2GF3 A;  5HYM A;  4Z2R A;  3UOX A;  2BK5 A;  3KU9 A;  3PO7 A;  3DK4 A;  1GES A;  2E5V A;  1TRB A;  1Q1R A;  2WES A;  1PBD A;  4FK1 C;  2H88 A;  2C75 A;  3GMC A;  3BHK A;  5KRQ A;  1KSS A;  2XVH A;  3NYE A;  1OJD A;  3AE5 A;  2BK4 A;  3FIM B;  2C3C A;  1CJ4 A;  2UZZ A;  3AD9 B;  2PYX A;  1ONF A;  1S3B A;  3UKH A;  4B63 A;  1FOH A;  3BI5 A;  1GTE A;  4EQR A;  1E1K A;  4U8O A;  5HXI A;  4U8K A;  5CKU A;  2RGJ A;  1GSN A;  3NT6 A;  4YKF A;  1XDI A;  1CHU A;  3ALL A;  3NG7 X;  2XFO A;  4Z26 A;  1JNR A;  2C4C A;  5IPY A;  2IID A;  2V5Z A;  2BA9 A;  3GMB A;  4U8N A;  2C76 A;  2BAC A;  3LAD A;  5BUL A;  2DKI A;  5KVI A;  3KVE A;  1TDE A;  1S2Y A;  1D4E A;  2CDU A;  1OJ9 A;  3H8L A;  1DJQ A;  1KNP A;  3CPI G;  4H4R A;  3AEB A;  2B7S A;  3T14 A;  4EM4 A;  4G6G A;  3G5R A;  3B3R A;  4OPG A;  4LU6 A;  4DSG A;  4IA6 A;  1PBF A;  3RNM A;  2C7G A;  2GAG B;  2ZZB A;  3AED A;  2Q0K A;  4U8L A;  3SX6 A;  1NHR A;  2WOV A;  3GRS A;  2QA2 A;  3O0H A;  3RHA A;  4JN9 A;  5GSN A;  3GYJ A;  1L0V A;  4HA6 A;  3DA1 A;  1RYI A;  2H89 A;  1KDG A;  3DK8 A;  1GAL A;  3GD4 A;  1DXL A;  3NYF A;  1K0L A;  4APN A;  3NRN A;  5KMQ A;  1LPF A;  1N4W A;  4YWO A;  5C3J A;  1CJC A;  2BC1 A;  3AE2 A;  1ZDL A;  2XDO A;  1GOS A;  2XLT A;  2Q6U A;  1W4X A;  1H7W A;  3LZX A;  2XFP A;  4JY3 A;  2WHD A;  3SGL A;  3GWF A;  4AT2 A;  1H81 A;  1CC6 A;  3F8R A;  3AE3 A;  3VRA A;  2C67 A;  1NEK A;  4JDR A;  1PDH A;  1BZL A;  2YG7 A;  4YTN A;  3SQP A;  2X8H A;  4C3X A;  3UKK A;  5GRT A;  4ZN0 A;  4CCR A;  4JQ9 A;  1GTH A;  1JRZ A;  2O9Z A;  1GRA A;  4YSY A;  1F3P A;  2BXR A;  4II3 A;  1MXT A;  2YG6 A;  1IJH A;  3NTD A;  1TYT A;  3UTH A;  4BUR A;  1AOG A;  1KF6 A;  2ACZ A;  1BKW A;  5KXJ A;  1PXC A;  4H4V A;  1B37 A;  3ABV A;  3IC9 A;  1PXB A;  4A7A A;  5BRT A;  3AD8 B;  3SFE A;  4A9W A;  2V6O A;  4AOX A;  1LQU A;  2WDR A;  3K7Q X;  1Y56 A;  4OPC A;  5KMS A;  2CUL A;  2EQ8 A;  4EM3 A;  2WBA A;  2XYO A;  4TM3 A;  4U8I A;  1XAN A;  2GMH A;  2J3N A;  1LTX R;  4B65 A;  1ZMC A;  4GDP A;  4A65 A;  4EIP A;  3QJ4 A;  1P2H A;  3ADA B;  4H4P A;  3OC4 A;  1ELI A;  2YR6 A;  1TDF A;  4FDC B;  2QCU A;  2WQY A;  2BS3 A;  4G74 A;  3M12 A;  1IUW A;  1PJ7 A;  1VQW A;  3QSS A;  4DNA A;  1SEZ A;  3T2Y A;  4EQX A;  2AAQ A;  2VRM A;  2JKC A;  4Z25 A;  1NG4 A;  3KD9 A;  2OAL A;  4B69 A;  3CN8 A;  4YTM A;  2VVL G;  4TM4 A;  2W0H A;  4EQW A;  3CMM A;  2NVK X;  3NN0 X;  3ITJ A;  2WEU A;  3CNT A;  3R9U A;  1B4V A;  1OJC A;  4AT0 A;  1FEA A;  1GT8 A;  4B68 A;  2Y6R A;  2XCG A;  2ZZC A;  3KPK A;  1K0I A;  4I59 A;  3P1W A;  2BAB A;  3KPF A;  4AP3 A;  4AOS A;  3HYW A;  3AEG A;  4MJW A;  2VQB A;  3NGC X;  3VR8 A;  1FEB A;  1S2Q A;  2GVC A;  2JAE A;  3DJJ A;  1GRB A;  2YLW A;  3T37 A;  1PJ5 A;  1PBB A;  1CL0 A;  3GRT A;  4X9M A;  1LQT A;  1TDO A;  2GV8 A;  3NN6 X;  3S61 A;  2JB1 A;  2X8C A;  4CNJ A;  1P2E A;  1FEC A;  2C73 A;  2VZ2 A;  4II2 A;  1PJ6 A;  2R46 A;  5LV9 A;  2Z5Y A;  2R45 A;  2C70 A;  2PHH A;  3AYJ A;  3JSK A;  3M13 A;  5HHF A;  4IVO B;  2YLS A;  3CPH G;  2YR4 A;  3G5Q A;  1D7Y A;  1DNC A;  2EQ7 A;  3AEC A;  4NEV A;  3RED A;  3VRD B;  1ZOY A;  2BRY A;  2E4G A;  1KSU A;  5TR3 A;  3RP7 A;  2RGH A;  4TM0 A;  5EB5 A;  3UTF A;  1PXA A;  2A89 A;  3ICR A;  4CY8 A;  3CND A;  3AYL A;  4GR1 A;  2XVE A;  4H7U A;  2Q7V A;  3IHG A;  3NIX A;  2V60 A;  2B76 A;  2YLT A;  4GRT A;  4TM1 A;  2A87 A;  1RP0 A;  3CNP A;  5L46 A;  2GB0 A;  4Z2T A;  2ZZ0 A;  4A6N A;  2Q0L A;  1GEU A;  4KX6 A;  1E1M A;  4K7Z A;  1BF3 A;  3PS9 A;  2X3N A;  2YQU A;  3UKL A;  3H8I A;  3C4A A;  2GQF A;  3Q9T A;  1UKV G;  5C2T A;  1N1P A;  4C74 A;  1TYP A;  3CGB A;  4GDE A;  2GR1 A;  4JY2 A;  5FS6 A;  1D7L A;  1PHH A;  1YQ4 A;  3QSE A;  3SZC A;  1CJ2 A;  4B64 A;  1E39 A;  2GR0 A;  4C5O A;  3D1C A;  2X8G A;  3LB8 A;  5CQF A;  1VG9 A;  4Z24 A;  3V76 A;  2RAB A;  3NK2 X;  3NH3 X;  2WDV A;  3URH A;  4H2N A;  1Y56 B;  3ATR A;  2R0C A;  1CC4 A;  4U8M A;  2DKH A;  4D04 A;  3PVC A;  5KNL A;  3NNE A;  3UKQ A;  4DGK A;  2WOI A;  1EL5 A;  1H82 A;  3GDN A;  2GH5 A;  2E1M A;  3LOV A;  4J31 A;  4TLX A;  1TDK A;  4C77 A;  1JU2 A;  1PN0 A;  2JK6 A;  4H4Y A;  3DME A;  4P9S A;  2OA1 A;  4NEW A;  3QVR A;  1BGN A;  2ZBW A;  3SFD A;  3UTE A;  2YLR A;  3T2Z A;  3AEE A;  4DSH A;  2XLS A;  1ZK7 A;  1H6V A;  3CIR A;  4G6H A;  1IUX A;  1JRY A;  1OJT A;  3CNS A;  4CRT A;  3ALJ A;  4EMJ A;  2WET A;  2YVF A;  3AE9 A;  2B9Y A;  1GRH A;  1YQZ A;  5U1O A;  3NKS A;  3T31 A;  1H83 A;  4LA1 A;  1M64 A;  2XVI A;  4YTP A;  1MOK A;  2GRT A;  1V59 A;  4X9N A;  3II4 A;  4G9K A;  1GND A;  5M0Z A;  4XXG A;  3SY4 A;  3EAO A;  3AE8 A;  1HYU A;  3OZ2 A;  4OPU A;  3DJD A;  2C3D A;  5EB4 A;  5J60 A;  3F8D A;  2C72 A;  3ICT A;  4GF7 A;  2C65 A;  3BHF A;  4OPD A;  1B5Q A;  2VQ7 A;  2YM1 A;  4H4X A;  1K0J A;  2I0Z A;  3GD3 A;  3CPJ G;  1BGJ A;  2A8X A;  1JEH A;  2BC0 A;  4A99 A;  4IV9 A;  3VR9 A;  2GR2 A;  3UOZ A;  2YG4 A;  4K5S A;  5M10 A;  5U63 A;  1CJ3 A;  1S3E A;  1Z6L A;  3CGE A;  4AP1 A;  1DOE A;  3LJP A;  4B67 A;  1ZOV A;  3AD7 B;  1O95 A;  4IVM B;  3NK0 X;  1VG0 A;  2RGO A;  3C4N A;  5FS8 A;  4EIQ A;  4YKG A;  1B8S A;  3SZW A;  3UKF A;  1IUU A;  4Y4L A;  4Z43 A;  3C96 A;  4H2R A;  3ZDN A;  4WCT A;  5FMH A;  5KOW A;  3UKP A;  4RG4 A;  3RP8 A;  1GER A;  3DH9 A;  4U2T A;  4K5R A;  4EMW A;  3AE4 A;  4UP3 A;  3VRB A;  4YXD A;  4YSH A;  4A5L A;  1LJ1 A;  4G73 A;  3P4P A;  4JNA A;  4EQS A;  2GAH B;  3T2K A;  2WP9 A;  4YSX A;  3FPZ A;  1DOB A;  4JNQ A;  4UDR A;  4XWR A;  3QFA A;  1YQ3 A;  4ADW A;  2XLP A;  1GRT A;  3QVP A;  1O94 A;  3UCL A;  4J2W A;  1K4Q A;  2AQJ A;  2QA1 A;  2VOU A;  4H4W A;  4K8D A;  3BNU A;  4M52 A;  4A6N B;  4NTD A;  4X4J A;  2GEW A;  2YLZ A;  3CGC A;  3G5S A;  1GPE A;  3IHM A;  5J7X A;  5KMR A;  1PBC A;  4B66 A;  1LV0 A;  3F8P A;  3P9U A;  2JBV A;  2VRL A;  1L9E A;  1PS9 A;  2BCG G;  4Y4M A;  3RP6 A;  4ECH A;  4K2X A;  1FL2 A;  5IQ1 A;  1REO A;  1ZMD A;  1JNZ A;  1CC2 A;  1ZX9 A;  3CTY A;  4NNJ A;  1H86 A;  5EOW A;  5ER0 A;  4N9X A;  1H84 A;  2BK3 A;  3AEA A;  4GAP A;  2CVJ A;  2WP5 A;  4IA5 A;  1H7X A;  1LVL A;  2YAU A;  3GSI A;  3P4S A;  4BK3 A;  4ZCD A;  2B9X A;  1Q9I A;  1IUT A;  2WS3 A;  5JCM A;  1BWC A;  2AR8 A;  1F6M A;  1GXF A;  2R4E A;  5U25 A;  4H50 A;  4BJY A;  1IUS A;  2FJA A;  3AE1 A;  4C3Y A;  2OLO A;  3AWI A;  3S5W A;  4PAB A;  4D03 A;  2C64 A;  4BK1 A;  2VVL A;  1GRF A;  2R9Z A;  2V61 A;  4HB9 A;  1DOC A;  2TPR A;  3AXB A;  4I58 A;  4J34 A;  4WX1 A;  3AE7 A;  3HYV A;  1NHP A;  3SXI A;  4B1B A;  4USR A;  5KWF A;  2FBW A;  3ATQ A;  4LII A;  4J56 A;  2TMD A;  2QAE A;  4PAA A;  4J33 A;  3UP4 A;  4BK2 A;  2BCP A;  2FJE A;  4CNK A;  4K22 A;  4UDQ A;  3NHO X;  3IF9 A;  2B9W A;  2WDQ A;  1E6E A;  3T0K A;  2WU5 A;  2WPF A;  2CFY A;  1N4U A;  4KPR A;  3V3O A;  4E0V A;  1XHC A;  4YT0 A;  4ICY A;  2IVE A;  3DGH A;  3P4R A;  3L8K A;  3L1R A;  3WE0 A;  4H2Q A;  4CCQ A;  1NG3 A;  3I3L A;  1EL8 A;  1GET A;  2YM2 A;  1CBO A;  1YKJ A;  4RSL A;  5FS9 A;  2BXS A;  3GYI A;  3SM8 A;  4GUV A;  1QJD A;  5JCN A;  1ZY8 A;  2XVF A;  3NTA A;  3HYX A;  3Q6J A;  2WPC A;  2F5Z A;  2GR3 A;  3NK1 X;  4RG3 A;  5KVH A;  2YG3 A;  1L9C A;  1X31 B;  4NZH A;  1NDA A;  4U8J A;  2HQM A;  4ZCC A;  2XLU A;  5HY5 A;  1M6I A;  3UOV A;  4YSZ A;  2YVG A;  3FMW A;  3K7M X;  1DJN A;  3IWA A;  4FX9 A;  3M0O A;  1DOD A;  2EQ9 A;  2Z5X A;  3LZW A;  3VQR A;  3GWD A;  3H4K A;  1KFY A;  4U2L A;  5FS7 A;  1GV4 A;  2R0G A;  3QSM A;  3UKA A;  2BYB A;  1E1N A;  1QO8 A;  1D4D A;  1JOA A;  3EPT A;  1Y0P A;  3UOY A;  3BI4 A;  4Z44 A;  3BNM A;  1NAA A;  2C66 A;  3P4Q A;  4Y4N A;  4EMI A;  3DJG X;  3I6D A;  4XWZ A;  4H4T A;  1NHQ A;  2B7R A;  2WOW A;  4TLZ A;  3UP5 A;  3LXD A;  4J57 A;  4H2P A;  3ISH A;  1YY5 A;  2YG5 A;  2BS2 A;  3BI2 A;  3ZYX A;  4H4U A;  4O5U A;  4BV6 A;  2FJD A;  2YR5 A;  4U2S A;  3AEF A;  5KOX A;  4GCM A;  1L9D A;  3AE6 A;  3KA7 A;  4U8P A;  1VRQ B;  3GYX A;  2V3B A;  1FCD A;  3DK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...