5KN1A

Recombinant bovine skeletal calsequestrin, high-ca2+ form
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
346
structure length
346
Chain Sequence
LDFPEYDGVDRVVNVNAKNYKNVFKKYEVLALLYHEPPEDDKASQRQFEMDELILELAAQVLEDKGVGFGMVDSEKDAAVAKKLGLTEEDSVYVFKGDEVIEYDGEFSADTLVEFLLDVLEDPVELIEGERELQAFENIEDDNKLIGYFKNKDSEHYKAYEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVSFVEAHKRSTLRKLKPESMYETWEDDLDGIHIVAFAEETDPDGYEFLETLKAVAQDNTDNPDLSIIWIDPDDFPLLVPYWEKTFNIDLSAPQIGVVNVTDADSVWMEMDDEEDLPSAEELEDWLEDVLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterization of Post-Translational Modifications to Calsequestrins of Cardiac and Skeletal Muscle.
pubmed doi rcsb
molecule keywords Calsequestrin
molecule tags Metal binding protein
source organism Bos taurus
total genus 102
structure length 346
sequence length 346
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2016-06-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn1A03
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn1A01
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 5kn1A02
2JZTA 2YWNA 4AF2A 1R5PA 3RPNA 5CRDA 4TR1B 5J9BA 4IP6A 4ZILA 3DRNA 3TJBA 3ZYWA 1M0UA 2H6ZA 2H30A 3U6VA 1U6TA 5D96A 2CV4A 3A2WA 1V9WA 1PA3A 3M8NA 2NPBA 3CRTA 3QR6A 3VI7A 4KA0A 3U5RE 2HZFA 1XWGA 2VL2A 2I3YA 2IMFA 4YQVA 2IMKA 2G0FA 2K6VA 4LMWA 4MK3A 2C80A 2XC2A 1IYIA 2FWEA 1NSWA 1GULA 4IS0A 1FVJA 5IPHA 2N5BA 1XIYA 10GSA 2F9SA 2H75A 4MCUA 3VURA 4PXOA 3H1NA 1SJZA 1HYUA 3GN3A 2GZPA 5HFIA 2FCHA 3KM6A 5IOWA 2HFDA 3TGZA 3UVHA 4GF0A 3PH9A 2HT9A 3RHCA 3EMPA 2YPMA 1YF0A 4JE1A 2B1KA 4IHUA 1W4VA 3QPMA 4TVEA 1N8JA 3HKRA 5GAPD 2EIOA 2V1MA 1JFUA 1TRVA 3C1RA 2FY6A 1AUCA 4FYBA 1EOHA 2XBQA 3GKNA 3SWLA 1EV4A 4MJEA 3VFIA 1SL0B 3KP9A 3F8UA 4E8HA 5G31A 3QFAC 3F63A 4HQZA 4K7NA 5AIXA 3FKFA 3F6FA 2A4VA 3APSA 2XPDA 3O76A 3LQ7A 1GL8A 1XWBA 3DWVA 3GV1A 4N30A 1PX7A 1RK4A 3ZVJA 4G10A 3ZIJA 3EYTA 5CAXA 2OBKA 2GDRA 5E59A 4ZB9A 5H5SA 4OWYA 2OA7A 4OO4A 1GUMA 4X1UA 2OE3A 1SKSB 3TB2A 1EV9A 4YQMA 2VL2C 3RPPA 4JRRA 1ABAA 1XW9A 2C0DA 4LL4B 1B9XC 5D9WA 5CREA 3LFLA 4CW9A 1GRXA 2LRNA 3CXGA 5A5KA 3WGXA 2X8CA 1SKRB 2FWHA 2R5GA 4QL9A 4F82A 4F0CA 4NPBA 4EKZA 1JZRA 18GSA 5CO3A 3C71A 4K0NA 4IBPA 4AJ8A 1EGOA 5HR2A 1MTCA 3CBUA 3DMLA 4G19A 2L5LA 2VD1A 1BYEA 1LBKA 2DIYA 4V2NA 5JCUA 1G0TA 4X0XA 1T3BA 2B5EA 1B9YC 3HJOA 3A2XA 4I2TA 2YV7A 2QC7A 5JWRB 4MJCA 1O8WA 2XHFA 2CX4A 3KMOA 1JHBA 3CRUA 2DIZA 2J9HA 1O8XA 3ZMLA 4NAXA 2N5AA 2L4QA 4ECJA 1YKAA 2CVDA 4ACSA 1BG5A 3O6TA 4TR0A 4YAPA 6GSUA 4F0BA 3HVXA 3HVVA 1TK0B 3L0HA 2XPEA 5IIZA 2YNXA 4BVYA 1Z6MA 5G5FA 2DJJA 4BA7A 1XOBA 4ZXGA 5A4VA 3CMIA 2JSZA 2I9HA 2O85A 3HZ4A 4EC0A 19GSA 3ZREA 1OKDA 2CA8A 4ZBBA 2Z9SA 1QK8A 4MLYA 3Q6OA 2MBTA 3OR5A 4J57E 1C72A 3GSTA 2CAQA 3MAKA 3A3TA 3ISOA 1M2DA 1WMJA 1SK2A 1E2YA 4MDCA 5DQSA 2LJRA 3EE2A 2QGVA 3PINA 4ZL7A 3GIXA 4HI7A 2XBIA 1GSSA 1U87A 3VPTA 1EWXA 2DBCA 3EURA 3ZRDA 2VIMA 5GSSA 2TIRA 2LNSA 1DSBA 4XRDA 4DVCA 5D8IA 1KEBA 1U3IA 2J23A 5F8BA 4XTSA 2B7KA 3KH9A 4EDYA 2L59A 4KAEA 1M9AA 4EXJA 3H93A 3TJFA 3EMXA 5IPGA 1ZCPA 2LEGA 2ZCTA 1V57A 5J4UA 5C00A 1F37A 1TK5B 1T1VA 2ZNMA 2MMZA 3L9UA 5CP1A 2DSAA 5DQYA 4DSRA 4ZB8A 2M46A 1ERTA 3WD6A 5EPFA 2IFQA 3IR4A 4RQRA 3QMXA 2JZRA 4KH7A 1N2AA 1FB6A 2OADA 1GSEA 1X5CA 2AYTA 3DXBA 2IFQB 4MF7A 1TTZA 4HJMA 3KJYA 3P2AA 5KN2A 5E4WA 4KDUA 2FA4A 1BEDA 2X8HA 3LYKA 1K0MA 1XWCA 4WXTA 4K8MA 1X5DA 1AIUA 3G7YA 4JR4A 5DALA 2RLIA 3DYRA 3GKMA 1GH2A 4OCEA 4XS1A 4IP1A 4TKYA 2OACA 5IMAA 4OO5A 3R2QA 2VCTA 4KB3A 3MSZA 1USBA 2IN3A 1G6YA 1AQVA 5DALB 5J3RA 1AQWA 2FNOA 2VLVA 1XWKA 11GSA 5A4UA 4OD7A 1SK0A 5ECOB 2L6CA 5DAKA 4GRFA 2KOKA 12GSA 3VWVA 5J9CA 3FY7A 1M99A 1SD8A 1BQ7A 1J9BA 1ZGNA 4LLRA 5DAKB 4I8BA 2QSIA 3V1WA 3UBKA 2WDUA 4FO5A 3P90A 4MZWA 4RI6A 3SBCA 4JU5A 2WULA 2YZUA 2P5QA 1YQ1A 4GTUA 3QAGA 1T7PB 3IA1A 5IOXA 2V6OA 4XIHA 2FA8A 3TJKA 1VF4A 3RBTA 4MH2A 1FW1A 5CRGA 2VL9A 1PRXA 3GTUA 4TXOA 2LNTA 5AGYA 5ECQB 2OE1A 4O7HA 2H6XA 1MDIA 2HZEA 3HHVA 3L4NA 1EEMA 3ERGA 14GSA 1V58A 2C4JA 1V98A 1Z5YE 2HZEB 3LYPA 4PQHA 1HD2A 5FWGA 4IJIA 3F4RA 4L5LA 1EZKA 2IMDA 2MYGA 2H0IA 5D9XA 3LXZA 1SJIA 2KLXA 5HR3A 17GSA 4KDXA 2AB6A 2DLXA 4PURA 2YOIA 1TXXA 1Z9HA 2CZ3A 2VCQA 1QMVA 3GHAA 4KNDA 1SYXA 1T4YA 2H74A 6GSSA 4MJBA 5L71A 4CDOA 5ABRA 5ECNB 4KDYA 4Q5FA 4HQSA 3HDCA 3E3EA 4WBRD 2GVPA 2IIYA 5DCHA 1SJ6A 4YAVA 1ZL9A 5IQYA 5H5RA 4JZQA 2HXKA 4YQUA 4NV5A 2NTOA 3GUSA 8GSSA 4OFMA 5ECMB 4IVFA 4PUFC 4F2IA 4MA9A 3ERFA 5D9TA 3HVSA 5ELGA 3K8NA 2GGTA 2IPAA 3W8JA 3S9FA 4HUAA 2L6DA 6GSTA 5LD0A 4PNGA 4ULXA 1XVWA 2H70A 1UVZA 4K1FA 2VLTA 4IW9A 2YN1A 2GQLA 1VGLA 3NOFA 1O85A 3TKQA 1A0RP 3J7Yk 5D9VA 1TU7A 4POMA 4PUAA 2FGXA 4IJ3A 2GZYA 2V2GA 5IMCA 2L4CA 1F2EA 1TDIA 1WRYA 2K9FA 3ZFBA 4GQCA 1Z7PA 2EIRA 1MDJA 2VCVA 1A2MA 2ON5A 3MWHA 3LG6A 3HZ8A 1PD21 3D22A 4LA1A 1EP7A 2IJYA 1YEPA 1LJRA 2VOCA 1E6BA 1KBNA 2X8GA 3AY8A 2P5RA 3E9JB 3CSJA 1WOUA 2BMXA 2JL4A 4ECBA 1ON4A 4Q5NA 2YWOA 1F9MA 1XFLA 1Y25A 1K3OA 5G2ZA 2B5YA 4TR3A 1XZOA 4L8EA 2PMTA 1GTBA 4HDEA 2VCWA 4I5QA 2HNLA 1ZYEA 4KX4A 3MNGA 3BOAA 3RDWA 1S3AA 6GSVA 5B6MA 1A2JA 5DBQA 2H1BA 1TI1A 3FEUA 2H73A 1GLPA 3EC3A 2JZSA 4K2DA 4PGTA 2WS2A 5IO2A 2CVKA 4I2UA 5LNKe 5CRHA 2GTUA 1SU9A 1F6MC 3M3MA 4KSMA 2H1GA 2C0GA 4WR4A 2RM6A 3IBHA 3KEBA 4IQ1A 4WEYA 3G9BA 4BPYA 4WF5A 4OFNA 1SL2B 2E2MA 3GFKA 1TU8A 1DUGA 5GAND 4IQAA 3KP8A 3GNJA 3CSIA 1A2LA 4HOJA 3QCPA 3H8QA 1YY7A 2CZ2A 2B1LA 2BJXA 4O5RA 4BL7A 1GLQA 4CHSA 1FOVA 3LEFA 1J0FA 1MEKA 1A24A 2LS5A 3TRXA 3GH9A 9GSSA 2R37A 5HR1A 3I9V2 2DJ3A 4ISDA 2YP6A 4FYUA 1SD9A 3TOTA 2MMOA 2IWTA 3GSSA 2V32A 4DSQA 1QFNA 4TOPA 3FZ4A 1GTUA 1BAYA 5J5NA 3N9JA 1AAZA 2JACA 3TJGA 5ECLB 2R2JA 2AUVA 2FLSA 4QQ7A 2GQMA 4NHWA 4N11A 3DEXA 2G2QA 1ML6A 2GT6A 2PPTA 5EVOA 2MZCA 3F4SA 1FB0A 4K7OA 4EE0A 2AHEA 1B4PA 1UA5A 1T00A 1I5GA 1PL2A 1WP0A 3HYPA 3UMAA 3TRQA 4ZL8A 4KSOA 5F07A 2FUG2 1G7OA 2B7JA 3TKRA 3D0ZA 4KGIA 3KCMA 4Z7XA 2H0HA 2HYXA 4FH8A 5EY6A 1JZWA 2MMAA 4TRXA 3VWUA 3US3A 1TRWA 2A2SA 5B8AA 5B8BA 3IK7A 5FT3A 1X9WB 3O3TA 3UJ1A 2KHPA 4MZBA 22GSA 2LUSA 2DMLA 3VI5A 3KD0A 3LSZA 1X0RA 1BX9A 2OKAA 2CAIA 2VUPA 3TKSA 4TXVA 3ZIVA 3CYNA 1THXA 2RUEA 5AIVA 4ML1A 3FYGA 4P3YB 3RAZA 4ZIJA 2GT5A 2K8VA 1EP8A 2VM2A 3UAPA 4BWSA 2JADA 5ECSA 3M1GA 3WT2A 2VAFA 1R7HA 5JCGA 1XW5A 2FWGA 2EC4A 3D4MA 3QAWA 3RHBA 1EOGA 1OC8A 4L5OA 4OMVA 1A8LA 4N0VA 5GSTA 1G7EA 4FIWA 2WB9A 3M0FA 3VK9A 3BD2A 4ZBAA 5IMFA 5ECRB 3TUEA 2B6MA 2LQOA 4V2MA 2YWIA 4DSSA 1SK1A 1VF2A 3BCIA 3DIEA 4XCSA 3IOSA 3QAVA 2LSTA 2LKUA 1OC9A 1SKWB 3LGCA 1RW1A 5DVBA 4PX1A 4HJ2A 3UARA 3H4KA 2LRCA 5C04A 2YV9A 4DEJA 1HNCA 3CTFA 1OE8A 2GZZA 2HRNA 5ECIB 4ID0A 1R5AA 1KNGA 1K0NA 5F06A 2H72A 1ST9A 3F4TA 2HSYA 3FZ9A 1K0BA 4F9ZA 4EDZA 2ON7A 4MF5A 1QXHA 4GWRA 2GSSA 1Y6EA 1XVQA 4ZBDA 2R3XA 3UBLA 1WJKA 2PGTA 1B48A 1K3YA 3APOA 2I81A 1S3CA 2TRXA 1U88A 5DJMA 4ILFA 5D73A 1UN2A 4BVXA 6GSYA 1ERWA 3TKSC 2O7KA 1HNBA 3ZZXA 4AGSA 1ACVA 2DJ2A 4MF6A 4IGJA 3IXRA 2AV4A 1R4WA 1WIKA 1THOA 2DJ0A 2GSRA 4HU7A 3TCOA 4PQ1A 4KCAA 2M80A 1ZYQB 1GP1A 2H76A 6GSWA 2H66A 1K0CA 1NHYA 4JEDA 1MDKA 2ES7A 1GUKA 1ERVA 3NZNA 4LMVA 2WFCA 2PUKC 3TKSE 1OAZA 2KUCA 2C3TA 2L5OA 1GNWA 4MZCA 2ZUPA 3BCKA 3VWXA 1R26A 1LU4A 1Q4JA 5IMDA 2CVBA 2C3QA 3GTUB 4TXOB 5GZZB 4EO3A 3I6AA 1CQGA 1AW9A 1GSQA 2DMMA 2VD0A 2A2RA 3IRAA 5ELAA 4JBBA 1XXUA 1ERUA 1URMA 4J56E 2KP1A 4AJ7A 1SENA 2E2GA 3DVWA 4GSSA 4J2FA 4MABA 4OCFA 4MPFA 2KP2A 4Q5QA 2H1AA 3IK9A 3JCML 3UIWA 3VWWA 2H19A 2YZHA 2LJKA 2F3MA 2L57A 2LRTA 3TKPA 3L9VA 1OVNA 4Q5RA 5IO0A 4KW6A 2DJKA 2O89A 2REMA 2MMNA 1A0FA 3MDKA 5ID2A 4MPGA 1SL1B 1GSFA 2E7PA 1XOAA 2K18A 4EF0A 2GSTA 3DVXA 5B6NA 1B4QA 4TR1A 3UVTA 1O6JA 3GKKA 4I6XA 3LWAA 1TP9A 2H01A 3I69A 5H5QA 1T4ZA 1AQXA 5G1LA 3TJJA 2VO4A 2WGRA 1QGVA 4ECCA 5KN1A 4XS6A 3ZMKA 2E0QA 1ZZYA 4N0ZA 4POBA 5JWOB 6GSXA 3H79A 3D4TA 1VRSD 4IN0A 1IYHA 4WF4A 4MMMA 5HFGA 2JSYA 1YF1A 3GKXA 2GSQA 2P31A 2WCIA 4OFTA 4IELA 3HCZA 4EUYA 5LCZA 13GSA 2WJUA 3G7JA 2V41A 2QKEA 3DKSA 3F6DA 4ECIA 5AISA 2YJHA 4NXIA 4JR6A 3KMNA 4LL1B 1F3BA 5B7CA 2NDOA 16GSA 3C7MA 2LJAA 5KN0A 5HQPA 1YJ6A 1QQ2A 5ENUA 1GSDA 3F3RA 3KIJA 1XBSA 5G30A 1TI3A 4RI7A 3EWLA 1PX6A 2RUFA 2I4AA 4XRAA 1M2AA 3GYKA 4V1Ag 2H71A 1AXDA 3ZFLA 2B5XA 1NM3A 3IPZA 2C0EA 1G6WA 4KCEA 2AJQB 4NHZA 3APQA 1AC1A 2VM1A 4GCIA 3KGKA 2LQQA 4PQIA 1JLWA 2DC5A 1SYRA 4D73A 3F0IA 5IM9A 3KH7A 2PBJA 3QOUA 4KE3A 5G1KA 2LTKA 4IKHA 3GMFA 3FRCA 5ECHB 1TJDA 3WGEA 4D73B 1RQMA 5ECPB 5ECKB 4ZL9A 5F0GA 2IMIA 1O73A 2F8AA 3E0UA 3FK8A 3WT1A 4GQFA 4EL1A 1U3AA 4BWQA 2V6KA 3ED3A 4I97A 3GH6A 5A4WA 2B3SA 5DCGA 1O7UA 4XS4A 1OC3A 2GQKA 2H6YA 4V1Ap 1PL1A 1B8XA 3LORA 1JZDA 4NWYA 4G9HA 2PU9C 3G7IA 5JWQB 3I43A 4MP4A 2HSHA 4XS4B 5COHA 1M7TA 2NBSA 3UEMA 2CQ9A 2AAWA 1ZOFA 3CSHA 1M2BA 3HA9A 3C1SA 2OBIA 3IAS2 3HXSA 3GRXA 1M9BA 1TRSA 4HS1A 5DJLA 3F9UA 2X64A 1YZXA 3IDVA 20GSA 1TOFA 2H1DA 2O8VB 3P7XA 3QFBC 5HR0A 5CRWA 2DJ1A 1DE2A 5JCWA 1PN9A 4O32A 3BBYA 3TOUA 1FHEA 1QUWA 5INYA 1GWCA 1Z6NA 1DE1A 1XPVA 3EU3A 4L0UA 4ML6A 4XHMA 3BJ5A 4TR4A 1NHOA 3IAM2 1VF1A 3TRPA 5HFKA 3ZL5A 3C73A 2ALBA 5IMZA 1TW9A 5AN1A 4L0WA 1UC7A 3LXTA 3GA4A 2VLUA 2RIIA 4K0GA 2IMEA 4HZ2A 1EEJA 2YWMA 3QDNA 4TN8A 1PGTA 4X43A 2YANA 4QL7A 1J08A 2HRFA 5FHIA 3HY2A 4HZ4A 3IHQA 4NV2A 2C0FA 5G5EA 2BTOT 1JLVA 4AJ6A 3A2VA 3FZ5A 1OYJA 1K0OA 2PVQA 2CX3A 3D21A 1GSYA 3VPQA 4GLTA 4GSNA 1O81A 3A5WA 1KTEA 1GNEA 1Z7RA 3EVIA 4HU9A 3GL5A 2P0GA 3ERWA 1XCCA 1HNAA 1VF3A 2K8SA 3FR6A 4K9ZA 2PVOC 7GSSA 2WRTA 1A8YA 1T8EB 3L9SA 2C3NA 1GUHA 1X9MB 1X5EA 3UL3A 2F8FA 2H8LA 2PERA 2EIQA 4MH3A 2IL3A 1YDKA 4G2EA 4RUVA 3UOMA 2VCZA 5CNWA 4DSSB 1DBYA 3IC4A 4WR5A 5CYYA 2JU5A 3P8WA 2M72A 1A23A 3GL3A 1OC9B 1V2AA 4ZB6A 2GS3A 2FHEA 2GLRA 1EGRA 3Q18A 3VLNA 1PQNA 3TDGA 4WKWA 3W8SA 1XW6A 2HI7A 3N5OA 1PMTA 3FZAA 3WGDA 1BJXA 3ME8A 1OE7A 4YH2A 1WPIA 3IE3A 4EVMA 1FG4A 2R4VA 1XWAA 3D5JA 1TKDB 2D2ZA 2N5FA 3DD3A 5DDLA 4WBJA 4K7IA 1TK8B 3EU4A 3C8EA 3FR3A 2NVLA 1K0DA 3DGQA 3FHKA 2OE0A 3ZVJD 1ZMAA 5D93A 3CTGA 3W6GA 1H4OA 1X9SB 1NW2A 2R6KA 1W89A 1GTIA 2F51A 1TRUA 3PGTA 2VL3A 4POLA 3GX8A 1YKCA 1PSQA 3D6IA 2YJ7A 1I9DA 2OJLA 3KXOA 2WZ9A 2LV3A 3ZLPA 4GXZA 1Q98A 1FAAA 3FW2A 2TRCP 5J41A 3FR9A 2C1YA 2VCXA 3IV4A 4RQXA 3ZITA 4PNFA 1Z3EA 1GTAA 1V40A 1CQHA 4KUNA 1PKZA 2PN8A 1PKWA 3HJMA 4V2LA 2O87A 1MD3A 2MBSA 4NMUA 4HEA2 4MJAA 1ILOA 2YCDA 4N10A 1FO5A 3KZQA 1MD4A 1WE0A 3KTBA 3NIVA 4WETA 3ME7A 2H0GA 4POKA 2I1UA 5EL8A 3Q19A 3KTLA 5F05A 4F03A 3M9JA 2PWJA 3J7Yb 1GSUA 4O92A 1YEXA 2RM5A 3Q74A 3QD9A 5KEJA 1HQOA 3LJRA 2FWFA 4H86A 3ZTLA 1OKTA 1K0AA 3PR8A 5IMVA 1S3DA 4E8EA 3GURA 3M9KA 3HJPA 2X99A 3EINA 3HD5A 3GX0A 4FYCA 4TW5A 2HE3A 2HLSA 1F3AA 5ID2B 1FVKA 4GSTA 5KN3A 1K3LA 1JZOA 4K6XA 3L78A 1H75A 3WYWA 1WWJA 2C8UA 2CT6A 3F3QA 2FD3A
chains in the Genus database with same CATH superfamily
2JZTA 2YWNA 4AF2A 3PPUA 1R5PA 3RPNA 5CRDA 4TR1B 5J9BA 4IP6A 4ZILA 3DRNA 3TJBA 3ZYWA 1M0UA 2H6ZA 2H30A 3U6VA 1U6TA 5D96A 2CV4A 3A2WA 1V9WA 1PA3A 3M8NA 2NPBA 3CRTA 3QR6A 3VI7A 4KA0A 4CY8A 3U5RE 2HZFA 1XWGA 2VL2A 2I3YA 2IMFA 4YQVA 2IMKA 2G0FA 2K6VA 4LMWA 4MK3A 2C80A 2XC2A 1IYIA 2FWEA 1NSWA 1GULA 4IS0A 1FVJA 5IPHA 2N5BA 1XIYA 10GSA 2F9SA 2H75A 4MCUA 3VURA 4PXOA 3H1NA 1SJZA 1HYUA 3GN3A 2GZPA 5HFIA 2FCHA 3KM6A 5IOWA 2HFDA 3TGZA 3UVHA 4GF0A 3PH9A 2HT9A 3RHCA 4ICYA 3EMPA 2YPMA 1YF0A 4JE1A 2B1KA 4IHUA 2QA1A 1ZYPA 1W4VA 3QPMA 4TVEA 2A4HA 1N8JA 3CQFA 3HKRA 5GAPD 2EIOA 2V1MA 1JFUA 1TRVA 3C1RA 2FY6A 1AUCA 4FYBA 1EOHA 2XBQA 3GKNA 3SWLA 1EV4A 4MJEA 2X4AA 3VFIA 1SL0B 3KP9A 3F8UA 4E8HA 5G31A 3QFAC 3F63A 4HQZA 4K7NA 5AIXA 3FKFA 3F6FA 2A4VA 3APSA 2XPDA 3O76A 3LQ7A 1GL8A 1XWBA 3DWVA 3GV1A 4N30A 1PX7A 1RK4A 3ZVJA 4G10A 3ZIJA 3EYTA 5CAXA 2OBKA 4HSCX 2GDRA 5E59A 4ZB9A 5H5SA 4OWYA 2OA7A 4OO4A 1GUMA 4X1UA 3MYDA 2OE3A 1SKSB 3TB2A 1EV9A 4YQMA 2VL2C 3RPPA 4JRRA 1ABAA 1XW9A 2C0DA 4LL4B 1B9XC 5D9WA 5CREA 3LFLA 4CW9A 1GRXA 2LRNA 3CXGA 5A5KA 3WGXA 2X8CA 1SKRB 2FWHA 2R5GA 4QL9A 4F82A 4F0CA 4NPBA 4EKZA 1JZRA 18GSA 5CO3A 3C71A 4K0NA 4IBPA 4G0KA 4AJ8A 1EGOA 5HR2A 1MTCA 3CBUA 3DMLA 4G19A 2L5LA 2VD1A 1BYEA 1LBKA 2DIYA 1PN0A 4YKFA 4V2NA 5JCUA 1G0TA 4X0XA 1T3BA 2B5EA 1B9YC 3HJOA 3A2XA 4I2TA 2YV7A 2QC7A 5JWRB 4MJCA 1O8WA 2XHFA 2CX4A 3KMOA 2R0CA 1JHBA 3CRUA 2DIZA 2J9HA 1O8XA 3ZMLA 4NAXA 2N5AA 1FOHA 2L4QA 4ECJA 1YKAA 2CVDA 4ACSA 1BG5A 3O6TA 4TR0A 4YAPA 6GSUA 4F0BA 3HVXA 3HVVA 1TK0B 3L0HA 2XPEA 5IIZA 2YNXA 4BVYA 1Z6MA 5G5FA 2DJJA 4BA7A 1XOBA 4ZXGA 5A4VA 3CMIA 2JSZA 2I9HA 2O85A 3HZ4A 4EC0A 19GSA 3ZREA 1OKDA 3MIXA 2CA8A 4ZBBA 2Z9SA 1QK8A 4MLYA 3Q6OA 2MBTA 3OR5A 4EIPA 4J57E 1C72A 3GSTA 2CAQA 3MAKA 3A3TA 3ISOA 1M2DA 1WMJA 1SK2A 1E2YA 4MDCA 5DQSA 2LJRA 3EE2A 2QGVA 3PINA 4ZL7A 3GIXA 4HI7A 2XBIA 1GSSA 1U87A 3VPTA 1EWXA 2DBCA 3EURA 3ZRDA 2VIMA 5GSSA 2TIRA 2LNSA 1DSBA 4XRDA 4BIKA 4DVCA 5D8IA 1KEBA 1U3IA 2J23A 3FMWA 5F8BA 4XTSA 2B7KA 3KH9A 4EDYA 2L59A 4KAEA 1M9AA 4EXJA 3H93A 3TJFA 3EMXA 5IPGA 1ZCPA 2LEGA 2ZCTA 1V57A 5J4UA 5C00A 1F37A 1TK5B 1T1VA 2ZNMA 2MMZA 3L9UA 5CP1A 2DSAA 4K5RA 5DQYA 4DSRA 4ZB8A 2M46A 1ERTA 3WD6A 5EPFA 4X4JA 2IFQA 3IR4A 4RQRA 3QMXA 2JZRA 4KH7A 1N2AA 1FB6A 2OADA 1GSEA 1X5CA 2AYTA 3DXBA 2IFQB 4MF7A 1TTZA 4HJMA 3KJYA 3P2AA 5KN2A 5E4WA 4KDUA 2FA4A 1BEDA 2X8HA 4K5SA 3LYKA 1K0MA 1XWCA 4WXTA 4K8MA 1X5DA 1AIUA 3G7YA 4JR4A 5DALA 2RLIA 3DYRA 3GKMA 1GH2A 4OCEA 4XS1A 4IP1A 4TKYA 2OACA 5IMAA 4OO5A 3R2QA 2VCTA 4KB3A 3MSZA 1USBA 2IN3A 1G6YA 1AQVA 5DALB 5J3RA 1AQWA 2FNOA 2VLVA 1XWKA 11GSA 5A4UA 4OD7A 1SK0A 5ECOB 2L6CA 4GRFA 5DAKA 2KOKA 12GSA 3VWVA 5J9CA 3FY7A 1M99A 1SD8A 1BQ7A 1J9BA 1ZGNA 4LLRA 5DAKB 4I8BA 2QSIA 3V1WA 3UBKA 2WDUA 4FO5A 3P90A 4MZWA 4RI6A 3SBCA 4JU5A 2WULA 2YZUA 2P5QA 1YQ1A 4GTUA 3QAGA 1T7PB 3IA1A 4O5UA 2V6OA 5IOXA 4XIHA 2FA8A 3TJKA 1VF4A 3RBTA 4MH2A 1FW1A 5CRGA 2VL9A 1PRXA 3GTUA 4TXOA 2LNTA 5AGYA 5ECQB 2OE1A 4O7HA 2H6XA 1MDIA 2HZEA 3HHVA 3L4NA 1EEMA 3ERGA 14GSA 1V58A 2C4JA 4CY6A 1V98A 1Z5YE 2HZEB 3LYPA 4PQHA 1HD2A 5FWGA 4IJIA 3F4RA 4L5LA 1EZKA 2IMDA 2MYGA 2H0IA 5D9XA 3LXZA 1SJIA 2KLXA 5HR3A 17GSA 4KDXA 2AB6A 2DLXA 4PURA 1PFOA 2YOIA 1TXXA 1Z9HA 1ZYNA 2CZ3A 2VCQA 1QMVA 3GHAA 4KNDA 1SYXA 1T4YA 2H74A 6GSSA 4MJBA 5L71A 4CDOA 5ABRA 5ECNB 4KDYA 4Q5FA 4HQSA 3HDCA 3E3EA 4WBRD 2GVPA 2IIYA 5DCHA 1SJ6A 4YAVA 1ZL9A 4G0LA 5IQYA 5H5RA 4JZQA 2HXKA 4YQUA 4NV5A 2NTOA 3GUSA 8GSSA 4OFMA 5ECMB 4IVFA 4PUFC 4F2IA 4MA9A 3ERFA 5D9TA 3HVSA 5ELGA 3K8NA 2GGTA 4PTSA 2IPAA 3W8JA 3S9FA 4HUAA 2L6DA 6GSTA 5LD0A 4PNGA 4ULXA 1XVWA 2H70A 1UVZA 4K1FA 2VLTA 4IW9A 2YN1A 2GQLA 1VGLA 3NOFA 1O85A 3TKQA 1A0RP 3J7Yk 5D9VA 1TU7A 4POMA 4PUAA 2FGXA 4IJ3A 2GZYA 2V2GA 5IMCA 2L4CA 1F2EA 1TDIA 1WRYA 2K9FA 3ZFBA 4GQCA 1Z7PA 2EIRA 1MDJA 2VCVA 1A2MA 2ON5A 3MWHA 3LG6A 3HZ8A 1PD21 3D22A 4LA1A 1EP7A 2IJYA 1YEPA 1LJRA 2VOCA 1E6BA 1KBNA 2X8GA 3AY8A 2P5RA 3E9JB 3CSJA 1WOUA 2BMXA 2JL4A 4ECBA 1ON4A 4Q5NA 2YWOA 1F9MA 1XFLA 1Y25A 1K3OA 5G2ZA 2B5YA 4TR3A 1XZOA 4L8EA 2PMTA 1GTBA 4HDEA 2VCWA 4I5QA 2HNLA 1ZYEA 4KX4A 3MNGA 3BOAA 3RDWA 1S3AA 6GSVA 5B6MA 1A2JA 5DBQA 2H1BA 1TI1A 3FEUA 2H73A 1GLPA 3EC3A 2JZSA 4K2DA 4PGTA 2WS2A 5IO2A 2CVKA 4I2UA 5LNKe 5CRHA 2GTUA 1SU9A 1F6MC 3M3MA 4KSMA 1M3IA 2H1GA 2C0GA 4WR4A 2RM6A 3IBHA 3KEBA 4IQ1A 4WEYA 3G9BA 4BPYA 4WF5A 4OFNA 1SL2B 2E2MA 3GFKA 1TU8A 1DUGA 5GAND 4IQAA 3KP8A 3GNJA 3CSIA 1A2LA 4HOJA 3QCPA 3H8QA 1YY7A 2CZ2A 2B1LA 2BJXA 4O5RA 4BL7A 1GLQA 4CHSA 1FOVA 3LEFA 1J0FA 1MEKA 1A24A 2LS5A 3TRXA 3GH9A 9GSSA 2R37A 5HR1A 3I9V2 2DJ3A 4ISDA 2YP6A 4FYUA 1SD9A 3TOTA 2MMOA 2IWTA 3GSSA 2V32A 4DSQA 1QFNA 4TOPA 3FZ4A 1GTUA 1BAYA 5J5NA 3N9JA 1AAZA 2JACA 3TJGA 5ECLB 2R2JA 2AUVA 2FLSA 4QQ7A 2GQMA 4NHWA 4N11A 3DEXA 2G2QA 1ML6A 2GT6A 2R0PA 2PPTA 5EVOA 2MZCA 3F4SA 1FB0A 4K7OA 4EE0A 2AHEA 1B4PA 1UA5A 1T00A 1I5GA 1PL2A 1WP0A 3HYPA 3UMAA 3TRQA 4ZL8A 4KSOA 5F07A 2FUG2 1G7OA 2B7JA 3TKRA 3D0ZA 4KGIA 3KCMA 4BVYB 4Z7XA 2H0HA 2HYXA 4FH8A 5EY6A 1JZWA 2MMAA 4TRXA 3VWUA 3US3A 1TRWA 2A2SA 5B8AA 5B8BA 2HRKA 3IK7A 5FT3A 1X9WB 3O3TA 3UJ1A 2KHPA 4Z2UA 4MZBA 22GSA 2LUSA 2DMLA 3VI5A 3KD0A 3LSZA 1X0RA 1BX9A 2OKAA 2CAIA 2VUPA 3TKSA 4TXVA 3A5IA 3ZIVA 3CYNA 1THXA 2HSMA 2RUEA 5AIVA 4ML1A 3FYGA 4P3YB 3RAZA 4ZIJA 2GT5A 2K8VA 1EP8A 2VM2A 3UAPA 4BWSA 2JADA 5ECSA 3M1GA 3WT2A 2VAFA 1R7HA 5JCGA 1XW5A 2FWGA 2EC4A 3D4MA 3QAWA 3RHBA 1EOGA 1OC8A 4L5OA 4OMVA 1A8LA 4N0VA 5GSTA 1G7EA 4FIWA 2WB9A 3M0FA 3VK9A 3BD2A 4ZBAA 5IMFA 5ECRB 3TUEA 2B6MA 2LQOA 4V2MA 2YWIA 4DSSA 1SK1A 1VF2A 3BCIA 3DIEA 4XCSA 3IOSA 3QAVA 2LSTA 4FQUA 2LKUA 1OC9A 4Z2TA 1SKWB 3LGCA 1RW1A 5DVBA 4PX1A 4HJ2A 3UARA 3H4KA 2LRCA 5C04A 2YV9A 4DEJA 1HNCA 3CTFA 1OE8A 2GZZA 2HRNA 5ECIB 4ID0A 1R5AA 1KNGA 1K0NA 5F06A 2H72A 1ST9A 3F4TA 2HSYA 3FZ9A 1K0BA 4F9ZA 4EDZA 2ON7A 4MF5A 1QXHA 4GWRA 2GSSA 1Y6EA 1XVQA 4ZBDA 2R3XA 3UBLA 1WJKA 2PGTA 1B48A 1K3YA 3APOA 2I81A 1S3CA 2TRXA 1U88A 5DJMA 4ILFA 5D73A 1UN2A 4BVXA 6GSYA 1ERWA 3TKSC 2O7KA 1HNBA 3ZZXA 4AGSA 1ACVA 2DJ2A 4MF6A 4IGJA 3IXRA 2AV4A 1R4WA 1WIKA 4BVXB 1THOA 2DJ0A 2GSRA 4HU7A 3TCOA 4PQ1A 4KCAA 2M80A 1ZYQB 1GP1A 2H76A 6GSWA 2H66A 5BRTA 1K0CA 1NHYA 4JEDA 1MDKA 2ES7A 1GUKA 1ERVA 3NZNA 4LMVA 4O5QA 2WFCA 2PUKC 3TKSE 1OAZA 2KUCA 2C3TA 2L5OA 1GNWA 4MZCA 2ZUPA 3BCKA 3VWXA 1R26A 4G0IA 4A5PA 1LU4A 1Q4JA 5IMDA 2CVBA 2C3QA 3GTUB 4TXOB 5GZZB 4EO3A 3I6AA 1CQGA 1AW9A 1GSQA 2DMMA 2VD0A 2A2RA 3IRAA 5ELAA 4JBBA 1XXUA 1ERUA 1URMA 4J56E 2KP1A 4AJ7A 1SENA 2E2GA 3DVWA 4GSSA 4J2FA 4MABA 4OCFA 4MPFA 2KP2A 4Q5QA 2H1AA 3IK9A 3JCML 4MNNA 3UIWA 3VWWA 2H19A 2YZHA 2LJKA 2F3MA 2L57A 2LRTA 3TKPA 3L9VA 1OVNA 4Q5RA 5IO0A 4KW6A 2DJKA 2O89A 2REMA 2MMNA 1A0FA 3MDKA 5ID2A 4MPGA 1SL1B 1GSFA 2E7PA 1XOAA 2K18A 4EF0A 2GSTA 3DVXA 5B6NA 1B4QA 4TR1A 3UVTA 1O6JA 3GKKA 4I6XA 3LWAA 1TP9A 2H01A 3I69A 5H5QA 1T4ZA 1AQXA 5G1LA 3TJJA 2VO4A 2WGRA 1QGVA 4ECCA 5KN1A 4XS6A 3ZMKA 2E0QA 1ZZYA 4N0ZA 4POBA 5JWOB 2HRAA 6GSXA 3H79A 3D4TA 1VRSD 4IN0A 1IYHA 4WF4A 4MMMA 5HFGA 2JSYA 1YF1A 3GKXA 2GSQA 5KOWA 2P31A 2WCIA 4OFTA 4IELA 3HCZA 4EUYA 5LCZA 13GSA 2WJUA 3G7JA 2V41A 2QKEA 3DKSA 3LW9A 3F6DA 4ECIA 5AISA 2YJHA 4NXIA 4JR6A 3KMNA 4LL1B 1F3BA 4KF9A 5B7CA 2NDOA 16GSA 3C7MA 2LJAA 5KN0A 5HQPA 1YJ6A 1QQ2A 5ENUA 1GSDA 3F3RA 3KIJA 1XBSA 5G30A 1TI3A 4RI7A 3EWLA 4EIQA 2DKHA 1PX6A 2RUFA 2I4AA 4XRAA 1M2AA 3GYKA 4V1Ag 2H71A 1AXDA 3ZFLA 2B5XA 1NM3A 1XG8A 3IPZA 2C0EA 1G6WA 4KCEA 2AJQB 4NHZA 3APQA 4YKGA 1AC1A 2VM1A 4GCIA 3KGKA 2LQQA 4PQIA 1JLWA 2DC5A 1SYRA 4D73A 3F0IA 5IM9A 3KH7A 2PBJA 3QOUA 4KE3A 5G1KA 2LTKA 4IKHA 3GMFA 3FRCA 5ECHB 1TJDA 5KOXA 3WGEA 1M3JA 4D73B 2UZ8A 1RQMA 5ECPB 5ECKB 4ZL9A 5F0GA 2IMIA 1O73A 2F8AA 3E0UA 3FK8A 3WT1A 4GQFA 4EL1A 1U3AA 4BWQA 2V6KA 3ED3A 4I97A 3GH6A 5A4WA 2B3SA 5DCGA 1O7UA 4XS4A 1OC3A 2GQKA 2H6YA 4V1Ap 1PL1A 1B8XA 3LORA 2DKIA 1JZDA 3R3EA 4NWYA 4G9HA 2PU9C 3G7IA 5JWQB 3I43A 4MP4A 2HSHA 4XS4B 5COHA 1M7TA 2NBSA 3UEMA 4BL7B 2CQ9A 2AAWA 1ZOFA 3CSHA 1M2BA 3HA9A 3C1SA 2OBIA 3IAS2 3HXSA 3GRXA 1M9BA 4USSA 1TRSA 4HS1A 5DJLA 3F9UA 2X64A 1YZXA 3IDVA 20GSA 1TOFA 2H1DA 2O8VB 3P7XA 3QFBC 5HR0A 5CRWA 2DJ1A 1DE2A 5JCWA 1PN9A 4O32A 3BBYA 3TOUA 1FHEA 1QUWA 5INYA 1GWCA 1Z6NA 1DE1A 1XPVA 3EU3A 4L0UA 4ML6A 4XHMA 3BJ5A 4TR4A 1NHOA 3IAM2 1VF1A 3TRPA 5HFKA 3ZL5A 3C73A 2ALBA 5IMZA 1TW9A 2A2PA 5AN1A 4L0WA 1UC7A 3LXTA 3GA4A 2VLUA 2RIIA 4K0GA 2IMEA 4HZ2A 1EEJA 2YWMA 3QDNA 4TN8A 1PGTA 4X43A 2YANA 4QL7A 1J08A 2HRFA 5FHIA 3HY2A 4HZ4A 3IHQA 4NV2A 2C0FA 5G5EA 2BTOT 1S3RA 1JLVA 4AJ6A 3A2VA 3FZ5A 1OYJA 1K0OA 2PVQA 2CX3A 3D21A 1GSYA 3VPQA 4GLTA 4GSNA 4Z2RA 1O81A 3A5WA 1KTEA 1GNEA 1Z7RA 3EVIA 4HU9A 3GL5A 2P0GA 3ERWA 4K2XA 1XCCA 1HNAA 1VF3A 2K8SA 3FR6A 4K9ZA 2PVOC 7GSSA 2WRTA 1A8YA 1T8EB 3L9SA 2C3NA 1GUHA 1X9MB 1X5EA 3UL3A 2F8FA 2H8LA 2PERA 2EIQA 4MH3A 2IL3A 1YDKA 4G2EA 4RUVA 3UOMA 2VCZA 5CNWA 4DSSB 1DBYA 3IC4A 4WR5A 5CYYA 2JU5A 3P8WA 2M72A 1A23A 3GL3A 1OC9B 1V2AA 4ZB6A 5BMUA 2GS3A 2FHEA 2GLRA 1EGRA 3Q18A 3VLNA 1PQNA 3TDGA 4WKWA 3W8SA 1XW6A 2HI7A 3N5OA 1PMTA 3FZAA 3WGDA 1BJXA 3ME8A 1OE7A 4YH2A 1WPIA 3IE3A 4EVMA 1FG4A 2R4VA 1XWAA 3D5JA 1TKDB 2D2ZA 2N5FA 3DD3A 5DDLA 4WBJA 4K7IA 1TK8B 3EU4A 3C8EA 3FR3A 2NVLA 1K0DA 3DGQA 3FHKA 2OE0A 3ZVJD 1ZMAA 5D93A 3CTGA 3W6GA 1H4OA 1X9SB 1NW2A 2R6KA 1W89A 1GTIA 2F51A 1TRUA 3PGTA 2VL3A 4POLA 3IHGA 3GX8A 1YKCA 1PSQA 3EPTA 3D6IA 2X49A 2YJ7A 1I9DA 2OJLA 3KXOA 2WZ9A 2LV3A 3ZLPA 4GXZA 1Q98A 1FAAA 3FW2A 2TRCP 5J41A 3FR9A 2C1YA 2VCXA 3IV4A 4RQXA 3ZITA 4PNFA 3HVNA 1Z3EA 1GTAA 1V40A 1CQHA 4KUNA 1PKZA 2PN8A 1PKWA 3IC8A 3HJMA 4V2LA 2O87A 1MD3A 2MBSA 4NMUA 4HEA2 4MJAA 1ILOA 2YCDA 4N10A 1FO5A 3KZQA 1MD4A 1WE0A 3KTBA 3NIVA 4WETA 3ME7A 2H0GA 4POKA 2I1UA 5EL8A 3Q19A 3KTLA 5F05A 4F03A 3M9JA 2PWJA 2R0GA 3J7Yb 1GSUA 4O92A 1YEXA 2RM5A 3Q74A 3QD9A 5KEJA 1HQOA 3LJRA 2FWFA 4H86A 3ZTLA 1OKTA 1K0AA 3PR8A 5IMVA 1S3DA 4E8EA 3GURA 3M9KA 3HJPA 2QA2A 2X99A 3EINA 3HD5A 3GX0A 4FYCA 4TW5A 2HE3A 2HLSA 1F3AA 5ID2B 1FVKA 4GSTA 5KN3A 1K3LA 1JZOA 4K6XA 3L78A 1H75A 3WYWA 1WWJA 2C8UA 2CT6A 3F3QA 2FD3A
chains in the Genus database with same CATH topology
2JZTA 2YWNA 4AF2A 3PPUA 1R5PA 3RPNA 5CRDA 4TR1B 5J9BA 4IP6A 4ZILA 3DRNA 3TJBA 3ZYWA 1M0UA 2H6ZA 2H30A 3U6VA 1U6TA 5D96A 2CV4A 3A2WA 1V9WA 1PA3A 3M8NA 2NPBA 3CRTA 3QR6A 3VI7A 4KA0A 4CY8A 3U5RE 2HZFA 1XWGA 2VL2A 2I3YA 2IMFA 4YQVA 2IMKA 2G0FA 2K6VA 4LMWA 4MK3A 2C80A 2XC2A 1IYIA 2FWEA 1NSWA 1GULA 4IS0A 1FVJA 5IPHA 2N5BA 1XIYA 10GSA 2F9SA 2H75A 4MCUA 3VURA 4PXOA 3H1NA 1SJZA 1HYUA 3GN3A 2GZPA 5HFIA 2FCHA 3KM6A 5IOWA 2HFDA 3TGZA 3UVHA 4GF0A 3PH9A 2HT9A 3RHCA 4ICYA 3EMPA 2YPMA 1YF0A 4JE1A 2B1KA 4IHUA 2QA1A 1ZYPA 1W4VA 3QPMA 4TVEA 2A4HA 1N8JA 3HKRA 5GAPD 2EIOA 2V1MA 1JFUA 1TRVA 3C1RA 2FY6A 1AUCA 4FYBA 1EOHA 2XBQA 3GKNA 3SWLA 1EV4A 4MJEA 2X4AA 3VFIA 1SL0B 3KP9A 3F8UA 4E8HA 5G31A 3QFAC 3F63A 4HQZA 4K7NA 5AIXA 3FKFA 3F6FA 2A4VA 3APSA 2XPDA 3O76A 3LQ7A 1GL8A 1XWBA 3DWVA 3GV1A 4N30A 1PX7A 1RK4A 3ZVJA 4G10A 3ZIJA 3EYTA 5CAXA 2OBKA 2GDRA 5E59A 4ZB9A 5H5SA 4OWYA 2OA7A 4OO4A 1GUMA 4X1UA 3MYDA 2OE3A 1SKSB 3TB2A 1EV9A 4YQMA 2VL2C 3RPPA 4JRRA 1ABAA 1XW9A 2C0DA 4LL4B 1B9XC 5D9WA 5CREA 3LFLA 4CW9A 1GRXA 2LRNA 3CXGA 5A5KA 3WGXA 2X8CA 1SKRB 2FWHA 2R5GA 4QL9A 4F82A 4F0CA 4NPBA 4EKZA 1JZRA 18GSA 5CO3A 3C71A 4K0NA 4IBPA 4G0KA 4AJ8A 1EGOA 5HR2A 1MTCA 3CBUA 3DMLA 4G19A 2L5LA 2VD1A 1BYEA 1LBKA 2DIYA 1PN0A 4YKFA 4V2NA 5JCUA 1G0TA 4X0XA 1T3BA 2B5EA 1B9YC 3HJOA 3A2XA 4I2TA 2YV7A 2QC7A 5JWRB 4MJCA 1O8WA 2XHFA 2CX4A 3KMOA 2R0CA 1JHBA 3CRUA 2DIZA 2J9HA 1O8XA 3ZMLA 4NAXA 2N5AA 1FOHA 2L4QA 4ECJA 1YKAA 2CVDA 4ACSA 1BG5A 3O6TA 4TR0A 4YAPA 6GSUA 4F0BA 3HVXA 3HVVA 1TK0B 3L0HA 2XPEA 5IIZA 2YNXA 4BVYA 1Z6MA 5G5FA 2DJJA 4BA7A 1XOBA 4ZXGA 5A4VA 3CMIA 2JSZA 2I9HA 2O85A 3HZ4A 4EC0A 19GSA 3ZREA 1OKDA 3MIXA 2CA8A 4ZBBA 2Z9SA 1QK8A 4MLYA 3Q6OA 2MBTA 3OR5A 4EIPA 4J57E 1C72A 3GSTA 2CAQA 3MAKA 3A3TA 3ISOA 1M2DA 1WMJA 1SK2A 1E2YA 4MDCA 5DQSA 2LJRA 3EE2A 2QGVA 3PINA 4ZL7A 3GIXA 4HI7A 2XBIA 1GSSA 1U87A 3VPTA 1EWXA 2DBCA 3EURA 3ZRDA 2VIMA 5GSSA 2TIRA 2LNSA 1DSBA 4XRDA 4DVCA 5D8IA 1KEBA 1U3IA 2J23A 3FMWA 5F8BA 4XTSA 2B7KA 3KH9A 4EDYA 2L59A 4KAEA 1M9AA 4EXJA 3H93A 3TJFA 3EMXA 5IPGA 1ZCPA 2LEGA 2ZCTA 1V57A 5J4UA 5C00A 1F37A 1TK5B 1T1VA 2ZNMA 2MMZA 3L9UA 5CP1A 2DSAA 4K5RA 5DQYA 4DSRA 4ZB8A 2M46A 1ERTA 3WD6A 5EPFA 4X4JA 2IFQA 3IR4A 4RQRA 3QMXA 2JZRA 4KH7A 1N2AA 1FB6A 2OADA 1GSEA 1X5CA 2AYTA 3DXBA 2IFQB 4MF7A 1TTZA 4HJMA 3KJYA 3P2AA 5KN2A 5E4WA 4KDUA 2FA4A 1BEDA 2X8HA 4K5SA 3LYKA 1K0MA 1XWCA 4WXTA 4K8MA 1X5DA 1AIUA 3G7YA 4JR4A 5DALA 2RLIA 3DYRA 3GKMA 1GH2A 4OCEA 4XS1A 4IP1A 4TKYA 2OACA 5IMAA 4OO5A 3R2QA 2VCTA 4KB3A 3MSZA 1USBA 2IN3A 1G6YA 1AQVA 5DALB 5J3RA 1AQWA 2FNOA 2VLVA 1XWKA 11GSA 5A4UA 4OD7A 1SK0A 5ECOB 2L6CA 4GRFA 5DAKA 2KOKA 12GSA 3VWVA 5J9CA 3FY7A 1M99A 1SD8A 1BQ7A 1J9BA 1ZGNA 4LLRA 5DAKB 4I8BA 2QSIA 3V1WA 3UBKA 2WDUA 4FO5A 3P90A 4MZWA 4RI6A 3SBCA 4JU5A 2WULA 2YZUA 2P5QA 1YQ1A 4GTUA 3QAGA 1T7PB 3IA1A 4O5UA 2V6OA 5IOXA 4XIHA 2FA8A 3TJKA 1VF4A 3RBTA 4MH2A 1FW1A 5CRGA 2VL9A 1PRXA 3GTUA 4TXOA 2LNTA 5AGYA 5ECQB 2OE1A 4O7HA 2H6XA 1MDIA 2HZEA 3HHVA 3L4NA 1EEMA 3ERGA 14GSA 1V58A 2C4JA 4CY6A 1V98A 1Z5YE 2HZEB 3LYPA 4PQHA 1HD2A 5FWGA 4IJIA 3F4RA 4L5LA 1EZKA 2IMDA 2MYGA 2H0IA 5D9XA 3LXZA 1SJIA 2KLXA 5HR3A 17GSA 4KDXA 2AB6A 2DLXA 4PURA 2YOIA 1TXXA 1Z9HA 1ZYNA 2CZ3A 2VCQA 1QMVA 3GHAA 4KNDA 1SYXA 1T4YA 2H74A 6GSSA 4MJBA 5L71A 4CDOA 5ABRA 5ECNB 4KDYA 4Q5FA 4HQSA 3HDCA 3E3EA 4WBRD 2GVPA 2IIYA 5DCHA 1SJ6A 4YAVA 1ZL9A 4G0LA 5IQYA 5H5RA 4JZQA 2HXKA 4YQUA 4NV5A 2NTOA 3GUSA 8GSSA 4OFMA 5ECMB 4IVFA 4PUFC 4F2IA 4MA9A 3ERFA 5D9TA 3HVSA 5ELGA 3K8NA 2GGTA 4PTSA 2IPAA 3W8JA 3S9FA 4HUAA 2L6DA 6GSTA 5LD0A 4PNGA 4ULXA 1XVWA 2H70A 1UVZA 4K1FA 2VLTA 4IW9A 2YN1A 2GQLA 1VGLA 3NOFA 1O85A 3TKQA 1A0RP 3J7Yk 5D9VA 1TU7A 4POMA 4PUAA 2FGXA 4IJ3A 2GZYA 2V2GA 5IMCA 2L4CA 1F2EA 1TDIA 1WRYA 2K9FA 3ZFBA 4GQCA 1Z7PA 2EIRA 1MDJA 2VCVA 1A2MA 2ON5A 3MWHA 3LG6A 3HZ8A 1PD21 3D22A 4LA1A 1EP7A 2IJYA 1YEPA 1LJRA 2VOCA 1E6BA 1KBNA 2X8GA 3AY8A 2P5RA 3E9JB 3CSJA 1WOUA 2BMXA 2JL4A 4ECBA 1ON4A 4Q5NA 2YWOA 1F9MA 1XFLA 1Y25A 1K3OA 5G2ZA 2B5YA 4TR3A 1XZOA 4L8EA 2PMTA 1GTBA 4HDEA 2VCWA 4I5QA 2HNLA 1ZYEA 4KX4A 3MNGA 3BOAA 3RDWA 1S3AA 6GSVA 5B6MA 1A2JA 5DBQA 2H1BA 1TI1A 3FEUA 2H73A 1GLPA 3EC3A 2JZSA 4K2DA 4PGTA 2WS2A 5IO2A 2CVKA 4I2UA 5LNKe 5CRHA 2GTUA 1SU9A 1F6MC 3M3MA 4KSMA 2H1GA 2C0GA 4WR4A 2RM6A 3IBHA 3KEBA 4IQ1A 4WEYA 3G9BA 4BPYA 4WF5A 4OFNA 1SL2B 2E2MA 3GFKA 1TU8A 1DUGA 5GAND 4IQAA 3KP8A 3GNJA 3CSIA 1A2LA 4HOJA 3QCPA 3H8QA 1YY7A 2CZ2A 2B1LA 2BJXA 4O5RA 4BL7A 1GLQA 4CHSA 1FOVA 3LEFA 1J0FA 1MEKA 1A24A 2LS5A 3TRXA 3GH9A 9GSSA 2R37A 5HR1A 3I9V2 2DJ3A 4ISDA 2YP6A 4FYUA 1SD9A 3TOTA 2MMOA 2IWTA 3GSSA 2V32A 4DSQA 1QFNA 4TOPA 3FZ4A 1GTUA 1BAYA 5J5NA 3N9JA 1AAZA 2JACA 3TJGA 5ECLB 2R2JA 2AUVA 2FLSA 4QQ7A 2GQMA 4NHWA 4N11A 3DEXA 2G2QA 1ML6A 2GT6A 2R0PA 2PPTA 5EVOA 2MZCA 3F4SA 1FB0A 4K7OA 4EE0A 2AHEA 1B4PA 1UA5A 1T00A 1I5GA 1PL2A 1WP0A 3HYPA 3UMAA 3TRQA 4ZL8A 4KSOA 5F07A 2FUG2 1G7OA 2B7JA 3TKRA 3D0ZA 4KGIA 3KCMA 4BVYB 4Z7XA 2H0HA 2HYXA 4FH8A 5EY6A 1JZWA 2MMAA 4TRXA 3VWUA 3US3A 1TRWA 2A2SA 5B8AA 5B8BA 2HRKA 3IK7A 5FT3A 1X9WB 3O3TA 3UJ1A 2KHPA 4Z2UA 4MZBA 22GSA 2LUSA 2DMLA 3VI5A 3KD0A 3LSZA 1X0RA 1BX9A 2OKAA 2CAIA 2VUPA 3TKSA 4TXVA 3A5IA 3ZIVA 3CYNA 1THXA 2HSMA 2RUEA 5AIVA 4ML1A 3FYGA 4P3YB 3RAZA 4ZIJA 2GT5A 2K8VA 1EP8A 2VM2A 3UAPA 4BWSA 2JADA 5ECSA 3M1GA 3WT2A 2VAFA 1R7HA 5JCGA 1XW5A 2FWGA 2EC4A 3D4MA 3QAWA 3RHBA 1EOGA 1OC8A 4L5OA 4OMVA 1A8LA 4N0VA 5GSTA 1G7EA 4FIWA 2WB9A 3M0FA 3VK9A 3BD2A 4ZBAA 5IMFA 5ECRB 3TUEA 2B6MA 2LQOA 4V2MA 2YWIA 4DSSA 1SK1A 1VF2A 3BCIA 3DIEA 4XCSA 3IOSA 3QAVA 2LSTA 4FQUA 2LKUA 1OC9A 4Z2TA 1SKWB 3LGCA 1RW1A 5DVBA 4PX1A 4HJ2A 3UARA 3H4KA 2LRCA 5C04A 2YV9A 4DEJA 1HNCA 3CTFA 1OE8A 2GZZA 2HRNA 5ECIB 4ID0A 1R5AA 1KNGA 1K0NA 5F06A 2H72A 1ST9A 3F4TA 2HSYA 3FZ9A 1K0BA 4F9ZA 4EDZA 2ON7A 4MF5A 1QXHA 4GWRA 2GSSA 1Y6EA 1XVQA 4ZBDA 2R3XA 3UBLA 1WJKA 2PGTA 1B48A 1K3YA 3APOA 2I81A 1S3CA 2TRXA 1U88A 5DJMA 4ILFA 5D73A 1UN2A 4BVXA 6GSYA 1ERWA 3TKSC 2O7KA 1HNBA 3ZZXA 4AGSA 1ACVA 2DJ2A 4MF6A 4IGJA 3IXRA 2AV4A 1R4WA 1WIKA 4BVXB 1THOA 2DJ0A 2GSRA 4HU7A 3TCOA 4PQ1A 4KCAA 2M80A 1ZYQB 1GP1A 2H76A 6GSWA 2H66A 5BRTA 1K0CA 1NHYA 4JEDA 1MDKA 2ES7A 1GUKA 1ERVA 3NZNA 4LMVA 4O5QA 2WFCA 2PUKC 3TKSE 1OAZA 2KUCA 2C3TA 2L5OA 1GNWA 4MZCA 2ZUPA 3BCKA 3VWXA 1R26A 4G0IA 4A5PA 1LU4A 1Q4JA 5IMDA 2CVBA 2C3QA 3GTUB 4TXOB 5GZZB 4EO3A 3I6AA 1CQGA 1AW9A 1GSQA 2DMMA 2VD0A 2A2RA 3IRAA 5ELAA 4JBBA 1XXUA 1ERUA 1URMA 4J56E 2KP1A 4AJ7A 1SENA 2E2GA 3DVWA 4GSSA 4J2FA 4MABA 4OCFA 4MPFA 2KP2A 4Q5QA 2H1AA 3IK9A 3JCML 4MNNA 3UIWA 3VWWA 2H19A 2YZHA 2LJKA 2F3MA 2L57A 2LRTA 3TKPA 3L9VA 1OVNA 4Q5RA 5IO0A 4KW6A 2DJKA 2O89A 2REMA 2MMNA 1A0FA 3MDKA 5ID2A 4MPGA 1SL1B 1GSFA 2E7PA 1XOAA 2K18A 4EF0A 2GSTA 3DVXA 5B6NA 1B4QA 4TR1A 3UVTA 1O6JA 3GKKA 4I6XA 3LWAA 1TP9A 2H01A 3I69A 5H5QA 1T4ZA 1AQXA 5G1LA 3TJJA 2VO4A 2WGRA 1QGVA 4ECCA 5KN1A 4XS6A 3ZMKA 2E0QA 1ZZYA 4N0ZA 4POBA 5JWOB 2HRAA 6GSXA 3H79A 3D4TA 1VRSD 4IN0A 1IYHA 4WF4A 4MMMA 5HFGA 2JSYA 1YF1A 3GKXA 2GSQA 5KOWA 2P31A 2WCIA 4OFTA 4IELA 3HCZA 4EUYA 5LCZA 13GSA 2WJUA 3G7JA 2V41A 2QKEA 3DKSA 3LW9A 3F6DA 4ECIA 5AISA 2YJHA 4NXIA 4JR6A 3KMNA 4LL1B 1F3BA 4KF9A 5B7CA 2NDOA 16GSA 3C7MA 2LJAA 5KN0A 5HQPA 1YJ6A 1QQ2A 5ENUA 1GSDA 3F3RA 3KIJA 1XBSA 5G30A 1TI3A 4RI7A 3EWLA 4EIQA 2DKHA 1PX6A 2RUFA 2I4AA 4XRAA 1M2AA 3GYKA 4V1Ag 2H71A 1AXDA 3ZFLA 2B5XA 1NM3A 3IPZA 2C0EA 1G6WA 4KCEA 2AJQB 4NHZA 3APQA 4YKGA 1AC1A 2VM1A 4GCIA 3KGKA 2LQQA 4PQIA 1JLWA 2DC5A 1SYRA 4D73A 3F0IA 5IM9A 3KH7A 2PBJA 3QOUA 4KE3A 5G1KA 2LTKA 4IKHA 3GMFA 3FRCA 5ECHB 1TJDA 5KOXA 3WGEA 4D73B 2UZ8A 1RQMA 5ECPB 5ECKB 4ZL9A 5F0GA 2IMIA 1O73A 2F8AA 3E0UA 3FK8A 3WT1A 4GQFA 4EL1A 1U3AA 4BWQA 2V6KA 3ED3A 4I97A 3GH6A 5A4WA 2B3SA 5DCGA 1O7UA 4XS4A 1OC3A 2GQKA 2H6YA 4V1Ap 1PL1A 1B8XA 3LORA 2DKIA 1JZDA 3R3EA 4NWYA 4G9HA 2PU9C 3G7IA 5JWQB 3I43A 4MP4A 2HSHA 4XS4B 5COHA 1M7TA 2NBSA 3UEMA 4BL7B 2CQ9A 2AAWA 1ZOFA 3CSHA 1M2BA 3HA9A 3C1SA 2OBIA 3IAS2 3HXSA 3GRXA 1M9BA 4USSA 1TRSA 4HS1A 5DJLA 3F9UA 2X64A 1YZXA 3IDVA 20GSA 1TOFA 2H1DA 2O8VB 3P7XA 3QFBC 5HR0A 5CRWA 2DJ1A 1DE2A 5JCWA 1PN9A 4O32A 3BBYA 3TOUA 1FHEA 1QUWA 5INYA 1GWCA 1Z6NA 1DE1A 1XPVA 3EU3A 4L0UA 4ML6A 4XHMA 3BJ5A 4TR4A 1NHOA 3IAM2 1VF1A 3TRPA 5HFKA 3ZL5A 3C73A 2ALBA 5IMZA 1TW9A 2A2PA 5AN1A 4L0WA 1UC7A 3LXTA 3GA4A 2VLUA 2RIIA 4K0GA 2IMEA 4HZ2A 1EEJA 2YWMA 3QDNA 4TN8A 1PGTA 4X43A 2YANA 4QL7A 1J08A 2HRFA 5FHIA 3HY2A 4HZ4A 3IHQA 4NV2A 2C0FA 5G5EA 2BTOT 1JLVA 4AJ6A 3A2VA 3FZ5A 1OYJA 1K0OA 2PVQA 2CX3A 3D21A 1GSYA 3VPQA 4GLTA 4GSNA 4Z2RA 1O81A 3A5WA 1KTEA 1GNEA 1Z7RA 3EVIA 4HU9A 3GL5A 2P0GA 3ERWA 4K2XA 1XCCA 1HNAA 1VF3A 2K8SA 3FR6A 4K9ZA 2PVOC 7GSSA 2WRTA 1A8YA 1T8EB 3L9SA 2C3NA 1GUHA 1X9MB 1X5EA 3UL3A 2F8FA 2H8LA 2PERA 2EIQA 4MH3A 2IL3A 1YDKA 4G2EA 4RUVA 3UOMA 2VCZA 5CNWA 4DSSB 1DBYA 3IC4A 4WR5A 5CYYA 2JU5A 3P8WA 2M72A 1A23A 3GL3A 1OC9B 1V2AA 4ZB6A 5BMUA 2GS3A 2FHEA 2GLRA 1EGRA 3Q18A 3VLNA 1PQNA 3TDGA 4WKWA 3W8SA 1XW6A 2HI7A 3N5OA 1PMTA 3FZAA 3WGDA 1BJXA 3ME8A 1OE7A 4YH2A 1WPIA 3IE3A 4EVMA 1FG4A 2R4VA 1XWAA 3D5JA 1TKDB 2D2ZA 2N5FA 3DD3A 5DDLA 4WBJA 4K7IA 1TK8B 3EU4A 3C8EA 3FR3A 2NVLA 1K0DA 3DGQA 3FHKA 2OE0A 3ZVJD 1ZMAA 5D93A 3CTGA 3W6GA 1H4OA 1X9SB 1NW2A 2R6KA 1W89A 1GTIA 2F51A 1TRUA 3PGTA 2VL3A 4POLA 3IHGA 3GX8A 1YKCA 1PSQA 3EPTA 3D6IA 2X49A 2YJ7A 1I9DA 2OJLA 3KXOA 2WZ9A 2LV3A 3ZLPA 4GXZA 1Q98A 1FAAA 3FW2A 2TRCP 5J41A 3FR9A 2C1YA 2VCXA 3IV4A 4RQXA 3ZITA 4PNFA 1Z3EA 1GTAA 1V40A 1CQHA 4KUNA 1PKZA 2PN8A 1PKWA 3IC8A 3HJMA 4V2LA 2O87A 1MD3A 2MBSA 4NMUA 4HEA2 4MJAA 1ILOA 2YCDA 4N10A 1FO5A 3KZQA 1MD4A 1WE0A 3KTBA 3NIVA 4WETA 3ME7A 2H0GA 4POKA 2I1UA 5EL8A 3Q19A 3KTLA 5F05A 4F03A 3M9JA 2PWJA 2R0GA 3J7Yb 1GSUA 4O92A 1YEXA 2RM5A 3Q74A 3QD9A 5KEJA 1HQOA 3LJRA 2FWFA 4H86A 3ZTLA 1OKTA 1K0AA 3PR8A 5IMVA 1S3DA 4E8EA 3GURA 3M9KA 3HJPA 2QA2A 2X99A 3EINA 3HD5A 3GX0A 4FYCA 4TW5A 2HE3A 2HLSA 1F3AA 5ID2B 1FVKA 4GSTA 5KN3A 1K3LA 1JZOA 4K6XA 3L78A 1H75A 3WYWA 1WWJA 2C8UA 2CT6A 3F3QA 2FD3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZT A;  2YWN A;  4AF2 A;  1R5P A;  3RPN A;  5CRD A;  4TR1 B;  5J9B A;  4IP6 A;  4ZIL A;  3DRN A;  3TJB A;  3ZYW A;  1M0U A;  2H6Z A;  2H30 A;  3U6V A;  1U6T A;  5D96 A;  2CV4 A;  3A2W A;  1V9W A;  1PA3 A;  3M8N A;  2NPB A;  3CRT A;  3QR6 A;  3VI7 A;  4KA0 A;  3U5R E;  2HZF A;  1XWG A;  2VL2 A;  2I3Y A;  2IMF A;  4YQV A;  2IMK A;  2G0F A;  2K6V A;  4LMW A;  4MK3 A;  2C80 A;  2XC2 A;  1IYI A;  2FWE A;  1NSW A;  1GUL A;  4IS0 A;  1FVJ A;  5IPH A;  2N5B A;  1XIY A;  10GS A;  2F9S A;  2H75 A;  4MCU A;  3VUR A;  4PXO A;  3H1N A;  1SJZ A;  1HYU A;  3GN3 A;  2GZP A;  5HFI A;  2FCH A;  3KM6 A;  5IOW A;  2HFD A;  3TGZ A;  3UVH A;  4GF0 A;  3PH9 A;  2HT9 A;  3RHC A;  3EMP A;  2YPM A;  1YF0 A;  4JE1 A;  2B1K A;  4IHU A;  1W4V A;  3QPM A;  4TVE A;  1N8J A;  3HKR A;  5GAP D;  2EIO A;  2V1M A;  1JFU A;  1TRV A;  3C1R A;  2FY6 A;  1AUC A;  4FYB A;  1EOH A;  2XBQ A;  3GKN A;  3SWL A;  1EV4 A;  4MJE A;  3VFI A;  1SL0 B;  3KP9 A;  3F8U A;  4E8H A;  5G31 A;  3QFA C;  3F63 A;  4HQZ A;  4K7N A;  5AIX A;  3FKF A;  3F6F A;  2A4V A;  3APS A;  2XPD A;  3O76 A;  3LQ7 A;  1GL8 A;  1XWB A;  3DWV A;  3GV1 A;  4N30 A;  1PX7 A;  1RK4 A;  3ZVJ A;  4G10 A;  3ZIJ A;  3EYT A;  5CAX A;  2OBK A;  2GDR A;  5E59 A;  4ZB9 A;  5H5S A;  4OWY A;  2OA7 A;  4OO4 A;  1GUM A;  4X1U A;  2OE3 A;  1SKS B;  3TB2 A;  1EV9 A;  4YQM A;  2VL2 C;  3RPP A;  4JRR A;  1ABA A;  1XW9 A;  2C0D A;  4LL4 B;  1B9X C;  5D9W A;  5CRE A;  3LFL A;  4CW9 A;  1GRX A;  2LRN A;  3CXG A;  5A5K A;  3WGX A;  2X8C A;  1SKR B;  2FWH A;  2R5G A;  4QL9 A;  4F82 A;  4F0C A;  4NPB A;  4EKZ A;  1JZR A;  18GS A;  5CO3 A;  3C71 A;  4K0N A;  4IBP A;  4AJ8 A;  1EGO A;  5HR2 A;  1MTC A;  3CBU A;  3DML A;  4G19 A;  2L5L A;  2VD1 A;  1BYE A;  1LBK A;  2DIY A;  4V2N A;  5JCU A;  1G0T A;  4X0X A;  1T3B A;  2B5E A;  1B9Y C;  3HJO A;  3A2X A;  4I2T A;  2YV7 A;  2QC7 A;  5JWR B;  4MJC A;  1O8W A;  2XHF A;  2CX4 A;  3KMO A;  1JHB A;  3CRU A;  2DIZ A;  2J9H A;  1O8X A;  3ZML A;  4NAX A;  2N5A A;  2L4Q A;  4ECJ A;  1YKA A;  2CVD A;  4ACS A;  1BG5 A;  3O6T A;  4TR0 A;  4YAP A;  6GSU A;  4F0B A;  3HVX A;  3HVV A;  1TK0 B;  3L0H A;  2XPE A;  5IIZ A;  2YNX A;  4BVY A;  1Z6M A;  5G5F A;  2DJJ A;  4BA7 A;  1XOB A;  4ZXG A;  5A4V A;  3CMI A;  2JSZ A;  2I9H A;  2O85 A;  3HZ4 A;  4EC0 A;  19GS A;  3ZRE A;  1OKD A;  2CA8 A;  4ZBB A;  2Z9S A;  1QK8 A;  4MLY A;  3Q6O A;  2MBT A;  3OR5 A;  4J57 E;  1C72 A;  3GST A;  2CAQ A;  3MAK A;  3A3T A;  3ISO A;  1M2D A;  1WMJ A;  1SK2 A;  1E2Y A;  4MDC A;  5DQS A;  2LJR A;  3EE2 A;  2QGV A;  3PIN A;  4ZL7 A;  3GIX A;  4HI7 A;  2XBI A;  1GSS A;  1U87 A;  3VPT A;  1EWX A;  2DBC A;  3EUR A;  3ZRD A;  2VIM A;  5GSS A;  2TIR A;  2LNS A;  1DSB A;  4XRD A;  4DVC A;  5D8I A;  1KEB A;  1U3I A;  2J23 A;  5F8B A;  4XTS A;  2B7K A;  3KH9 A;  4EDY A;  2L59 A;  4KAE A;  1M9A A;  4EXJ A;  3H93 A;  3TJF A;  3EMX A;  5IPG A;  1ZCP A;  2LEG A;  2ZCT A;  1V57 A;  5J4U A;  5C00 A;  1F37 A;  1TK5 B;  1T1V A;  2ZNM A;  2MMZ A;  3L9U A;  5CP1 A;  2DSA A;  5DQY A;  4DSR A;  4ZB8 A;  2M46 A;  1ERT A;  3WD6 A;  5EPF A;  2IFQ A;  3IR4 A;  4RQR A;  3QMX A;  2JZR A;  4KH7 A;  1N2A A;  1FB6 A;  2OAD A;  1GSE A;  1X5C A;  2AYT A;  3DXB A;  2IFQ B;  4MF7 A;  1TTZ A;  4HJM A;  3KJY A;  3P2A A;  5KN2 A;  5E4W A;  4KDU A;  2FA4 A;  1BED A;  2X8H A;  3LYK A;  1K0M A;  1XWC A;  4WXT A;  4K8M A;  1X5D A;  1AIU A;  3G7Y A;  4JR4 A;  5DAL A;  2RLI A;  3DYR A;  3GKM A;  1GH2 A;  4OCE A;  4XS1 A;  4IP1 A;  4TKY A;  2OAC A;  5IMA A;  4OO5 A;  3R2Q A;  2VCT A;  4KB3 A;  3MSZ A;  1USB A;  2IN3 A;  1G6Y A;  1AQV A;  5DAL B;  5J3R A;  1AQW A;  2FNO A;  2VLV A;  1XWK A;  11GS A;  5A4U A;  4OD7 A;  1SK0 A;  5ECO B;  2L6C A;  5DAK A;  4GRF A;  2KOK A;  12GS A;  3VWV A;  5J9C A;  3FY7 A;  1M99 A;  1SD8 A;  1BQ7 A;  1J9B A;  1ZGN A;  4LLR A;  5DAK B;  4I8B A;  2QSI A;  3V1W A;  3UBK A;  2WDU A;  4FO5 A;  3P90 A;  4MZW A;  4RI6 A;  3SBC A;  4JU5 A;  2WUL A;  2YZU A;  2P5Q A;  1YQ1 A;  4GTU A;  3QAG A;  1T7P B;  3IA1 A;  5IOX A;  2V6O A;  4XIH A;  2FA8 A;  3TJK A;  1VF4 A;  3RBT A;  4MH2 A;  1FW1 A;  5CRG A;  2VL9 A;  1PRX A;  3GTU A;  4TXO A;  2LNT A;  5AGY A;  5ECQ B;  2OE1 A;  4O7H A;  2H6X A;  1MDI A;  2HZE A;  3HHV A;  3L4N A;  1EEM A;  3ERG A;  14GS A;  1V58 A;  2C4J A;  1V98 A;  1Z5Y E;  2HZE B;  3LYP A;  4PQH A;  1HD2 A;  5FWG A;  4IJI A;  3F4R A;  4L5L A;  1EZK A;  2IMD A;  2MYG A;  2H0I A;  5D9X A;  3LXZ A;  1SJI A;  2KLX A;  5HR3 A;  17GS A;  4KDX A;  2AB6 A;  2DLX A;  4PUR A;  2YOI A;  1TXX A;  1Z9H A;  2CZ3 A;  2VCQ A;  1QMV A;  3GHA A;  4KND A;  1SYX A;  1T4Y A;  2H74 A;  6GSS A;  4MJB A;  5L71 A;  4CDO A;  5ABR A;  5ECN B;  4KDY A;  4Q5F A;  4HQS A;  3HDC A;  3E3E A;  4WBR D;  2GVP A;  2IIY A;  5DCH A;  1SJ6 A;  4YAV A;  1ZL9 A;  5IQY A;  5H5R A;  4JZQ A;  2HXK A;  4YQU A;  4NV5 A;  2NTO A;  3GUS A;  8GSS A;  4OFM A;  5ECM B;  4IVF A;  4PUF C;  4F2I A;  4MA9 A;  3ERF A;  5D9T A;  3HVS A;  5ELG A;  3K8N A;  2GGT A;  2IPA A;  3W8J A;  3S9F A;  4HUA A;  2L6D A;  6GST A;  5LD0 A;  4PNG A;  4ULX A;  1XVW A;  2H70 A;  1UVZ A;  4K1F A;  2VLT A;  4IW9 A;  2YN1 A;  2GQL A;  1VGL A;  3NOF A;  1O85 A;  3TKQ A;  1A0R P;  3J7Y k;  5D9V A;  1TU7 A;  4POM A;  4PUA A;  2FGX A;  4IJ3 A;  2GZY A;  2V2G A;  5IMC A;  2L4C A;  1F2E A;  1TDI A;  1WRY A;  2K9F A;  3ZFB A;  4GQC A;  1Z7P A;  2EIR A;  1MDJ A;  2VCV A;  1A2M A;  2ON5 A;  3MWH A;  3LG6 A;  3HZ8 A;  1PD2 1;  3D22 A;  4LA1 A;  1EP7 A;  2IJY A;  1YEP A;  1LJR A;  2VOC A;  1E6B A;  1KBN A;  2X8G A;  3AY8 A;  2P5R A;  3E9J B;  3CSJ A;  1WOU A;  2BMX A;  2JL4 A;  4ECB A;  1ON4 A;  4Q5N A;  2YWO A;  1F9M A;  1XFL A;  1Y25 A;  1K3O A;  5G2Z A;  2B5Y A;  4TR3 A;  1XZO A;  4L8E A;  2PMT A;  1GTB A;  4HDE A;  2VCW A;  4I5Q A;  2HNL A;  1ZYE A;  4KX4 A;  3MNG A;  3BOA A;  3RDW A;  1S3A A;  6GSV A;  5B6M A;  1A2J A;  5DBQ A;  2H1B A;  1TI1 A;  3FEU A;  2H73 A;  1GLP A;  3EC3 A;  2JZS A;  4K2D A;  4PGT A;  2WS2 A;  5IO2 A;  2CVK A;  4I2U A;  5LNK e;  5CRH A;  2GTU A;  1SU9 A;  1F6M C;  3M3M A;  4KSM A;  2H1G A;  2C0G A;  4WR4 A;  2RM6 A;  3IBH A;  3KEB A;  4IQ1 A;  4WEY A;  3G9B A;  4BPY A;  4WF5 A;  4OFN A;  1SL2 B;  2E2M A;  3GFK A;  1TU8 A;  1DUG A;  5GAN D;  4IQA A;  3KP8 A;  3GNJ A;  3CSI A;  1A2L A;  4HOJ A;  3QCP A;  3H8Q A;  1YY7 A;  2CZ2 A;  2B1L A;  2BJX A;  4O5R A;  4BL7 A;  1GLQ A;  4CHS A;  1FOV A;  3LEF A;  1J0F A;  1MEK A;  1A24 A;  2LS5 A;  3TRX A;  3GH9 A;  9GSS A;  2R37 A;  5HR1 A;  3I9V 2;  2DJ3 A;  4ISD A;  2YP6 A;  4FYU A;  1SD9 A;  3TOT A;  2MMO A;  2IWT A;  3GSS A;  2V32 A;  4DSQ A;  1QFN A;  4TOP A;  3FZ4 A;  1GTU A;  1BAY A;  5J5N A;  3N9J A;  1AAZ A;  2JAC A;  3TJG A;  5ECL B;  2R2J A;  2AUV A;  2FLS A;  4QQ7 A;  2GQM A;  4NHW A;  4N11 A;  3DEX A;  2G2Q A;  1ML6 A;  2GT6 A;  2PPT A;  5EVO A;  2MZC A;  3F4S A;  1FB0 A;  4K7O A;  4EE0 A;  2AHE A;  1B4P A;  1UA5 A;  1T00 A;  1I5G A;  1PL2 A;  1WP0 A;  3HYP A;  3UMA A;  3TRQ A;  4ZL8 A;  4KSO A;  5F07 A;  2FUG 2;  1G7O A;  2B7J A;  3TKR A;  3D0Z A;  4KGI A;  3KCM A;  4Z7X A;  2H0H A;  2HYX A;  4FH8 A;  5EY6 A;  1JZW A;  2MMA A;  4TRX A;  3VWU A;  3US3 A;  1TRW A;  2A2S A;  5B8A A;  5B8B A;  3IK7 A;  5FT3 A;  1X9W B;  3O3T A;  3UJ1 A;  2KHP A;  4MZB A;  22GS A;  2LUS A;  2DML A;  3VI5 A;  3KD0 A;  3LSZ A;  1X0R A;  1BX9 A;  2OKA A;  2CAI A;  2VUP A;  3TKS A;  4TXV A;  3ZIV A;  3CYN A;  1THX A;  2RUE A;  5AIV A;  4ML1 A;  3FYG A;  4P3Y B;  3RAZ A;  4ZIJ A;  2GT5 A;  2K8V A;  1EP8 A;  2VM2 A;  3UAP A;  4BWS A;  2JAD A;  5ECS A;  3M1G A;  3WT2 A;  2VAF A;  1R7H A;  5JCG A;  1XW5 A;  2FWG A;  2EC4 A;  3D4M A;  3QAW A;  3RHB A;  1EOG A;  1OC8 A;  4L5O A;  4OMV A;  1A8L A;  4N0V A;  5GST A;  1G7E A;  4FIW A;  2WB9 A;  3M0F A;  3VK9 A;  3BD2 A;  4ZBA A;  5IMF A;  5ECR B;  3TUE A;  2B6M A;  2LQO A;  4V2M A;  2YWI A;  4DSS A;  1SK1 A;  1VF2 A;  3BCI A;  3DIE A;  4XCS A;  3IOS A;  3QAV A;  2LST A;  2LKU A;  1OC9 A;  1SKW B;  3LGC A;  1RW1 A;  5DVB A;  4PX1 A;  4HJ2 A;  3UAR A;  3H4K A;  2LRC A;  5C04 A;  2YV9 A;  4DEJ A;  1HNC A;  3CTF A;  1OE8 A;  2GZZ A;  2HRN A;  5ECI B;  4ID0 A;  1R5A A;  1KNG A;  1K0N A;  5F06 A;  2H72 A;  1ST9 A;  3F4T A;  2HSY A;  3FZ9 A;  1K0B A;  4F9Z A;  4EDZ A;  2ON7 A;  4MF5 A;  1QXH A;  4GWR A;  2GSS A;  1Y6E A;  1XVQ A;  4ZBD A;  2R3X A;  3UBL A;  1WJK A;  2PGT A;  1B48 A;  1K3Y A;  3APO A;  2I81 A;  1S3C A;  2TRX A;  1U88 A;  5DJM A;  4ILF A;  5D73 A;  1UN2 A;  4BVX A;  6GSY A;  1ERW A;  3TKS C;  2O7K A;  1HNB A;  3ZZX A;  4AGS A;  1ACV A;  2DJ2 A;  4MF6 A;  4IGJ A;  3IXR A;  2AV4 A;  1R4W A;  1WIK A;  1THO A;  2DJ0 A;  2GSR A;  4HU7 A;  3TCO A;  4PQ1 A;  4KCA A;  2M80 A;  1ZYQ B;  1GP1 A;  2H76 A;  6GSW A;  2H66 A;  1K0C A;  1NHY A;  4JED A;  1MDK A;  2ES7 A;  1GUK A;  1ERV A;  3NZN A;  4LMV A;  2WFC A;  2PUK C;  3TKS E;  1OAZ A;  2KUC A;  2C3T A;  2L5O A;  1GNW A;  4MZC A;  2ZUP A;  3BCK A;  3VWX A;  1R26 A;  1LU4 A;  1Q4J A;  5IMD A;  2CVB A;  2C3Q A;  3GTU B;  4TXO B;  5GZZ B;  4EO3 A;  3I6A A;  1CQG A;  1AW9 A;  1GSQ A;  2DMM A;  2VD0 A;  2A2R A;  3IRA A;  5ELA A;  4JBB A;  1XXU A;  1ERU A;  1URM A;  4J56 E;  2KP1 A;  4AJ7 A;  1SEN A;  2E2G A;  3DVW A;  4GSS A;  4J2F A;  4MAB A;  4OCF A;  4MPF A;  2KP2 A;  4Q5Q A;  2H1A A;  3IK9 A;  3JCM L;  3UIW A;  3VWW A;  2H19 A;  2YZH A;  2LJK A;  2F3M A;  2L57 A;  2LRT A;  3TKP A;  3L9V A;  1OVN A;  4Q5R A;  5IO0 A;  4KW6 A;  2DJK A;  2O89 A;  2REM A;  2MMN A;  1A0F A;  3MDK A;  5ID2 A;  4MPG A;  1SL1 B;  1GSF A;  2E7P A;  1XOA A;  2K18 A;  4EF0 A;  2GST A;  3DVX A;  5B6N A;  1B4Q A;  4TR1 A;  3UVT A;  1O6J A;  3GKK A;  4I6X A;  3LWA A;  1TP9 A;  2H01 A;  3I69 A;  5H5Q A;  1T4Z A;  1AQX A;  5G1L A;  3TJJ A;  2VO4 A;  2WGR A;  1QGV A;  4ECC A;  5KN1 A;  4XS6 A;  3ZMK A;  2E0Q A;  1ZZY A;  4N0Z A;  4POB A;  5JWO B;  6GSX A;  3H79 A;  3D4T A;  1VRS D;  4IN0 A;  1IYH A;  4WF4 A;  4MMM A;  5HFG A;  2JSY A;  1YF1 A;  3GKX A;  2GSQ A;  2P31 A;  2WCI A;  4OFT A;  4IEL A;  3HCZ A;  4EUY A;  5LCZ A;  13GS A;  2WJU A;  3G7J A;  2V41 A;  2QKE A;  3DKS A;  3F6D A;  4ECI A;  5AIS A;  2YJH A;  4NXI A;  4JR6 A;  3KMN A;  4LL1 B;  1F3B A;  5B7C A;  2NDO A;  16GS A;  3C7M A;  2LJA A;  5KN0 A;  5HQP A;  1YJ6 A;  1QQ2 A;  5ENU A;  1GSD A;  3F3R A;  3KIJ A;  1XBS A;  5G30 A;  1TI3 A;  4RI7 A;  3EWL A;  1PX6 A;  2RUF A;  2I4A A;  4XRA A;  1M2A A;  3GYK A;  4V1A g;  2H71 A;  1AXD A;  3ZFL A;  2B5X A;  1NM3 A;  3IPZ A;  2C0E A;  1G6W A;  4KCE A;  2AJQ B;  4NHZ A;  3APQ A;  1AC1 A;  2VM1 A;  4GCI A;  3KGK A;  2LQQ A;  4PQI A;  1JLW A;  2DC5 A;  1SYR A;  4D73 A;  3F0I A;  5IM9 A;  3KH7 A;  2PBJ A;  3QOU A;  4KE3 A;  5G1K A;  2LTK A;  4IKH A;  3GMF A;  3FRC A;  5ECH B;  1TJD A;  3WGE A;  4D73 B;  1RQM A;  5ECP B;  5ECK B;  4ZL9 A;  5F0G A;  2IMI A;  1O73 A;  2F8A A;  3E0U A;  3FK8 A;  3WT1 A;  4GQF A;  4EL1 A;  1U3A A;  4BWQ A;  2V6K A;  3ED3 A;  4I97 A;  3GH6 A;  5A4W A;  2B3S A;  5DCG A;  1O7U A;  4XS4 A;  1OC3 A;  2GQK A;  2H6Y A;  4V1A p;  1PL1 A;  1B8X A;  3LOR A;  1JZD A;  4NWY A;  4G9H A;  2PU9 C;  3G7I A;  5JWQ B;  3I43 A;  4MP4 A;  2HSH A;  4XS4 B;  5COH A;  1M7T A;  2NBS A;  3UEM A;  2CQ9 A;  2AAW A;  1ZOF A;  3CSH A;  1M2B A;  3HA9 A;  3C1S A;  2OBI A;  3IAS 2;  3HXS A;  3GRX A;  1M9B A;  1TRS A;  4HS1 A;  5DJL A;  3F9U A;  2X64 A;  1YZX A;  3IDV A;  20GS A;  1TOF A;  2H1D A;  2O8V B;  3P7X A;  3QFB C;  5HR0 A;  5CRW A;  2DJ1 A;  1DE2 A;  5JCW A;  1PN9 A;  4O32 A;  3BBY A;  3TOU A;  1FHE A;  1QUW A;  5INY A;  1GWC A;  1Z6N A;  1DE1 A;  1XPV A;  3EU3 A;  4L0U A;  4ML6 A;  4XHM A;  3BJ5 A;  4TR4 A;  1NHO A;  3IAM 2;  1VF1 A;  3TRP A;  5HFK A;  3ZL5 A;  3C73 A;  2ALB A;  5IMZ A;  1TW9 A;  5AN1 A;  4L0W A;  1UC7 A;  3LXT A;  3GA4 A;  2VLU A;  2RII A;  4K0G A;  2IME A;  4HZ2 A;  1EEJ A;  2YWM A;  3QDN A;  4TN8 A;  1PGT A;  4X43 A;  2YAN A;  4QL7 A;  1J08 A;  2HRF A;  5FHI A;  3HY2 A;  4HZ4 A;  3IHQ A;  4NV2 A;  2C0F A;  5G5E A;  2BTO T;  1JLV A;  4AJ6 A;  3A2V A;  3FZ5 A;  1OYJ A;  1K0O A;  2PVQ A;  2CX3 A;  3D21 A;  1GSY A;  3VPQ A;  4GLT A;  4GSN A;  1O81 A;  3A5W A;  1KTE A;  1GNE A;  1Z7R A;  3EVI A;  4HU9 A;  3GL5 A;  2P0G A;  3ERW A;  1XCC A;  1HNA A;  1VF3 A;  2K8S A;  3FR6 A;  4K9Z A;  2PVO C;  7GSS A;  2WRT A;  1A8Y A;  1T8E B;  3L9S A;  2C3N A;  1GUH A;  1X9M B;  1X5E A;  3UL3 A;  2F8F A;  2H8L A;  2PER A;  2EIQ A;  4MH3 A;  2IL3 A;  1YDK A;  4G2E A;  4RUV A;  3UOM A;  2VCZ A;  5CNW A;  4DSS B;  1DBY A;  3IC4 A;  4WR5 A;  5CYY A;  2JU5 A;  3P8W A;  2M72 A;  1A23 A;  3GL3 A;  1OC9 B;  1V2A A;  4ZB6 A;  2GS3 A;  2FHE A;  2GLR A;  1EGR A;  3Q18 A;  3VLN A;  1PQN A;  3TDG A;  4WKW A;  3W8S A;  1XW6 A;  2HI7 A;  3N5O A;  1PMT A;  3FZA A;  3WGD A;  1BJX A;  3ME8 A;  1OE7 A;  4YH2 A;  1WPI A;  3IE3 A;  4EVM A;  1FG4 A;  2R4V A;  1XWA A;  3D5J A;  1TKD B;  2D2Z A;  2N5F A;  3DD3 A;  5DDL A;  4WBJ A;  4K7I A;  1TK8 B;  3EU4 A;  3C8E A;  3FR3 A;  2NVL A;  1K0D A;  3DGQ A;  3FHK A;  2OE0 A;  3ZVJ D;  1ZMA A;  5D93 A;  3CTG A;  3W6G A;  1H4O A;  1X9S B;  1NW2 A;  2R6K A;  1W89 A;  1GTI A;  2F51 A;  1TRU A;  3PGT A;  2VL3 A;  4POL A;  3GX8 A;  1YKC A;  1PSQ A;  3D6I A;  2YJ7 A;  1I9D A;  2OJL A;  3KXO A;  2WZ9 A;  2LV3 A;  3ZLP A;  4GXZ A;  1Q98 A;  1FAA A;  3FW2 A;  2TRC P;  5J41 A;  3FR9 A;  2C1Y A;  2VCX A;  3IV4 A;  4RQX A;  3ZIT A;  4PNF A;  1Z3E A;  1GTA A;  1V40 A;  1CQH A;  4KUN A;  1PKZ A;  2PN8 A;  1PKW A;  3HJM A;  4V2L A;  2O87 A;  1MD3 A;  2MBS A;  4NMU A;  4HEA 2;  4MJA A;  1ILO A;  2YCD A;  4N10 A;  1FO5 A;  3KZQ A;  1MD4 A;  1WE0 A;  3KTB A;  3NIV A;  4WET A;  3ME7 A;  2H0G A;  4POK A;  2I1U A;  5EL8 A;  3Q19 A;  3KTL A;  5F05 A;  4F03 A;  3M9J A;  2PWJ A;  3J7Y b;  1GSU A;  4O92 A;  1YEX A;  2RM5 A;  3Q74 A;  3QD9 A;  5KEJ A;  1HQO A;  3LJR A;  2FWF A;  4H86 A;  3ZTL A;  1OKT A;  1K0A A;  3PR8 A;  5IMV A;  1S3D A;  4E8E A;  3GUR A;  3M9K A;  3HJP A;  2X99 A;  3EIN A;  3HD5 A;  3GX0 A;  4FYC A;  4TW5 A;  2HE3 A;  2HLS A;  1F3A A;  5ID2 B;  1FVK A;  4GST A;  5KN3 A;  1K3L A;  1JZO A;  4K6X A;  3L78 A;  1H75 A;  3WYW A;  1WWJ A;  2C8U A;  2CT6 A;  3F3Q A;  2FD3 A; 
#chains in the Genus database with same CATH topology
 2JZT A;  2YWN A;  4AF2 A;  3PPU A;  1R5P A;  3RPN A;  5CRD A;  4TR1 B;  5J9B A;  4IP6 A;  4ZIL A;  3DRN A;  3TJB A;  3ZYW A;  1M0U A;  2H6Z A;  2H30 A;  3U6V A;  1U6T A;  5D96 A;  2CV4 A;  3A2W A;  1V9W A;  1PA3 A;  3M8N A;  2NPB A;  3CRT A;  3QR6 A;  3VI7 A;  4KA0 A;  4CY8 A;  3U5R E;  2HZF A;  1XWG A;  2VL2 A;  2I3Y A;  2IMF A;  4YQV A;  2IMK A;  2G0F A;  2K6V A;  4LMW A;  4MK3 A;  2C80 A;  2XC2 A;  1IYI A;  2FWE A;  1NSW A;  1GUL A;  4IS0 A;  1FVJ A;  5IPH A;  2N5B A;  1XIY A;  10GS A;  2F9S A;  2H75 A;  4MCU A;  3VUR A;  4PXO A;  3H1N A;  1SJZ A;  1HYU A;  3GN3 A;  2GZP A;  5HFI A;  2FCH A;  3KM6 A;  5IOW A;  2HFD A;  3TGZ A;  3UVH A;  4GF0 A;  3PH9 A;  2HT9 A;  3RHC A;  4ICY A;  3EMP A;  2YPM A;  1YF0 A;  4JE1 A;  2B1K A;  4IHU A;  2QA1 A;  1ZYP A;  1W4V A;  3QPM A;  4TVE A;  2A4H A;  1N8J A;  3CQF A;  3HKR A;  5GAP D;  2EIO A;  2V1M A;  1JFU A;  1TRV A;  3C1R A;  2FY6 A;  1AUC A;  4FYB A;  1EOH A;  2XBQ A;  3GKN A;  3SWL A;  1EV4 A;  4MJE A;  2X4A A;  3VFI A;  1SL0 B;  3KP9 A;  3F8U A;  4E8H A;  5G31 A;  3QFA C;  3F63 A;  4HQZ A;  4K7N A;  5AIX A;  3FKF A;  3F6F A;  2A4V A;  3APS A;  2XPD A;  3O76 A;  3LQ7 A;  1GL8 A;  1XWB A;  3DWV A;  3GV1 A;  4N30 A;  1PX7 A;  1RK4 A;  3ZVJ A;  4G10 A;  3ZIJ A;  3EYT A;  5CAX A;  2OBK A;  4HSC X;  2GDR A;  5E59 A;  4ZB9 A;  5H5S A;  4OWY A;  2OA7 A;  4OO4 A;  1GUM A;  4X1U A;  3MYD A;  2OE3 A;  1SKS B;  3TB2 A;  1EV9 A;  4YQM A;  2VL2 C;  3RPP A;  4JRR A;  1ABA A;  1XW9 A;  2C0D A;  4LL4 B;  1B9X C;  5D9W A;  5CRE A;  3LFL A;  4CW9 A;  1GRX A;  2LRN A;  3CXG A;  5A5K A;  3WGX A;  2X8C A;  1SKR B;  2FWH A;  2R5G A;  4QL9 A;  4F82 A;  4F0C A;  4NPB A;  4EKZ A;  1JZR A;  18GS A;  5CO3 A;  3C71 A;  4K0N A;  4IBP A;  4G0K A;  4AJ8 A;  1EGO A;  5HR2 A;  1MTC A;  3CBU A;  3DML A;  4G19 A;  2L5L A;  2VD1 A;  1BYE A;  1LBK A;  2DIY A;  1PN0 A;  4YKF A;  4V2N A;  5JCU A;  1G0T A;  4X0X A;  1T3B A;  2B5E A;  1B9Y C;  3HJO A;  3A2X A;  4I2T A;  2YV7 A;  2QC7 A;  5JWR B;  4MJC A;  1O8W A;  2XHF A;  2CX4 A;  3KMO A;  2R0C A;  1JHB A;  3CRU A;  2DIZ A;  2J9H A;  1O8X A;  3ZML A;  4NAX A;  2N5A A;  1FOH A;  2L4Q A;  4ECJ A;  1YKA A;  2CVD A;  4ACS A;  1BG5 A;  3O6T A;  4TR0 A;  4YAP A;  6GSU A;  4F0B A;  3HVX A;  3HVV A;  1TK0 B;  3L0H A;  2XPE A;  5IIZ A;  2YNX A;  4BVY A;  1Z6M A;  5G5F A;  2DJJ A;  4BA7 A;  1XOB A;  4ZXG A;  5A4V A;  3CMI A;  2JSZ A;  2I9H A;  2O85 A;  3HZ4 A;  4EC0 A;  19GS A;  3ZRE A;  1OKD A;  3MIX A;  2CA8 A;  4ZBB A;  2Z9S A;  1QK8 A;  4MLY A;  3Q6O A;  2MBT A;  3OR5 A;  4EIP A;  4J57 E;  1C72 A;  3GST A;  2CAQ A;  3MAK A;  3A3T A;  3ISO A;  1M2D A;  1WMJ A;  1SK2 A;  1E2Y A;  4MDC A;  5DQS A;  2LJR A;  3EE2 A;  2QGV A;  3PIN A;  4ZL7 A;  3GIX A;  4HI7 A;  2XBI A;  1GSS A;  1U87 A;  3VPT A;  1EWX A;  2DBC A;  3EUR A;  3ZRD A;  2VIM A;  5GSS A;  2TIR A;  2LNS A;  1DSB A;  4XRD A;  4BIK A;  4DVC A;  5D8I A;  1KEB A;  1U3I A;  2J23 A;  3FMW A;  5F8B A;  4XTS A;  2B7K A;  3KH9 A;  4EDY A;  2L59 A;  4KAE A;  1M9A A;  4EXJ A;  3H93 A;  3TJF A;  3EMX A;  5IPG A;  1ZCP A;  2LEG A;  2ZCT A;  1V57 A;  5J4U A;  5C00 A;  1F37 A;  1TK5 B;  1T1V A;  2ZNM A;  2MMZ A;  3L9U A;  5CP1 A;  2DSA A;  4K5R A;  5DQY A;  4DSR A;  4ZB8 A;  2M46 A;  1ERT A;  3WD6 A;  5EPF A;  4X4J A;  2IFQ A;  3IR4 A;  4RQR A;  3QMX A;  2JZR A;  4KH7 A;  1N2A A;  1FB6 A;  2OAD A;  1GSE A;  1X5C A;  2AYT A;  3DXB A;  2IFQ B;  4MF7 A;  1TTZ A;  4HJM A;  3KJY A;  3P2A A;  5KN2 A;  5E4W A;  4KDU A;  2FA4 A;  1BED A;  2X8H A;  4K5S A;  3LYK A;  1K0M A;  1XWC A;  4WXT A;  4K8M A;  1X5D A;  1AIU A;  3G7Y A;  4JR4 A;  5DAL A;  2RLI A;  3DYR A;  3GKM A;  1GH2 A;  4OCE A;  4XS1 A;  4IP1 A;  4TKY A;  2OAC A;  5IMA A;  4OO5 A;  3R2Q A;  2VCT A;  4KB3 A;  3MSZ A;  1USB A;  2IN3 A;  1G6Y A;  1AQV A;  5DAL B;  5J3R A;  1AQW A;  2FNO A;  2VLV A;  1XWK A;  11GS A;  5A4U A;  4OD7 A;  1SK0 A;  5ECO B;  2L6C A;  4GRF A;  5DAK A;  2KOK A;  12GS A;  3VWV A;  5J9C A;  3FY7 A;  1M99 A;  1SD8 A;  1BQ7 A;  1J9B A;  1ZGN A;  4LLR A;  5DAK B;  4I8B A;  2QSI A;  3V1W A;  3UBK A;  2WDU A;  4FO5 A;  3P90 A;  4MZW A;  4RI6 A;  3SBC A;  4JU5 A;  2WUL A;  2YZU A;  2P5Q A;  1YQ1 A;  4GTU A;  3QAG A;  1T7P B;  3IA1 A;  4O5U A;  2V6O A;  5IOX A;  4XIH A;  2FA8 A;  3TJK A;  1VF4 A;  3RBT A;  4MH2 A;  1FW1 A;  5CRG A;  2VL9 A;  1PRX A;  3GTU A;  4TXO A;  2LNT A;  5AGY A;  5ECQ B;  2OE1 A;  4O7H A;  2H6X A;  1MDI A;  2HZE A;  3HHV A;  3L4N A;  1EEM A;  3ERG A;  14GS A;  1V58 A;  2C4J A;  4CY6 A;  1V98 A;  1Z5Y E;  2HZE B;  3LYP A;  4PQH A;  1HD2 A;  5FWG A;  4IJI A;  3F4R A;  4L5L A;  1EZK A;  2IMD A;  2MYG A;  2H0I A;  5D9X A;  3LXZ A;  1SJI A;  2KLX A;  5HR3 A;  17GS A;  4KDX A;  2AB6 A;  2DLX A;  4PUR A;  1PFO A;  2YOI A;  1TXX A;  1Z9H A;  1ZYN A;  2CZ3 A;  2VCQ A;  1QMV A;  3GHA A;  4KND A;  1SYX A;  1T4Y A;  2H74 A;  6GSS A;  4MJB A;  5L71 A;  4CDO A;  5ABR A;  5ECN B;  4KDY A;  4Q5F A;  4HQS A;  3HDC A;  3E3E A;  4WBR D;  2GVP A;  2IIY A;  5DCH A;  1SJ6 A;  4YAV A;  1ZL9 A;  4G0L A;  5IQY A;  5H5R A;  4JZQ A;  2HXK A;  4YQU A;  4NV5 A;  2NTO A;  3GUS A;  8GSS A;  4OFM A;  5ECM B;  4IVF A;  4PUF C;  4F2I A;  4MA9 A;  3ERF A;  5D9T A;  3HVS A;  5ELG A;  3K8N A;  2GGT A;  4PTS A;  2IPA A;  3W8J A;  3S9F A;  4HUA A;  2L6D A;  6GST A;  5LD0 A;  4PNG A;  4ULX A;  1XVW A;  2H70 A;  1UVZ A;  4K1F A;  2VLT A;  4IW9 A;  2YN1 A;  2GQL A;  1VGL A;  3NOF A;  1O85 A;  3TKQ A;  1A0R P;  3J7Y k;  5D9V A;  1TU7 A;  4POM A;  4PUA A;  2FGX A;  4IJ3 A;  2GZY A;  2V2G A;  5IMC A;  2L4C A;  1F2E A;  1TDI A;  1WRY A;  2K9F A;  3ZFB A;  4GQC A;  1Z7P A;  2EIR A;  1MDJ A;  2VCV A;  1A2M A;  2ON5 A;  3MWH A;  3LG6 A;  3HZ8 A;  1PD2 1;  3D22 A;  4LA1 A;  1EP7 A;  2IJY A;  1YEP A;  1LJR A;  2VOC A;  1E6B A;  1KBN A;  2X8G A;  3AY8 A;  2P5R A;  3E9J B;  3CSJ A;  1WOU A;  2BMX A;  2JL4 A;  4ECB A;  1ON4 A;  4Q5N A;  2YWO A;  1F9M A;  1XFL A;  1Y25 A;  1K3O A;  5G2Z A;  2B5Y A;  4TR3 A;  1XZO A;  4L8E A;  2PMT A;  1GTB A;  4HDE A;  2VCW A;  4I5Q A;  2HNL A;  1ZYE A;  4KX4 A;  3MNG A;  3BOA A;  3RDW A;  1S3A A;  6GSV A;  5B6M A;  1A2J A;  5DBQ A;  2H1B A;  1TI1 A;  3FEU A;  2H73 A;  1GLP A;  3EC3 A;  2JZS A;  4K2D A;  4PGT A;  2WS2 A;  5IO2 A;  2CVK A;  4I2U A;  5LNK e;  5CRH A;  2GTU A;  1SU9 A;  1F6M C;  3M3M A;  4KSM A;  1M3I A;  2H1G A;  2C0G A;  4WR4 A;  2RM6 A;  3IBH A;  3KEB A;  4IQ1 A;  4WEY A;  3G9B A;  4BPY A;  4WF5 A;  4OFN A;  1SL2 B;  2E2M A;  3GFK A;  1TU8 A;  1DUG A;  5GAN D;  4IQA A;  3KP8 A;  3GNJ A;  3CSI A;  1A2L A;  4HOJ A;  3QCP A;  3H8Q A;  1YY7 A;  2CZ2 A;  2B1L A;  2BJX A;  4O5R A;  4BL7 A;  1GLQ A;  4CHS A;  1FOV A;  3LEF A;  1J0F A;  1MEK A;  1A24 A;  2LS5 A;  3TRX A;  3GH9 A;  9GSS A;  2R37 A;  5HR1 A;  3I9V 2;  2DJ3 A;  4ISD A;  2YP6 A;  4FYU A;  1SD9 A;  3TOT A;  2MMO A;  2IWT A;  3GSS A;  2V32 A;  4DSQ A;  1QFN A;  4TOP A;  3FZ4 A;  1GTU A;  1BAY A;  5J5N A;  3N9J A;  1AAZ A;  2JAC A;  3TJG A;  5ECL B;  2R2J A;  2AUV A;  2FLS A;  4QQ7 A;  2GQM A;  4NHW A;  4N11 A;  3DEX A;  2G2Q A;  1ML6 A;  2GT6 A;  2R0P A;  2PPT A;  5EVO A;  2MZC A;  3F4S A;  1FB0 A;  4K7O A;  4EE0 A;  2AHE A;  1B4P A;  1UA5 A;  1T00 A;  1I5G A;  1PL2 A;  1WP0 A;  3HYP A;  3UMA A;  3TRQ A;  4ZL8 A;  4KSO A;  5F07 A;  2FUG 2;  1G7O A;  2B7J A;  3TKR A;  3D0Z A;  4KGI A;  3KCM A;  4BVY B;  4Z7X A;  2H0H A;  2HYX A;  4FH8 A;  5EY6 A;  1JZW A;  2MMA A;  4TRX A;  3VWU A;  3US3 A;  1TRW A;  2A2S A;  5B8A A;  5B8B A;  2HRK A;  3IK7 A;  5FT3 A;  1X9W B;  3O3T A;  3UJ1 A;  2KHP A;  4Z2U A;  4MZB A;  22GS A;  2LUS A;  2DML A;  3VI5 A;  3KD0 A;  3LSZ A;  1X0R A;  1BX9 A;  2OKA A;  2CAI A;  2VUP A;  3TKS A;  4TXV A;  3A5I A;  3ZIV A;  3CYN A;  1THX A;  2HSM A;  2RUE A;  5AIV A;  4ML1 A;  3FYG A;  4P3Y B;  3RAZ A;  4ZIJ A;  2GT5 A;  2K8V A;  1EP8 A;  2VM2 A;  3UAP A;  4BWS A;  2JAD A;  5ECS A;  3M1G A;  3WT2 A;  2VAF A;  1R7H A;  5JCG A;  1XW5 A;  2FWG A;  2EC4 A;  3D4M A;  3QAW A;  3RHB A;  1EOG A;  1OC8 A;  4L5O A;  4OMV A;  1A8L A;  4N0V A;  5GST A;  1G7E A;  4FIW A;  2WB9 A;  3M0F A;  3VK9 A;  3BD2 A;  4ZBA A;  5IMF A;  5ECR B;  3TUE A;  2B6M A;  2LQO A;  4V2M A;  2YWI A;  4DSS A;  1SK1 A;  1VF2 A;  3BCI A;  3DIE A;  4XCS A;  3IOS A;  3QAV A;  2LST A;  4FQU A;  2LKU A;  1OC9 A;  4Z2T A;  1SKW B;  3LGC A;  1RW1 A;  5DVB A;  4PX1 A;  4HJ2 A;  3UAR A;  3H4K A;  2LRC A;  5C04 A;  2YV9 A;  4DEJ A;  1HNC A;  3CTF A;  1OE8 A;  2GZZ A;  2HRN A;  5ECI B;  4ID0 A;  1R5A A;  1KNG A;  1K0N A;  5F06 A;  2H72 A;  1ST9 A;  3F4T A;  2HSY A;  3FZ9 A;  1K0B A;  4F9Z A;  4EDZ A;  2ON7 A;  4MF5 A;  1QXH A;  4GWR A;  2GSS A;  1Y6E A;  1XVQ A;  4ZBD A;  2R3X A;  3UBL A;  1WJK A;  2PGT A;  1B48 A;  1K3Y A;  3APO A;  2I81 A;  1S3C A;  2TRX A;  1U88 A;  5DJM A;  4ILF A;  5D73 A;  1UN2 A;  4BVX A;  6GSY A;  1ERW A;  3TKS C;  2O7K A;  1HNB A;  3ZZX A;  4AGS A;  1ACV A;  2DJ2 A;  4MF6 A;  4IGJ A;  3IXR A;  2AV4 A;  1R4W A;  1WIK A;  4BVX B;  1THO A;  2DJ0 A;  2GSR A;  4HU7 A;  3TCO A;  4PQ1 A;  4KCA A;  2M80 A;  1ZYQ B;  1GP1 A;  2H76 A;  6GSW A;  2H66 A;  5BRT A;  1K0C A;  1NHY A;  4JED A;  1MDK A;  2ES7 A;  1GUK A;  1ERV A;  3NZN A;  4LMV A;  4O5Q A;  2WFC A;  2PUK C;  3TKS E;  1OAZ A;  2KUC A;  2C3T A;  2L5O A;  1GNW A;  4MZC A;  2ZUP A;  3BCK A;  3VWX A;  1R26 A;  4G0I A;  4A5P A;  1LU4 A;  1Q4J A;  5IMD A;  2CVB A;  2C3Q A;  3GTU B;  4TXO B;  5GZZ B;  4EO3 A;  3I6A A;  1CQG A;  1AW9 A;  1GSQ A;  2DMM A;  2VD0 A;  2A2R A;  3IRA A;  5ELA A;  4JBB A;  1XXU A;  1ERU A;  1URM A;  4J56 E;  2KP1 A;  4AJ7 A;  1SEN A;  2E2G A;  3DVW A;  4GSS A;  4J2F A;  4MAB A;  4OCF A;  4MPF A;  2KP2 A;  4Q5Q A;  2H1A A;  3IK9 A;  3JCM L;  4MNN A;  3UIW A;  3VWW A;  2H19 A;  2YZH A;  2LJK A;  2F3M A;  2L57 A;  2LRT A;  3TKP A;  3L9V A;  1OVN A;  4Q5R A;  5IO0 A;  4KW6 A;  2DJK A;  2O89 A;  2REM A;  2MMN A;  1A0F A;  3MDK A;  5ID2 A;  4MPG A;  1SL1 B;  1GSF A;  2E7P A;  1XOA A;  2K18 A;  4EF0 A;  2GST A;  3DVX A;  5B6N A;  1B4Q A;  4TR1 A;  3UVT A;  1O6J A;  3GKK A;  4I6X A;  3LWA A;  1TP9 A;  2H01 A;  3I69 A;  5H5Q A;  1T4Z A;  1AQX A;  5G1L A;  3TJJ A;  2VO4 A;  2WGR A;  1QGV A;  4ECC A;  5KN1 A;  4XS6 A;  3ZMK A;  2E0Q A;  1ZZY A;  4N0Z A;  4POB A;  5JWO B;  2HRA A;  6GSX A;  3H79 A;  3D4T A;  1VRS D;  4IN0 A;  1IYH A;  4WF4 A;  4MMM A;  5HFG A;  2JSY A;  1YF1 A;  3GKX A;  2GSQ A;  5KOW A;  2P31 A;  2WCI A;  4OFT A;  4IEL A;  3HCZ A;  4EUY A;  5LCZ A;  13GS A;  2WJU A;  3G7J A;  2V41 A;  2QKE A;  3DKS A;  3LW9 A;  3F6D A;  4ECI A;  5AIS A;  2YJH A;  4NXI A;  4JR6 A;  3KMN A;  4LL1 B;  1F3B A;  4KF9 A;  5B7C A;  2NDO A;  16GS A;  3C7M A;  2LJA A;  5KN0 A;  5HQP A;  1YJ6 A;  1QQ2 A;  5ENU A;  1GSD A;  3F3R A;  3KIJ A;  1XBS A;  5G30 A;  1TI3 A;  4RI7 A;  3EWL A;  4EIQ A;  2DKH A;  1PX6 A;  2RUF A;  2I4A A;  4XRA A;  1M2A A;  3GYK A;  4V1A g;  2H71 A;  1AXD A;  3ZFL A;  2B5X A;  1NM3 A;  1XG8 A;  3IPZ A;  2C0E A;  1G6W A;  4KCE A;  2AJQ B;  4NHZ A;  3APQ A;  4YKG A;  1AC1 A;  2VM1 A;  4GCI A;  3KGK A;  2LQQ A;  4PQI A;  1JLW A;  2DC5 A;  1SYR A;  4D73 A;  3F0I A;  5IM9 A;  3KH7 A;  2PBJ A;  3QOU A;  4KE3 A;  5G1K A;  2LTK A;  4IKH A;  3GMF A;  3FRC A;  5ECH B;  1TJD A;  5KOX A;  3WGE A;  1M3J A;  4D73 B;  2UZ8 A;  1RQM A;  5ECP B;  5ECK B;  4ZL9 A;  5F0G A;  2IMI A;  1O73 A;  2F8A A;  3E0U A;  3FK8 A;  3WT1 A;  4GQF A;  4EL1 A;  1U3A A;  4BWQ A;  2V6K A;  3ED3 A;  4I97 A;  3GH6 A;  5A4W A;  2B3S A;  5DCG A;  1O7U A;  4XS4 A;  1OC3 A;  2GQK A;  2H6Y A;  4V1A p;  1PL1 A;  1B8X A;  3LOR A;  2DKI A;  1JZD A;  3R3E A;  4NWY A;  4G9H A;  2PU9 C;  3G7I A;  5JWQ B;  3I43 A;  4MP4 A;  2HSH A;  4XS4 B;  5COH A;  1M7T A;  2NBS A;  3UEM A;  4BL7 B;  2CQ9 A;  2AAW A;  1ZOF A;  3CSH A;  1M2B A;  3HA9 A;  3C1S A;  2OBI A;  3IAS 2;  3HXS A;  3GRX A;  1M9B A;  4USS A;  1TRS A;  4HS1 A;  5DJL A;  3F9U A;  2X64 A;  1YZX A;  3IDV A;  20GS A;  1TOF A;  2H1D A;  2O8V B;  3P7X A;  3QFB C;  5HR0 A;  5CRW A;  2DJ1 A;  1DE2 A;  5JCW A;  1PN9 A;  4O32 A;  3BBY A;  3TOU A;  1FHE A;  1QUW A;  5INY A;  1GWC A;  1Z6N A;  1DE1 A;  1XPV A;  3EU3 A;  4L0U A;  4ML6 A;  4XHM A;  3BJ5 A;  4TR4 A;  1NHO A;  3IAM 2;  1VF1 A;  3TRP A;  5HFK A;  3ZL5 A;  3C73 A;  2ALB A;  5IMZ A;  1TW9 A;  2A2P A;  5AN1 A;  4L0W A;  1UC7 A;  3LXT A;  3GA4 A;  2VLU A;  2RII A;  4K0G A;  2IME A;  4HZ2 A;  1EEJ A;  2YWM A;  3QDN A;  4TN8 A;  1PGT A;  4X43 A;  2YAN A;  4QL7 A;  1J08 A;  2HRF A;  5FHI A;  3HY2 A;  4HZ4 A;  3IHQ A;  4NV2 A;  2C0F A;  5G5E A;  2BTO T;  1S3R A;  1JLV A;  4AJ6 A;  3A2V A;  3FZ5 A;  1OYJ A;  1K0O A;  2PVQ A;  2CX3 A;  3D21 A;  1GSY A;  3VPQ A;  4GLT A;  4GSN A;  4Z2R A;  1O81 A;  3A5W A;  1KTE A;  1GNE A;  1Z7R A;  3EVI A;  4HU9 A;  3GL5 A;  2P0G A;  3ERW A;  4K2X A;  1XCC A;  1HNA A;  1VF3 A;  2K8S A;  3FR6 A;  4K9Z A;  2PVO C;  7GSS A;  2WRT A;  1A8Y A;  1T8E B;  3L9S A;  2C3N A;  1GUH A;  1X9M B;  1X5E A;  3UL3 A;  2F8F A;  2H8L A;  2PER A;  2EIQ A;  4MH3 A;  2IL3 A;  1YDK A;  4G2E A;  4RUV A;  3UOM A;  2VCZ A;  5CNW A;  4DSS B;  1DBY A;  3IC4 A;  4WR5 A;  5CYY A;  2JU5 A;  3P8W A;  2M72 A;  1A23 A;  3GL3 A;  1OC9 B;  1V2A A;  4ZB6 A;  5BMU A;  2GS3 A;  2FHE A;  2GLR A;  1EGR A;  3Q18 A;  3VLN A;  1PQN A;  3TDG A;  4WKW A;  3W8S A;  1XW6 A;  2HI7 A;  3N5O A;  1PMT A;  3FZA A;  3WGD A;  1BJX A;  3ME8 A;  1OE7 A;  4YH2 A;  1WPI A;  3IE3 A;  4EVM A;  1FG4 A;  2R4V A;  1XWA A;  3D5J A;  1TKD B;  2D2Z A;  2N5F A;  3DD3 A;  5DDL A;  4WBJ A;  4K7I A;  1TK8 B;  3EU4 A;  3C8E A;  3FR3 A;  2NVL A;  1K0D A;  3DGQ A;  3FHK A;  2OE0 A;  3ZVJ D;  1ZMA A;  5D93 A;  3CTG A;  3W6G A;  1H4O A;  1X9S B;  1NW2 A;  2R6K A;  1W89 A;  1GTI A;  2F51 A;  1TRU A;  3PGT A;  2VL3 A;  4POL A;  3IHG A;  3GX8 A;  1YKC A;  1PSQ A;  3EPT A;  3D6I A;  2X49 A;  2YJ7 A;  1I9D A;  2OJL A;  3KXO A;  2WZ9 A;  2LV3 A;  3ZLP A;  4GXZ A;  1Q98 A;  1FAA A;  3FW2 A;  2TRC P;  5J41 A;  3FR9 A;  2C1Y A;  2VCX A;  3IV4 A;  4RQX A;  3ZIT A;  4PNF A;  3HVN A;  1Z3E A;  1GTA A;  1V40 A;  1CQH A;  4KUN A;  1PKZ A;  2PN8 A;  1PKW A;  3IC8 A;  3HJM A;  4V2L A;  2O87 A;  1MD3 A;  2MBS A;  4NMU A;  4HEA 2;  4MJA A;  1ILO A;  2YCD A;  4N10 A;  1FO5 A;  3KZQ A;  1MD4 A;  1WE0 A;  3KTB A;  3NIV A;  4WET A;  3ME7 A;  2H0G A;  4POK A;  2I1U A;  5EL8 A;  3Q19 A;  3KTL A;  5F05 A;  4F03 A;  3M9J A;  2PWJ A;  2R0G A;  3J7Y b;  1GSU A;  4O92 A;  1YEX A;  2RM5 A;  3Q74 A;  3QD9 A;  5KEJ A;  1HQO A;  3LJR A;  2FWF A;  4H86 A;  3ZTL A;  1OKT A;  1K0A A;  3PR8 A;  5IMV A;  1S3D A;  4E8E A;  3GUR A;  3M9K A;  3HJP A;  2QA2 A;  2X99 A;  3EIN A;  3HD5 A;  3GX0 A;  4FYC A;  4TW5 A;  2HE3 A;  2HLS A;  1F3A A;  5ID2 B;  1FVK A;  4GST A;  5KN3 A;  1K3L A;  1JZO A;  4K6X A;  3L78 A;  1H75 A;  3WYW A;  1WWJ A;  2C8U A;  2CT6 A;  3F3Q A;  2FD3 A; 
#chains in the Genus database with same CATH homology
 2JZT A;  2YWN A;  4AF2 A;  3PPU A;  1R5P A;  3RPN A;  5CRD A;  4TR1 B;  5J9B A;  4IP6 A;  4ZIL A;  3DRN A;  3TJB A;  3ZYW A;  1M0U A;  2H6Z A;  2H30 A;  3U6V A;  1U6T A;  5D96 A;  2CV4 A;  3A2W A;  1V9W A;  1PA3 A;  3M8N A;  2NPB A;  3CRT A;  3QR6 A;  3VI7 A;  4KA0 A;  4CY8 A;  3U5R E;  2HZF A;  1XWG A;  2VL2 A;  2I3Y A;  2IMF A;  4YQV A;  2IMK A;  2G0F A;  2K6V A;  4LMW A;  4MK3 A;  2C80 A;  2XC2 A;  1IYI A;  2FWE A;  1NSW A;  1GUL A;  4IS0 A;  1FVJ A;  5IPH A;  2N5B A;  1XIY A;  10GS A;  2F9S A;  2H75 A;  4MCU A;  3VUR A;  4PXO A;  3H1N A;  1SJZ A;  1HYU A;  3GN3 A;  2GZP A;  5HFI A;  2FCH A;  3KM6 A;  5IOW A;  2HFD A;  3TGZ A;  3UVH A;  4GF0 A;  3PH9 A;  2HT9 A;  3RHC A;  4ICY A;  3EMP A;  2YPM A;  1YF0 A;  4JE1 A;  2B1K A;  4IHU A;  2QA1 A;  1ZYP A;  1W4V A;  3QPM A;  4TVE A;  2A4H A;  1N8J A;  3HKR A;  5GAP D;  2EIO A;  2V1M A;  1JFU A;  1TRV A;  3C1R A;  2FY6 A;  1AUC A;  4FYB A;  1EOH A;  2XBQ A;  3GKN A;  3SWL A;  1EV4 A;  4MJE A;  2X4A A;  3VFI A;  1SL0 B;  3KP9 A;  3F8U A;  4E8H A;  5G31 A;  3QFA C;  3F63 A;  4HQZ A;  4K7N A;  5AIX A;  3FKF A;  3F6F A;  2A4V A;  3APS A;  2XPD A;  3O76 A;  3LQ7 A;  1GL8 A;  1XWB A;  3DWV A;  3GV1 A;  4N30 A;  1PX7 A;  1RK4 A;  3ZVJ A;  4G10 A;  3ZIJ A;  3EYT A;  5CAX A;  2OBK A;  2GDR A;  5E59 A;  4ZB9 A;  5H5S A;  4OWY A;  2OA7 A;  4OO4 A;  1GUM A;  4X1U A;  3MYD A;  2OE3 A;  1SKS B;  3TB2 A;  1EV9 A;  4YQM A;  2VL2 C;  3RPP A;  4JRR A;  1ABA A;  1XW9 A;  2C0D A;  4LL4 B;  1B9X C;  5D9W A;  5CRE A;  3LFL A;  4CW9 A;  1GRX A;  2LRN A;  3CXG A;  5A5K A;  3WGX A;  2X8C A;  1SKR B;  2FWH A;  2R5G A;  4QL9 A;  4F82 A;  4F0C A;  4NPB A;  4EKZ A;  1JZR A;  18GS A;  5CO3 A;  3C71 A;  4K0N A;  4IBP A;  4G0K A;  4AJ8 A;  1EGO A;  5HR2 A;  1MTC A;  3CBU A;  3DML A;  4G19 A;  2L5L A;  2VD1 A;  1BYE A;  1LBK A;  2DIY A;  1PN0 A;  4YKF A;  4V2N A;  5JCU A;  1G0T A;  4X0X A;  1T3B A;  2B5E A;  1B9Y C;  3HJO A;  3A2X A;  4I2T A;  2YV7 A;  2QC7 A;  5JWR B;  4MJC A;  1O8W A;  2XHF A;  2CX4 A;  3KMO A;  2R0C A;  1JHB A;  3CRU A;  2DIZ A;  2J9H A;  1O8X A;  3ZML A;  4NAX A;  2N5A A;  1FOH A;  2L4Q A;  4ECJ A;  1YKA A;  2CVD A;  4ACS A;  1BG5 A;  3O6T A;  4TR0 A;  4YAP A;  6GSU A;  4F0B A;  3HVX A;  3HVV A;  1TK0 B;  3L0H A;  2XPE A;  5IIZ A;  2YNX A;  4BVY A;  1Z6M A;  5G5F A;  2DJJ A;  4BA7 A;  1XOB A;  4ZXG A;  5A4V A;  3CMI A;  2JSZ A;  2I9H A;  2O85 A;  3HZ4 A;  4EC0 A;  19GS A;  3ZRE A;  1OKD A;  3MIX A;  2CA8 A;  4ZBB A;  2Z9S A;  1QK8 A;  4MLY A;  3Q6O A;  2MBT A;  3OR5 A;  4EIP A;  4J57 E;  1C72 A;  3GST A;  2CAQ A;  3MAK A;  3A3T A;  3ISO A;  1M2D A;  1WMJ A;  1SK2 A;  1E2Y A;  4MDC A;  5DQS A;  2LJR A;  3EE2 A;  2QGV A;  3PIN A;  4ZL7 A;  3GIX A;  4HI7 A;  2XBI A;  1GSS A;  1U87 A;  3VPT A;  1EWX A;  2DBC A;  3EUR A;  3ZRD A;  2VIM A;  5GSS A;  2TIR A;  2LNS A;  1DSB A;  4XRD A;  4DVC A;  5D8I A;  1KEB A;  1U3I A;  2J23 A;  3FMW A;  5F8B A;  4XTS A;  2B7K A;  3KH9 A;  4EDY A;  2L59 A;  4KAE A;  1M9A A;  4EXJ A;  3H93 A;  3TJF A;  3EMX A;  5IPG A;  1ZCP A;  2LEG A;  2ZCT A;  1V57 A;  5J4U A;  5C00 A;  1F37 A;  1TK5 B;  1T1V A;  2ZNM A;  2MMZ A;  3L9U A;  5CP1 A;  2DSA A;  4K5R A;  5DQY A;  4DSR A;  4ZB8 A;  2M46 A;  1ERT A;  3WD6 A;  5EPF A;  4X4J A;  2IFQ A;  3IR4 A;  4RQR A;  3QMX A;  2JZR A;  4KH7 A;  1N2A A;  1FB6 A;  2OAD A;  1GSE A;  1X5C A;  2AYT A;  3DXB A;  2IFQ B;  4MF7 A;  1TTZ A;  4HJM A;  3KJY A;  3P2A A;  5KN2 A;  5E4W A;  4KDU A;  2FA4 A;  1BED A;  2X8H A;  4K5S A;  3LYK A;  1K0M A;  1XWC A;  4WXT A;  4K8M A;  1X5D A;  1AIU A;  3G7Y A;  4JR4 A;  5DAL A;  2RLI A;  3DYR A;  3GKM A;  1GH2 A;  4OCE A;  4XS1 A;  4IP1 A;  4TKY A;  2OAC A;  5IMA A;  4OO5 A;  3R2Q A;  2VCT A;  4KB3 A;  3MSZ A;  1USB A;  2IN3 A;  1G6Y A;  1AQV A;  5DAL B;  5J3R A;  1AQW A;  2FNO A;  2VLV A;  1XWK A;  11GS A;  5A4U A;  4OD7 A;  1SK0 A;  5ECO B;  2L6C A;  4GRF A;  5DAK A;  2KOK A;  12GS A;  3VWV A;  5J9C A;  3FY7 A;  1M99 A;  1SD8 A;  1BQ7 A;  1J9B A;  1ZGN A;  4LLR A;  5DAK B;  4I8B A;  2QSI A;  3V1W A;  3UBK A;  2WDU A;  4FO5 A;  3P90 A;  4MZW A;  4RI6 A;  3SBC A;  4JU5 A;  2WUL A;  2YZU A;  2P5Q A;  1YQ1 A;  4GTU A;  3QAG A;  1T7P B;  3IA1 A;  4O5U A;  2V6O A;  5IOX A;  4XIH A;  2FA8 A;  3TJK A;  1VF4 A;  3RBT A;  4MH2 A;  1FW1 A;  5CRG A;  2VL9 A;  1PRX A;  3GTU A;  4TXO A;  2LNT A;  5AGY A;  5ECQ B;  2OE1 A;  4O7H A;  2H6X A;  1MDI A;  2HZE A;  3HHV A;  3L4N A;  1EEM A;  3ERG A;  14GS A;  1V58 A;  2C4J A;  4CY6 A;  1V98 A;  1Z5Y E;  2HZE B;  3LYP A;  4PQH A;  1HD2 A;  5FWG A;  4IJI A;  3F4R A;  4L5L A;  1EZK A;  2IMD A;  2MYG A;  2H0I A;  5D9X A;  3LXZ A;  1SJI A;  2KLX A;  5HR3 A;  17GS A;  4KDX A;  2AB6 A;  2DLX A;  4PUR A;  2YOI A;  1TXX A;  1Z9H A;  1ZYN A;  2CZ3 A;  2VCQ A;  1QMV A;  3GHA A;  4KND A;  1SYX A;  1T4Y A;  2H74 A;  6GSS A;  4MJB A;  5L71 A;  4CDO A;  5ABR A;  5ECN B;  4KDY A;  4Q5F A;  4HQS A;  3HDC A;  3E3E A;  4WBR D;  2GVP A;  2IIY A;  5DCH A;  1SJ6 A;  4YAV A;  1ZL9 A;  4G0L A;  5IQY A;  5H5R A;  4JZQ A;  2HXK A;  4YQU A;  4NV5 A;  2NTO A;  3GUS A;  8GSS A;  4OFM A;  5ECM B;  4IVF A;  4PUF C;  4F2I A;  4MA9 A;  3ERF A;  5D9T A;  3HVS A;  5ELG A;  3K8N A;  2GGT A;  4PTS A;  2IPA A;  3W8J A;  3S9F A;  4HUA A;  2L6D A;  6GST A;  5LD0 A;  4PNG A;  4ULX A;  1XVW A;  2H70 A;  1UVZ A;  4K1F A;  2VLT A;  4IW9 A;  2YN1 A;  2GQL A;  1VGL A;  3NOF A;  1O85 A;  3TKQ A;  1A0R P;  3J7Y k;  5D9V A;  1TU7 A;  4POM A;  4PUA A;  2FGX A;  4IJ3 A;  2GZY A;  2V2G A;  5IMC A;  2L4C A;  1F2E A;  1TDI A;  1WRY A;  2K9F A;  3ZFB A;  4GQC A;  1Z7P A;  2EIR A;  1MDJ A;  2VCV A;  1A2M A;  2ON5 A;  3MWH A;  3LG6 A;  3HZ8 A;  1PD2 1;  3D22 A;  4LA1 A;  1EP7 A;  2IJY A;  1YEP A;  1LJR A;  2VOC A;  1E6B A;  1KBN A;  2X8G A;  3AY8 A;  2P5R A;  3E9J B;  3CSJ A;  1WOU A;  2BMX A;  2JL4 A;  4ECB A;  1ON4 A;  4Q5N A;  2YWO A;  1F9M A;  1XFL A;  1Y25 A;  1K3O A;  5G2Z A;  2B5Y A;  4TR3 A;  1XZO A;  4L8E A;  2PMT A;  1GTB A;  4HDE A;  2VCW A;  4I5Q A;  2HNL A;  1ZYE A;  4KX4 A;  3MNG A;  3BOA A;  3RDW A;  1S3A A;  6GSV A;  5B6M A;  1A2J A;  5DBQ A;  2H1B A;  1TI1 A;  3FEU A;  2H73 A;  1GLP A;  3EC3 A;  2JZS A;  4K2D A;  4PGT A;  2WS2 A;  5IO2 A;  2CVK A;  4I2U A;  5LNK e;  5CRH A;  2GTU A;  1SU9 A;  1F6M C;  3M3M A;  4KSM A;  2H1G A;  2C0G A;  4WR4 A;  2RM6 A;  3IBH A;  3KEB A;  4IQ1 A;  4WEY A;  3G9B A;  4BPY A;  4WF5 A;  4OFN A;  1SL2 B;  2E2M A;  3GFK A;  1TU8 A;  1DUG A;  5GAN D;  4IQA A;  3KP8 A;  3GNJ A;  3CSI A;  1A2L A;  4HOJ A;  3QCP A;  3H8Q A;  1YY7 A;  2CZ2 A;  2B1L A;  2BJX A;  4O5R A;  4BL7 A;  1GLQ A;  4CHS A;  1FOV A;  3LEF A;  1J0F A;  1MEK A;  1A24 A;  2LS5 A;  3TRX A;  3GH9 A;  9GSS A;  2R37 A;  5HR1 A;  3I9V 2;  2DJ3 A;  4ISD A;  2YP6 A;  4FYU A;  1SD9 A;  3TOT A;  2MMO A;  2IWT A;  3GSS A;  2V32 A;  4DSQ A;  1QFN A;  4TOP A;  3FZ4 A;  1GTU A;  1BAY A;  5J5N A;  3N9J A;  1AAZ A;  2JAC A;  3TJG A;  5ECL B;  2R2J A;  2AUV A;  2FLS A;  4QQ7 A;  2GQM A;  4NHW A;  4N11 A;  3DEX A;  2G2Q A;  1ML6 A;  2GT6 A;  2R0P A;  2PPT A;  5EVO A;  2MZC A;  3F4S A;  1FB0 A;  4K7O A;  4EE0 A;  2AHE A;  1B4P A;  1UA5 A;  1T00 A;  1I5G A;  1PL2 A;  1WP0 A;  3HYP A;  3UMA A;  3TRQ A;  4ZL8 A;  4KSO A;  5F07 A;  2FUG 2;  1G7O A;  2B7J A;  3TKR A;  3D0Z A;  4KGI A;  3KCM A;  4BVY B;  4Z7X A;  2H0H A;  2HYX A;  4FH8 A;  5EY6 A;  1JZW A;  2MMA A;  4TRX A;  3VWU A;  3US3 A;  1TRW A;  2A2S A;  5B8A A;  5B8B A;  2HRK A;  3IK7 A;  5FT3 A;  1X9W B;  3O3T A;  3UJ1 A;  2KHP A;  4Z2U A;  4MZB A;  22GS A;  2LUS A;  2DML A;  3VI5 A;  3KD0 A;  3LSZ A;  1X0R A;  1BX9 A;  2OKA A;  2CAI A;  2VUP A;  3TKS A;  4TXV A;  3A5I A;  3ZIV A;  3CYN A;  1THX A;  2HSM A;  2RUE A;  5AIV A;  4ML1 A;  3FYG A;  4P3Y B;  3RAZ A;  4ZIJ A;  2GT5 A;  2K8V A;  1EP8 A;  2VM2 A;  3UAP A;  4BWS A;  2JAD A;  5ECS A;  3M1G A;  3WT2 A;  2VAF A;  1R7H A;  5JCG A;  1XW5 A;  2FWG A;  2EC4 A;  3D4M A;  3QAW A;  3RHB A;  1EOG A;  1OC8 A;  4L5O A;  4OMV A;  1A8L A;  4N0V A;  5GST A;  1G7E A;  4FIW A;  2WB9 A;  3M0F A;  3VK9 A;  3BD2 A;  4ZBA A;  5IMF A;  5ECR B;  3TUE A;  2B6M A;  2LQO A;  4V2M A;  2YWI A;  4DSS A;  1SK1 A;  1VF2 A;  3BCI A;  3DIE A;  4XCS A;  3IOS A;  3QAV A;  2LST A;  4FQU A;  2LKU A;  1OC9 A;  4Z2T A;  1SKW B;  3LGC A;  1RW1 A;  5DVB A;  4PX1 A;  4HJ2 A;  3UAR A;  3H4K A;  2LRC A;  5C04 A;  2YV9 A;  4DEJ A;  1HNC A;  3CTF A;  1OE8 A;  2GZZ A;  2HRN A;  5ECI B;  4ID0 A;  1R5A A;  1KNG A;  1K0N A;  5F06 A;  2H72 A;  1ST9 A;  3F4T A;  2HSY A;  3FZ9 A;  1K0B A;  4F9Z A;  4EDZ A;  2ON7 A;  4MF5 A;  1QXH A;  4GWR A;  2GSS A;  1Y6E A;  1XVQ A;  4ZBD A;  2R3X A;  3UBL A;  1WJK A;  2PGT A;  1B48 A;  1K3Y A;  3APO A;  2I81 A;  1S3C A;  2TRX A;  1U88 A;  5DJM A;  4ILF A;  5D73 A;  1UN2 A;  4BVX A;  6GSY A;  1ERW A;  3TKS C;  2O7K A;  1HNB A;  3ZZX A;  4AGS A;  1ACV A;  2DJ2 A;  4MF6 A;  4IGJ A;  3IXR A;  2AV4 A;  1R4W A;  1WIK A;  4BVX B;  1THO A;  2DJ0 A;  2GSR A;  4HU7 A;  3TCO A;  4PQ1 A;  4KCA A;  2M80 A;  1ZYQ B;  1GP1 A;  2H76 A;  6GSW A;  2H66 A;  5BRT A;  1K0C A;  1NHY A;  4JED A;  1MDK A;  2ES7 A;  1GUK A;  1ERV A;  3NZN A;  4LMV A;  4O5Q A;  2WFC A;  2PUK C;  3TKS E;  1OAZ A;  2KUC A;  2C3T A;  2L5O A;  1GNW A;  4MZC A;  2ZUP A;  3BCK A;  3VWX A;  1R26 A;  4G0I A;  4A5P A;  1LU4 A;  1Q4J A;  5IMD A;  2CVB A;  2C3Q A;  3GTU B;  4TXO B;  5GZZ B;  4EO3 A;  3I6A A;  1CQG A;  1AW9 A;  1GSQ A;  2DMM A;  2VD0 A;  2A2R A;  3IRA A;  5ELA A;  4JBB A;  1XXU A;  1ERU A;  1URM A;  4J56 E;  2KP1 A;  4AJ7 A;  1SEN A;  2E2G A;  3DVW A;  4GSS A;  4J2F A;  4MAB A;  4OCF A;  4MPF A;  2KP2 A;  4Q5Q A;  2H1A A;  3IK9 A;  3JCM L;  4MNN A;  3UIW A;  3VWW A;  2H19 A;  2YZH A;  2LJK A;  2F3M A;  2L57 A;  2LRT A;  3TKP A;  3L9V A;  1OVN A;  4Q5R A;  5IO0 A;  4KW6 A;  2DJK A;  2O89 A;  2REM A;  2MMN A;  1A0F A;  3MDK A;  5ID2 A;  4MPG A;  1SL1 B;  1GSF A;  2E7P A;  1XOA A;  2K18 A;  4EF0 A;  2GST A;  3DVX A;  5B6N A;  1B4Q A;  4TR1 A;  3UVT A;  1O6J A;  3GKK A;  4I6X A;  3LWA A;  1TP9 A;  2H01 A;  3I69 A;  5H5Q A;  1T4Z A;  1AQX A;  5G1L A;  3TJJ A;  2VO4 A;  2WGR A;  1QGV A;  4ECC A;  5KN1 A;  4XS6 A;  3ZMK A;  2E0Q A;  1ZZY A;  4N0Z A;  4POB A;  5JWO B;  2HRA A;  6GSX A;  3H79 A;  3D4T A;  1VRS D;  4IN0 A;  1IYH A;  4WF4 A;  4MMM A;  5HFG A;  2JSY A;  1YF1 A;  3GKX A;  2GSQ A;  5KOW A;  2P31 A;  2WCI A;  4OFT A;  4IEL A;  3HCZ A;  4EUY A;  5LCZ A;  13GS A;  2WJU A;  3G7J A;  2V41 A;  2QKE A;  3DKS A;  3LW9 A;  3F6D A;  4ECI A;  5AIS A;  2YJH A;  4NXI A;  4JR6 A;  3KMN A;  4LL1 B;  1F3B A;  4KF9 A;  5B7C A;  2NDO A;  16GS A;  3C7M A;  2LJA A;  5KN0 A;  5HQP A;  1YJ6 A;  1QQ2 A;  5ENU A;  1GSD A;  3F3R A;  3KIJ A;  1XBS A;  5G30 A;  1TI3 A;  4RI7 A;  3EWL A;  4EIQ A;  2DKH A;  1PX6 A;  2RUF A;  2I4A A;  4XRA A;  1M2A A;  3GYK A;  4V1A g;  2H71 A;  1AXD A;  3ZFL A;  2B5X A;  1NM3 A;  3IPZ A;  2C0E A;  1G6W A;  4KCE A;  2AJQ B;  4NHZ A;  3APQ A;  4YKG A;  1AC1 A;  2VM1 A;  4GCI A;  3KGK A;  2LQQ A;  4PQI A;  1JLW A;  2DC5 A;  1SYR A;  4D73 A;  3F0I A;  5IM9 A;  3KH7 A;  2PBJ A;  3QOU A;  4KE3 A;  5G1K A;  2LTK A;  4IKH A;  3GMF A;  3FRC A;  5ECH B;  1TJD A;  5KOX A;  3WGE A;  4D73 B;  2UZ8 A;  1RQM A;  5ECP B;  5ECK B;  4ZL9 A;  5F0G A;  2IMI A;  1O73 A;  2F8A A;  3E0U A;  3FK8 A;  3WT1 A;  4GQF A;  4EL1 A;  1U3A A;  4BWQ A;  2V6K A;  3ED3 A;  4I97 A;  3GH6 A;  5A4W A;  2B3S A;  5DCG A;  1O7U A;  4XS4 A;  1OC3 A;  2GQK A;  2H6Y A;  4V1A p;  1PL1 A;  1B8X A;  3LOR A;  2DKI A;  1JZD A;  3R3E A;  4NWY A;  4G9H A;  2PU9 C;  3G7I A;  5JWQ B;  3I43 A;  4MP4 A;  2HSH A;  4XS4 B;  5COH A;  1M7T A;  2NBS A;  3UEM A;  4BL7 B;  2CQ9 A;  2AAW A;  1ZOF A;  3CSH A;  1M2B A;  3HA9 A;  3C1S A;  2OBI A;  3IAS 2;  3HXS A;  3GRX A;  1M9B A;  4USS A;  1TRS A;  4HS1 A;  5DJL A;  3F9U A;  2X64 A;  1YZX A;  3IDV A;  20GS A;  1TOF A;  2H1D A;  2O8V B;  3P7X A;  3QFB C;  5HR0 A;  5CRW A;  2DJ1 A;  1DE2 A;  5JCW A;  1PN9 A;  4O32 A;  3BBY A;  3TOU A;  1FHE A;  1QUW A;  5INY A;  1GWC A;  1Z6N A;  1DE1 A;  1XPV A;  3EU3 A;  4L0U A;  4ML6 A;  4XHM A;  3BJ5 A;  4TR4 A;  1NHO A;  3IAM 2;  1VF1 A;  3TRP A;  5HFK A;  3ZL5 A;  3C73 A;  2ALB A;  5IMZ A;  1TW9 A;  2A2P A;  5AN1 A;  4L0W A;  1UC7 A;  3LXT A;  3GA4 A;  2VLU A;  2RII A;  4K0G A;  2IME A;  4HZ2 A;  1EEJ A;  2YWM A;  3QDN A;  4TN8 A;  1PGT A;  4X43 A;  2YAN A;  4QL7 A;  1J08 A;  2HRF A;  5FHI A;  3HY2 A;  4HZ4 A;  3IHQ A;  4NV2 A;  2C0F A;  5G5E A;  2BTO T;  1JLV A;  4AJ6 A;  3A2V A;  3FZ5 A;  1OYJ A;  1K0O A;  2PVQ A;  2CX3 A;  3D21 A;  1GSY A;  3VPQ A;  4GLT A;  4GSN A;  4Z2R A;  1O81 A;  3A5W A;  1KTE A;  1GNE A;  1Z7R A;  3EVI A;  4HU9 A;  3GL5 A;  2P0G A;  3ERW A;  4K2X A;  1XCC A;  1HNA A;  1VF3 A;  2K8S A;  3FR6 A;  4K9Z A;  2PVO C;  7GSS A;  2WRT A;  1A8Y A;  1T8E B;  3L9S A;  2C3N A;  1GUH A;  1X9M B;  1X5E A;  3UL3 A;  2F8F A;  2H8L A;  2PER A;  2EIQ A;  4MH3 A;  2IL3 A;  1YDK A;  4G2E A;  4RUV A;  3UOM A;  2VCZ A;  5CNW A;  4DSS B;  1DBY A;  3IC4 A;  4WR5 A;  5CYY A;  2JU5 A;  3P8W A;  2M72 A;  1A23 A;  3GL3 A;  1OC9 B;  1V2A A;  4ZB6 A;  5BMU A;  2GS3 A;  2FHE A;  2GLR A;  1EGR A;  3Q18 A;  3VLN A;  1PQN A;  3TDG A;  4WKW A;  3W8S A;  1XW6 A;  2HI7 A;  3N5O A;  1PMT A;  3FZA A;  3WGD A;  1BJX A;  3ME8 A;  1OE7 A;  4YH2 A;  1WPI A;  3IE3 A;  4EVM A;  1FG4 A;  2R4V A;  1XWA A;  3D5J A;  1TKD B;  2D2Z A;  2N5F A;  3DD3 A;  5DDL A;  4WBJ A;  4K7I A;  1TK8 B;  3EU4 A;  3C8E A;  3FR3 A;  2NVL A;  1K0D A;  3DGQ A;  3FHK A;  2OE0 A;  3ZVJ D;  1ZMA A;  5D93 A;  3CTG A;  3W6G A;  1H4O A;  1X9S B;  1NW2 A;  2R6K A;  1W89 A;  1GTI A;  2F51 A;  1TRU A;  3PGT A;  2VL3 A;  4POL A;  3IHG A;  3GX8 A;  1YKC A;  1PSQ A;  3EPT A;  3D6I A;  2X49 A;  2YJ7 A;  1I9D A;  2OJL A;  3KXO A;  2WZ9 A;  2LV3 A;  3ZLP A;  4GXZ A;  1Q98 A;  1FAA A;  3FW2 A;  2TRC P;  5J41 A;  3FR9 A;  2C1Y A;  2VCX A;  3IV4 A;  4RQX A;  3ZIT A;  4PNF A;  1Z3E A;  1GTA A;  1V40 A;  1CQH A;  4KUN A;  1PKZ A;  2PN8 A;  1PKW A;  3IC8 A;  3HJM A;  4V2L A;  2O87 A;  1MD3 A;  2MBS A;  4NMU A;  4HEA 2;  4MJA A;  1ILO A;  2YCD A;  4N10 A;  1FO5 A;  3KZQ A;  1MD4 A;  1WE0 A;  3KTB A;  3NIV A;  4WET A;  3ME7 A;  2H0G A;  4POK A;  2I1U A;  5EL8 A;  3Q19 A;  3KTL A;  5F05 A;  4F03 A;  3M9J A;  2PWJ A;  2R0G A;  3J7Y b;  1GSU A;  4O92 A;  1YEX A;  2RM5 A;  3Q74 A;  3QD9 A;  5KEJ A;  1HQO A;  3LJR A;  2FWF A;  4H86 A;  3ZTL A;  1OKT A;  1K0A A;  3PR8 A;  5IMV A;  1S3D A;  4E8E A;  3GUR A;  3M9K A;  3HJP A;  2QA2 A;  2X99 A;  3EIN A;  3HD5 A;  3GX0 A;  4FYC A;  4TW5 A;  2HE3 A;  2HLS A;  1F3A A;  5ID2 B;  1FVK A;  4GST A;  5KN3 A;  1K3L A;  1JZO A;  4K6X A;  3L78 A;  1H75 A;  3WYW A;  1WWJ A;  2C8U A;  2CT6 A;  3F3Q A;  2FD3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...