5KNDH

Crystal structure of the pi-bound v1 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
TYKIGVVGDKDSVSPFRLFGFDVQHGTTKTEIRKTIDEMAKNEYGVIYITEQCANLVPETIERYKGQLTPAIILIPSHQGTLGIGLEEIQNSVEKAVGQNIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the ATP-binding and ADP-release dwells of the V1 rotary motor
pubmed doi rcsb
source organism Enterococcus hirae atcc 9790
molecule tags Hydrolase
molecule keywords V-type sodium ATPase catalytic subunit A
total genus 25
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 5kndH00
3VR5H 2I4RA 3VR6H 5KNDH 4RNDB 5KNCH 3VR4H 3W3AH 3AONB 2OV6A 2QAIA 2D00A 4IX9A 5KNBH
chains in the Genus database with same CATH superfamily
4MIKA 1HQCA 1GQYA 1XI2A 3Q40A 4LE1A 4O1HA 2Y6UA 3SEZA 1QK5A 1GQQA 4GMHA 1HX7A 3IOYA 5JISA 1FJHA 1NW5A 3RGWS 3RJTA 4MB6A 3IEPA 3C3AA 4NFYA 1FX0B 1C30A 1QIJA 4PHTA 2ZIXA 2D2IA 5DJ5A 1U94A 3FF1A 4BIIA 2GMWA 5JU6A 1G5PA 1SUAA 1H0KA 2EOAA 3H17A 3PJFA 4OP1A 4FFLA 2YICA 3BE5A 5C52B 1NURA 1C29B 1UZLA 4Y0VA 2VH1A 5DB4A 4RHTA 1P0QA 1FP1D 5KEIA 3UV6A 2UKDA 3VNVA 3ZE8A 4AFNA 5K0EA 4M0UA 3U7GA 3PEEA 3C7CB 4ER6A 5DM0A 5CM9C 2R6FA 1B16A 1PU2A 2OV3A 2HHAA 3O8LA 2JIBA 2BONA 3K5PA 5DHTA 2BBOA 2CJYA 4INJA 2QN7A 4UDOA 2ZXUA 3L6BA 1M1YA 2RBGA 2X13A 3TXXA 4C0SA 1R9GA 5IKPA 1SUCA 1W1WA 2C97A 4J9VA 4CDMA 1C9DB 3G8YA 4NULA 5IHPA 4JB0A 1UXGA 4KPEC 4CU2A 3RABA 2AMLA 2XTNA 4Y7DA 1DBWA 2YYYA 1QF7A 4J0FA 1IJBA 2ATVA 3QJGA 3R7LA 2ZOSA 1NJ8A 3SN6A 3OFJA 3UFBA 2QF7A 5KVCA 1G3QA 5BNTA 1JG4A 4HZUB 4B2LA 4ER5A 2G28A 3FFBA 1RABA 3B1XA 3E9RA 3IPLA 2WYOA 4L4RA 2DBVO 2Y1FA 2ZQYA 2FSFA 3NUGA 4II7A 3E70C 4KG7A 5HIMA 4QJ3A 4MPRA 3T3MB 5HZMA 5C8DA 3P9NA 2G3YA 1HEUA 4ZU3A 1BXRA 3KQSA 4IMPA 1I4EB 1IOLA 2N3ZA 4XQGA 4CVNA 5HOQA 5CFNA 3FOZA 1GSOA 1S3FA 1VIVA 4AKSA 4BFUA 3FHLA 3BX1A 3IVAA 3KJQA 5IP5A 1TDJA 2VT2A 2XECA 1ESDA 3LT0A 1YBVA 4HVTA 4EHNA 1P18A 3TOCA 1YR9A 2LE0A 3CF6R 2A9FA 1MC1A 1NVXQ 3G0CA 1ETUA 1RAAA 1GAQA 2IS6A 1D9XA 4EJ0A 3OLCX 4QHSA 1P5ZB 3MVEA 1H0HA 4WESA 1Z75A 2VBFA 1NQVA 5KOHA 1A76A 3EZ9A 2PX3A 3P26A 5BN3B 3OX2A 5KOIA 1P1FA 3L7OA 3E23A 3AHGA 1HDCA 1XEWX 1ZEMA 2A30A 2OG1A 4RD6A 2OTCA 1LDMA 4B83A 5HE9A 3Q0IA 4EJ2A 2JRLA 3KQTA 2YFQA 1G7SA 1HG1A 1SXJC 2BR5A 1JIUA 4IX9A 1XKLA 1TCAA 4J43A 1WXGA 2AGVA 3VPXA 3CVXA 4MQ5A 5JDIC 2BMDA 1JIVA 4UEOA 2J09A 1P9OA 1WXIA 1CERA 4YJKA 3EQ2A 3W7AA 5K4GA 1E8MA 1TD9A 3R9XB 2V96A 1KE1A 4OLJA 3VR2D 4EEXA 3JYOA 3AX6A 3OM0A 4IV5A 3RFCA 3V42A 1WXEA 4YLYA 3A4TA 3H9GA 2GD6A 5MN4A 4NH0A 4CKZA 2I62A 4MKGA 1VA5A 2ZT7A 3DDHA 3K94A 1FSGA 3D0RA 3GBSA 4OA5A 1HQYE 5FLYA 1HT3A 4C7XA 4NE7A 2JFYA 2H85A 2CUTA 1RAEA 4KE9A 5FRDA 2OV6A 2JIZD 3TO5A 3HJHA 3ZCPA 2BKXA 3L6OO 2BTQA 1QGDA 3FTFA 3P9XA 1KYYA 3P4UA 3QG1A 3CPSA 4AF8A 1XHEA 2Q2QA 2VP6A 3ELYA 1G1MA 4LZJA 4ASUA 1XOIA 5JOQA 1L7AA 4GOXA 4RSRA 4EPYA 1AQJA 4I4LA 3P9QA 2C7RA 3K31A 1AQUA 1TK9A 1EWTA 2J3HA 4YMHA 1I2BA 1NRXA 1E9RA 3L7MA 4L9RA 5IXYA 2GPBA 4I1UA 1ZJJA 4UBJA 2FN3A 2E87A 2ZYAA 3DLIA 4QDZA 5JCJA 4IXMA 3CUUA 4RKWA 1DAKA 1JXOA 1L6RA 1NZFA 2VJDA 3IT3A 4Q0MA 1H2FA 3DZGA 3K8ZA 3ETNA 3EH2A 3ONEA 4M88A 2WQ7A 3WYNA 1SOWA 4G07A 3T3PB 1TF7A 3YASA 421PA 3HTXA 3FYSA 3MT9A 4J2TA 3H99A 1ZC4A 2Z57A 4MO9A 1PW7A 1S2IA 1PL8A 2V1UA 1FRNA 1EM6A 1G8AA 4OJYA 4RFSA 1DI0A 3T3DA 3JASB 3MJVA 3VJKA 4MB0A 3N39C 3ZU3A 4HBZA 1WZNA 1ZUIA 3BF8A 1OMOA 2AVNA 3MWKA 1L1RA 4KC0A 3RFXA 2QM0A 1POWA 4DGSA 4FYMA 9MHTA 4HAUA 2IXTA 1EFCA 5CUQA 5LLTA 1SIBE 5HDBB 5J5VA 4ED9A 1LDBA 2P2CA 2V98A 2ZR8A 5AI4A 3SQMA 1Z8NA 3VR4H 1TCBA 1VIMA 2OSBA 3KT8A 1IDN1 2A78A 2W93A 3I92A 3MSCA 1GLNA 3O4VA 4KXXA 3VZBA 1DMRA 3PFNA 3COSA 2Z8ZA 1QK4A 1JQEA 3T3HA 3UB4A 3GAAA 2Y1OA 1FP6A 3OT4A 1HO3A 4YRGA 5KVVA 4R9RA 1DOHA 2DJ5A 2IHTA 3L6CA 3T9BA 4REQA 1EE9A 3MWGA 2A1IA 1SC6A 1WNFA 1K3TA 2O06A 3PKZA 3B7WA 2WYIA 4OIFA 1COZA 5TRTA 5BVHB 1Z4LA 2VOJA 7GPBA 3K2EA 3AO0B 2VL7A 1TJPB 4ERNA 3TXYA 1RU3A 4BPBA 2M32A 1I14A 4JI8B 2NXNA 2RHWA 4PC3A 4F4UA 2B1GA 1CZLA 1XU9A 1J07A 3C0KA 4QD3A 8ABPA 3U4CA 3W77A 1XTZA 1J33A 1YA8A 1A69A 4XYGA 3D8RA 3JR7A 1N6HA 2CNKA 4QX6A 4CM8A 5IBCA 1K4YA 3JY6A 4M22A 5AI9A 4WJLA 2V9PA 3FSEA 3ZE6A 1DC3A 4LW8A 2R6CA 1YFZA 2HW8A 2ZUEA 1PV2A 3B9BA 2H7VA 3HA7A 1BKDR 5JZSA 3MCZA 3FXAA 1BEEA 3N7AA 3OOYA 4G23A 4URYR 4CM8B 4CV1A 4ZYWA 4DBVO 5JD4A 4BATA 4N5NA 4WACA 4N5LA 1B2RA 2BSQA 1CVRA 4ZI7F 1P2SA 2C31A 3KAQA 3T3OA 3U7FB 1BDHA 3FNGA 3H18A 1EZ4A 1RRMA 2BLLA 5H59A 3I61A 3QLUA 1CEYA 4EYEA 2AN3A 4LXIA 1HTTA 5BYJA 3CF0A 2FK7A 4EJMA 4NJEB 3T5GA 1HOXA 3ZDQA 1RZ3A 4H7KA 4M0EA 3P20A 4HEA6 5FBWB 3DOFA 1QHSA 3JWPA 1CY2A 4ZTUB 5CLHA 2PL1A 4MA5A 3FTEA 3GT4A 5IVPA 4HRXA 3OJCA 3K71B 1HPLA 2F00A 5TJ9A 121PA 4CEHA 2PKXA 1DBIA 1BH2A 4G6ZA 4EYGA 1YRWA 2WABA 3AY0A 2OFPA 1SBNE 1SG6A 2OBBA 5A03A 3UC9A 4Z1MD 4JXKA 5I9SA 2CFOA 2VJLA 2VVTA 4G01B 3AWDA 4UKDA 3RV4A 3SU8A 5JBNA 4ESVA 5JS1A 4FOTA 5LOVB 4IVPA 4C78A 3GF4A 4RLSA 4KN9S 2DFNA 1CVIA 1RM0A 2B4QA 2I4MA 3TIFA 2FZKA 2Z1DA 3ZR4B 4UVIA 4AJNA 5F2EA 1GZ6A 4R51A 3I72A 2Q41A 4AZSA 4BMPB 5BNIA 1CY0A 4W9NA 2APJA 4DZTA 1RWVA 3THWA 4UM9D 2R65A 5EHZA 4KKVA 4L08A 3COYA 4YALA 5LNK1 4X65B 1QPZA 1QB8A 1A8IA 3TINA 3MYYA 5IHXA 2PD4A 4ECAA 3CJTA 3CZ4A 3S27A 1LTKA 4DCGA 3N28A 3SMVA 1N2IA 1Q0HA 2WYUA 4ALMA 2Q1SA 5BWOA 2PZBA 2QR2A 3RVMA 4YRTA 3G49A 3WC4A 4TKZA 2H2IA 2PK3A 2DG2A 2ZPAA 1QHHB 1E4EB 4ZARA 1GUZA 2B1IA 4FSHA 4Q9KA 1NVKA 4MYRA 1UPCA 2D3TA 4JQZA 3CVYA 2I6FA 5IANA 1AZWA 1AZTA 1UADA 3W2IA 1DWPA 4TMFA 4HYTA 2C8JA 2G1JA 3L1IA 4TM8A 3GBPA 3OQJA 2Z2YA 3PDIA 5K4AA 4MARA 4CF4A 5A0VA 3K2BA 1VHJA 2C04A 1RWBA 1QH1B 3GB9A 4ZODA 1A9ZA 5AXDA 1PVOA 2VKQA 4KMMA 4EBBA 4X5OA 2FGKA 5EUMA 2WTNA 1ZUWA 4K6MA 2BHNA 2QU8A 1EZZA 5EKTA 3V6MA 3RVBA 5HZHA 1OGIA 3PLNA 5J63A 3M6LA 5AI8A 3C6KA 4GL2A 1SG0A 2OLKA 5KS2A 2BL4A 4NU8X 5EZYF 1GOTA 5E6UB 4B17A 3OCVA 2ILVA 4XWKA 1EBFA 3CHYA 3KXKA 5KTTA 1N6OA 5LXTF 2E4UA 1FMJA 1SHUX 2NO6A 4NPHA 1PHRA 1ULZA 5IF9A 1OA0A 1I7LA 4ZTZB 1FE8A 3DFZA 3QX8A 2P3LA 4NG4A 2J31A 4AC9A 3WLAA 2PJZA 2P9FA 1T91A 3LOQA 4IH9A 1MEEA 3VHXB 5LCXA 3A9SA 1A72A 1PWEA 1U1EA 1GN9A 2V5AA 3D02A 3FAZA 4QFCA 3HNPA 1HC7A 1D04A 1J8MF 4N3AA 4Y98A 3PFGA 3I05A 4NDZA 4AWXA 4LF4B 1IU9A 4QPDA 1O9GA 3VHXA 1DXQA 3Q3EA 2O20A 2WINI 3CF2A 4IFIA 3RI3A 4KMRA 3CH4B 2J0VA 1UL1X 4L6AA 3SXUB 1YZ3A 3K6SB 2I2WA 4GR5A 4YPVA 2UYGA 4RJKA 5I8PA 3HBFA 4YRNA 4H35A 1QIMA 4F6CA 1Y1TA 1ZIXA 2I65A 1HRKA 1R16A 2R8ZA 3I1IA 4L85A 5CTAA 1NOJA 3SXUA 5CA1A 4UNPA 1P29A 2P9HA 3QU4A 1L5YA 1K92A 2YVKA 4UQLA 3WOVA 1FDVA 3ZBTA 1U2DC 5AOBA 1RLIA 4GZ3A 3GLHB 3AG5A 2GJ4A 4I50A 1T6BY 2WSIA 1YS1X 4QG3A 3P96A 1E5VA 2OR3A 1X0VA 3K15A 5DYGA 4KEAA 3EDOA 2VJCA 4TVBA 1A8QA 2OPHA 1JDTA 1OWOA 3OFSA 4YGXB 1H1TA 1W93A 4AZVA 1LJUA 4GW3A 1C9JA 1SQ6A 5CVVA 2YZ7A 3OZDA 3ND8A 4JB2A 3UANA 1EJ2A 1RCUA 3NPMA 4RK6A 5E6RB 1NRWA 3BL5A 4IQFA 4E2ZA 1T3LA 3GP8A 4HYEA 4LJSA 4DLRA 1DIGA 1MB0A 1JIJA 1ZD1A 4JSTA 3H9UA 5ESRA 3U0VA 1YI1A 4HP8A 2WYVA 1U3DA 2MMGA 1UKZA 2X40A 4ZAYA 2H5JA 2PU5A 4DSAA 1O2DA 3KYCB 3WGOA 1Z73A 3THXB 4C6RA 1E0KA 5FYDA 3TLJA 3H2GA 3PD0A 3IELA 1SKUA 1MD9A 4JOSA 4QTTB 3ZE7A 3FOCA 3ZWYA 3M6FA 3W5CA 3DMNA 1OXKB 4PF1A 4RV9A 3VGPA 2OAEA 2GWRA 2HLDA 3TZCA 4DADA 4MW5A 4PEVA 5KNLA 1NIPA 1QHXA 3H1EA 3B3GA 4IHAA 2ZE8A 5IARA 2QRUA 4EFMA 5MFZA 1VGRA 2HMTA 5K8UA 3L6EA 4ARIA 3CVUA 1KRWA 5D1HA 3OIYA 1AH2A 1CRLA 3CLVA 2C5SA 4LPKA 4ZVSA 3I9KA 2Q3BA 1Y6FA 2XEXA 1UPFA 4LY3A 2B8TA 2SBTA 3H3FA 1UK8A 3HUTA 5DYNA 1V48A 2LPMA 1EEXB 5FLKA 2QOEA 1RYHA 3AY3A 4RA6A 3GPCA 1GCGA 3GIWA 3PC4A 4HNSA 1DU4A 3VYSB 1M34B 4RH1A 1I7SB 1UOPA 4RKRA 5FUQA 3S29A 5M2QA 1F7UA 1Z5PA 1USVA 3FJOA 3JD2A 3LJKA 3MJDA 4QU0A 1Q6ZA 1NSTA 1LBTA 4FMCF 3W5JA 3EQ7A 3O84A 4NNOA 1KTVA 1JPJA 4RA6B 4UEWA 2PGJA 3OIDA 4MEBA 5JY1A 3WLPA 2YJ4A 1ZA2A 5FEMA 5ALVA 1K7EB 2LWIA 2ZFUA 3L93A 1F2TA 2Q0HA 2R1UA 5CT6A 3X1DA 4TMZA 1NLFA 4YUVA 3N70A 4XVQA 4P7JA 4TV9B 4TQAA 3M33A 2FEXA 2Q07A 2PX8A 2W11A 3O8BA 4B4UA 2VNAA 1AXGA 1BU8A 4Q6WA 4R2JA 4DMCA 2FKNA 3W8DA 4E7PA 2NO0A 4CLRA 2D1TA 2GAJA 5HE8A 3OE7A 2JCYA 3E9QA 1UIMA 4HTFA 3QYJA 4RY2A 3CPHA 1GARA 1SQGA 4XR9A 4K0KB 1O94D 3CRQA 1CEEA 3QOYA 4XB2A 4RZHA 4X8OA 4IMRA 5SZIA 4J49A 3JWJA 4NYMR 1LNQA 1JYEA 2ACKA 2FW8A 2JBAB 3C45A 1U1CA 2Q1UA 3DVAA 4ABYA 2F3SA 4BNXA 4HTFB 4LVUA 5DHRA 2FNAA 5A7FA 3PC3A 1J2JA 2WIFA 1MOQA 2CHUA 4LVOA 2VZ0A 1Z13A 1JEAA 3QW2A 2D0PB 3QMVA 5LP6F 5BN4B 5A71A 3RUCA 3NHJA 3HM2A 5TF4A 1RXUA 1L5SA 1QTRA 1Y1QA 2GSDA 1MG0A 3EXIB 3OLWA 3MUOA 5EE5B 4ZHQA 3WNVA 3BL6A 1A8HA 1Q74A 3G6WA 5TQVA 5KKAA 1A7KA 2UYYA 1ZESA 2CVOA 3F9CA 3FZEA 3R3HA 4N39A 4AECA 1XMJA 4EW1A 4QUEA 1GAJA 1B15A 1GG8A 3AJ8A 5BY2A 3FB4A 4M9XA 2ZUDA 3BMOB 1IN7A 1JU3A 3OE4A 4QEKA 2HO4A 3LUFA 5D84A 4WTOA 4DKXA 5D86A 3M9WA 2MU1A 3GCXA 2J08A 4M49A 4K9QA 2Z4RA 3BXHA 4YCSA 1EUZA 1I1OA 1JUDA 3TLZA 4EY4A 1TL7C 5CHYA 2UV8A 4AJOA 1NXWA 4LXUA 1FMFA 1E1KA 2ES4A 2FEWB 4Y6RA 3UWDA 1SH7A 4ZCMA 3F4LA 5DX1A 5AR1A 1UXJA 1U04A 2C83A 4D4LA 2PSEA 3GJ3A 3AVYA 2CK3D 2XY4A 1ST2A 5BXQC 2AW5A 4PYMA 3UT0A 4QFMA 2HB6A 2A9KA 2NXJA 2GCEA 1TCCA 4O4IB 2GEJA 3VC2A 3VAYA 4ZYUA 1N5OX 1N8KA 3O4IA 4P5PA 3RUFA 2WIAA 2VFAA 3DXZA 1YULA 3ZV3A 1B8NA 4N6OA 4BO8A 2VNKA 2OQRA 3HEMA 4UD6A 3UO8B 4Q4AA 2RONA 1H1LB 1PFVA 1RP7A 2BKUA 2DFKB 2IGBA 3IILA 5E4JA 1TAGA 4YMUA 4OB8A 1WBJB 4B3BA 1MGPA 4B4OA 5CJJA 4WXMA 1UINA 3GOHA 3WQSB 1A4RA 2QDKA 1NDUA 4KTVE 1DC4A 1OYOA 3OLZA 3NAZA 4Q4AB 1PEAA 5DSXA 4A27A 5TB5A 4BTLA 5BV2P 1JR3E 4YCBA 1NU6A 1VKOA 5HK8A 5GTDA 2YY5A 3C48A 2PUHA 3QOWA 3SIWA 4URVR 1ISSA 4YAEA 1LWOA 3BL8A 2FEKA 3LLUA 4IVNA 3TLYA 1EVYA 3CV3A 3FCAA 2PRZA 1TB4A 4C6SA 4YMWA 3UYLA 4FB5A 2HRQA 1KQGA 3L40A 3NHBA 3DAPA 2I4RA 2BHLA 2A9OA 4PSAA 2J5QA 1IBMB 1K0FA 3C3BA 4GDMA 4DNPA 1VKRA 1Q7CA 2GBFA 3K1AA 4IJ5A 3LECA 1QV7A 3TW6A 3W9YA 5IJ9B 3FUTA 4RFLA 3UMRA 5L4SA 2O3TA 4MVJI 5IBPA 1ZFNA 2HCBA 5CT5A 2MDTA 3VR5A 3PNYA 2IXDA 1U1GA 1VIDA 1PS9A 3NTUA 1K88A 4LGYA 3NI2A 2EJBA 1NJ2A 3SR0A 2CLEB 4PAGA 4Q19A 2XD9A 3WSVA 1ZK4A 1DTSA 1XV5A 4ARBA 1P7ZA 5G1OA 3IJPA 1HK7A 3H5IA 1SZPA 2BF4A 2P9JA 1P9WA 3LXUX 4MO2A 3BXGA 5IW8A 1QV9A 5EJ6A 3ECCA 1NDHA 5E3HA 3H2JA 2ST1A 4WN9B 2JKVA 3GD5A 1XE3A 2GHRA 1JKJB 4JOQA 3RKUA 2O5RA 4QBGB 2A0YA 2J33A 2CL6X 3DT6A 1E2QA 1JDSA 1XYVA 4TXHA 4J4BA 4AWAA 3T41A 4UD2A 3AL0C 5E7JA 1G16A 1QC5A 3MMSA 2X0RA 2EJTA 1Y5MA 3E6AA 3SYTA 2YWJA 4ER0A 1TU0A 3BGVA 1T29A 3PQ5A 2X5KO 2WVHA 3RK1A 4A7PA 1Z0IA 1GA4A 1K75A 4XIJA 3ZCSA 5HKOA 4MHTA 2QQEA 4RL4A 4HFJA 3I3SR 3QJ5A 4RLFA 3K6KA 3RIMA 1RXSA 1S7GA 4WADA 2EERA 3PXDA 1J25A 1O9BA 5K3OA 2A9PA 2DECA 2YFKA 3EGEA 5J2UB 1C0LA 5CFMA 1XSEA 1PX2A 4Y2RA 5DTEA 3O8CA 1RJDA 4GKVA 1ZL2A 4A26A 5EI5A 2QLTA 4Q4JA 1C3XA 3H1BA 3WK9A 3TKLA 4W1SA 3I2KA 3HVUA 3R5KA 4BLOA 3RYCA 5CEFA 5TQ2B 3IUYA 4XGRA 5G41A 1MVOA 5JPIA 2AEMA 4ZAXA 1U98A 3QLJA 1EK6A 2VH5R 1OYWA 4YAWA 5K0LA 3I4FA 4M8KA 1U5BB 5FV4A 2W4MA 3KHKA 1LSSA 2EVWX 2V7BA 4AF7A 2XDQA 2YZMA 1UKEA 4Y1RA 5FL7A 2WKRA 4ZCLA 1VI2A 1RYZA 4UE6A 4JVNA 2G71A 2X5OA 2R96A 2V7XA 2DZDA 1U5BA 4JU8A 3JWGA 4JEIA 4B40A 4IP0A 3L0SA 1R4NA 3KSRA 1HMPA 4IIJF 4P4GA 1RRGA 1KK2A 1FUYB 2OCKA 2XCQA 2V55B 4ZJPA 4AURA 4BLWA 2PR2A 2GPSA 1TU4A 2WR8A 5BMOA 3NVAA 1RR6A 1D03A 1KH1A 3L1UA 2VQEB 1FFBA 3O38A 4PX3A 1YUMA 4JKIA 1BS9A 4OAQA 4U4AA 5FOVA 3T7RA 1BYUA 3WYDA 3KQUA 1Q0TA 1DJMA 2PS9A 2QNRA 2ZYDA 3KCQA 5GJWC 2FR8C 1GTMA 4BBAA 3ORQA 4RPKA 4K5QA 3RT1A 1QE5A 4DPKA 4GPTA 5HF5A 2OORA 5D6NA 1YJQA 1GA6A 2HWXA 4L7QA 2C0CA 4OI1A 4LQDA 1RYNA 3IRUA 1DG3A 4ZQEA 2HNBA 4GP9A 1G4HA 1CQWA 3EW9A 3I9V6 4H6PA 1WHTB 2F3QA 4JJGA 5B7NA 4JP1A 5JXWA 2IHZA 3SYKA 4JT8A 4H16A 3PWKA 1WCWA 3UPDA 2E4WA 4BVFA 2OHOA 2I3GA 3MRVA 1WHTA 1I6WA 3RHTA 1B1CA 1EHIA 4IINA 1RQGA 2NSYA 3ZZ0A 5I3ZA 1TM5E 1FFXB 1W4BA 3DWEX 3FSGA 1Z18A 1EB9A 3K8YA 4JSRA 1WSBA 2XD4A 1Z2OX 4GUAA 5BPFA 3HN7A 4GX2A 3GMSA 4PSDA 2FZEA 4R69A 4R1LA 4F3TA 1FTSA 4L27A 3GWGA 4KZKA 1K3UB 4B3RB 3FN4A 4KITB 2AJCA 3LRPA 2J3MA 2C00A 3C3CA 1JQBA 1LFDB 2FTKE 4AT1A 4GWGA 4MGYR 3ENWA 2FPIA 4Z9BA 2WG2A 4HZGA 3V33A 4A8TA 5CFZA 5J2UF 3PEWA 2XTAA 1Y3IA 2G4CA 4MV3A 1E7QA 4OXKA 4X60A 3VU8A 3BQMB 1X7XB 1BMFD 3CZCA 3HG7A 4ZXPA 2KSQA 3QVOA 4LXQA 2FRDC 3BRQA 1K66A 4Y2UA 3C5WP 2FPIB 1K63A 2A5FA 2YN0A 1UBFA 3LAWA 1H8ED 4RQBA 5DXAA 3K0EA 5JALA 3E5NA 1P60A 2IXGA 2DPLA 4W5WA 2QHXA 4RCVA 3BIOA 3OZGA 2B4KA 1UF9A 3VPDA 1TRKA 4YAGA 3S2GA 3E82A 1TTPB 1CXZA 3L8CA 3LFHA 2IV3A 2WAAA 1PUIA 4Y6QA 2MSWA 2O8BA 5KREA 1MG5A 2VHXA 4R8RA 3WL4A 4E13A 1FVXA 3W8EA 1IWPB 3HUUA 4WDQA 1LX6A 4FFOA 3I28A 4XA8A 1QQAA 3V8QA 3HFRA 4ZD6A 5LLSA 5DWDA 4HDAA 5FO0A 3OIVA 5EWMB 4CCYA 3MOGA 1XLTC 5JNWA 2MTBA 4JL5A 3HA3A 4MULA 5ES4B 4FYWA 2OCLA 1FX0A 2C0QA 4D9JA 3ZLVA 3LXXA 3GWZA 1QRSA 4HJRA 1WXQA 3UWOA 4B4DA 2WWHA 3LE8A 3THRA 1QAMA 1JHZA 4NBTA 2QV0A 1JDBB 4R5MA 4IF4A 3ZV7A 2EFJA 2VSQA 3USES 4EFKA 3PQ3A 6ABPA 3L7JA 4JLPA 4L15A 4WUTA 3SHVA 3I2HA 2HYDA 5DBEX 3T7KA 1C7QA 1NX9A 1M2GA 1M1YB 2ATIA 1AV6A 2XF8A 3K0HA 4EHAA 5JNRA 1NULA 4E6EA 2OKCA 4UVDA 5AJHA 5EP2A 1TLFA 4BB6A 1QGED 1BVYF 2NQTA 2HRDA 1G8KA 3VA7A 4Q7QA 4JJ4A 3WKDA 2HK8A 2FSIA 5ILGA 1Q91A 1ZR2A 4OKSA 3QUSA 3EDYA 2F62A 3LUDA 4HYQA 4JU9A 4N49A 3UJ8A 1JPVA 2OFFA 1QG6A 1OZAA 3T1QA 2C58A 1AXEA 4Q9NA 1OFUA 2O5VA 1MR3F 2ZW9A 4M6WA 3IBFA 3VO2A 1MOSA 5AVRA 1IHXA 3ZWNA 5KBYA 5B57C 5CK5A 1BZYA 1NYLA 4BZZA 4HR7A 5BT8A 3RCBA 5EEHA 1I4TD 4LZPA 5KSZA 3WLFA 1JPNA 3QLEA 3CBQA 5FFNA 1BCSB 1TM2A 3AJRA 2OC4A 2PPVA 2CY0A 2NM0A 2RHTA 2IYZA 3WL7A 1TT5A 4C7VA 2GEBA 2VTBA 1V3TA 4RGVA 3ZJ4A 1S8FA 3VPAA 3O8RA 4L0QA 1FTWA 3BM5A 3P0JA 4I2NA 1BG6A 4AKEA 2WUVA 2V8OA 1KWGA 1NAHA 3G2MA 1XZHA 2DFVA 1NTRA 4KYVA 4DQDA 1HLGA 3N8HA 3OF3A 2NUAA 3IOBA 2X77A 3DR3A 3RTCA 1C4KA 6Q21A 4KQ1A 3E7WA 4P33A 1OE0A 2Q0QA 5ECYA 1IULA 1VCNA 5ALJA 1CJBA 2H4WA 1LZLA 1JWAB 2H17A 4P38A 2VDUE 3OQHA 3HKDA 4J0GA 1SHJA 1UBMS 4L5IA 1K86A 3RROA 4DNQA 5A4JA 2CXTA 1KP9A 2JFFA 2V4ZA 1MOPA 4QVGA 3RIEA 2V6IA 1S2NA 3FZYA 3SICE 2Q2OA 1SUSA 2AKAB 5HR5A 3S44A 1QYVA 3SBXA 3LH5A 4KJXA 1XRRA 2ZJ6A 3MRSA 2OCGA 1U9ZA 3KT0A 3GLFB 1QJ4A 1ZUD1 4QT0A 2PUBA 2V9CA 3MOSA 4J16A 2FPGB 2BGJA 4Y0AA 4UEJA 5TPZA 3SYNA 2O0MA 5LP6B 3CNLA 2ZWPA 2X6QA 2M6KA 2P41A 2P79A 2Q3MA 2XMCA 4BO3A 2CLLB 3AY6A 4UCFA 1ORRA 4REOA 4DG8A 1MT0A 3HA5A 4Q39A 1Y1LA 4NH4A 3Q8LA 3L8ZA 3E18A 3VKVA 3DL2A 3X44A 4U7FA 1S2GA 5HG0A 2G77B 2JEYA 4URXR 3SQXA 2IWHA 3BFPA 4K46A 1FYFA 1ITZA 2QE7A 4BRUA 3FOBA 5E1MA 4D3ZA 1OPRA 2QTLA 2VPQA 3TZHA 2C3YA 2GF0A 1A1SA 3BEOA 3IB3A 1SXQA 4U9IS 1FUEA 1XCJA 1Z2NX 3DHEA 3OCWA 1JPUA 3VV3A 3FLEA 3IXLA 4N7BA 4Y1FA 1ZP6A 5CDGA 4UREA 1XTSA 4MRMA 4UBNA 5EMMA 1AIPA 2VWGA 3ENNA 3SC4A 4RIFA 5HIIA 3D2LA 4Z6KA 1H6AA 1LKZA 1OI4A 1YQXA 1BHJA 1W0JD 3M5CA 4HNVA 4MRNA 4CMJA 2G5CA 4TV9F 1C8BA 5L51A 4EKIA 4QXAA 3OH8A 4KLRA 5DP2A 2JHCA 2VP3A 2VJYA 1COWA 3B7GA 1L7DA 4OHPA 2O3RA 3CKMA 5A1JA 1G3RA 3ACDA 3ZVLA 3Q7RA 3WQRA 3MJSA 3K4QA 2NTYC 2AOTB 1N33B 2P2NA 3VSAA 4NE9A 4YV0A 2FA9A 2QTWB 4C43A 3BZUA 3M4YA 1PFWA 2N42A 2ODWA 1QUFA 2C42A 3R3VA 4GQAA 3A26A 1SD5A 1W88A 3CWZA 3ICOA 5ENDA 1GTRA 3RYIA 3T99A 1NF8A 5JSUA 1Z68A 1SNYA 4QO8A 1AX9A 1Z6QA 1RPAA 4OHBA 3W2EA 3A27A 3WGKA 2DWQA 2JDIA 1L5HB 1RMYA 3LBHA 1I4WA 2FQQA 3NEPX 1AS3A 1OXUA 2ZI4A 4CKEA 1IQ0A 1LQ2A 5K0JA 2ASVA 2YNMA 4D9CA 2OLJA 1UCFA 1R6VA 2VDMB 4WUVA 1TYDE 3V8VA 1M1NB 4CYMA 4P81A 4DCTA 4IJVA 1Y5NA 2M1XA 3H5RA 4B2PA 1Y9JA 3LP6A 4WBSA 4DR4B 1ZW6A 2EV9A 4N7MA 4CKEB 3GMTA 1H2BA 4YUWA 3IP1A 1UM8A 2Q27A 5FBHA 3MTQA 4HGNA 1T6NA 2OFWA 3WL8A 3CNNA 4PINA 2WZQA 3TOZA 2A0XA 2ZS9A 3T7JA 2YFHA 3H1TA 3OCJA 1NIJA 1RI4A 5B37A 2XIJA 4TRRA 1I3NA 2LIVA 3MTJA 3C16C 2FPWA 3DLHA 2HF2A 2ZCJA 3EA5A 3ZVRA 4PZCA 4YPOA 1NXTA 4BY9E 3DSRA 1P7VA 3I0ZA 3R20A 4TWAA 2AB0A 3HVJA 3A3KA 3GRYA 1VKZA 5THXA 4YRIA 2KWIA 2OFXA 3GGDA 4OHOA 5ADUS 1BKYA 4TKLA 2O1SA 1PFYA 2RAUA 2R4QA 3BJEA 2WG0A 2ASEA 1KK1A 1S02A 3RS0A 3UF0A 2W6QA 1JSXA 1EAYA 2CMGA 4WGFA 3AVWA 2HIMA 2Y67A 1IBSA 3JQBC 2ZYVX 1X7YA 4IUCS 3WMWA 1RMTA 2OWEA 3AESA 1EI9A 5CM2Z 2ZJYA 1OLUA 3O0DA 1QO9A 1T8SA 3WSTA 5KYYA 4MV6A 4NF2A 1DEAA 1ZZEA 3OQPA 4S05A 3HDGA 1E7MA 4C3OB 2ZRFA 4OQ4A 4XEHA 2VAVA 3A6ZA 3VZDA 5IK2D 4NHOA 1UJ5A 2RHGB 3LWNA 2ONZA 2CW5A 4CMIB 1VHQA 4LXYA 3WRYA 4O2BA 1KDTA 1O7JA 3QIVA 4MTCA 4KVFA 4PS0A 1SVWA 5L3QA 2IXBA 2BFDB 2HQSA 3MUEA 5AKJA 3W7VA 1WNTA 3CB4A 5TT0A 5I9LA 1X74A 3KTFA 1TVCA 1SM4A 3AVXA 1V8BA 1VYHA 4Q3LA 2GN8A 3RSHA 2IPXA 1U2SA 1UKAA 5A5DA 1IHYA 4YJFB 4F4IA 1QO0D 3BMXA 3I4CA 4EO4A 1O96B 1DT5A 4DY6A 2OBFA 3FPCA 4EG1A 3O8QB 5FDFA 3H42B 2FUCA 4K26A 4AMZA 5DN6D 5LDDC 1X1DA 2F4VB 1O94C 1E3EA 3THXA 2BZ0A 1N2JA 1C8KA 2QTAA 3PC8C 4Z4QA 1E3JA 2GTPA 3HADA 4S1NA 1YSCA 2ID8A 2RCYA 4U1RA 1TX4B 1BGWA 4NNPA 1RRPA 3O8QA 3CX4A 1GHTA 2R5WA 3ORRA 3VBCA 3DDNA 3ZQ4A 5JC8A 3C6MA 1E8DA 1NJSA 4MH0R 3ZE2B 5ABPA 3CA8A 2H5EA 1OH6A 2FKAA 2PE5A 5LXTA 4K81B 1I10A 5TEWA 4KXUA 4BJ5A 1U2DA 4X1OA 4UOEA 3LW7A 1E18A 1MRSA 3RTBA 4J0HA 4C7KA 2XVZA 2IZ0A 3IJEB 3EGWA 3PHCA 5FR1A 1L9KA 2BSAA 2GN0A 2I7DA 5AVOA 4MYCA 4URUR 5LA6A 2QYOA 3HR4A 4BUJA 3WKBA 2R60A 2FAXA 4EL0A 9LDTA 1N3LA 1T8YA 3W6NA 3QU2A 4MGEA 3O2NA 4OH7A 5G3ZA 4J3NA 3U80A 3UHOA 3U9TA 4DMMA 2ZRQA 5EIAA 3BRWD 1LUAA 1O6BA 1POXA 5FPHA 3W5BA 1QRRA 3KPWA 4TXLA 2JPDA 4JBIA 3FCXA 4Z86A 1L7VC 2EU8A 5KNBD 3BH6A 2JFOA 4K6CA 2F90A 2PX6A 2X0JA 2HJRA 1E3DA 2O4CA 1UPXA 2XUAA 2QSUA 1P4JA 3LFTA 2XCTB 3DO5A 5DNUA 2RAVA 4XE5A 3BWDD 3R3SA 4JITA 3N0XA 1R64A 2Q5EA 3ZDYB 4O4JA 3ONFA 4C01A 2PEYA 5BO5A 3FKSD 1PL0A 3WZMA 5B7QA 1QP0A 5LMCA 3CWCA 4J75A 3TUZC 1KVTA 2WSSD 4PYNA 4UUMA 4BV2A 3MW8A 4Y8VA 1WL8A 2IS2A 4IWYA 3DQPA 2C5FA 4HLUA 4NBVA 2OECA 3TQTA 2Q7XA 3MA0A 4Z4HA 1VCMA 4DWJA 1SCIA 1LLFA 1BS2A 3E8SA 3JCZA 2GAIA 2XNCA 1XA0A 1ZHOA 3WY9A 1IN8A 1DVRA 1SKBA 2IY9A 4LYAA 5IJXA 4W6QA 4A0SA 4EGAA 4ESEA 3GFSA 5E9AA 1YFJA 4D56A 2H57A 1GKYA 3QE3A 4WH0A 2IOQA 2IPAB 2ZQ5A 4RO0A 4IDAA 3D0OA 3IDQA 5JCJD 4GE0A 1Z5VA 2AX4A 3CMMA 3NC0C 2XVMA 3CISA 3R23A 3R8FA 4AY6A 4UJ3A 3GDWA 4RYLA 4RK0A 2IEGA 4E2XA 3FZGA 1OWNA 3LGSA 2TECE 3KHSA 5CFQA 3ZKWB 2FZ5A 3QFHA 5C8ZA 2Q2VA 4EDFA 1RQXA 4CM7A 1ZOIA 1IOVA 3UBTA 1ABBA 1PVDA 4HFMA 3WGQA 1ZJ6A 3TZQA 5YASA 2QVZX 1YC2A 1E1MA 4V24A 4K3VA 4CIXA 3PQ7A 2OA0A 3X1MA 1VSQA 1JFFA 3UK1A 1WY7A 4TWBA 2ZJAA 4B81A 5CXSA 1OTHA 3M1AA 1ESNA 1SA0B 2Y0DA 3F8WA 3VGJA 3TTVA 1KPGA 1ZOOA 2VPWA 1JHOA 3PQ6A 1XNQB 1DEOA 1JQKA 1SD2A 3DQQA 2EC5A 3CSUA 2AJDA 3QWFA 1JFFB 1JE0A 1VKJA 1X13A 2BFMA 2O52A 3H8JA 4S35A 1V8PA 5JHHB 3UA3A 2A9RA 1PJQA 2WLSA 4ZANA 2G1KA 4KVGA 5ERYA 4QULA 4C04A 3EVEA 4X44A 5JSHA 4MDYA 5J43A 5J2TA 5CA0B 2P9TA 1P5RA 3I52A 1VB3A 4PBRA 1T1GA 3C2QA 3ICCA 3P9CA 4C1BA 2DTEA 3GJRA 1X42A 5A3JA 1BAPA 5DNDA 1MEOA 2WICA 4HD8A 4PW0A 3PD1A 4MWTA 4XCXA 5AMXA 1LA2A 2V45A 1FFDA 4RKQA 4GPD1 1KS9A 4Q4HA 3M6WA 4A5SA 3IDFA 3Q8WA 3TZLA 2QD4A 2MR5A 3VBEA 1WABA 4M99A 4ZGWA 5JPDA 1E3TA 3LQKA 3FBWA 3NIFB 4RMNA 4MINA 3TDNA 3S1SA 3JZDA 3TRDA 1NXXA 1P4AA 3DA8A 3H8VA 4NY1A 3G1WA 3DOJA 3Q8XB 4UAGA 4DJFC 5JTUA 4RY9A 1NONA 1Q7EA 5GY7A 3IVCA 5HQJA 4DTCA 4TV9A 2IUEA 3TIVA 4X1KB 3KL2A 1WEKA 3WXBA 2IYUA 5DBGA 2CE2X 1GFWA 4E3WA 5AK3A 2OBNA 4CLRB 1J1UA 5T5QA 1Z2EA 4FK8A 2QW0X 4B4KA 1Z5WA 2OXRA 4RHYA 1HETA 2XQVA 2F1OA 3KTDA 4OAOA 1XNHA 1XMIA 2YWEA 3AHJA 3F6YA 4IEIA 2FDRA 1E64A 3VVLA 4ENRA 3I09A 1E0SA 3SYRA 4CGZA 3GRRA 1V11B 1HDGO 4IEFB 4OFBA 4Y6OA 2BDTA 1Z16A 2GRUA 1J1ZA 2YY7A 4QLAA 5TS2A 1Q1QA 2V54A 1ECBA 1MAHA 1QMGA 2AQHA 3PA8A 4M53A 4CW7A 2JBAA 3DE4X 3DVAB 4WLVA 2WTMA 2EP8A 2OO7A 4LQLA 3T3GA 1P7CA 4COOA 4DIEA 1YMUA 1MAWA 2G6TA 4EGCB 4V39A 3URKA 4ODIA 1NJ6A 1ONSA 4DQ0A 4C06A 3A8TA 4G0XA 5H4GA 2I4LA 1ULTA 4BC1A 4RDCA 3A2LA 2QN3A 3HA2A 3V46A 3STHA 3PCTA 4UNRA 1KU0A 4I6GA 4JL6A 4PN7A 1CZRA 3PK0A 1SVMA 1M6YA 5I4KA 3WGZA 4D6PA 1KJQA 3OZTA 5DHAA 4LSMA 4YP9A 3RF7A 1T6YA 5EIXA 4HWGA 4R3WA 2WBLC 3VSEA 1ZVJA 2R87A 4BKPA 3DCYA 2D7DA 1FX1A 2IC5A 2P9CA 3R5TA 2CLFB 1AC5A 2FSHA 4OA8A 4I9NA 2Q46A 1OREA 4LSZA 4F60A 3C1AA 3ZZTA 1IRIA 1GGJA 1N5IA 1U5AA 4M7PA 4NCXA 3C85A 1Z08A 2WWVD 1COWD 1RZRD 1MC5A 4OJQA 4S1VA 1MV5A 3X3HA 4YAKA 3M4JA 3ZW8A 1WZIA 5JFGA 3UJPA 3DC7A 5L8VA 1UPTA 4PZPA 2R85A 1D2RA 2DPHA 3D3WA 3O8OA 4EJSA 2IZZA 3RC9A 4MI1A 4KDRA 4QARA 5BR7A 2E4XA 4D42A 3D2CA 1ZMRA 4HCJA 5F2NA 3UKJA 2W58A 1RHQA 4ZRMA 1M54A 3ZV5A 4X8MA 4CTMA 2JLSA 1E2PA 3IHWA 1D6MA 1V0JA 2D2FA 3O8OB 4KBGA 3NHZA 1Q19A 2RH4A 3WYGA 4EJSB 5HRCA 5LBTA 3E9ZA 4DDTA 1H85A 3WQQA 4HZUA 5B6IA 3QXXA 4ZREA 2WD7A 2QD2A 2ZJBA 4I9HA 3DTYA 3IUMA 3FZQA 3RU7A 2H1RA 4R5HA 1XPUA 1EWVA 4UBOA 1NJFA 5LDHA 2FXVA 4AJHA 5AKKA 1E9FA 4R71A 1YE8A 2EP5A 4PLGA 4B0PA 1PJZA 2WD7B 2BE9A 1GGFA 4K6KA 3DW3X 3NHFA 3NATA 3Q6IA 4ATNA 2Y1XA 3FLAA 3VZQA 5LPNA 2P40A 3RAGA 2V8BA 4FEYA 1Z8DA 1K6MA 3ZI7A 2XMBA 3KJZA 2VZEA 3NV7A 1VRVA 2WNSA 3E61A 3QRWA 3EVZA 5D6OA 4DHEA 1U0BB 2OV1A 4L5AA 2NU9B 3U7RA 1Q3KA 3TSZA 2MSDB 2G25A 2QZZA 4OM7A 4WESB 2H2DA 5ADWA 2PUFA 4ZVRA 1Q0QA 3UCXA 4DE5A 4CLDA 2R6R1 3KALA 3OO0A 3BD8A 1YZFA 4D97A 1J2UA 1YA6A 3K4PA 4QO7A 3JYPA 4J07A 3OQNA 4OHYA 2QZSA 3AZQA 1AV7A 4RM2A 2IPOA 4BS9A 4DGQA 3KXLA 3LSTA 4DLUA 3ITDA 4WY2A 3ZE9A 4BNGA 5C9ZA 1O4VA 3IMKA 5IH3A 1R15A 4IDGA 2XMQA 3AHHA 3VYRB 4RANA 4BV3A 2V0GA 1FDOA 4C4PA 3VZRA 1N1DA 4WNAA 1ZH8A 2GZ2A 3KDPA 4QZVA 4L8FA 4KHPB 1JQDA 1XMXA 1CIJA 4AO8A 4PX2A 4MV5A 3REQB 4A2WA 3X43A 4DPLA 4YMVA 1KQOA 2FVXA 3IV9A 2YJTD 2OV8A 3AEXA 3FNEA 1ZZGA 1VHLA 2HU7A 2QAJA 3UK0A 1T3ZA 5DYTA 4Q9HA 3TB4A 3GH3A 4C05A 2B5WA 4LI3X 1ZMBA 2JATA 2COUA 2IY8A 2X1LA 3IMEA 4I4TB 1U8TA 4TWZA 3QXSA 3IERA 1NJ5A 3RV3A 1HRDA 3OUZA 1PJ2A 2A5JA 2IT1A 1Z63A 2BY4A 1EDBA 3EXFA 1KJ8A 5B4UA 1M6WA 4M21A 3AV0B 4FT2A 1XKQA 2JLWA 4EMBA 1SB8A 3PFFA 3ZHZA 1KYXA 4C0QC 1QC5B 2QQ5A 5EESA 3BSSA 1M6NA 2X42A 4MS4A 4MW0A 4E30A 1KQPA 1U28A 1A7JA 1TKRA 1PUJA 3MXTA 3RK4A 2HPVA 3ZHQA 4YRKA 3UMGA 4CETA 4OGWA 1XT6A 5HRUA 3MTEA 4XCQA 2NUTB 2OHIA 3L1KA 4OMDA 4AUMA 4V0QA 3MS4A 1IK4A 1KIAA 4QBTA 3W3ZB 1ANKA 1PP4A 2BFPA 4AJLA 4G0WA 3TCKA 3R77A 1E5XA 4JUFA 4FGSA 3IE1A 2REBA 1C9NA 3EK2A 1D2MA 1YK1A 1DKLA 1MX9A 3LX5A 4PQGA 4Q4JB 3O3OB 3UGJA 3I5MA 1NMYA 2B2NA 3JQFA 5K3AA 1EGHA 5BRAA 2DBZA 3JASA 3CXUA 1E3QA 2J5XA 4TRMA 2HSDA 4PSKA 1NMQA 1OR8A 3ZDFA 4GMXA 4H7HA 4NDNE 3AM4A 4KB5A 1LV8A 3ZVNA 1ESZA 2K4MA 1L5RA 3QX3A 1E60A 3GK3A 1NDQA 5UKDA 3RBVA 1UUFA 3NU1A 3R44A 2P5TB 3GDGA 4D41A 4UNIA 5G53C 2DSNA 3SDBA 2OESA 4P54A 4XI9A 4R1MA 1CY4A 2QEQA 3L7AA 3BDVA 4IKEA 4R31A 1E2BA 4ND5A 4MUKA 4R8KA 4CIWA 1Y34E 2RHJA 2PSDA 2QG6A 4Y6LA 3MJTA 3IQHX 5K2OA 2Y66A 1DUSA 3CRNA 1N5LA 4EK9A 1BDBA 5K8IA 5F2OA 1LV7A 5KC9A 4URZR 1TCVA 4UUBA 1IZ7A 4AKHA 3P0EA 3FVRA 3P2YA 1IXSB 3HYTA 3I2FA 3GJTA 3I2YX 4CM1A 1ZOPA 4HGQA 1V41E 1SKQA 3NFRA 1MCZA 3MLEA 2EGHA 4C0HA 1DDGA 4EI2A 1T2DA 5AICA 5L3ZA 4J1SA 1P4RA 5DT9A 1KJWA 4GGPA 4NS4A 2O8VA 3AYXB 5ARCA 1TQ4A 5K3FA 3SZLA 3W1VA 3RS5A 3ADBA 1GO2A 2GRJA 1P8AA 1RD4A 4W7HA 1CF9A 4KQHA 5IT9A 4ARCA 4BOYA 2H16A 1L3IA 4QGGA 3W79A 1V5WA 2GJAA 2PYZA 2YYAA 5K01A 2PTHA 4Q9DA 3JQAD 2PMDA 4X3OA 3RJ5A 3RSFA 3HO8A 3WWZA 2H08A 1P4HA 1DLIA 1HV8A 3TAUA 1SU8A 1ML3A 4NJEA 3R3UA 5H0IA 4BWFB 3TNJA 1RQRA 3GUHA 1OC4A 2PNJA 4D4KA 2Z04A 3H2SA 2JDID 2AQKA 4AJ2A 3IEMA 1TZ2A 2P6OA 4Y9TA 5F1KA 3VTAA 1TUGA 4LHSA 4W63A 4EYSA 4YCDA 4B43A 3ENQA 2Z9CA 3ID6C 1FW6A 5EVJA 4DBLC 3AVVA 3VJRA 4HFNA 2JGDB 4HDMA 5HCNA 5HWSA 4OYRA 3CTMA 3DYIA 1OLOA 2IYEA 3F0TA 3RS8A 4L50A 1JHDA 2FP3A 4YONB 3ZXIA 4QAJA 1SK9A 4ZVPA 2EEZA 2C5EA 2EL9A 3FUUA 3NGLA 3OOSA 3AF3A 1RQPA 4KQ9A 5DGXA 1EINA 4QUDA 4C21A 4NBLA 1U1FA 4CU5A 2HEIA 4IDHA 3HMKA 5JNSA 5FUWA 1UH5A 5CXUA 2BMFA 2NU7A 2Y4OA 2YMMA 3JVVA 4B8WA 1B6RA 1PD0A 2I1LA 3OU7A 1PAUA 1R8QA 1VL8A 2CDNA 4GO1A 1KO5A 1U3CA 4XB1A 1O0CA 1H4VB 1T3SA 4CM5A 4HV4A 6NULA 3JVUA 2AN5A 2O8BB 1F5SA 4ZVOA 1NVWQ 2NU7B 3A0UA 4D74A 3TD9A 4IHJF 2GESA 1MHTA 4QM7A 1KEZA 1WP9A 3TQCA 1G5TA 3NWOA 1NUTA 1LVGA 3HNOA 2PS3A 3B5EA 4IDCA 2IRWA 3MGKA 1CY1A 1ML4A 3EXAA 1NMXA 4KWTA 2GZHA 1A9OA 1TW2A 1KDZA 4MDEA 1N3BA 2J6CA 3KD2A 3OLVA 1LLUA 1EK5A 1P3JA 5DGDA 1DARA 1N2BA 4O8CA 2BM8A 3QYFA 3PDIB 4YAIA 3CNBA 2HUPA 1ODKA 3LA6A 2P77A 3II6X 5JD5A 1JWLA 3DH0A 3E05A 4BVEA 4QTUB 3BXOA 2CLMB 2MINB 5AKHA 2H1HA 3NQ41 1H8HA 2HWWA 2DF8A 2GNOA 1QAOA 2NWQA 3CLHA 1XA3A 4Z4CA 1JEDA 3ZEAA 3JV7A 4IYJA 4PONA 3EAFA 2WOJA 1BSVA 3K0CA 5E6UA 3W7BA 5KYTA 1M66A 2B8JA 2OZEA 1H5UA 4JLKA 1N5KA 5CHEA 3SHQA 1LPOA 3UHAA 4IJQA 1HA3A 3WWYA 1IQPA 2L2QA 2RBEA 1UBNA 2UXDB 4JS0A 3IQXA 4CF7A 5CG1A 2UDPA 3QEKA 1HE1C 1B76A 1O8BA 2AQIA 3OZIA 2FX5A 2VR1A 2XT0A 1NPDA 3JZMA 4DG9A 821PA 3R0JA 5KKNB 2XE7A 2DT5A 2WMOB 2WZCA 3ESCA 1B42A 3A6HA 3GI1A 2R6AA 3KUDA 4RTQA 1YTLA 3DYVA 4LMBA 2JJ1A 5DX8A 3QPDA 4PHFA 2C99A 4MIYA 5BUQA 3ANLA 1DAFA 1DKRA 4KN5A 1N0WA 3OLQA 3DOOA 3UMFA 4QUIA 4H7IA 4A1FA 3N75A 4GX0A 1WUKS 3NAGA 3TQRA 5KYNA 3UJNA 1BNCA 2ODAA 2OGUA 3PNMA 1VSTA 2EXXA 1P2BA 3IBGA 1K8XB 4KK4A 3U7QA 3G68A 4L5BA 4OHZA 2QRHA 2WV9A 2ZSAA 1PRYA 3F7MA 4UHEA 2JBWA 2FW1A 4L9AA 3UWMA 2F8SA 2AKYA 2VYQA 4WKNA 3DEJA 3HXLA 5C7IO 1YL5A 2VTBB 2HQBA 3QYAA 5K7SA 1RIFA 4QYWA 4EJFA 5BWNA 3VPGA 2JB9A 2P1RA 1RQLA 2CUNA 2QRVA 3FSJX 4IIDA 4DSOA 2VQFB 2DXIA 4QEDA 1C0IA 1SHTX 4P0PB 2MSLA 1FRVA 2DY1A 2IIBA 3BG5A 5JCOC 3A6KA 4YGYA 5CNKA 4V0ME 3NH6A 1P7WA 4YR7A 1VJDA 3HJRA 3TKAA 1JRLA 2WEKA 4A0RA 5EPOA 3COWA 4U00A 5DYIA 3DE5X 3U4QA 3HKDB 4TTQA 4ICIA 4TV8F 2FQ1A 1FJGB 4JZKA 3U2QA 3VISA 1TADA 3HFGA 4FCTA 4NOKA 2V3VA 2ODTX 4D1YA 4FP9A 2EQAA 1P17A 5FTKA 3HXQA 4PY2A 1Z3IX 3R5SA 3O7MA 4KPYA 4FYYA 1QXSA 2ANCA 3OEED 2XMRA 5EE0A 4IZIA 4YCMA 2FWAA 3NNDA 4WZBE 3A3OA 2W9XA 3ODGA 3DNFA 1P80A 1YQUA 3OESA 3GNTA 3QSYA 3SC2B 5LP6A 1X8XA 3GCWA 4L95C 2IF0A 4Q1VA 1QS0B 4JT9A 4JLNA 4IMIB 1PI3A 2PKCA 3FB1A 3GU3A 3GDHA 1J0CA 4C6TA 1NRJB 2VSFA 1U8YA 2GHTA 2XEDA 4HGRA 4YROA 3QA9A 1BQEA 2NXWA 4ZA2A 3UXEA 2YQ5A 2JHPA 4FTWA 1Z6AA 3GA5A 2NYUA 4FFNA 1UANA 1M8GA 4EAAA 4FR2A 1G0OA 5H3LA 2E4ZA 4C6TB 4F2GA 3VZPA 4EM6A 3QVTA 3TLGA 1YT5A 2YCLA 2BI8A 4MA0A 1UK7A 4FONA 5EE9A 2Q2WA 3P45A 4LOJA 5HK9A 2VBIA 3BGIA 4H1TA 4G4SO 1T1RA 2PLAA 3HCRA 5T4BA 1MXHA 4EUEA 4Q3OA 4UHKA 4Y9DA 5A9RA 1CS4C 4IDNA 1KAQA 1RWNA 4BKRA 4MRRA 1IQUA 2HLNA 3A25A 2W0MA 4LV5B 5ICCA 1Z4JA 2VPYA 1HNXB 4NCHA 2ACWA 2YWFA 1GFIA 1J7KA 2VUUA 3O1IC 4FKMA 4LYEA 1KYTA 3I3OA 4U3JB 1UWKA 5F1OA 3S5JA 2CXNA 3ZS9A 2VK4A 1ORHA 1ORDA 5CNJA 1DOZA 5DM1A 5EJ5A 3EPHA 3MN1A 3GLSA 4EG3A 1CUGA 2AOTA 4PFJA 3AFIA 4BVLA 1B23P 3WIVA 5TE9A 2PZFA 1ECJA 4PFQA 5J1TB 3VHRA 3WHIA 1Z6GA 1WULS 1XP5A 2YWGA 5HJ7A 4ZQBA 1YRAA 3HUDA 3KM0A 4WNYA 3RYIB 3ST7A 1HE3A 5KQMA 3LY9A 4HWKA 2IVZA 3KSBC 4CFZA 2HMAA 3SSNA 1IUNA 1X7WB 2JIOA 3GBVA 3G1UA 4EIWA 3NJRA 1VLMA 2ZDHA 2VF8A 2P4SA 3W9BA 3MHTA 3ZBQA 4AK9A 2ZT8A 4CUJA 3ZK9A 5AVZA 3IESA 3SVLA 1ARZA 4U2EA 1IM5A 4KLCA 2CKMA 1RDFA 3NP9A 4NP6A 4Z0TA 3E2IA 3SNKA 2FEAA 4JFRA 4CDGA 5H5JA 5L95A 1ZQ9A 2DP4E 2E5LB 1QQBA 3FI0A 3PUWA 5EXXA 4F56A 1MNQA 4LC1A 3QI2A 1KZHA 4D26A 1G7CA 2Y0CA 5FTMA 3ZUGA 5IM4A 1PGPA 1PT9A 1JW9B 3QKWA 4FS3A 4WNCA 1ATIA 4CR6A 3UPTA 4P4TA 3ACBA 2RGAA 4OFWA 2BW0A 4CR8A 3UM9A 1EFDN 4QXQA 1E2MA 4MV4A 4EW2A 2GWHA 3IEKA 5M5BA 4DLTA 4CKCB 2BC9A 5JJ5A 1D4FA 1W0KD 4BZQA 1XBTA 1O95C 2D3WA 2W6PA 3KPYA 4A23A 2H2GA 5A4FS 5TR9A 1R12A 1FS4A 1XIVA 3QH4A 4NMXB 4WNIA 4DUGD 2XZLA 1LVUA 2NZXA 3P9ZA 1EWKA 2FPSA 4EGJA 2OMKA 2DYKA 2PQ6A 1JG7A 1I7NA 1E94E 3PXAA 5KAMA 2OD2A 2GI4A 1FFEA 3ZDEA 4ZJZA 1R66A 1BE8A 1J8YF 5B1YA 1K8RA 4D4MA 1JKIA 1WIWA 2JFHA 3NB0A 3MD9A 5AVJA 1FP7A 1ZNXA 4CI9A 5KYYB 2OZVA 1DL5A 2VDKB 3JATA 3JW8A 3HYRA 5ALGA 4F7DA 5BSEA 1VQ1A 1M76A 5EJAA 1WQ4A 1FFAA 3CX7A 2Q29A 3CZ9A 4U7TB 1XCOA 1USUA 1EB8A 3I45A 4LWOA 4X24A 5GQSA 3W4KA 4AL4A 4UMDA 1QB7A 4CMIA 7REQA 5A9SA 3D7NA 3NEYA 3CJQA 3QOFA 4JI5B 2I78A 2JNWA 1VBFA 4QUJA 5ENVA 4OK6A 4HGPA 5IBRA 3UJ3X 3GDFA 2UUPA 3CM0A 4JMPA 3NG1A 5TY0A 2XYQA 3HV0A 4EF4A 3TOVA 3I01M 2ZRPA 2V9ZA 4F5DA 2D1SA 2ATEA 4WCVA 2PH7A 4DS3A 4F86A 4CL2A 1AKVA 1G3UA 2I54A 4TQ9A 2H1IA 2FPUA 4PZDA 1NXSA 4UARA 2NO5A 4BNFA 5GZ1A 2W2VA 5EERA 3CW9A 4F5EA 1JEEA 4HB2A 1UBRS 4GECA 3U9LA 2ZXFA 2Q5OA 1LQUA 1NRIA 4V0OA 4ES6A 1F06A 1Z38A 2ZP1A 4D57A 3QJYA 4MHSA 2FEOA 2FW6A 1F12A 4BWVA 1ZEJA 1TFRA 2FWJA 2O8NA 3LBYA 4XXHA 1ZOLA 2GB4A 1YE3A 3IT1A 4WVLA 2JGKA 2ZYSA 2DWPA 5KNDH 1H2EA 2PXAA 1BGVA 3DONA 4R98A 1OZ0A 3ICPA 4FYPA 2ZRNA 1G8YA 1OV4A 1KS2A 1TQ8A 1NC1A 2PMCA 4QFBA 1JV2B 3WL3A 4RVNA 3HQ4O 4IAOA 2A58A 4QWWA 2EW1A 5BV7A 2ZIVB 1HFEL 4PN3A 5DYWA 2H5IA 2QD3A 1JQAA 1U7ZA 3F6RA 5FF9A 2WTBA 5JH7B 1Z4MA 1XP8A 3D3QA 2IYWA 3S4YA 5IDWA 4JT4A 3U19A 3OHMA 3H7IA 3WNCA 1EUCB 2H3EA 3HSYA 4ETWA 1IEQA 1HOTA 5JS6A 2G9NA 1ULSA 3L0DA 3HYLA 2P3OA 3DVSX 4DDVA 4Z2AA 1V8DA 4JI4B 1DB3A 3VPCA 3EJWA 5JMWA 3D81A 1QIKA 2KLHA 1EUCA 1PZEA 3M0EA 2BEKA 3CB2A 3CNQS 5KJEA 2CHVA 4BAGA 2JRCA 3P52A 1CV2A 2D0IA 5LQMA 1BWQA 4MKXA 4HADA 1MJ5A 3TTXA 1ZBDA 2W6JA 1WM1A 3B3JA 4V0LA 3A1DA 1UJNA 2JH3A 4ZI3A 3ZWDA 1QO7A 5EMJA 3BKXA 1JDZA 3F4KA 2D2EA 1Z2CA 4C07A 4GLLA 4O4JB 3DOUA 5DTRA 5DWVA 4OXIA 5D85A 4C30A 3UJAA 1LX7A 4ZYZA 3L43A 1NC3A 3EVFA 1T3HA 4D99A 3KETA 1EJ6A 3E3LA 3F1KA 1TVKB 2WUFA 2Q7DA 4D3FA 4KNYA 2PU7A 1H4SA 1OVGA 2AFRA 4LRTB 4E5KA 5H1YA 5J2UA 1VMKA 2FUKA 3K72B 1XYGA 3WADA 4B44A 1GL3A 1QTNA 2PAFA 1TVKA 1M0SA 2AI1A 4TLDA 3OTOB 4AWBA 3CVVA 5BQXA 5G4LA 1QNLA 2QE6A 3DD1A 1BWPA 3ER8A 2CLKB 1Y4UA 2KYRA 2BEUB 4B0OA 4D81A 1DDIA 4LV6A 3UEOA 4ZAWA 2R62A 5D3QA 5DIZA 3AF0A 1QFYA 3AB3A 4Y1RB 1QP8A 2W8BA 1M1XB 3GJ0A 4HEHA 1DJQA 1Q15A 1Y1PA 4N54A 3NIBA 4KJZA 4YQFA 5K6AA 1ZSNA 4P0QB 1GVHA 2PWAA 3CEMA 1A8PA 3RS7A 2QLFA 3TDKA 2Z8XA 4K03A 3CY6A 3IURA 4M0KA 1AG9A 1L7XA 4KUEA 4XKJA 4H17A 1JKFA 2HXSA 3H9CA 2EDAA 4A8PA 3DXXA 5CD9A 2X2OA 3Q10A 5IT4A 2ZJ0A 3K5WA 3PHBE 4L76A 4RVUA 1PYOA 4GRDA 5ADVA 3W2HA 3OTHA 2FP4A 1KXZA 2GA9A 1O5TA 3ORYA 1XGKA 4JI7B 2VJQA 1N1GA 3QVKA 4R9VA 4TM7A 4WZAE 1FIUA 2H11A 1H3NA 1QVRA 2D13A 2HADA 3A3PA 1SA0A 3A36A 3BILA 3F6PA 3PRHA 4QDJA 2J9RA 3WJ1A 4AMVA 3HDHA 3N76A 2XKAA 1VSVA 1NE2A 1FDRA 2J48A 2AW3A 1XTTA 2HPHA 4H1VA 4MAFA 2GZAA 1DAPA 1D07A 2W71A 2WD8A 3E22A 2FOXA 1JXQA 3PG5A 1E0DA 3GAZA 4RKEA 4OPMA 3HN6A 4TMWA 5E3IA 1OSNA 1V39A 4RD1A 2Z3ZA 2J0UA 1ISMA 3HXKA 4Z99A 5LQRA 2H7XA 2IEIA 1XJQA 5J2TB 1T5TA 1LPMA 1MEJA 2E0IA 4NMMA 2OY0A 3CVWA 4M1ZA 1P9RA 3WK7A 3L04A 3ZZNA 3ETCA 4NEGA 2WIBA 2XUQA 4YAOA 5FX2A 4KFUA 4GZMA 2BGKA 1HF3A 2WWTA 3DHYA 3V4FA 3S68A 4F72A 3T06B 4F8JA 1XQVA 13PKA 4Q4HB 4L3VA 4B87A 1GZ7A 2G9ZA 2EKPA 3SF8A 1X1TA 2IQ5A 2YZ2A 4R7TA 4JROA 3V4SA 3SNHA 4NENA 2H4FA 3AINA 3RAPR 2I7CA 4X90A 1OXSC 4O8ZA 1YR2A 5CDUA 3NHAA 5B58C 1M5UA 2Y1EA 1E1QA 4AYTA 1C0PA 1RI5A 5FJJA 3OTIA 5IXSA 3AR3A 1ZK0A 1AB5A 2O57A 1PEDA 3OPVA 4R0MA 1TK3A 4K6GA 2JVIA 1U80A 5JUWA 3KVRA 1GKKA 2PNFA 3JALA 3K0KA 4FHEA 5E6SA 3ZGLA 5IZCA 5EY5B 1BN7A 1SUDA 4M9CA 1DHRA 4YXWD 1QDLB 3SQOA 2Z3VA 3ZTYA 1FZTA 1DWOA 3N87A 3WGMA 1U2EA 3GHHA 4HL6A 3G1TA 4UNNA 5FTWA 3FD8A 5EIWA 4BPRA 3JALB 3HFSA 3AXSA 1T5OA 2NPOA 3FOAA 1I6KA 3MPUA 4U2CA 5FCDA 3THYA 5ALKA 4QJ5A 5DIFA 1G7TA 5DN9A 1UFKA 4KE6A 3VPFA 5B7PA 5AW7A 2JLCA 4IH4A 3GXOA 5EVCA 3FHJA 2O48X 1T4MA 2DR0A 2QV7A 3N74A 4U39A 4UDXX 5IN5A 3REOA 1B1AA 3TBFA 3ZXSA 2FK8A 4FVTA 1YOBA 2VRWA 3T5PA 5LD2C 3V1MA 3L5OA 1YGPA 4Z49A 1Z47A 5ITZB 3GQVA 4A03A 3C6XA 3HWRA 1AQIA 2QSYA 4QOHA 1TEVA 5G4KA 3RRFA 3RRXA 3TI9A 5JCXA 4F4CA 3DE0X 1BIFA 3MT8A 4BNKA 3N6XA 4J91A 3HB0A 3ZWVA 3G17A 2BMWA 1XMVA 2XOKA 3BCSA 1YASA 2HQRA 3DOEA 3P9SA 4HWPA 4X41A 4YP5A 1ZXXA 5G4KB 1T0BA 3HZRA 3QKIA 4IVQA 4F2HA 2WUDA 1NPTO 2YJGA 5TNXA 4U02A 2VA9A 4MUGA 3ZXUB 4S04A 1Q3HA 5CNIA 1YO6A 4QRDA 5T41A 4F3NA 4WBNB 5BQ3A 1WHSB 4P5EA 2XTZA 1XF1A 2VP0A 4W7SA 2QMZA 2ISCA 5EQDA 1UWLA 1XPOA 2WB2A 2R3SA 2QMHA 1LBSA 3GT0A 3OMXA 4NPCA 2X23A 1YL6A 4ZAGA 3ZVKA 4YQYA 1SU6A 4G1FA 1USKA 4FC6A 4L3OA 1R2QA 2QVCA 3KR2A 4FFBB 5BV1A 3INNA 1Y9ZA 3GYBA 4IJWA 1YRLA 3NRCA 2GYUA 4ME6A 1KHHA 2ZT5A 1JDVA 3IE2A 1SOMA 1GGVA 1U90A 3HJBA 3PDCA 5L6MB 1R9MA 2O2CA 1PQ4A 4DLKA 1S3GA 5FI1B 4XH9B 3H0KA 3GZJA 2GN6A 2X4DA 1S4MA 2VXOA 3G2NA 3IEUA 5CPBA 1VI5A 3WA7A 4JJ6A 4I99A 1VG8A 5FOXA 4JIGA 1P19A 4A1OA 3AF4A 4WCDA 2C3OA 1SQ0A 1VYUA 3BXXA 4FHDA 3IRVA 2R2GA 3O91A 3QEJA 5IEJA 2PHZA 3BMCA 1FLAA 1T8PA 1WMDA 3MAJA 3PL5A 4HJXA 4M1KA 1R6BX 2ZSBA 3ANYB 4HQ6A 4CV2A 1QOPB 2PL3A 1CUWA 2AOVA 1XD8A 2AHOA 3D6HA 3KJFA 2CL7X 3L7CA 3L8HA 4H1HA 4D2IA 4YCNA 4FR5A 5CLIA 1R6UA 3FJ1A 4GI2A 3ROKA 4F93B 1S1CA 2X15A 1AOXA 4D9NA 3T7CA 5IVHA 1T8WA 4YJ2A 4NONA 1JSLA 3AHDA 1E9AA 1O5IA 2NVUB 1XDUA 2CDBA 3ULKA 3ZG6A 3QV2A 5DBFA 3ABSB 5JNTA 2WP8J 4I9UA 2O19A 4QREA 1U8AA 1FLDA 3ODPA 3PSAA 1USWA 4BX8A 4MV1A 3VPBA 1OF1A 3BWMA 3FTDA 1XWIA 4FZRA 3AEZA 4HQ0A 1KOGA 2NUAB 2ZGVA 4XRRA 1EFAA 4U9HS 3TNDA 5JSQA 2GUWA 5D5HA 3HGQA 2PUWA 3KELA 4JCOA 5FULA 1OBOA 3S70A 5IASA 2HU5A 2X8AA 1SAYA 2ZRBA 1BXZA 4IFEA 3FETA 3PNBA 2FZWA 1XWFA 1DS6A 3CUSA 4LOLA 3V4VB 3R9XA 1CUIA 2G9QA 3DZKA 3FPSA 3AJDA 2AXPA 1E3LA 3AM1A 5F5NA 5E8RA 4HAZA 3AKDA 2C0PA 4WNAB 5B1IA 2J5KA 3UB3A 2BP7A 1ACLA 4PNZA 2P4UA 1CP3A 5JATA 3BIFA 5IM5A 4WJZA 3MM4A 4OKNA 3IHTA 3ETJA 2EJVA 4D4JA 4E5PA 1TZMA 7AT1A 2IDKA 2FPGA 5AM3A 1QH9A 5K6TA 5TPWB 1VHDA 1KJYA 3UAZA 2FR0A 4B5LA 2DQYA 1XRSB 5K0SA 4FNOA 2XWPA 1I01A 5LJIA 4N0QA 5DH9A 1EG2A 3PDWA 1T6ZA 1QPBA 2R2AA 1XALA 3NP7A 2IEZA 1UBSB 3RUEA 3EXFB 4Z4GA 2FRXA 1HT2E 1RQ7A 3ELBA 5TPWA 1XD2B 5T57A 4NFSA 3R5FA 3D4PA 1ZHHA 3OPQA 4MUBA 4P7GA 4ZPJA 4US2R 1T9BA 1HXHA 1S9DA 1CQIB 1SVUA 1ZD5A 2Z2KA 4P32A 3ETHA 3O47A 1CY6A 2XNHA 4KIJA 4KXVA 4PV7A 4RQUA 3SEAA 2P2DA 3JWEA 1IG0A 2CZGA 2NSJA 2AG5A 4IZHA 3HKCA 1N2EA 5IFLA 5I7AA 1L3CA 4O4LF 3MPOA 2J0QA 2J6BA 1QZUA 2B9VA 5KQGA 3MJFA 2V4UA 4UZFA 1RCFA 3FUWA 4K8OA 1WDKA 3CG4A 1JR3D 1KAOA 4RFSB 4UHBA 1ODSA 3A11A 2VDWA 3OJWA 4P9NA 3GEPA 3WHLA 2EWVA 1M7HA 1N77A 3EF1A 2FETA 3F5QA 2I3BA 2DBYA 2CFCA 3FI9A 5LVAA 5BMVF 1KVUA 2WNHA 4A73A 4CMGA 4IDFA 2D1YA 2FW7A 5DNEA 2YWRA 4E1VA 4DEVA 3EMVA 3CE6A 1URPA 3QGMA 2ZWMA 3DTNA 2A3RA 2IHNA 1E0AA 4HPXB 5JR3A 5D01A 4EELA 1KY4A 2R86A 3LOUA 1IUOA 1Z12A 1R74A 3JAWA 5ITWA 1XK7A 3Q11A 1L7NA 3SE7A 1YDWA 4JDUA 1WQ3A 3SLRA 1JFRA 3K0CC 1QFSA 4GOND 4FT4A 2GETA 1KO1A 4YXFA 1QO0A 4IKPA 3EG5A 3LC2O 4GSYA 5BVHA 4CT4B 4LQ4A 3V7UA 4Y67A 3PRYA 1W581 3JAWB 4UAVA 2LRHA 4R7GA 3HB9A 3JQBA 4LGMA 1L5HA 5D3KA 3NANA 5I9TA 3KWFA 4GOKA 2IEBA 3DBRA 4I19A 3PPXA 2X3FA 3NZEA 1WQ1R 2WMNB 3EXEA 3MXOA 2H2AA 5A2GA 4D7AA 5BSWA 3G5TA 2FW0A 5HKLA 4F3KA 2KBFA 1KO7A 2YMQA 1OQAA 4HS4A 2JW5A 3L3BA 3Q98A 1KORA 2ZI5A 3WDMA 2WFLB 3F71A 4O2AA 3ZIAA 1P1RA 3BE4A 3LDFA 2QLNA 3C6QA 2HSEA 3HYNA 2NVOA 1W4RA 1A9PA 3GEDA 3H1PA 3I04A 3M4ZA 4BHTA 2HM7A 1FXWA 4RIGA 4E2WA 2CUZA 3KQWA 4XQ9A 4D0LB 4X3PA 4DR7B 4FGLA 4ALIA 2WFLA 3IIKA 3M6XA 1L4NA 5K3FB 3HWWA 4EPWA 3H65A 1WSDA 4DMRA 3SBEA 3EGXB 3OICA 3FUCA 3IKJA 4WERA 3ZDAA 1W19A 2HSGA 3ESYA 4RV4A 4RD4A 3BHMA 5GWXA 1DTWA 5SYNA 1QCZA 3HEAA 4OX9B 2YNMC 5H68A 4F2WA 4OI0A 2PX2A 3BTVA 3OJ0A 5TEVA 1ZAYA 1QM5A 5LKRA 5F7ZA 4FHGA 1X7YB 3NEAA 3MHPA 3EPJA 3BD9A 3E5MA 3OIFA 1DTWB 1VPEA 1XVVA 2G72A 4XTRA 1D0VA 1G8JA 1QSGA 2IODA 1TUBA 1R88A 1N0HA 2I99A 2Y2UA 3FNFA 2AMVA 2WUEA 1R8JA 4KQCA 4TTPA 2BGGA 1DUVG 1Y80A 2IYYA 1YCFA 1Q0ZA 3KZ1E 3VNUA 2OB1A 1JFVA 4PXSA 5ALXA 2G7MC 2Y3IA 4M76B 1IXZA 1NBEA 2I66A 2VDVE 1TUBB 2YJ5A 3MWDB 2VUSA 3EBLA 1YZYA 1TGYA 2QJTA 1VP3A 3FGNA 4PAOA 4U8HA 5LQDA 1EA5A 4DARA 1RI2A 2FZ4A 3DW1X 2B69A 4H0FA 4G56A 4KAAA 3WIEA 1QJCA 4G8JA 2O0LA 1YBHA 2A5YB 5I7HA 3HACA 3ZHVA 4FB4A 4HVAA 1X39A 2PIAA 4ZFNA 4YJFA 4MVYA 2ENWA 1V45E 3HCAA 2NT4A 5FR2A 3IUEA 4JV5B 1O96A 1QCYA 3GJ4A 1SHKA 4X6UA 3FNRA 4XWTA 4CKWA 4OYHA 3D6FA 4U7JA 4AJPA 2RAFA 5E2AA 3LZ6A 1YZNA 4TLAA 3OE5A 3I9FA 1G6OA 3PXCX 1KQNA 2C4HA 4NCIA 3KQVA 5GIOE 2ZROA 3JAKA 2D4HA 3AF2A 2C03A 2BCJQ 3DMFA 2C9BA 3ESBA 4CKWB 4LZAA 4OHUA 1NP6A 6ADHA 1ZRNA 1QR6A 4QGHA 1GCIA 2IUUA 2HSZA 3CURA 4U7GA 3R7BA 3R5JA 1YS9A 4XQEA 3V1NA 4IIUA 2CJPA 3M3PA 2AJLI 4KIFA 1Y9AA 1NM5A 4OV6B 3UUEA 5GZ6A 2VQ3A 3G0DA 1PTKA 3K9CA 2P9YA 4MMXB 4UMEA 5BMVB 4RWEA 5A62A 1OXTA 3O03A 1N5JA 4C87A 3DB1A 5KNDD 3H5NA 4HRAA 2XKJE 2J3JA 1Y6ZA 1LBEA 2D00A 2P4HX 4XB6B 1QNFA 3AHIA 4XVCA 5AI5A 5AOCA 4AB1A 3BD7A 2XVXA 5JAUA 3TSCA 3EA0A 1CQPA 4URWR 1XTPA 1KTIA 1DIHA 3ILVA 4KK3A 4JR1A 3V55A 4AX8A 3FR8A 1JG3A 4CL0A 1CKEA 3G2QA 2C59A 4LCEA 3PGA1 2ZUTA 3FNHA 2GZRA 1PBTA 3O3CA 1QBGA 1TIBA 1Y4ZA 1L4KA 2JZNA 1E2KA 1UJ2A 2Q5JA 2X0IA 4FQ7A 4K1LA 4LNAA 3EG9A 1QE3A 1XHLA 1D9ZA 4HMPA 1L5MA 2FUNB 4P4UA 3DDZX 1ADCA 3TX2A 4LNUA 1ZUNB 2ZBVA 1GVNB 2R6GA 3K6SA 3ZHOA 4G4JA 1TC1A 3LX8A 2M98A 2F9MA 5IRCD 4IIXA 3ZWWA 4K86A 3L4EA 5JSKA 2I5PO 1DPGA 3W1EA 1XCBA 3PE6A 2WT9A 4DXDA 2R4UA 2WF6A 2DPGA 4P1ZA 3UT6A 1E99A 2ZPTX 3VR2A 3IE0A 3VV2A 3Q7IA 1UM9B 3I0MA 4I50B 4Q18A 5HP4A 1WZ2A 4K2HA 5LD2B 3ESXA 1B6GA 3C7AA 2PWYA 3WMGA 1D7OA 3V2UA 3ECSA 4R1NA 4NEHB 2I91A 5CDSA 3EMKA 1GTSA 2EARA 2ZTUA 4KN8A 4OBEA 2XR1A 2ANBA 3QA3E 4B71A 4EUSA 1FSFA 4PYKA 4PNHA 5H9WA 1GDHA 2LW7A 2QRVB 2W48A 3NC4A 4M2LA 1EZ1A 1X86B 2A9JA 1HZZA 2AJBA 2B8EA 2KQUA 2ZAMA 3N8GA 5C8VA 3FRHA 5BSMA 3RJ9A 3MS7A 3PVSA 3CW2A 4ZI7A 4PPQA 3LFUA 2C77A 2R1TA 2WDPA 4R8MA 4AS3A 4CM6A 3DDSA 1GG9A 2VK2A 5H3CA 1QGOA 4MLZA 1GNQA 1OJ7A 5H9VA 3SZ3A 1KYQA 5K3SA 4IG9A 4ETNA 2SCUA 4EMTA 4HNQA 3IP8A 2C2GA 1AKTA 2OLEA 3VDQA 4RV5A 3CTPA 2R8BA 6REQB 4PQYA 2QQGA 4YRSA 2XLCA 1NMSA 2B5VA 3PPVA 3ML1A 4KXQA 5CX4A 4Q1FA 4H7JA 2OAGA 3C41J 1V3UA 3GCDA 1U7XA 5DLDA 4Q7JB 1SUEA 2PBLA 1THGA 3RNLA 1SB9A 2X0NA 3NALA 1C2YA 5HBGA 3FWYA 1T0UA 2AK3A 1AHHA 3GMIA 1VHWA 4OMUA 4TTTS 5B2FA 1NHWA 1KZ6A 1KYIA 1XVAA 4N0MA 1QS0A 2EBHX 2RJ3A 3L0ZA 4JBNA 1PTJC 1RWMA 5HF9A 3BRWA 1T5HX 4N76A 1V3VA 3HGTA 3ILYA 4DNXA 1ZH0A 3BOSA 2DOKA 1GQFA 1O8CA 4NMWA 3EOAI 3GRFA 2WJ4A 4HT3B 1QBKC 1RBQA 5JAOA 1DQPA 1QUEA 2UZ1B 3DLTA 1OWLA 3IP6A 2I87A 1LLDA 1XXLA 3P0IA 3H87A 2ZVJA 1VMIA 4F12A 3U6BA 1MORA 3KKQA 4ZOEA 3B8HA 2B61A 2OK8A 1E77A 3SP1A 1PNQA 2AFIA 1TM1E 2YYZA 1CULC 4ZOQI 3SDSA 1PJ3A 4HDKA 4RGQA 5KB3A 1RXYA 1JX6A 5FV7A 1A27A 4I5FA 4OHXA 5DLPA 3H04A 3TCXB 1GPH1 1HQKA 1P72A 3H9BA 3IMFA 2EDCA 3N1UA 4P7BA 4XZ3A 4X97A 5E38A 4PAMA 4MI9A 1EVEA 3QFTA 2SHKA 3AR8A 1DXYA 1H23A 4MRPA 2JGFA 4BECA 3HN2A 4KXYA 4AP9A 1N5RA 3G2OA 4GM0A 3LMKA 2FPKA 2GCNA 3KJNA 4RVOA 4RLQA 3L8YA 3X1JA 1P44A 2OEPA 4GM4A 3UAOA 1ZR4A 1H0RA 4C0XA 2MR6A 1FBTA 3ZTWA 3R9KA 7ABPA 1IPFA 4ITVA 4LHYA 3NOOA 4DJJA 1QHFA 2QYSA 3HVIA 4XYEA 4N6GA 4ENTA 3ZCRA 2Z9BA 3DKVA 1Z4OA 3LM8A 4DV2B 1Q1NA 4HLUC 4F3CA 5L3SA 2ZUUA 2VJMB 3QTBA 4JYAB 1UPAA 3DOHA 2A7QA 5HX7A 1LRJA 4EFLA 4DYVA 5JYCA 3T1TA 4EWLA 1I7DA 4KQ6A 3CU5A 3GN2A 1QIDA 3EXIA 1XZKA 5WRFA 4MWGA 3S2EA 4OXQA 5B1HA 1BQ3A 4HUJA 3NHWA 1UBHS 5L3SB 1CCWA 1V26A 1Q84A 2P67A 4M1OA 1ZMXA 4GICA 1NF9A 2IOHA 4GBJA 2JARA 2VIIA 1I6MA 3UENA 1YCGA 5C7OO 1MOZA 4JVSB 2X5NA 5EJ4A 5C2JB 1Q5PA 4B32A 1FP4B 2IEYA 2FRVA 3D31A 1ZJYA 2JAUA 1NN0A 3CEAA 1HTWA 3KZMA 4JQOA 3G5AA 3KQLA 5DGTA 3AIIA 1JLKA 3DVQX 3L46A 3NM5A 4Q9LA 3PSHA 1RJFA 2R25B 4CIAA 3B51X 1DIBA 4IQ8A 4GOOD 1YS4A 4M1EA 3LPDA 4MUXA 1L7EA 1N6RA 4JLUA 2G5TA 1BCRA 4V2UA 5KHAA 3O1HB 4GT1A 1XXHE 2C5HA 4KGDA 4O1MA 1WBBA 1W5BA 2HGZA 1VLZA 2H2HA 2R6JA 2XQGA 5KCMA 1QGYA 2HA7A 4X71A 4YRMA 4MSUA 3VPSA 4MJXA 3E9CA 3JQRA 2XSZA 2IEDA 1BCRB 4MQMA 4ND2A 1OGYA 4QASA 1CRWG 1TRHA 2Z0MA 2IDZA 2X5JO 4U7HA 4QA9A 1J8VA 3O4RA 1N57A 4E4YA 1MO3A 1JHXA 4KQGA 3SK0A 2V7PA 3QUCA 4G5HA 3VVBA 4ARAA 3N2NA 4YHHB 2UUAB 1NGSA 2ZZMA 3SE0A 2ZJ7A 3VVMA 4LK3A 1VTKA 2JD1A 4ML3A 8LDHA 1L7BA 1FQOA 4JZYA 4L4UA 4TT3D 2W90A 3E5RA 3ZHYA 1VSUA 3AQ4A 1GZ3A 4MVXA 4GU5A 1X3SA 3OZFA 5CP8A 2JEZA 3D8SA 3GEGA 3G8AA 1SIOA 2N1MA 4X9XA 3K9LA 4HH1A 5A9SB 5JS2A 2AUMA 3O9ZA 4YMIA 3H97A 1JZTA 4NCKA 4JXZA 2EZ9A 3CLRC 2Q45A 4PLFA 4PZ0A 4YDQA 2IS4A 4QHYA 1KPIA 1WW8A 3IIMA 4FSXA 5AKZA 1MF7A 1Q0LA 4UUAA 5D3ZA 3ZIAD 5BSHA 1C0EA 2FLKA 4TOIA 4WOPA 3NT5A 2IPMA 3FVQA 4FUTA 2NO1A 1YONA 5BSGA 5IC4A 2BFCA 3ROXA 2Q4EA 2JFUA 3A0RB 4X64B 4DLWA 1L7MA 4QVIA 2M6LA 3H4VA 3C3EA 4BO0A 4DA0A 4MAMA 3QZUA 3RSQA 1S9HA 1JVNA 2UYCA 1ZH4A 4N9WA 4ESHA 2BVNA 4F84A 1EH5A 3EVAA 2EG9A 1X0XA 1GD1O 2HKIA 3VRHA 4D4HA 1KKLA 3SIPA 2W6ZA 3ES9A 4DBZA 3A1VA 5FA6A 4ZVVA 1EE2A 1CDEA 3OCCA 1HT0A 4TTRA 1ZM4A 1PN3A 4ZAZA 1CJTC 2AZ4A 2QDXA 3I04M 2QJWA 3PQCA 1X8JA 3FPBA 4C08A 2C54A 4NXNB 4ALJA 2J7PA 4E15A 3ZX4A 3DFIA 3WRWA 4UHDA 3G2PA 4GFDA 4L0DA 4PLVA 2PUDA 4WLFA 3WGIA 4WN9A 2D59A 2WU0A 1VPLA 2XADA 3KJGA 2ZE7A 4MUYA 4ZV4A 3CR3C 3FWZA 4CG2A 5JH7A 1ZMTA 2O7NA 3ZUPA 4BZWA 2QD5A 3ZKAA 3ANSA 2DHEA 2CCKA 2FG7C 1JFTA 1QKIA 2R79A 2HCFA 2X1VA 4FINA 2FWPA 4LJ4A 1N4AA 3NVDA 4E08A 3L7BA 4B3JA 4J0KA 5HGXA 3V7NA 1J5PA 2Y0PA 5JAHA 2GZMA 2IYQA 1U02A 3LQRA 3ZHRA 1AUVA 2QI9F 1DRJA 1UK9A 4MDHA 4AS2A 2O9JA 2F3PA 5F98A 3Q8KA 2GEUA 3IQWA 3BXEA 2YUIA 3M3DA 1CF2O 1EFTA 3KUCA 4JMLA 5AKLA 1HGXA 3VH4A 2UVDA 3BZBA 3K1JA 3ABRB 3VR1A 4M37A 1YUBA 1T9GR 3USCS 1KKUA 4HQNA 4UQOA 3TQQA 1QE0A 5I9IA 1XVTA 3DL7A 2NUTA 2ZBGA 5LZ4A 2F67A 2P91A 1W96A 2N75A 1NUQA 2WA1A 3FKSA 3I6IA 1GCOA 3R0ZA 3UGTA 4DLXA 2FZLA 3NT2A 2PUEA 4E33A 1CP2A 5LN1A 4GF5A 1O57A 1PHPA 1P1BA 3HY6A 1C7FA 1I7PA 3C39A 1KVRA 4WY8A 5J59A 3RT9A 4JA2A 4KUGA 3T1YB 5LIPA 4EVIA 3GNLA 3B38A 1XU4A 4FFWA 2FFAA 4B73A 1IIBA 3VTKA 2ZCVA 2GJSA 3MMPA 1AHIA 5PGMA 3O8NA 3JZFA 3AKEA