5KNDH

Crystal structure of the pi-bound v1 complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
102
structure length
102
Chain Sequence
TYKIGVVGDKDSVSPFRLFGFDVQHGTTKTEIRKTIDEMAKNEYGVIYITEQCANLVPETIERYKGQLTPAIILIPSHQGTLGIGLEEIQNSVEKAVGQNIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords V-type sodium ATPase catalytic subunit A
publication title Crystal structures of the ATP-binding and ADP-release dwells of the V1 rotary motor
pubmed doi rcsb
source organism Enterococcus hirae atcc 9790
molecule tags Hydrolase
total genus 25
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2016-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF01990 ATP-synt_F ATP synthase (F/14-kDa) subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold ATPase, V1 complex, subunit F 5kndH00
5KNCH 3VR5H 4RNDB 5KNDH 3W3AH 5KNBH 3VR6H 3AONB 4IX9A 3VR4H 2D00A 2I4RA 2QAIA 2OV6A
chains in the Genus database with same CATH superfamily
1Q12A 1NAHA 1RI3A 1Z0DA 5KTMA 2ZULA 1BXRB 1K6EA 1V47A 2BM8A 2UV8A 3CUTA 4Z6KA 3GMTA 4O1HA 5AR1A 2AEEA 2N0SA 1DEKA 4FWBA 2TRSB 1V96A 2VQ3A 4ZOBA 3EEOA 4K9KA 3Q72A 1Y6RA 2C3YA 1MO4A 2HQBA 2WWRA 3M6IA 4KTVE 1GNSA 3HJTA 5G2OA 3L1IA 3WBJA 4C07A 4NAHA 4OYYA 3LLMA 1Z47A 2UZ3A 3PA6A 4M38A 4H0FA 5ENZA 4QO8A 4K2AA 5LU9A 3BOSA 4B3XA 2E3JA 1NIPA 2Q5HA 2Q1YA 1C4OA 4KTTE 1FJ2A 1SUFA 5KNBH 5AI8A 4BKPA 1KHTA 2X4LA 3EZYA 4UBOA 1H0RA 4GMGA 3T94A 3K0CA 4PANA 3COVA 1OC4A 2PQ6A 4GF5A 4IPTA 1XRLA 1B23P 1QH8A 2ZXFA 4D9BA 3DS8A 5B3LA 4WFQA 2WUGA 4EW6A 4QRIA 4XX1A 3WNVA 3W3AH 1P44A 3TQCA 1VM6A 3LRPA 3WMEA 1AD2A 1JKMA 4Z1MA 5CURA 1S3FA 5ALVA 4N6GA 1BROA 3A27A 4R8LA 2PYIA 3PLRA 5J5CA 2FPLA 1US8B 3MOSA 3BXOA 3IMGA 3AVWA 1LFAA 1NQTA 2X5JO 2OV1A 3V4LA 1G1AA 2HXSA 4XASA 4OYLA 1BGVA 3GT4A 2WLTA 4LGVA 5T57A 4ZKEA 3ZQ6A 3BGOS 1LD3A 3M6MD 5ALXA 5IDQA 3LBAA 4M0UA 3S3TA 4EARA 4XWKA 2X5OA 4MA4A 2GZ3A 2ZRFA 1Q2XA 1T0JB 3DZKA 1H9CA 5JFOA 5K5EA 4OI2A 4INZA 3LJKA 2WFLA 4IIJA 4OQYA 3D7RA 1L7MA 4OSOA 1PG2A 4NQRA 4DAEA 4I55B 2GYVA 4QODA 5BSUA 4BB9A 5BNWA 1WP9A 1MPXA 5AIAA 2W70A 4FUTA 3UV6A 1R0WA 3L8MA 5BSWA 3PPXA 1P45A 3GEMA 3ZGOA 5KREA 3EXEA 4P0QB 5IN5A 4HDOB 1W4RA 4J6FA 5K0NA 1QIJA 1C3OA 4MMZB 5BN5B 3ZXIA 4CI9A 5JRZA 3EX7C 5IXYA 3GEPA 4ZI7A 3GRYA 4OH7A 4WLUA 3R7AA 4OA8A 4N5IX 4QBGB 4HGPA 1G2QA 1O03A 3QVOA 4EY4A 3AF6A 3ZIUA 4D57A 3SC3A 3U3MA 2DAPA 3IAXA 3B3JA 4BZPA 4N82A 2FPIA 3OZTA 4NYMR 4TWZA 2QPTA 1NGSA 4D0LB 2D2XA 2PX0A 3IQGX 2OORC 4NX2A 5C5CA 2QL9A 1O1YA 1NVAA 1IULA 3OESA 3P2MA 5KOHB 3GK3A 1R0CA 4ZU1X 4C4TA 4E5NA 3AKEA 5DLYA 2JLVA 1NBIA 2AVDA 1A1SA 1O0SA 3NRJA 2QQEA 2OZLB 4HNSA 3GR6A 4CEIB 2FN7A 2RAPA 3BVPA 4RKYA 2HU5A 1G7CA 1ICEA 1TL7C 1UM9B 1OT3A 3DL7A 1JE0A 4AZ0A 3PE6A 4CMIA 2Q4OA 1E3TA 2BEUB 3EXIB 2QE7D 3JQFC 4RY2A 1XQWA 2WFLB 1J06A 5L40A 1UF9A 4XTCS 4O4LA 4DV7B 4AUKA 5JCZA 5LWHA 2X7XA 1UXJA 1W59A 1YJ5A 2F55A 1B14A 4NJOA 2NQ8A 3QUCA 2OZEA 3UCXA 5B1YA 4B3JA 4C2UA 4MA0A 4NE7A 3RFUA 2FSGA 5HOQA 4IV8A 4R05A 3H11B 2ATXA 1BDJA 2EGUA 2P41A 4EY6A 2PH3A 1FW6A 1D9XA 4J1TC 4KE9A 5SZJA 1OZ0A 1L1RA 2FWMX 3M2TA 4Y2GA 5FUYA 3RF7A 2HXGA 3ZY6A 4CFZA 4D3XA 4F5ZA 1TF5A 5DU2A 1ZVKA 2QP3A 5ALHA 4JEIA 4NE9A 4UM8B 3TL3A 4CKEA 2QP9X 1JXQA 1YKSA 4LY9A 4N6OA 2QRPA 2X41A 2AWNA 4CMJA 1GPLA 5K2MA 3DDCA 5ALQA 1ML3A 3OTIA 2YMPA 4YASA 1C1YA 1MNAA 2C5FA 1UDXA 2Z58A 1N2CA 3SR4A 5CA1B 1NN0A 3D8UA 4J0GA 3ZXXA 2IYSA 1QYRA 3TKLA 3SZRA 2PO7A 2PSHA 4AZTA 1YNSA 2EJUA 1PUJA 2D3WA 3G2NA 4HMPA 4RVOA 2LGJA 4M89A 4Y2RA 4CM9A 4IDQA 2RB4A 3KKEA 4M53A 5E6SA 1T6NA 2OV4A 3PYMA 1HEIA 4JCOA 4PNPA 3T4XA 4B3DA 2DC1A 3IAEA 4OMCA 3HABA 2QLTA 2B35A 2WM3A 2CVQA 5DGHA 2AKEA 3PHJA 3UB2A 2V58A 3L8FA 2XYPA 3OCWA 1RXWA 3QTBA 1IZ9A 1SCUA 4OFWA 1KYWA 3H2ZA 3KWLA 5HIAA 1G21A 2IK8A 2WEKA 3WC4A 1NF2A 1C3JA 5DYTA 3VC1A 1M8KA 4OO3A 3L3BA 1Q0QA 4ZALA 3M5CA 1V9CA 1DBSA 2NXJA 3BX1A 3L7YA 4MQEB 2JZOA 1LRJA 4EL5A 3EW9A 3P97A 4RV4A 2FUG6 5CFOA 4OLBA 1CETA 3I28A 4BLSA 4TN1A 2QUHA 1TDJA 2R8EA 4F8JA 1L5YA 4A8JC 2PRZA 2JF0A 3PQ2A 4ETNA 4ZREA 4RSHA 4KR7A 3O3OB 2PXAA 1O58A 1JG3A 1SKAA 2V7UA 2YY7A 3ANLA 1NURA 3I53A 1MRZA 3QWAA 3Q8WA 3HNPA 4M8NE 1Z5ZA 4QOSA 2AXQA 3GBVA 5CPBA 4CXMA 1I3CA 1HFJA 4RVGA 3S29A 4YJKA 1PYOA 5AMXA 5F9MA 2DLCX 1Z12A 2LKCA 3ROPA 4W4TA 2BP7A 3AGPA 2CXSA 2QSYA 4WOBA 1J25A 5CT4A 1KPGA 3S99A 4C7XA 1VLZA 1CEXA 3LDGA 3VHLB 3HH8A 4F56A 4O4HA 5C34B 1CR2A 1DO2A 1TCBA 3EBLA 3WMRA 2DHCA 3CF0A 2XA1A 2ZJBA 3BWMA 3O92A 2Q4RA 2XOXA 4JVNA 3TRIA 1SVNA 1EGQA 1GKLA 5HMMA 1O97C 3L4BC 2G7ZA 1G21B 1UMDA 1J42A 2DP4E 2RGDA 1VCIA 2L19A 2WHQA 3IEUA 5F4BA 2PTHA 5EJEA 1AK1A 2AG6A 3BMXA 3JVVA 5I4IA 4HO1X 3BRWA 1M75A 1CG6A 4MWOA 2M6RA 5EVJA 3WDKA 3L8EA 3RT1A 4ZVTA 3PD1A 1KYXA 2OFOA 1K3UB 1BHQ1 1TFUA 3W78A 3LX6A 3VR2A 1T24A 4EHAA 1H3EA 5TQVA 3KOUA 2QRNA 3PTAA 3DBLB 3OJCA 3LCRA 5TVGA 1UBHS 2QZ4A 3P0RA 1JVNA 4FMCF 1R4NB 1F48A 1W52X 3DWFA 1ZAKA 4W8GA 4BAUA 1F51E 4L9SA 4HWKA 1C1XB 4IDOA 2YX1A 1GKYA 3G0HA 4WXYB 3L9WA 4MJLA 4QPDA 2A5GA 2OWEA 4DMFA 2DHRA 4TL7A 3KLNA 5FBRB 5TQJA 3VZPA 1CK4A 1GGNA 3A36A 3LCMA 5DM60 2BP7B 2J0UA 2R1TA 4FYPA 1IH8A 2GUWA 4I50F 2VPTA 2DWUA 1KS2A 1WSBA 2Z4TA 3AP1A 4BOYA 1VE9A 3C6MA 3MWGA 4GZ3A 4PSVA 4QDOA 5F3DA 4PXYA 1YL5A 5F2OA 2KMLA 4AD8A 1Q7EA 1UPTA 4W5NA 3G2PA 3LUAA 3KCNA 3HY6A 4PAGA 4E03A 1Z0IA 4GDMA 3EA5A 4A2CA 4J0DA 2B1IA 3ND5A 2D1SA 4EYKA 1BW9A 3PFKA 3U0VA 4NS1A 3R9KA 3VMFA 3KP1A 1MT3A 1LWNA 3AKCA 1PR1A 2W8BA 3WIOA 4KHZA 1QGUB 3FPHA 1XKQA 5LZ4A 1ODSA 1Z6YA 3JATA 2XUQA 1P7CA 3E61A 5EIOA 3RODA 3UJBA 3A7EA 4PBRA 4LPKA 2HJ9A 4EAQA 5HXAA 2W6QA 1AZLA 3WP1B 1G5PA 3L6DA 3QLEA 1Z45A 4JIGA 4UZSA 3SIWA 2OZPA 2W2PA 1PWZA 4MWBA 1MW9X 1WSWA 4CBVA 2PBZA 1RI1A 4NPHA 1E3WA 1PZNA 4R4JA 2EW1A 4RJJA 4ZO6A 1SA0A 4A0GA 4NH4A 1LLCA 2EFGA 4WGGA 2DPYA 5LB4A 2NT3A 5BQXA 1T5SA 4BUJA 4F4HA 3IP3A 3QPCA 5TF4A 5HZKA 2C7BA 1K0FA 1MJGA 3EVCA 1IXZA 1L0BA 1WHSB 1IEVA 4QE3A 4UAUA 3U0BA 3UMJA 2FDCA 2VDKB 2PNFA 4IVNA 2AFIA 2RI0A 5A4KA 4F38A 4R3UC 3BFXA 4YQEA 2MSWA 4A6EA 2FZGA 4MKHA 3NGXA 5IDWA 1HF3A 3NBFA 4DLXA 1OFHA 3A4LA 5ALIA 2O0KA 1N5OX 2IW3A 3IXQA 4FXPA 2DH6A 4ZTZB 1N2HA 1UMBB 2FVXA 2XMSA 3DWGA 1OX4A 1COWA 2AG8A 3PEYA 3O3MB 2WC1A 2W8BB 2D8MA 5EA2A 1WVGA 2NTVA 2PBLA 2PFGA 3DCIA 3OOWA 3FNHA 2CV1A 1PFKA 4P38A 3KUKA 4RQBA 2R751 4YYZA 3BN3A 1VIAA 1QX4A 4QU9A 4RLSA 1HYBA 4NLLA 2OYSA 4EW2A 1QKKA 1JDSA 4WFIA 3JWGA 1HT1E 3PGKA 4PYIA 5DCLA 3EH2A 2JJQA 1UKVY 3COPA 3EEBA 4HV4A 3OUUA 3ZK9A 4OHXA 3ACCA 1JGTA 1GVHA 4OGGA 4R1TA 4O2BB 2F1JA 3BIXA 4M9RA 4OHOA 1W581 4Z4FA 1DC3A 1HPLA 2OV8A 1UC9A 1VA5A 4LJLA 1JQ5A 1O2DA 5E4JA 4AZSA 3ASUA 4MLDA 3ID6C 2RH9B 3IPAA 1YB6A 5CP8A 1Z0FA 4YRKA 5E8JA 2YOFA 3X1DA 5I47A 1RJ9B 1YJBA 3HMKA 1EBFA 4JP3A 2E5WA 1DCTA 3CPEA 5CT6A 4S05A 4YAEA 3RFXA 2JLBA 4HWPA 3RYTC 2HB6A 3OZAA 2DR0A 2FRXA 3WKAA 5BSKA 1RZUA 4FUQA 1U0OC 1JN0A 2XNCA 4IGAA 3E05A 2PGIA 3W8EA 1P2SA 1Z5PA 3BZBA 4GOOD 2WJWA 4AFNA 1LFDB 4NBNA 5B1HA 1PDVA 2CDAA 3L93A 3OF3A 1LBIA 5J2UA 4WJKB 3LT1A 1R0YA 3Q0TA 2IHTA 1NLMA 4LE2A 1RBYA 4OFZA 4XGQA 3I04M 1WLYA 4C2BA 2NPFA 2VTKA 1W2WB 4QO7A 4B33A 5G0VA 1NM5C 1JYEA 1W96A 2VTVA 2XMBA 5AKHA 1VP9A 2H1WA 4ED9A 1IPEA 2JLZA 1ZK4A 1FIUA 3X1YA 1KJQA 4C4OA 3UATA 2FETA 2YWJA 3UV7A 5I7EA 2UUAB 4ZT3A 1YDMA 2VCHA 4U9HS 2QN6A 1OR8A 4X3OA 1DOZA 5CIQA 5CDYA 1A9QA 3GRUA 4K3UA 3H19A 2JIPA 1PGPA 1EK1A 3EA0A 2PX6A 4BO1A 1TTQB 3I9JA 4OLHA 3CX7A 3PFHA 4Y30A 1W4CA 2Q29A 4MYUA 3G2IA 3O9MA 3TOXA 2XXBA 2XEDA 3DF7A 3LY7A 3N2GA 4PQFA 3AVVA 1EPUA 4OJNA 4J7CA 4NZNA 3OTGA 3GRKA 3DAYA 4Z7QB 2HSZA 5J2TB 1N92A 1AKWA 1BWSA 1NUAA 1JILA 2ZRKA 2G17A 2F2TA 2FR8C 4KUHA 1GQRA 1XHEA 3HLTA 2DU8A 2XCOA 3AM3A 3BE6A 3HEAA 3GI1A 5CX1A 3REQA 3TTUA 3K8OE 4PG8A 4XIYA 4X65B 4B8YA 2I7VA 5G1PA 2I66A 2Q45A 3ESQA 3HWRA 2ID7A 4X63A 2QX8A 3G8DA 3D0OA 1L7OA 4LJ5A 3WWYA 4ZARA 4BEVA 3THWB 4I1OA 2GUGA 5A6SB 2GD0A 1WV0A 4PAMA 1DPGA 2H4JA 2PWBA 2QN2A 3PHGA 4Y8VA 4XE5A 1OAOA 4OKIA 4C5AA 5L7TA 3Q8LA 1E92A 2WZDA 3WNCA 5BUQA 4WA8A 3ZJ4A 4RNDB 3F6YA 2HRBA 2IGTA 3DM5A 3P9NA 4NJEA 3RK4A 1ZI8A 3BERA 1NE2A 1DDGA 1KJWA 2PMKA 2TMGA 2YZNA 3ST7A 1Y4ZA 3RS4A 4I4IA 1MBZA 4JXXA 2GLXA 2EAUA 4KUEA 3M3PA 4BCCA 5HSGA 1DT5A 1NVXQ 4DDKA 3UPTA 1PWYE 2BAGA 1NXPA 4HBZA 3QKRA 5H3HA 3ZWCA 2UUCB 3QUBA 2QU8A 2VJMB 3N2GB 2NTNA 3P2YA 4AMYA 4G5HA 3OZWA 4AG5A 4MS1A 3VZCA 4F06A 2R8RA 5CDTA 3L5OA 1J0XO 5IWAB 2YN2A 1M5UA 5DM2A 4GRAA 4QNMA 4V0KA 3SEQA 2ZIFA 3GX1A 3A9RA 1YRHA 1WW8A 3KZOA 4HZGA 4AI6A 4M1SA 2R6FA 2WB2A 2FWIA 5JATA 2QX4A 5MN5A 5CX1B 2BEVA 3MILA 2FEPA 3A70A 3FJ1A 4J43A 4S2UA 4LMBA 4WK0B 2F48A 4WNAA 4YC7A 3HJCA 2ZSDA 2OQRA 3LSYA 3R3ZA 4LDPA 4ZGWA 1BN7A 4GX5A 2E48A 3KYCA 1FBTA 3JV7A 1YFLA 3V4FA 3MK31 4E2ZA 4DVJA 3HBMA 3EWIA 1ODJA 4KO3S 4UULA 1OF1A 3ZQ4A 1EGAA 2E89A 4RQUA 2WD9A 3PWKA 3ZDYB 3KQQA 3NPAA 4Y1RB 4ZICA 4GMKA 5T5QA 3CH6A 2PCLA 3TS1A 1TJ4A 3DJYA 3MQFA 2IYZA 5SY9A 4BKUA 2FEMA 5CB4B 3SHOA 3KVNA 1OYYA 5AKYA 2H48A 5TVKA 4IIEA 5TGDA 1K6JA 3AIOA 1MZPA 4P54A 5E7JA 5KVVA 1SUSA 2QA5A 5LKRA 2RAUA 4HEJA 4H3KB 3ROTA 3ZXYA 3D02A 2XZDA 3LOUA 4XUEA 3VSBA 3C4JA 3O31A 1FVFA 2ECPA 4JKOA 4LC1A 2ZIAA 4BJ3A 4M88A 1ZW1A 1Z22A 1NY5A 4G97A 3FROA 4R54A 3NH9A 2V1XA 3W4IA 3U7QB 4L85A 1OREA 2XODA 4YRDA 4IGKA 2TSYB 3NCHA 1JVBA 4AL4A 4RD0A 2AFHA 2QDKA 1NMSA 1VPDA 3WGGA 2OCYC 2ETXA 1Q14A 2PQMA 4GKJB 4IIJF 1UBOS 1KI9A 3KYCB 4PZYA 3MTDA 2M1ZA 3ZOKA 4OB8A 4Z4IA 3WJAA 3ORRA 3PIRA 1XU4A 4CM1A 3HJUA 3O4IA 1MB2A 1U99A 2VCYA 2VDVE 3G13A 4Q1EA 2IH5A 3DTYA 5GONA 3KSMA 2B1GA 1XPUA 5SY6A 2F00A 1GAEO 1IOVA 4MR7A 3ZU2A 2PMCA 2VF7A 3AY3A 4M86A 4RH0A 3E7DA 2CVZA 1FBNA 4IQFA 3S1AB 1JEEA 3SXPA 3NG1A 1TE2A 1GL3A 3AV0B 2NW6A 3AERA 3F71A 1U2RA 3OZCA 3PA8A 2JIZA 3CUEF 5DP1A 4D25A 2A5YB 3TSOA 1M2VA 4XQ0A 3V4PB 3LX5A 3LX4A 1I30A 2O8CB 1L4HA 2AR0A 2O14A 2VXBA 4IVQA 5BV0A 4YIHA 1ZISA 2NPOA 3EEFA 4BATA 5EC8A 1KZ1A 4UAGA 5AD1A 1WPQA 5CDGA 1ZD5A 4HS9A 1MQAA 1E6CA 1ZUWA 2QJTA 3CT4A 1WF6A 3DOFA 4I8DA 2GZAA 2GF0A 3UWKA 5JY1A 3AUSA 2LWIA 4O4LF 1Y81A 1NPTO 1YVEI 2A5DA 1XCLA 2X14A 2Y0CA 3JD3A 2EHJA 3ZV5A 1EFCA 1AUXA 3Q7EA 3VU1A 4LWQA 4BLWA 3Q87B 4YQYA 4DGSA 5NULA 4BQQA 1SHJA 4DMKA 1KYIA 2VG8A 3QU9A 4GEGA 1R37A 1YT5A 4QDXA 4Z4QA 2D7JA 1DBWA 1FFXB 3DOJA 4RH1A 2JLCA 3WKDA 3QWBA 3QELA 4IZOA 4RA6A 5IAKA 3LY5A 4J3JA 5FOSA 4JJ8A 5I01A 4GR4A 4X6LA 4II7A 2XMCA 1HQKA 2G36A 1Q3TA 2FKAA 4MVJH 4HMOA 3FHOA 4WESA 4F8EA 3W5DA 3HXOA 4QKQA 2AOUB 1ISIA 1KU6A 3X43A 2WSIA 1TM5E 5LIRA 1KMHA 1F12A 2IUSA 2PIAA 3MINB 3AT1A 3M1LA 4GVXA 1XMSA 1YZFA 2HH9A 3GMIA 1TPYA 1Z2OX 4IMRA 4M7RA 5LQKA 4A8TA 2BKUA 3C70A 2WWVD 3BICA 3K8YA 2DTDA 4IQ0A 4L9WA 5C53B 2OCLA 3D7NA 5JLAA 2YVLA 1P3JA 4LJKA 1KEWA 6GPBA 3E9NA 1KI2A 1Z4KA 1GGJA 1YJXA 5HJ5A 2OZKA 2AF4C 4WLNA 4YRPA 3LDAA 4K8OA 3E1KA 2O2ZA 3TD6A 4C4YA 1OLUA 2XT6A 4M49A 3GT0A 3K0AB 2PX4A 1BOOA 4UBLA 3SJZA 1HT2E 3TE6A 4BVKA 4B4VA 4CG1A 5KYXA 5LMZA 4KQ6A 3FE2A 4NOJA 2YXBA 4HJRA 3ZHRA 1A04A 2XWQA 4OAPA 4UHJA 1YBVA 2W48A 3OX2A 4Y98A 1KOGA 5A4JA 4W5QA 1J1ZA 2MSNA 3QMPA 2XB2A 3PCRB 2INGX 4IYJA 4B7ZA 1V5GA 3AKDA 1Q77A 3DP9A 3ZG6A 4DLKA 3QELB 1Z74A 3GIWA 4RA6B 5CJJA 3F9RA 3H3XA 1YE3A 1OFUX 3HY3A 1UP4A 2ZQ5A 4KDRA 3GLGE 1XQ6A 1T9GS 3PHLA 5IAAA 3UOGA 1XMPA 4EGSA 3CB2A 4B3GA 3EAQA 3H1GA 1MOPA 1D1PA 2C82A 1FDIA 4UXIA 1N7HA 3IQIX 2JFVA 3NJ4A 1B4DA 1THZA 2X40A 1L4MA 2EFJA 3IP7A 4BLQA 3W6NA 1L8LA 2P2LA 3WHLA 2BFBA 1E1QA 1KDVA 2P2SA 3S7ZA 4ZD6A 4D02A 4JUDX 3ZV4A 4ASUD 1HQDA 2XHEA 3U61B 1TU3A 2Z2JA 4CM4B 4QGBA 4RKFA 3F74A 1IZ8A 3ZZ0A 1CP3A 1W88A 5AKIA 1UZMA 1F17A 5E7QA 1Q57A 3U4IA 4C7VA 2YWBA 3HCEA 4LF9B 3FMVA 3RVQA 4HS4A 1MO2A 2VRBA 2IOQA 1JA1A 4O4HF 3VDRA 1Q0UA 3ONVA 2EF1A 2CE2X 2L0XA 4QFCA 3IMEA 4L8YA 2G83A 2V6GA 2I9PA 3FPCA 1KY4A 1C50A 2QTAA 4JP5A 4X71A 4PN3A 5CM9C 5AW8A 4N01A 4ARAA 2O6LA 2GK6A 3ZD9A 3T9DA 1KKUA 4WZZA 3Q7TA 4XD7A 2PL9A 2GFHA 4O0MA 4DQXA 1OX6A 4TROA 2YCBA 4P4NA 1I6KA 1U3GA 4V0SA 1GUAA 3ZWOA 1NQOA 5NLLA 3KHTA 3UK0A 1EIWA 3ZV6A 1CQWA 1UBEA 5MFZA 5GIPE 2GXAA 1ATZA 4NEGA 4NEHB 4EIWA 2HQSA 1PS0A 1LDGA 1ULTA 3EXAA 1R9NA 2HTEA 2DM6A 1D5WA 1R6AA 4Y6QA 3UMRA 3ZD8A 4AAYA 1BGXT 3S2GA 4YXWD 2ZCJA 3L05A 3GRPA 3IILA 1MX5A 1K7YA 4G5SA 1B6RA 2QL6A 3EBOA 4HP8A 5HPYB 4E4YA 3H5RA 5T41A 4PZEA 4MW7A 4RPJA 2ZM5A 3PE3A 1FFBA 3SR0A 1E4YA 3RTDA 3TZ6A 1X8KA 2ZJAA 4ZA2A 2QRVA 3W2IA 2UYGA 2G0AA 4YJDA 1SOWA 3MAJA 3I04A 3REFA 3PDIA 4PGMA 4RETA 5DXJA 4YRCA 3QKIA 4YRBA 2JFWA 4G25A 4HMQA 4QD3A 3ICQB 3KIPA 1JECA 3WGZA 1F20A 1RI4A 2P90A 3GA0A 1YIDA 1ZK3A 1MB9A 1ZLXA 3K5PA 3C8HA 4GVPA 5FBKA 4AQDA 5BRAA 5J5VA 1EBBA 4UDXX 1S02A 1E3DA 2O8BB 4ZAZA 3D8HA 1JTFA 2FWJA 3U26A 1ZKMA 2PGDA 4X7MA 2PZFA 2HGSA 3O38A 4U2GA 4Q16A 1C0PA 4DJDC 3NW9A 3RGGA 1C4WA 3Q98A 4V0MA 2NXWA 3T9FA 3ZH9B 5K4GA 4LWOA 2IEBA 4YUVA 4BU1A 1VRWA 4UPVA 5PNTA 3KAKA 2Z30A 4U0KA 1FSZA 4QX6A 3RUPA 2JDIA 3C74A 1WPRA 1GZSA 2H92A 2NO4A 4M1OA 4RJ2A 5EXPA 4D9CA 4EPXA 1LNQA 5DW0A 5A5VA 2I3GA 5HRAA 2BBOA 4KQGA 3ZDBA 1NRIA 4A23A 3KK0A 1GZ3A 2YXPX 3E5RA 5T64A 1N2JA 4XLLA 4PS0A 4XOUA 1JB9A 2W2NA 1P80A 3FCCA 3PNSA 3VU9B 2R8BA 3BE8A 3T5AA 3HXTA 1N2XA 1TEZA 4QVKA 5KYWB 1C4XA 4I46A 4ZCLA 2O3TA 3G2MA 3U62A 1ZSVA 2D7CA 2H4FA 3D54D 3LCVB 1E9CA 2PRYA 1A8UA 1E3JA 3LQ2A 3F6PA 3OEEA 4L8WB 1F2UA 5HZMA 3L49A 3DV0A 3G2OA 1RQ2A 3PZRA 2CHGA 1GN9A 1NPYA 1Q83A 3F2VA 3IDOA 1YASA 1OT5A 2W2KB 1XLTA 3UYKA 1FSFA 4YBRA 1FNBA 3N8IA 2XECA 3KQYA 3AK4A 1JHQA 3HN6A 3HB7A 4HXFB 3JRXA 5FYQA 2NU9A 4ES6A 1THTA 2WTEA 2UYHA 1AKQA 1R64A 4GOMD 4LXQA 3UFXA 4GXTA 3AESA 4D9MA 5KNDH 5DBGA 1FZQA 2WJIA 3AUJB 1RDFA 2B37A 2K7ZA 1Y3DE 3FB4A 1K2WA 4QLBA 5JS2A 4O2AB 3GLIA 2WSMA 4NSNA 1UQTA 4BUCA 3CCFA 2WABA 4UTPA 1ZNZA 3QOFA 2D62A 4M3NA 3ESDA 3WYGA 3K4HA 1FW8A 4LIPD 1B6GA 1D6JA 2ZI7A 3WHPA 2N9UA 2LE0A 1RXEA 2GPJA 1F2DA 1DO8A 3B1XA 4EPRA 1WW2A 1BE6A 2W6MA 3QENA 4HLUC 1N2SA 3EPPA 4Q3BA 4EJFA 1ZH8A 2XUHA 5AK5A 1PTJA 4ACBA 1OX5A 5LMCA 1V3TA 1WD5A 4R2IA 3NIFB 1A5BB 1BWRA 1H8HA 2ZBGA 4LRSB 2ZIEA 3TE7A 5J2UF 3RSOA 1CR1A 1AO0A 4ENSA 4F93B 3D2LA 2GPAA 1ZEMA 3GXOA 5DBOA 3VR4H 2XBLA 2IYWA 5EUMA 1YB7A 3VR5H 1QFSA 5J3JA 3LW8A 2C98A 1VE7A 3CVOA 3FWPA 3OBBA 3PFCA 3AIIA 3AR3A 1I5OA 5CB6A 2ZE6A 1T0HB 3BC1A 4GI7A 4A10A 4QJ5A 3TZLA 2NZJA 4V24A 3UFXB 4M0EA 1IAVA 2DHEA 1N2CE 3U44A 5CW2A 4R8VA 2CEAA 3FPFA 2J5BA 5CD9A 4IUBS 5L95A 2IHKA 2DBRA 5PGMA 3G2HA 2X5NA 2VH1A 3GLIB 1GCIA 3CE9A 4YMUA 4KGXA 4EGQA 1OI2A 1X1EA 3KZMA 1G8SA 3ZWQA 3WOVA 3NWJA 3V00A 4B2LA 1QQAA 1ZXXA 3MSXA 1PEKE 5H68A 5HYVA 5M3BA 1SXJD 3H6GA 2P1DA 1UH5A 3RVKA 2IVFA 3C6KA 1F4LA 1T0PA 4ROSA 3CFYA 5ALUA 3JRWA 1YTLA 3PGA1 2G0TA 3HZOA 5CNMA 5JI2E 1WZIA 2CWWA 3FIUA 1Q7RA 2GDJA 3EY9A 4LTMA 4NZ9A 4ZO7A 1M76A 4PIMA 3RTAA 4AWBA 5F1KA 2Y2UA 4UQLA 2KBEA 2MSDB 3W8FA 1ID1A 1PZFA 1L8XA 4TMYA 1NQVA 2C4KA 3KXDA 2QZ9A 3I32A 4LYYA 1W4LA 5BVHA 1FFSA 5JMWA 4PYLA 2IYRA 4RK5A 1A9OA 1I7SB 3C43A 1E7RA 5DT9A 3W5AA 2X15A 2RI6A 3AJEA 1SWVA 3IP9A 1E7WA 3H6HA 1JXAA 1C8BA 3PBKA 4L95C 3UH1A 3W5HA 1RMQA 4F21A 1BDIA 1UODA 3W8RA 5F77A 3IR7A 3Q15C 3UHPA 2LTAA 3PQ4A 4ZT6A 3AOEA 3U44B 4Y2HA 1TK2A 2OUIA 4FD3A 1PL0A 1N6LA 1YQWA 4OQQA 3TDKA 3L7OA 1GM5A 3W6ZA 1PJQA 1ECBA 3DDOA 3BTSA 3OA0A 4FFPA 4NDNE 4JI5B 1HEUA 4O8CA 2B3TA 4U7DA 3KT0A 3L02A 1UBCA 1BO6A 1NYLA 3HYLA 3K72B 2E1RA 1LCIA 3RC2A 4ITVA 1GV1A 3HKDB 1A95A 3AI1A 3OZSA 6AT1A 2A0XA 5ITZA 1OJLA 4EF6A 4WXEA 3JPWA 1YQQA 3P9PA 3IT3A 3RIXA 1U8UA 2C2MA 1WCIB 2EF0A 1SOVA 4MQFA 3UQYS 3LT5A 2AI2A 3H9GA 3OEYA 2ENWA 2GF2A 2P2NA 2PLRA 4UD2A 3PXEA 3ROZA 1Z4IA 1DCFA 4B75A 1YZQA 3ZZUA 5EHZA 1ZWLA 2C7OA 3WRVA 3TOVA 3NBYC 5IANA 1AUVA 1ZIOA 2R6DA 2B8WA 3C14C 4Y0NA 4ZP1A 3W8DA 1QORA 3QQ5A 3KR9A 2KYRA 4S3MA 5FOVA 4TKUA 2RCYA 4C6TB 4MYCA 1AMNA 3U7EB 4IQ8A 2VSQA 1HYQA 2ZYAA 3P32A 3ANXA 4HG2A 1JEYA 3FNBA 4WTOA 2F6RA 5FO1A 5ED0A 1GKUB 3PR3A 4R9UC 3F0TA 3W9UA 1E1RD 3M1IA 4F3CA 5BR7A 3LYHA 1CIJA 1JI0A 1IQ0A 3EXFA 4GOLD 4YGYA 2NAPA 2QU7A 3W7AA 3AM4A 1U0NA 1XF1A 4JU9A 1DLIA 2VHZA 3E3LA 3C7AA 3WK6A 3IUBA 3VYSB 4O1IA 3T4EA 3KC2A 1JRLA 3OTWA 1JBKA 2V55B 5IBPA 1I3LA 1RPZA 2HREA 2GEJA 5I8ZA 3ZWPA 1ODIA 3V1TC 1X86B 4LXGA 3BQ9A 1E77A 4BEWA 1A9YA 1ENZA 4KIUA 1TZJA 3RV3A 5FR2A 4NG5A 4UATA 3GJ6A 3ONEA 2M6KA 3F2IA 3FOCA 4EMBA 2JLRA 1NBWB 5TSDA 5E6RA 4J90A 2ZG6A 4IH4A 4FIDA 4BMCA 2IEIA 5AKEA 4P92A 1YOVA 2Z9CA 2ZWIA 3T6KA 4PO3X 2XD9A 1XZCA 3DO5A 3GJZA 3MIIA 1EJBA 4L4SA 5IM4A 3TLGB 3PC2A 2GBFA 2RKBA 6REQA 4QUKA 4CZ2A 5DK6A 1EX9A 1NR7A 1Y6FA 5DYIA 4HB4A 2E18A 3BEOA 3LC0A 3GEGA 4YGXB 2ZDGA 4MQ5A 4UXJA 4AP9A 1B43A 1AS3A 2PBRA 2PL3A 5B36A 1TUGA 4OREX 3B2NA 3ILHA 3AEQB 2V3CC 2GJKA 5BWMA 5FPTA 1PG5A 2DUNA 1KEUA 1YR2A 5GONF 3U60B 2JCXA 4PCVA 2H31A 4L7QA 2B20A 3WG9A 4D7AA 4G0WA 1QIGA 1TAHA 3AF3A 3QV1A 3S8YA 1CUVA 1JAXA 1IHUA 2WNHA 1SNYA 2ZCVA 2ZRGA 4EYSA 1SY7A 3TRJA 4RXTA 1JPJA 2AFIE 1XCJA 5DE3A 4YPOA 1QV7A 1U7HA 1MKYA 1XDGA 1HDCA 1N2ZA 2V7PA 3X2FA 2ZZKA 4R9SA 4R2JA 4TLAA 1B42A 2LZ0A 1XK6A 2IE8A 3IB6A 3MS7A 4OBXA 2AN3A 4QUBA 5L7YA 4HB3A 3T7SA 4B0OA 1OBHA 5D3KA 4YJFB 5IJAA 1T9GR 2W42A 2Y92A 1DKRA 2CJWA 3AZOA 1OXTA 4FR2A 5JD3A 4ER3A 4YBZA 3ZQKA 2XYVA 2C5EA 1UBJS 2JFHA 3AG5A 3ESRA 3MJCA 3OJLA 6REQB 1DFHA 3E35A 1PNTA 4P93A 3HUTA 1XMXA 3IKVA 3ROGA 3L06A 3IAS1 2EJVA 2D8AA 2O3QA 2WMYA 3HUDA 1XN1A 4NFYA 3S4YA 4HDNB 2RKWA 4B48A 4OQMA 4I1VA 1QX3A 2MIIA 4RKWA 4TXHA 3VOTA 1DB3A 3GNLA 2FW0A 4K9MA 3L92A 2R7LA 2QJFA 3HVIA 3L4SO 1TO6A 1SU4A 3B9PA 4MB2A 4S2EA 1NTOA 2QL7A 2ZE8A 4HI0E 4TKLA 3SOZA 4JJAA 5K4HA 1DAFA 2ABWA 1RQLA 2TYSB 2RONA 4ND4A 2PUBA 1SBNE 1MFPA 3FY4A 2XT0A 4BNFA 2ZWPA 3GVIA 1K0UA 1O54A 1PWEA 2Q9AA 3GJ4A 3P4UA 3BRSA 1S89A 2XVMA 4RKRA 1I1QB 1FTQA 1NIJA 1G19A 2J9ZB 3P9RA 2O6HA 3QLUC 4PX5A 4R83A 2HBZA 1Y7IA 3EGVA 3GLKA 5CW1A 3N39C 5E0OA 1O9BA 1ESMA 5C4GB 4DGQA 4URXR 4EFNA 1HE2A 2VSFA 4M0CA 3PEWA 4U63A 4KQXA 3AFOA 2B30A 1G3IA 1H2FA 5H5JA 3WFIA 4CM5A 5H82A 3HDGA 4DG8A 4I08A 4EQZA 4W7IA 3UIEA 1GCAA 1U3FA 1P6UA 4KG7A 1ZGGA 2OD7A 1KETA 3WIEA 3EWNA 3SXUB 5EJ7A 4RTNA 1RXUA 4MJ3A 1IXKA 1SG0A 2PUCA 1V9LA 4ZAXA 3W9YA 1GZHB 2FPWA 4BB5A 1SXGA 3GGCA 1II8B 4L5YA 5AVWA 2WHPB 2W0MA 3FYDA 1UOEA 1R1DA 4O4IA 5A71A 3V34A 4QYTA 1CR0A 2PRSA 3RC7A 4MVXA 1MU0A 4HVLA 4ZV7A 4TL8A 4RANA 4TQAA 1X1SA 2AB0A 2UYQA 2J3MA 4GYJA 1FPMA 1BXGB 4Q19A 5EERA 3LIPA 2HMVA 2P9EA 3NIDB 3TMYA 1K8QA 2R6CA 2HA7A 1KDOA 5IEJA 4URWR 2IQIA 4YDHB 3I37X 1FS4A 2MINB 3G8CA 1F1JA 2V74B 3HB5X 3I9OA 3TSAA 3VSCA 5C52B 3I9V1 3R3HA 3H7AA 1W0JD 1XA0A 2JNWA 3V7NA 5JPDA 5ALZA 4EK9A 2DGDA 3DE1X 5HK9A 1DLJA 4OFBA 3U4QA 4TYYA 3AEUB 2QRKA 3HO8A 5EMJA 2R11A 2C9CA 4G89A 1GARA 3OO1A 4FEYA 1W36D 5CEFA 3F3SA 3VX4A 3TSCA 5LQNA 1TC2A 3F90A 3K1ZA 5JDIA 4XJVA 3KSBC 3TNLA 2Y68A 1ABFA 4EDHA 4C7OA 4MW1A 2FJ0A 2JJYA 4GMXA 3W9BA 2HL6A 5GGXA 3NCTA 1CR4A 4ADSG 4LF8B 3ZCPA 2FJPA 3A1NA 5BYAA 4MW9A 3LF1A 2ZWMA 3UWSA 1D4AA 1Q21A 1SKUA 2H1HA 2QX7A 3TUIC 1PJCA 221PA 2X8BA 3T38A 5COBA 4X3CA 3KLBA 3N05A 3E27A 4O4IB 4OHPA 3VYVA 5ALOA 2QRHA 2R7AA 3HI6A 3PNYA 3NAGA 4NAUA 3SOPA 2OKGA 3SS8A 4A8HA 1CB0A 2R1VA 3AB7A 5GTDA 4DR1B 3LYLA 3BWYA 2IRWA 1DJMA 2AK2A 5AT1A 2XUZA 3AOEC 3JPYA 4DJEC 1CUYA 4BNIA 1ZVVA 3PPYA 4OF4A 2WYHA 1DIGA 3JSXA 3ZV3A 3M82A 2GEKA 1CZOA 4NBUA 1P39A 3V8BA 2ZYVX 3ILXA 1E1CA 1FS6A 1OU4A 1EFAA 2VAXA 4OA5A 5LUAA 4MB0A 2Q07A 4DA9A 3JQ7A 4LMRA 1A0OA 5KTKA 1XZMA 1NVVQ 2HBRA 2ZUUA 4BLVA 1O0CA 2LPMA 1LDYA 3Q41A 3IS3A 1T4MA 1VGVA 3QPBA 4L5JA 1FU4A 4AJ2A 1DX6A 4QG7A 4S35A 1WTAA 4M99A 5AVUA 1BS1A 3OT4A 1YBAA 2WYIA 4PE5B 1CS4C 4Q4JA 2F4NA 1KYQA 1DADA 2JIBA 2W98A 3O2SB 2QTMA 3QVLA 4YT5A 4PCLA 3E7WA 4ZGBA 3PXCX 1UZLA 4B40A 4FEGA 2HRZA 2IUFA 1XMQB 1H93A 5TPZD 2XBUA 1NWHA 2C2ZA 2JIRA 5BSRA 5KPDA 2VWQA 3PFNA 2R1VB 4IIUA 4TT3D 4JVLA 1O4VA 2QSJA 4X1YA 1VHLA 2J6IA 3WXMA 5GZ6A 3EIEA 2KB0A 1O6ZA 3UNXA 3CR3C 1GZ5A 3JZAA 4EZBA 2CZQA 3E3OA 1JLLA 4JBNA 3OP4A 4TTJA 1JR3A 1QBKC 3CGGA 4C14A 3ZWNA 5CHEA 3GV0A 2RKOA 2NU8B 5DFAA 2Y0BA 4ZFNA 3MMSA 1E1CB 1R0SA 4FZJA 1DTWA 1I2MA 4ZMBA 4PYOA 3PEEA 3QHAA 3A1UA 4AJKA 2FCRA 3E9CA 3A25A 1IXRC 4E12A 1NT2A 3TM4A 1QB8A 2FW1A 2YS6A 1HKHA 1NUSA 1VRVA 4A6XA 2XAUA 4A9AA 1G63A 4C43A 4YRJA 3H8SA 3D3WB 2VKQA 4LCJA 4ZQGA 1ZG3A 4OHWA 2X22A 1SQGA 3HYSA 2IUUA 2NO0A 3I30X 4O3FA 4MRAA 2AFHE 5DI9A 4GL2A 1KEZA 2C88A 2P0YA 3OP1A 2KWIA 3GFOA 1MO5A 3OQ1A 4P7GA 3BGVA 8MHTA 1EFUA 3RB8A 2H2FA 5M29A 2BDEA 2HKIA 1EUDB 4OOFA 3VBEA 1V2GA 2HSJA 3K73O 3NBKA 1E8MA 5B58T 1A50B 1E63A 3AM5A 4KLRA 3PWZA 3LQ4A 4KMSA 1BS9A 1RYEA 1CPYA 3BWDD 4R84A 1L6IA 2WHXA 4K6MA 1X80B 4QOGA 4X1YB 3VR0A 4YMVA 4J03A 2I6SA 1DOAA 3LOQA 2V7TA 4XGIA 1J2YA 1JLLB 3A6FA 5JXGA 2V8OA 3HUFA 1T0UA 1JH8A 2L2QA 1JS1X 3TLMA 3F47A 1U8AA 4LAFA 1IDN1 1PO7A 4YLYA 4UTXA 3FKQA 1OPRA 2Y1FA 3GT7A 3SVTA 4RTRA 1EX6A 2PNJA 1B1CA 3DT6A 3ET4A 1JU3A 2ZBQA 3AZQA 2BTOA 4UCFA 1H1LB 1X7DA 4A91A 4JV5B 4ZTUB 2VUTA 5AVQA 1XXHA 1L8QA 3IT0A 2BBTA 5HIMA 1VBKA 3V1KA 1Q95A 4Y2TA 1ODCA 3CF4A 2P3OA 1VJRA 1F1BA 1TB4A 2HA6A 5LXTA 1HR0B 1EVLA 1NX6A 1A9SA 4WERA 3Q5GA 3QEJA 2AN4A 6ABPA 3A1VA 1AOXA 1KERA 4DB4A 5LYJA 2O05A 1YHZA 2OK8A 2EWMA 4LYGA 1F6WA 1Z7YA 2O2IA 2XCLA 4XI9A 3EGDA 3LO8A 2J4FA 4XGKA 3P2KA 3E5HA 4LJRA 5JFGA 8GPBA 2Q4BA 5DTRA 2CL0X 2BM1A 3OFJA 1D2RA 1SBQA 3F8SA 4BFZA 2HHCA 3RV4A 3ADOA 2PT6A 2QRQA 4L0CA 3OD5A 1YR7A 3UCFA 1VIYA 2CJPA 4BQNA 1XWFA 3FRJA 3KSZO 3LKBA 4ZEVA 1DV1A 5KWJA 3SLRA 3A6PC 1YUNA 1V41E 4KZKA 2BSAA 4C6RA 5BN3B 4ZYLA 1K98A 1A71A 2OTCA 3UO8B 3R9IA 3NO4A 2ZB4A 3LW7A 4UM7A 2VBGA 2RH5A 1D03A 4FYVA 4UUPA 4RSRA 5KYUA 1SD5A 1KGSA 3FXAA 3GA5A 4I5GA 2AEJA 1FCJA 4HGRA 3QXHA 1E6KA 1U8ZA 2KPOA 3EXHC 3N7TA 2Q7OE 4FHEA 4HEA6 5ALJA 3GAAA 1I9GA 3ODGA 2VDLB 4BYGA 3D8BA 1B0ZA 1QIKA 5LXTB 3DCJA 4PYJA 1RWPA 1CY2A 4HH0A 3HKBA 4IQGA 4JA0A 4MRMA 5LD2B 1QO0D 1M1YA 1E1MA 2P6NA 2QUKA 2VNKA 1XQVA 2A86A 4IL5A 3EGDB 1QP8A 3OJEA 4LECA 5CTJA 5FOWA 4BX2A 5IARA 2GSWA 4BO6A 5A2QA 3QX8A 4BIIA 1QIEA 5AOVA 4UFPA 1FYFA 1G5IA 1FMFA 4D43A 1XOIA 3SHFA 3QXGA 4RFSA 4CR8A 3OT5A 5HM6A 4YEDA 3IEIA 1ZVMA 4P3OA 1UK8A 5JHGB 1G6Q1 1T36B 2EKDA 1YQDA 1VMIA 1PQWA 4MB6A 3HL4A 2WR8A 1CU1A 4MZDA 4NZPA 1GR1A 3L0PA 2NM0A 3RSGA 3TGPA 2O8NA 3GGOA 1U5BA 4OP1A 2JH3A 1LVGA 4JLKA 4ZDIA 3C4QA 4D5EA 1ILWA 3GEDA 3N0XA 1K3TA 1T5DX 4KACA 3PC8C 3CG0A 4M9SA 3TRHA 1L9KA 3LTNC 1U7TA 1FRNA 3DR5A 3WGUA 2DERA 1MCZA 1CFJA 2X13A 1FP7A 4NU6A 4AMGA 1QO7A 1ENPA 3ZTTA 3UJNA 4RVUA 4UEOA 2AYYA 3WI7A 2YR0A 3PT5A 3EG9A 1N7JA 2Y1LA 4UU8A 5FAKA 1ZJYA 4XTRA 2RJOA 2WJ4A 2VNSA 1WS6A 3G2JA 3WWZA 5JDIC 2WOJA 2F67A 2XHZA 3B6JA 4F9FA 2BWJA 1TC1A 5I9IA 4KRGA 4A6DA 1LLUA 4U9IS 5GAJA 1A5TA 1MEEA 3HVHA 3PXGA 1YONA 5CITA 3HWSA 1PD0A 1WCYA 3O4HA 4KIGA 2JRLA 4WZAA 4YUWA 2P5YA 4KOEC 3GUZA 3VVMA 3QEMA 4LZLA 4NU0A 2ILTA 5TARA 2BZ1A 2CVHA 2LBPA 1LJLA 1IVYA 3H9UA 4P7BA 1FA9A 1PTKA 1V0JA 4BUZA 4DUGD 2Z2XA 4JXZA 2FMXA 3N58A 3WL8A 4EYGA 4P35A 1S3IA 5DNEA 2F1KA 5BUCA 1JPVA 4L4RA 1IZ7A 3X1XA 2ZSFA 4YO8A 1SK8A 4TYNA 1MRSA 2DPMA 1FPQA 4DF3A 4M0MA 1SOAA 2ZYUX 1XE3A 4C06A 1LLQA 4DJ5X 2ZETA 3SX2A 1A7UA 1DIRA 3I01M 3CBGA 3RC1A 1I3OA 1SOUA 2EQBA 1N6KA 3L7KA 4UBNA 3LA6A 4DYHA 4G1UC 4YRQA 4MAAA 3L6UA 4KE6A 2A1IA 4GNRA 1ZGBA 1RWOA 4COKA 1E99A 1XVIA 4YCBA 5CXXA 3OU6A 5COAA 3AY0A 3A2KA 1SBTA 4KBFA 3TR5A 4ZCTA 4LRWA 5CDFA 1QTRA 1QDLB 1J6UA 4PR0A 1Q2UA 1NFFA 1PZEA 2YUIA 1YB5A 3LXUX 4QQFA 3VTKA 4QIHA 2ZAIA 3QRWA 1OBFO 4JI2B 5JJKA 2ZZMA 3OY7A 1UXIA 4HF7A 4KQEA 4L5CA 1PX0A 3VBCA 3AVUA 1I10A 1I4LD 1R8JA 4ZMRA 1ADJA 3AETA 4OBEA 4RVSA 1PE0A 1J2RA 4Y6GB 1Z0JA 3IR6A 4NOKA 3ZBPA 3X2EA 4DEXA 3BT7A 4JGBA 3UMSA 3OUZA 2ZS8A 1IOZA 1TVKA 3IMKA 1UQUA 3AF5A 5GVRA 4W6QA 3OM9A 2NZUG 4ND7A 1G8HA 4WKCA 4C0JA 2JI7A 2W2VA 3DZDA 5ULLA 1YUBA 1Y5LA 4FQ8A 3KL4A 4OUDA 5HCNA 4A36A 2NUPA 3DMRA 3EIXA 3AM1A 2ZI9A 1MENA 4QPJC 3TEFA 2OXIA 2O1WA 3NONA 5TQ2B 2P6RA 2Q1SA 4FFBB 3Q11A 3GG2A 4KBYA 1XGKA 5EKDA 1XBTA 3R5TA 1KDRA 1FNDA 1NRJB 3NS7A 1S96A 2VQ6A 4LXIA 4QYWA 1XEWX 3INNA 4ZO8A 3FZNA 3SS7X 3IC5A 5CMLA 1F7UA 3H0CA 2PKWA 5HKAA 1Q7GA 2DPLA 4QNRA 3KUCA 4UU0A 3HI4A 4FGSA 4HH4A 1M5RA 4O4JA 1RRGA 5FTMA 3UA4A 5LR6A 4DUYB 4TS9A 1W94A 1EBUA 2BVNA 3EW7A 3AETB 3M5DA 4F46A 4P33A 3F49S 1P9OA 2OAQ1 3CB4A 3IIEA 5CNKA 5JISA 2QW1A 1E79A 4GBMA 4IILA 1J2EA 1ZI9A 4GKAA 3RRNA 2K87A 5DCWA 5I9BA 2IHUA 4JOQA 4BNVA 4F8YA 5KCZA 4NOMA 1NMZA 2IYTA 2NXEA 2SKEA 3LWZA 4L5BA 5JZOA 3SC2A 3Q3EA 2OE2A 3IGFA 5I51A 3TB4A 1SM4A 3IOMA 5CLFA 1MPTA 3O3CA 3I23A 1OKKD 3LTEA 4RHCA 3DAGA 4DJAA 1I2CA 1RM3A 1Z07A 3RYIB 4E09A 3COJA 4JJ6A 2BIFA 4BTVA 4JSTA 2P2YA 2GJ9A 4RMJA 5REQB 1LS1A 5DH9A 4HAUA 1RE1A 1Z0KA 2D0DA 2EKLA 1RU3A 3BSWA 3L8ZA 5FO0A 2HNKA 1O97D 1SCIA 3WGJA 4KQCA 4CIVA 3CZRA 4N7BA 5TC4A 1PEYA 1JFLA 3HB9A 3NR2A 4RLHA 4UEQA 4Y0AA 2IKSA 7REQA 1K75A 1I9CA 4R9RA 1WQ4A 2O4UX 2OM6A 4Z4HA 5KTNA 1U2GC 4L2IB 3R1IA 3GJYA 5LD2C 2Q3HA 1XNHA 2GT1A 3MWDA 1G1MA 1OXMA 3EMDA 4GLBA 4PLWA 1O96B 5EIHA 2AQ8A 3GCDA 5E2AA 3DZIA 4TTIA 1N4DA 4DAOA 1U3DA 3LP5A 1GY8A 5BOSB 1LQUA 4R2KA 3REGA 2ZKIA 4WGFA 5LPNA 2JHPA 3CH5A 4BAZA 4FGKA 3PWTA 4I8IA 4Q3EA 5TR9A 5JS7A 2PMWB 2I5PO 3WGVA 4D42A 1KZGB 2GBLC 5F5NA 3ABIA 4DZRA 1ZM3A 4YUAA 2YNMC 2VTBA 4ATNA 1UK9A 4G8DA 4O4IF 1VE6A 3LHKA 4HBGA 4KU4A 4LZOA 1N0UA 4PZDA 3W8NA 5C1OA 2UXDB 3U9SA 3Q85A 2FLWA 1P75A 3D6AA 2GOYA 3HU3A 2LW7A 3PVCA 5CVJA 3ZHQA 5CBPA 1JQAA 1UINA 3Q8MA 3KOWA 2FK8A 5DIFA 5JC8A 3CVWA 4OIMA 5D6OA 4CCWA 1AN0A 4BVGA 5JROA 1ZH0A 4JT9A 2NNLD 3O5AA 2AR7A 2YFKA 2VP6A 5EMMA 4I66A 1L8OA 3ULKA 3FFBA 1EXNA 3BHNA 1Y5NA 3EFEA 1DQRA 1P2GA 1ANKA 2CXPA 4LWPA 5THKA 1AH2A 5C4IA 4D81A 2O5RA 4PX9A 4NMLA 1NW6A 1QLJA 5CNIA 1DAMA 2P9HA 3RADC 1UPAA 2HTFA 3HKEA 4WLEA 1ST3A 2ZJ7A 1ZVQA 5K8JB 4UJ3A 1LY1A 4DANA 1NNEA 3ZPXA 3UJCA 1UBMS 3GGDA 4Z1MD 1LNZA 3IT2A 3HE3A 4TSRA 1SEVA 2V6FA 5A62A 2X9VA 3CLRD 1KMIY 1ZX1A 5EE9A 1ZL2A 3K4PA 2FB9A 2NZ8A 1YSCA 4JHXA 3O74A 4QWWA 1XKLA 1U0JA 5F1OA 2ZJFA 3CZ4A 3FF4A 3G7NA 1V8ZA 2R65A 3PRJA 4RHYA 4B5KA 1IHDA 4BFXA 4WVLA 5KQPA 2FTKE 1KJJA 3IAAA 1KVQA 1UEXC 5CJ2A 3E22A 4R7ZA 3BZWA 3A9TA 2FP4A 3MEQA 4KQHA 4V0RA 1G17A 1FQJA 3RUCA 5HWSA 2JFNA 4ABTA 1DWUA 2REQA 3HO6A 5K8LA 5C37A 4W5OA 1BCRA 4IIVA 1XLUA 3QV2A 5DJ5A 2P8SA 2WA2A 4LXXA 1TECE 4TMXA 5KTRA 1TU4A 2ORWA 2R6HA 2I2XB 3GFPA 1TM2A 3H87A 5FF9A 3T9CA 3UJDA 1NVWQ 3X1KA 2VDWB 4CKCB 1E2GA 3M5PA 1RYNA 2EQAA 3AR7A 4TRMA 1KAOA 2QW8A 1SCBA 1ZL0A 1CEQA 1NHGA 1RQPA 1QF6A 2G5GX 5H1YA 4C7MA 4MVJM 2IEYA 3VI3B 3FYCA 1LXCA 4XFKA 2H17A 1K8RA 3HR4A 3BJZA 1JDUA 2GWHA 2HRCA 2R00C 3DC2A 3IX7A 5EWMB 3KZ1E 1IQPA 4Q9IA 1ZMXA 3GF4A 1F5NA 4NU8X 4ZV9A 4P98A 1KH3A 1J7JA 5ALSA 4C6HA 1KHHA 3WJ7A 2C9BA 4XSVA 1E69A 3BJRA 3KCQA 1DBQA 1YFZA 2C59A 3BZUA 3SF0A 1K6MA 1U2EA 2HV9A 4MVCA 4RNCA 4EFDA 1GNLA 1T5TA 1FQOA 3CZCA 4FB4A 2IYUA 5EZYB 3ZTYA 1UBNA 2FP4B 4EGFA 1GDTA 2WJVA 1X1CA 1GUFA 2DCMA 1SZJG 2REQB 2BE9A 4MS3B 3IHWA 2Q1WA 3TEJA 3AHIA 2IVZA 2YDXA 1XTUA 4N5DA 3JYQA 5H02A 2VA8A 4TKMA 1JFFA 1JEOA 1RQRA 4RO0A 4X1IA 4XCVA 4BWYA 1IFXA 5AM0A 1LBEA 5A3QA 1XVTA 1G20E 5EKUA 3NVKI 3DAOA 2Z9DA 3OLQA 4EJSB 4XWWA 4GGOA 3O0DA 1PYGA 3OQBA 1U8XX 2O1SA 5B6PA 2HO4A 2SBTA 4PC1A 3IH5A 1R74A 4P7FA 1IE3A 2IZ0A 4WZBB 1J22A 4ZCPA 1U2DA 3QNWA 2ISSD 1OB2A 3N3AC 2Y4OA 1XKTA 4HRXA 4L8LA 1L3IA 1J56A 2VAMA 3LUGA 4C0QC 2IELA 4POAA 3E18A 3DEHA 3U40A 1YF3A 2ZUCA 2QG4A 3K32A 2A1TS 4UBJA 1Z26A 4CN9A 5FIUA 2A7XA 3LP6A 4RC9A 4GM0A 2YJNA 1KZYC 1HLFA 4UHFA 1ZM7A 2NXCA 4HWGA 3SJUA 4RDHA 4M87A 3SHQA 2I91A 1UXGA 1HZZA 4FYMA 3RG2A 1ORIA 3CSSA 3PJRA 4CQNA 1KYYA 5D86A 1PR2A 3F78A 1TA0A 3HDJA 2WOOA 1SXIA 4JR1A 2YHAA 3ZZNA 2FRVA 1ULHA 2H07A 1AB6A 1G5TA 1ZZGA 2GPSA 4IG4A 2IS4A 4PRZA 3D3KA 3L0SA 1JHDA 1M34B 1B0UA 4PLVA 3FWHA 3U9TA 4KI0A 1MFZA 2C8VA 2QK4A 2DX7A 1R16A 1RBQA 1ZOOA 2YWDA 3BTUA 3PE4A 4M8KA 4L1KA 5CG1A 1YE5A 3E82A 1MXHA 4G0ZA 3H7IA 4NJMA 3SYNA 4NV3A 3CVYA 1UWVA 2P6UA 2WU3A 3EFOA 1PZHA 1XVVA 5LXTF 3KZCA 2EJBA 2JHCA 4NQZA 3ZVRA 1KA9H 4B0PA 2GBIA 3JZIA 1XJWA 4ETMA 5JSHA 2F3PA 2ZRNA 3GYBA 3QBVA 3OM0A 5DWDA 3RIHA 3LT0A 5LYJF 2C2OA 2C84A 1OV4A 4H6XA 4FGWA 1E5DA 5THQA 3JAWA 4A82A 5MN4A 4BWGA 3KJNA 4NBLA 2GNPA 4PM4A 1NVBA 3AR2A 2Y3IA 3S0JA 4AIRA 1Q6ZA 1QYXA 4LNHA 1T9CA 1Z4QA 2I54A 2X2OA 3GUUA 4EG8A 2CBXA 4AO8A 5C8DA 3I01A 3Q2IA 4U0JA 3IVRA 3OH8A 1QVAA 3NTXA 3AUTA 1TM1E 3G1UA 3D0KA 4CDGA 2IEZA 4JN6B 1XMOB 1U0HC 1E5QA 3GOHA 4F97A 2WHEA 1TQ6A 1HE3A 2Q0XA 2GILA 3HY4A 4OXIA 5AHOA 3JQDA 1AKNA 4A4DA 2AGVA 4K28A 4RTQA 2PGJA 1TKBA 1PYDA 4XIIA 1H0HA 2OYCA 4E7OA 3M1AA 1YZHA 1KFEB 3TOSA 4LMPA 2VAWA 2CV2A 4P4SA 1CDZA 1QS0A 2BFAA 4X44A 3LGSA 5KBYA 3GGPA 3ER8A 1U28A 5FUXA 4NV0A 1PCXA 4PGAA 1FUEA 3HPQA 2Q6OA 2HPZA 3MWJA 3BRWD 1SIBE 4BKRA 1Z29A 4OJTA 3KQUA 2X4IA 1ZUNA 2WVGA 1BA3A 1DKLA 1H3NA 1OAAA 2WJYA 3EPJA 2UVQA 4FN5A 1ORRA 3PV0A 3A58B 3SHWA 2ONZA 2JK0A 4ZZ0A 1IY2A 5AVSA 3FUVA 2B99A 5D6NA 3OG9A 1OMOA 4WWHA 1RPTA 2AOTB 2B21A 2E4VA 2WG2A 4DSOA 5A4IS 4DB2A 2B3DA 3S2FA 4NATA 1Y8CA 1MZVA 3ZW8A 2YXDA 4BN0A 3HK2A 1ZNXA 1MX9A 4UNRA 3R20A 1J23A 1ZUIA 5K3AA 2R7MA 1PT7A 3NALA 3PNBA 3R76A 3NTLA 3ANTA 3AI3A 2GZSA 2XEXA 1UPXA 1CZRA 1HA3A 2CKDA 2X8JB 2WE8A 3O8DA 3RRXA 4KNWA 3II6X 5JBNA 3BB4A 4JP2A 3W9SA 3R6DA 4OY3A 1JR2A 3IBYA 2I3ZA 3KZXA 2C94A 3DO8A 3TX2A 3VNSA 2Y9PB 1CZHA 4EBBA 3D4LA 3I3OA 3WK9A 3T1NA 3O83A 4WCVA 3ZUPA 3UJ8A 4OLJA 2DETA 1YVPA 3RNLA 5CLLA 2CD7A 3TVYA 1LSOA 4BDTA 5IT0A 2PHZA 2IXBA 5DCUA 1I8TA 2Q5LA 4J7UA 1H1DA 3V46A 1UBKS 3ETHA 1PFGA 2D5AA 3DTVA 3Q1LA 4LCEA 4C4ZA 5GJWC 2BTQB 3T1TA 1R3UA 1W2GA 2FRDA 4XKJA 4ZCQA 3B1FA 4RPIA 3U17A 1IZYA 1TW2A 1OI3A 1GZ7A 2FPUA 4CT0A 2QF7A 4KXXA 2J1LA 2Z95A 2FW8A 3T3IA 4RTLA 4I5FA 3OQHA 4HNAA 2IITA 3UJ3X 1F6BA 4B80A 1JSCA 4K6KA 1HDXA 4U2DA 1PVOA 2DFPA 3PGVA 3JR7A 5A6VA 4IZ6A 4C21A 3CBQA 5DI3B 1N6NA 2IYNA 1CJBA 4R1OA 3IEPA 2FPGA 1P5HA 3TLYA 1WP4A 4D4MA 2WFMA 1W6RA 4Q9DA 4WN9A 2DFTA 3V4SA 4BO2A 1EVYA 2GX6A 4DVGA 2C3UA 5LQRA 2GYUA 5EJ6A 2HK6A 1PNRA 2ZSKA 2XCIA 3NHUA 1UBSB 3KWMA 4MI3A 3WXBA 1KP2A 2AG0A 2CFOA 4FE3A 4Q9KA 1WUHS 3L7LA 4J0KA 3SFZA 4BNXA 3WBBA 1H4QA 4XDHA 1F8XA 1TPZA 5HUHA 1IB6A 4EJSC 5JSZA 3NTOA 3PPIA 2VH5R 3T12A 1ABEA 5HQ3B 2A0FA 5EEGA 4PC2A 2C97A 3W1VA 3PPVA 2QTHA 4PAQA 4GFDA 3WYEA 4CMGA 3QF7A 1L5QA 5EEHA 2Q0SA 1U9YA 4AN0A 3CY6A 2NG1A 3NM5A 4KUGA 2QRUA 1SIWA 4Z3OA 1M8JA 1G8FA 3KR0A 4OHMA 4X5OA 3RTEA 1TXGA 4TTPA 1YA4A 5B3AA 1XHFA 2W2MA 3UF0A 1O95A 1MV8A 2RBKA 3TIVA 2BGWA 1Q0LA 2NSHA 2J08A 3UC5A 3CUSA 3U4AA 2R6AA 4F5YA 2XB6A 1KO7A 2Z8XA 1V8OA 2YRWA 2YN0A 3C6QA 4IIDA 4KSBA 3LKVA 4YRZA 3VI4B 2AX4A 4AUNA 4EYQA 1V8FA 1JR3E 4G84A 4QAJA 2ZVQX 5IJZA 1SKMA 2D6FA 3COWA 3PRYA 4L3WA 4UM9B 3QW4B 3W6PA 4WSOA 2ORIA 2FPGB 5BV7A 2RMKA 2VF8A 2Z43A 5GP1A 5EIEA 4FI3F 4R2LA 2G4CA 2ZSBA 4DNQA 2WF6A 3OTQA 5HTOA 1CZLA 2E6KA 4XVQA 4BBJA 1MVNA 4N48A 1QZZA 1SVKA 2R6ZA 3P71T 1H8EA 1P2TA 1CY0A 2SICE 4PPGA 1BX1A 1TX4B 3TTYA 5F3WB 2EWVA 3FTFA 5FLKA 1KWKA 5JHHB 4K6FA 3TW4A 1QYCA 2O2XA 3QXJA 4QM7A 5D7NA 1YDFA 1EE1A 3AIKA 3KT3A 5LBTA 3H9EO 4R3NA 1HX7A 4JL5A 4PZZA 1UJCA 3NEPX 3TO5A 1T1SA 1WW3A 3N0VA 5AM2A 5JQWA 1CUIA 3AH8A 5FAXA 3TQTA 4O4JF 3OQVA 4RABA 3EWSA 2J41A 2IIVA 2WSBA 4XPZA 3WGTA 5U4XA 3U16A 2RB5A 2V4MA 2YY6A 1Y4SA 5DYNA 4EPWA 4F9GA 4ZANA 2UVDA 5AUNB 4LHZA 1RP1A 1Y4DE 2X0NA 3GROA 4HDRA 4I1UA 3UT5A 2EEZA 4KWHA 5BO5A 5LZ2A 2ZRLA 1ZJJA 3A32A 3JXEA 4GM4A 4G36A 4Z9BA 3ZGXA 1XJCA 1O94A 5EMKA 4YRMA 1DJNA 3D7SA 5AKGA 2I4MA 3GQBA 4ZYYA 2O8EA 2V65A 1U65A 2JAWA 3FMFA 4MGZR 1TA4A 3HJRA 4YT8A 3DMTA 3I2IA 3OX1A 4IH9A 2VVTA 3UAGA 1NW3A 4QECA 1NG9A 1LSJA 3AX6A 1LWOA 1GGHA 1QGOA 4GI2A 5JZVA 3GRRA 2BPOA 1JVSA 1GA1A 1WXDA 3IODA 3QOWA 3PF9A 4B83A 4QHYA 1AMUA 3CX8A 1XXHE 3OMXA 1CUAA 4KCGA 2UZ1B 5AUOB 1WABA 3AUFA 5U4QA 3VPXA 4EFMA 3CXUA 3R3WA 4Z9XA 5AXAA 3F4BA 2OSVA 4L28A 3WZ2A 1RC0A 3F67A 2QVCA 1SRRA 3AB3A 1W35A 2IPMA 3FVRA 3CLHA 1QVRA 1L7RA 3QWFA 1XJ5A 4V0NA 3R0IA 4YALA 4MVJA 1CQPA 5IKXA 3MZ0A 2OD2A 2H2IA 3PXXA 1NASA 3HS3A 4UEJA 4HUQB 3BKXA 5K0TA 2ACVA 1QK4A 4L4XA 1T4CA 1K7CA 1NSYA 2JLSA 4NTZA 2GPBA 3UT5B 2Z8ZA 3TSWA 1TD9A 3IPRA 2JD0A 1YDHA 4JL8A 1OFGA 1KU0A 4MR9A 4BN5A 3AFMA 3H42B 4H7EA 2EZUA 4WE3A 2J3LA 4XIGS 4D5GA 2R8ZA 1MD9A 4E5SA 4LHXA 3OPXA 2HFKA 1ORWA 3O84A 1KI8A 3KYDB 4NDZA 2L42A 4Z8YA 4HT3B 4MA5A 1XZQA 2PKEA 4MKZA 4WNYA 4B45A 3NTQA 1CHDA 3HMQA 3C3XA 5DCYA 4FDLA 2H1LA 2M1XA 4HRYA 1WZCA 4JP1A 4D98A 2RIRA 2W2TA 1U6IA 1Y1TA 2EKPA 1I3KA 1AHNA 1VIDA 5JWOA 1DO0A 3KBBA 2VHUA 4E94A 1ESCA 4O6VA 2OM2A 2XYHA 4Y2UA 3RQSA 3SSAA 4RCZA 1LZLA 1G4HA 2QT9A 3FYSA 1M1YE 4RSMA 5KSOA 5FL7A 1RTKA 2B5OA 2P40A 4FFNA 5EMHA 5M34A 3EDOA 4JVMA 2YV1A 4XVCA 4RD2A 3U7HB 1DGQA 4KQIA 2Y0EA 3DBHA 5BNIA 4RZSA 3R5XA 1UK7A 3BWVA 2O1EA 4BQSA 4BZXA 1PGNA 3DBVO 3RARA 2KQUA 1VXOA 3L43A 4KGVA 4QYXA 3VH1A 3EYAA 4Y6SA 2O5CA 3W4JA 4XB2A 2P7IA 4Q01A 1NDUA 5ENVA 3SF8B 3DE3X 3KYBA 4YJHA 2QX6A 3CNLA 3DR3A 1JMYA 5DM4A 5KHAA 3B6MA 1YI1A 3DL2A 3RUHA 4I99A 2DUMA 3TZKA 4ZQEA 2QMYA 4FC7A 5KX5A 5ALTA 2X4GA 3IEMA 3WLRA 2PMEA 5KIAA 3JD1A 1YRYE 5D85A 4E2WA 4G8JA 2QQ5A 3OPYA 2XV1A 1XCOA 1I2ZA 1UDWA 1G41A 3EZNA 3EUAA 3AVYA 3ML1A 5KYTA 5E7IA 3IOBA 4GXNA 4MRNA 1IZ0A 1J9ZA 3PUKA 2A1TR 2C0PA 4PIPA 5KTOA 1HOXA 3EPRA 2OO5C 3HCWA 1U02A 1P7PA 3MB5A 1OYOA 3D2CA 3G7UA 5JO0A 1VSUA 4DCGA 5HP4A 1OIWA 3PNPA 2CV0A 1M6WA 3DF9A 4CF3A 2Q7XA 1JKJB 2BKEA 4UUOA 1I4TD 1IUPA 1GU1A 4WZAE 3DNPA 4HH3C 5YASA 4ZVNA 1PK7A 4Q5IA 3K5IA 4TUYA 4ALKA 5F33A 1E3LA 2RARA 3EZFA 1S2IA 3FX2A 2HI0A 5EKTA 2PLFA 5DGIA 1GILA 3S40A 1C8VB 1V43A 4J94A 1E9DA 1K7SN 2XCUA 4YJHB 4CDRA 1TUEA 1KQFA 2G82A 4AMBA 2WKRA 3TW8A 4Y9RA 2O8DB 4WKOA 2WUEA 3FF1A 3E5NA 1QGED 2JIZD 3QX7A 5KX5B 3WLIA 4Y2YA 1DRKA 2AJTA 3OPYI 2CNBA 2ZUVA 4J75A 3U3RA 1LPNA 1TUBA 4M21A 3MQ2A 3UPDA 4DLSA 1GA6A 2CK3A 1T5LA 1P1HA 1V8PA 1KBZA 1ATIA 1MF7A 2LV8A 1PQYA 1T5BA 2I87A 3HNRA 2HD4A 1RWMA 1VLLA 4IDNA 2BMFA 4KQMA 4LQLA 2NXNA 4UXHA 4A73A 1NN3A 2SCUB 3K20A 3PFBA 4JBIA 4DIEA 4E5YA 3LNCA 4BVBA 2WYUA 4D80A 2B6HA 2Q1TA 2ZANA 5CDFE 5JPCA 3J7AC 4QA9A 3IELA 1KY2A 3IMFA 4M1QA 1M1NB 1BE1A 2CL7X 1YBHA 5AW2A 2W43A 4DSTA 4OM7A 1O9HA 4DQ0A 5AJTA 4K03A 5TMBA 1QRUA 3V4VB 4B1FA 5C7IO 1LBTA 2QAJA 5AVKA 2W7TA 1N2IA 5LMUB 4M7PA 2JFYA 4JLDA 4O5OA 2LD4A 2P67A 4QAQA 2XGMA 5HKKA 4H7KA 4GQBA 5KDLA 4F3RA 3VC7A 5AUPB 5AK6A 2AOXA 1S8NA 3PUZA 3ND9A 4G56A 4LHYA 4N39A 3Q7QA 3DGEC 3DW1X 3H1BA 3RLIA 1KJZA 2NUTA 4GGMX 4JJIA 1O95C 3HP7A 3ZV7A 3ZYCA 1NKSA 5GOTA 4OUKX 3J81A 3A9VA 1SUCA 3UGJA 1QP0A 3I1YA 1U2ZA 5CLIA 3SKYA 1IC6A 3HCRA 1XDBA 5HK8A 1PUIA 1YB1A 3O8QA 1D0SA 3LWDA 4X41A 1XYVA 3H9QA 4MPJA 4MW2A 4PZ0A 4E51A 1L5RA 4IEFB 5BMVA 2ZWVA 3TTSA 1RCUA 4XPIB 3QNMA 1FU7A 1QLHA 2VN8A 1L5HA 5SV2A 1V45E 2Q5JA 5JSFA 4IV0A 2CYBA 1BE8A 3K9GA 3NXSA 3TCXB 2P27A 3IUSA 4Q93A 3BYZA 3A3NA 4DJJA 2E5LB 1ZOLA 2VR1A 4OATA 1CJSA 2JHGA 4HAIA 4PHGA 4DLYA 4R8SA 5FI0B 4IXMA 1OIVA 3PJEA 4B6RA 3D31A 1Z4LA 2PX5A 3ILSA 3O6VA 5C81A 4F3TA 4D3ZA 3T5PA 4H3VA 3WRXA 4HNUA 5KNDA 1TRKA 2C58A 3WYFA 3OTOB 3PIDA 4BZZA 1X87A 1QZ3A 2AYXA 3AO0B 2QNBA 1KNQA 3K4QA 3PEUA 4JBXA 1JZSA 1BN6A 4KVFA 3KU1A 3TWOA 4N0EA 3O03A 1QFJA 4QEZA 1FXUA 5M7EA 1YUMA 1MVOA 1W30A 3EK2A 5CA0A 4FHGA 2OCAA 4KMRA 4CR7A 3TAXA 3EVZA 4EB8A 5GINE 1JKXA 2ZQZA 3HFRA 3OLXA 4YT2A 4NCKA 3RKSA 2DSNA 4NRDA 4ZJYA 4F3KA 1NR1A 3QVKA 5I9SA 2OXRA 2VQSA 5D8DA 1C0EA 1E1QD 2H8GA 2HRRA 3JYNA 4H27A 5HQJA 4KQJA 5GWXA 1RZ3A 2ZSUA 4BVJA 1R8QA 2C20A 2OGWA 4GMHA 1M8PA 3KR1A 3BDAA 4GBGA 4PC6A 1YD7A 3VPCA 2OHIA 3WQBA 1C2TA 1K68A 2W6OA 4QBFA 2P62A 5ALDA 1GL7A 1PJAA 3VR4A 4E6EA 3MGCA 1IHOA 3LYUA 1UJ6A 3GRCA 3O93A 1HFEL 1VIMA 2HJRA 5THXA 3UXHA 1XD2A 1PR0A 3SYRA 3PQEA 4FN4A 3NNDA 4UUBA 4MKRA 5JY6A 1PZGA 3TFWA 2VDPB 1PV4A 3KVOA 1D2HA 3GZJA 1EM8A 1XKXA 4XJTA 4ZAYA 5IHPA 5H59A 5A7GA 1OI4A 3IESA 3E9DA 4BCDA 2YJTD 1C1DA 1VIVA 4F2WA 3QBJA 4WV3A 3KQNA 1TTPB 4UARA 1J39A 2O06A 3IQHX 3OQ6A 3WP0A 1R0LA 5AJWA 2Y99A 3T95A 4GW3A 1QXSA 1USKA 3DAPA 5DM70 1DUIA 3TJZA 5L3SB 1GSIA 1E2UA 4FYIA 3UMGA 3ICVA 1CUUA 4D9EA 5BUZA 1LX6A 4FFVA 1A5AB 4CQLA 2GN8A 8ADHA 1NI4A 4NG4A 3JWEA 4XEHA 1J8FA 2P6MA 1YFJA 4QRHA 5B7NA 5DNUA 1ZS9A 1NW9B 4OHKA 3BUSA 1YJQA 2GBCA 4JH0A 3CZQA 1RWBA 3U31A 4K86A 3C3MA 3TCKA 4NY1A 3CO0S 1YRAA 2QROA 1G16A 2DOKA 3AMVA 5EHQA 2YYZA 3A28A 1RABA 2M9MA 4KN8A 2JCGA 3H2KA 3WK8A 3E4CA 3MQ4A 2FK7A 3V6LA 4QTTB 1THGA 3U09A 3UK2A 4DQUA 1KY3A 5GM2A 2PT7A 1HE8B 4RD4A 3QE9Y 5FJJA 4F1WA 1SBZA 2YZKA 5L6LB 5K2OA 4X1KA 1Z6PA 3GLFE 4GLFA 5DV9A 1AMOA 2JLUA 4NL4H 1I7PA 5IG2A 3ZE9A 3ONDA 3D3EA 1Z0ZA 5IH7A 2CCJA 3KSAC 2BR5A 2B7CA 2AE1A 2FG6C 3VNRA 1B8VA 3WE7A 3ZOZA 3HYCA 5I7HA 1KEKA 4F4IA 3GT3A 3JQ8A 2PZAA 4XFDA 3NM4A 3R41A 3INYA 3ITDA 4JLPA 4QUGA 1E2IA 4OU4A 2DBQA 3VSDA 1IU9A 2GEVA 5EJ5A 2XW6A 3ZS9A 4K0KB 5DDIP 3ABQB 3I34X 4XWTA 7MHTA 1VJCA 1SJ9A 4FFWA 5FWAA 3QA9A 3MYRA 4X1OA 3ZJ5A 3S44A 5H9VA 1JFVA 1XAJA 2F43B 1P0QA 2IYXA 2E7ZA 1S2LA 1U9ZA 3BB1A 4RMIA 2GEFA 1SVMA 1W0KA 4I3HA 1OH7A 4W8HA 4F60A 5KYKA 1PHPA 3IHKA 3K9HA 3R5KA 3RHFA 1P8JA 4GG1A 5JSUA 3I61A 5CVCA 1S9DA 3ZLVA 3OAAA 1HSZA 1H65A 1C7IA 5K05A 1AKTA 3C6BA 4NARA 5ALWA 1WMEA 3P2IA 4YHBA 3I5UA 2ODTX 4LJYA 1QONA 3FSGA 3KVRA 2PVCA 4OX9B 3FWKA 1DIHA 1VBNA 4HNQA 4Y18A 2QWXA 3P0HA 1QRSA 4E30A 1CYEA 1L5FA 1RYDA 1QWSA 4OVKA 5CFZA 4V03A 4MPTA 2OL4A 4EMUA 3GPIA 4NBSA 5FB3A 4FNAA 2XR1A 4EI7A 2HK8A 1EE2A 4M1MA 1GYRA 4Q05A 1DHTA 4MQUA 3R7NA 1QC5A 2DBZA 3W2FA 1A96A 1EK0A 4PRYA 5CLHA 5LBIA 3HBAA 5K20A 4RU1A 3JQAA 3PUVA 3VRHA 1N33B 5CJPA 2A14A 2OB1A 3AF2A 3BMQB 4B43A 1JV2B 3EGWA 5KSPA 2XLCA 2AR9A 3BXHA 1DIAA 4BB0A 3IBFA 1DMSA 3GPCA 1T8UA 3BD7A 1A2OA 3BRCA 2VT3A 4MI1A 3BH6A 4IDCA 1B8OA 3QEBZ 1X1TA 3FVQA 2GTIA 5BWCA 3PQ3A 1FYXA 2I78A 2OGTA 4ZC8A 4LHEA 3S6JA 3LL4A 2I9KA 1PJ3A 4E5DA 1E6LA 3TX6A 4B3RB 3ZEAA 2G4LA 3RT9A 2VJLA 1LDBA 3HACA 4OCZA 3RC9A 3DLPX 1T9BA 2FFJA 3SQNA 2EYUA 3ZDEA 1AUPA 1EXMA 3KFVA 1JDBC 1G66A 4DYDA 5K0LA 5C5EA 2O5VA 2HIHA 1JYSA 2R48A 1ONBA 2BH2A 1MNQA 4C5BA 4CVNA 4W1QA 5I8PA 1GG2A 1UUFA 2C9MA 4XYGA 2QRJA 4J0FA 3DQQA 3USCS 4JP8A 1JHZA 4N9QA 3TW0A 1DS6A 3EIUA 1HNXB 2AFVA 1D07A 2YZGA 2QTZA 1QVVA 1VZ2A 1Q44A 1WXWA 2FFRA 3ER6A 1GN8A 4HYQA 4ZAGA 5IAOA 1VYTA 4GPD1 3TAUA 3VU0A 4BHTA 3O4JA 4D46A 2O57A 4M2LA 3WNQA 1F8YA 4XCQA 4C0XA 4EM6A 2CJXA 1CX9B 2B4RO 2EIHA 3G8BA 1P1FA 1YNOA 3IIMA 3ZE1B 1GFIA 3HZRA 2GF9A 1DDIA 2GPWA 4UTOA 2VTEA 3QYFA 3ODPA 4IOKA 3VAYA 3PDWA 3AL3A 3WFZA 1S7CA 2CBZA 3CW2A 1SFRA 5D5PA 1EZ4A 3Q6IA 4W5WA 2G6BA 1WIWA 2ZRIA 1MIHA 4QRDA 5BPFA 1NMXA 1P2BA 4LE0A 1GPKA 1EFPA 3UAVA 1GIAA 2UU9B 5J47A 4N8SA 1ZK0A 3JD4A 3O8RA 1O57A 1C81A 1NR5A 2A9RA 3D2BA 4JLMA 1R4MB 3H5OA 3KTAB 4E32A 5KTTA 4RVFA 1F2TA 3T7KA 2QDXA 3O95A 4FOOA 3OKCA 3KQWA 2GO7A 2G5PA 1JQEA 2CBGA 1XT6A 3OMLA 1FDVA 4JODA 2GZ1A 4MVJF 5EHXA 2HNBA 3FYUA 5JRDS 5KS2A 4X45A 1UFQA 2Z6AA 1TAUA 2QTVB 3WK7A 2EZ8A 3QYPA 2VPQA 1U1EA 4NYMQ 4UW9A 3JWPA 4FT4A 2FNAA 4J7XA 1ZDMA 3ZZTA 1JT2A 1GQFA 4D9GA 1T1IA 4ZRMA 4FCVA 4ZYUA 3CN9A 2IDKA 3D6UA 3QP9A 1SVSA 4GGPA 3WB0A 4CTNA 2J3HA 1QKIA 2AC7A 3B1KA 4PINA 5LNK6 3ZCXA 5IRCD 3C7TA 1YHNA 1FTNA 1J09A 4DKXA 1DXOA 3FTPA 4RGQA 3X1MA 3T3GA 3AQIA 4FDVA 2PCJA 3F8TA 3GHYA 3QNUA 1P29A 3IURA 3A6LA 4Q7EA 1C9EA 1V95A 1EFPB 1Z2DA 3KLOA 2J7PD 1D8AA 1RXVA 2QM3A 1FJGB 4GSYA 5ALRA 3B8HA 1A7JA 4YI3A 3LPMA 2IEDA 4W9RA 4ZEWA 2X1LA 3BMCA 3VJMA 2VHJA 4ZHQB 2P5UA 4IXWA 3QVSA 4X93A 3K0EA 2AYZA 3Q2KA 2WW8A 4EWLA 4RTKA 1JB1A 3NC0C 1C2YA 1ADFA 3UMVA 3M6VA 4GPAA 3A10A 4IEEA 4AO6A 3R6WA 4YMGA 3T99A 2X6RA 3K0FA 4I1RA 4KKVA 4CIYA 3VMMA 3C6YA 3FTEA 3M4ZA 1SCAA 5DWQA 3TIXB 3UG6A 2B2NA 3H13A 3PR2B 3HXMA 3C24A 2GI4A 3TLXA 5FPKA 1XG5A 2DECA 3GJRA 2IOYA 4ZVUA 5DVZA 4Z2YA 2VHTA 5EWLA 3U13A 4FHFA 2ZBDA 5ICMA 1PL6A 4RQAA 1FLAA 4HAWA 2PKQO 4FJ0A 4J16A 3C1OA 4ENPA 4WLFA 5AJXA 2QAIA 4HZIA 4YJ3B 5KX5F 4OL0A 7ADHA 4LOAA 1FVHA 1X1BA 3P9KA 1PW7A 1Q20A 1RAHA 2NQTA 1NZJA 3DD5A 1BHO1 1FVXA 2CUNA 3BK7A 3FKSA 1ZJWA 2OLEA 2NAFA 9ATCA 4QXQA 1FMJA 4EKEA 1FXWA 3JASB 1MJFA 1Y8QA 4TZ0A 1DL5A 1QRDA 1XV5A 1Z39A 2NU6A 2W11A 2AVNA 2X0IA 1KZ6A 4JHLA 4REQA 5EKXA 2EDAA 4WKPA 2VDQB 2POCA 1AKYA 4MI9A 3W5JA 5FWNA 3LCJA 3ER9A 2ZUSA 4GIBA 3GFTA 1WXEA 4ZAVA 1E2BA 1SKYB 2R4QA 1XPRA 1U6JA 2J67A 3H1FA 4TLDA 3OC6A 2F8SA 4W9NC 1Q1QA 2JAQA 4DNOA 2G88A 1JMVA 1N6IA 5SY4A 4DG5A 2A33A 4RX1A 1HKUA 2C0CA 3VO1A 3R6GA 1YRLA 4ECEA 1QUFA 3DVAA 2GXUA 5KI6A 2WSYB 4Y7DA 3NOQA 3NP7A 1PJ2A 1QGAA 4CUJA 3PTZA 1CJCA 4TUYF 4YV2A 1GNPA 1V4BA 5DGXA 3PFFA 5EE1A 3HP1A 3VKFA 1Q1NA 4QSMA 5CEJA 2XMQA 4I9GA 1OOEA 2GHTA 1EVJA 3D4OA 4ISBA 4JBLA 1DIBA 1KZHA 3CYFA 4UEWA 1GZ6A 2RGCA 4HAVA 4WY2A 2LRHA 4QHSA 4HLDA 4YRFA 2NTJA 1QQ5A 1ULUA 3B1JA 5JXWA 4B3CA 3GG9A 4BECA 5JYDA 1NV9A 1QGZA 4ZDWA 5L3VA 2NUAA 2C2YA 3FOAA 5F51A 3B48A 4LDZA 3VM6A 1USIA 3OIDA 3PRHA 2JLYA 4XSGA 1KP9A 3UHJA 2FY8A 2A0YA 1XWIA 1WTCA 2FSVA 3MRTA 2WTNA 3ORFA 4LXHA 1ZD4A 1AQUA 3AI2A 2NU6B 3FLEA 4PSUA 4UFOA 4UVHA 1Q7TA 3BGDA 5TQ0A 2VHQA 3C4VA 1OA1A 5GV7A 2ZB8A 3EF0A 1XU7A 5IXSA 1RIIA 1ENOA 3MG9A 3FGOA 1P9NA 1Q5PA 2QENA 2VHWA 4PPFA 3A37A 1Q0PA 1POXA 3N53A 3R4CA 1OYWA 3HGMA 4FR5A 3ZWYA 4BB6A 5F76A 4RK0A 1LJUA 2C96A 5AO9A 5TMDA 1T34A 4Q37A 2ZYTX 3FAZA 1N32B 1ADCA 2QVXX 3OKAA 5BW4A 1U8FO 4URVR 1JAYA 1AQ6A 4H1HA 4P58A 4MUNA 1Z33A 4P86A 3MGKA 3GUCA 4P4LA 4B17A 1CDOA 3S81A 4KPYA 2YQZA 3E6AA 4YAOA 4FZRA 4W82A 3ZLTA 2X7JA 3U7FB 1VMKA 3GVPA 4RIIA 2XXAB 1ZYUA 4DC0A 3BHMA 2I34A 1Q15A 1GPH1 4Q3AA 3R5FA 4P84A 2EL9A 1WBJB 3HCCA 5LU8A 3K9FC 3HJFA 1NLYA 1PS9A 4BQOA 2HMYB 1ZIPA 5JCOC 4ND3A 4U5QA 4CMEC 4PYKA 3E2MA 3MCUA 3NAZA 3U3OA 2BGGA 5FT9A 2AE2A 4B09A 3KKKA 2P7HA 2AJCA 1EQAA 3CRZA 2ZIUB 3RSZA 2XUKA </