5KO1A

Pseudokinase domain of mlkl bound to compound 4.
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
279
structure length
265
Chain Sequence
QIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKIRKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ATP-Competitive MLKL Binders Have No Functional Impact on Necroptosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane proteins/inhibitor
molecule keywords Mixed lineage kinase domain-like protein
total genus 85
structure length 265
sequence length 279
ec nomenclature
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ko1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ko1A01
4IE9A 4CFUA 3VRZA 3BHHA 3OEZA 3OTUA 1A48A 1AD5A 2PUPA 5E8YA 2G9XA 1IA8A 2CKPA 4MAOA 4X3FA 3D0EA 4BDCA 2B1PA 2VD5A 2VWXA 4G34A 4BCFA 2R3NA 5CY3A 4OT6A 1U5QA 4EONA 4K18A 3VAPA 2ERZE 4LQMA 3E3PA 3MTFA 3CBLA 4GFOA 4ENXA 3KCKA 4KSQA 1KV1A 4BTFA 3OZ6A 4O6EA 3FQEA 4BWPA 5CAOA 1T46A 3RALA 1TQMA 5DNRA 3E8DA 2XM8A 3F69A 4S32A 3KULB 4IH8A 5DMZA 1MRUA 3EQGA 1UWJA 1Q3WA 4JRVA 4O83A 3DK7A 3OBGA 1URCA 2R3LA 1PKDA 3QQGA 3ORIA 1H1SA 4KIKA 2EWAA 5IA2A 2HZNA 3L8SA 4KUJA 4MQ1A 5AUVA 2UVZA 3GU7A 3BYVA 4KIQA 5KMLA 4CFNA 1OITA 3DXNA 3EYHA 4RBLA 3F3ZA 3R8UA 3ANQA 4FTAA 1OIQA 3LFAA 4C57A 1FMKA 3FQHA 2C6MA 4DEAA 4O7ZA 4WA9A 2WZJA 5CU6A 5IQHA 4QTDA 4I93A 2QO2A 2UW9A 5CI6A 4YHJA 3FEGA 2PVMA 4FUXA 4O21A 4XLVA 4XNEA 4YGAA 5LOHA 3UOJA 5DIAA 5B7VA 4MKCA 3V51A 3ORLA 4G5JA 4L6QA 4M84A 3N9XA 3AC2A 4KRCA 2WB8A 4R6VA 1AQ1A 2CNQA 2G01A 4CG8A 3VUIA 4OTGA 3OCGA 4PTGA 5F95A 5IA3A 4WNKA 2ITYA 2PHKA 3UODA 4I5PA 3PPJA 4HCUA 4HPTE 2BFXA 2NRYA 4FTNA 4BFMA 3NX8A 3L8VA 2B0QA 1YI6A 4W8EA 3MPMA 4O7WA 1REKA 4EH8A 4G16A 3C4XA 5LVPA 3PIZA 3VUKA 4C3PA 3BEGA 3EQFA 2X9EA 1OL1A 5AP5A 4L8MA 4XUFA 3V5QA 4IWDA 2X7GA 3KB7A 1PXOA 3QKLA 4O0VA 4OTWA 4NUSA 4YTIA 4YTFA 2WXVA 4HYIA 3K3JA 3DBEA 4RIWA 2AUHA 2YWPA 3MW1A 4RJ8A 3G33A 2PK9A 3NUNA 4FT7A 5F9EA 5A4QA 4DH8A 1JKSA 1RDQE 4RFMA 3SA0A 4FT5A 3QUPA 3FLZA 3OT8A 3PP1A 3TTJA 4R1YA 2WMRA 3DZOA 2PVNA 4AXAA 3KVXA 5EI6A 3UIMA 1XJDA 2XNPA 5CEQA 5KKRC 1RW8A 3OOMA 5C26A 2VNYA 5AUWA 2QLUA 4UYAA 2W05A 3JY9A 5JQ5A 1UWHA 1H25A 4F70A 4D1ZA 4RIWB 3QBNA 2GQSA 5CSWA 5CU2A 4ZK5A 4HVSA 2PTKA 3HNGA 4X2GA 5G6VA 2BTSA 2X2MA 3F2AA 3C51A 4EOOA 2WTCA 2OIDA 3RKBA 3R9RA 2A19B 3HMPA 3MESA 3DKFA 1W83A 2E9UA 4FA2A 3KRRA 4A9YA 4NEUA 5J5TA 4QMOA 3CD3A 3TZ7A 3NUUA 5CTPA 4JAJA 4LRJA 4FX3A 3I60A 2ERKA 1Y8GA 2GU8A 2CLXA 4BGHA 4DEEA 4G2FA 4DE4A 4YJQA 2RKUA 2C3JA 2Y4PA 4DH7A 4FKSA 3PJ1A 4G3GA 4WKQA 2JDSA 3GU6A 2QG7A 3COMA 3E7VA 3VS7A 2J0IA 2OU7A 4Q2AA 4GT5A 4MBIA 3WE8A 5J87A 1QMZA 3QQJA 3RVGA 2C0TA 3A62A 1W8CA 3A7JA 4XRLA 3NPCA 4Q9SA 3RINA 4FEWA 3MVMA 2XIXA 4MBJA 3OXZA 1QPCA 3A4OX 4R7HA 4TPTA 3H0ZA 3MJ1A 3UQGA 4QPMA 3HV6A 3D2KA 5J7HA 2XEZA 1J7UA 4FV4A 3N4TA 4DGMA 1Q8UA 2JBOA 2XK9A 5H9BA 1S9IA 4KINA 4AX8A 2WFYA 5CS6A 2Y7JA 3VQHA 3POOA 3FSKA 3C4FA 4WSYA 4GIIA 1SZMA 3EKKA 4F9WA 3ZFMA 3GC7A 3R2YA 4HYHA 4L43A 5H8BA 3NIEA 4C4IA 3TUBA 2GDOA 2IVUA 3DT1A 3DLZA 3IW6A 2JIIA 4X6RA 4PDYA 4YP8A 2FGIA 1R78A 3MVLA 4PP9A 4ALWA 2J5FA 2XIYA 3F6XA 1H1PA 4P5QA 4FOBA 4FV2A 3VN9A 3MB6A 4C4GA 3R9HA 4QD6A 5L8LA 3P7AA 4FIEA 2X8IA 3O8TA 4EBWA 3CJGA 5CF4A 2GTMA 1L8TA 3V5WA 1P4FA 1LPUA 4V04A 4EEVA 3O8UA 5EW8A 4J8NA 4UMUA 2W1IA 4DAWA 2WMAA 4FVPA 3R9NA 4IM0A 4FT9A 1Q8WA 3ATSA 4XBRA 1OPJA 3C4CA 4CXAA 3TIYA 4XEYA 3UBDA 2PUIA 2H96A 1MRYA 2VZ6A 4E93A 4D28A 4NM7A 1JQHA 5CZHA 4H36A 3R8PA 3PLSA 5CAUA 2X6EA 3TNWA 5LWMA 3LQ3A 2ZMDA 3QX4A 2WHBA 3H4JA 2XKCA 2V7AA 4CGAA 3F3VA 5L8KA 4BI0A 2I7QA 2W5BA 3FLSA 4A4OA 4IVAA 3DS6A 3HV7A 4F0GA 4UMPA 5KHXA 2QHMA 5L4QA 1LEZA 1DAWA 3I6WA 3R7EA 3BU3A 1ND4A 3BYMA 3QC9A 5BVWA 3RAWA 4QT1A 1MQBA 2Z7RA 2E9NA 2ITVA 5E92A 1M7NA 4IWOA 4D2WA 3OVVA 5DG5A 2YZLA 1GNGA 5JZNA 4OTFA 2FB8A 3GEQA 4BVUA 1J91A 1JNKA 5J1WA 2YIRA 4NKAA 5FDXA 3FWQA 2GMXA 4C58A 4EUUA 4ZJJA 2YCRA 2ITOA 2UW7A 3FLWA 4RIXB 5CAQA 2GFSA 4IM3A 3W2RA 4BL1A 4YO4A 4D1XA 2WTWA 2QCSA 4CTCA 4BTJA 4EH9A 4U45A 3D5WA 4R7BA 3ZO1A 3HV3A 3KQ7A 3R7YA 4BC6A 2B55A 4WG4A 1R0EA 4YC3A 3G9NA 3UNJA 3EZVA 1FGIA 1WAKA 4OTHA 5E1SA 3W2OA 4JT3A 4HOKA 4B99A 2G15A 2OH4A 4RVTA 3PZEA 4DEIA 4EORA 4OBQA 4GVAA 5L6PA 3RPVA 3MS9A 4DT9A 4CV8A 2UZEA 4CKRA 2WPAA 4IX6A 2WMWA 3WIGA 2VX3A 2YDIA 3DLSA 4LUDA 3GCSA 3K5VA 3NUYA 4AZWA 3KK8A 4AT3A 4ZSLA 4Z55A 5M56A 5HCZA 1YXVA 2FSMX 2QKRA 2WTVA 2YM7A 3FQSA 3QQFA 4FT3A 4QP7A 5CNNA 5DRBA 4ONAA 5C4LA 4C7TA 4DGGA 3ERKA 1YQJA 3BI6A 4RC2A 2R4BA 4YR8A 3BBTB 3JVSA 3E7OA 1ZARA 3T9TA 2UZVA 2HYYA 4FZ6A 4IDTA 4O22A 4AS0A 4F09A 4DBXA 4XX9A 3ZBXA 3WZEA 1GZNA 4FC0A 1F0QA 1P5EA 1KOAA 2ITWA 4E4NA 2C6TA 3FKOA 3UP7A 3A7IA 2VWZA 4HJOA 3AT4A 2YM6A 2Y6MA 2V7OA 3TXOA 2GCDA 2C3KA 3I0OA 4UZDA 2PY3A 5DH3A 3DFCB 4ANNA 4MH7A 4H3QA 3RAHA 4BGQA 3FZ1A 4G31A 3RWQA 3AXWA 3NZ0A 3RZFA 5IDNA 2BVAA 4APCA 5IH6A 5KX8A 3U55A 3MIYA 2WQBA 3ORPA 4CCUA 5EW3A 2DWBA 2IZSA 2XA4A 4FL1A 4RMZA 2OXDA 3N51A 2E2BA 3LM5A 4FNYA 3NYOA 4F64A 2XB7A 4IHPA 2BRNA 4FZDB 2C6LA 5EDRA 3F7ZA 5CWZA 3G15A 3BEAA 3THBA 5K4IA 2XKEA 1OKWA 4I3ZA 4JBPA 4WOVA 5BYZA 2W96B 3PRFA 4IWQA 5KCVA 2YITA 4DFLA 4AQCA 4E6DA 2W9FB 4BN1A 3W8QA 3C0GA 1SNUA 4FSNA 3EQRA 5J95A 5FGKA 5TKDA 4GK3A 3EJ1A 2BZJA 4JI9A 2PL0A 4FTRA 3OEFX 4NSTA 3CD8A 4BCOA 4G9CA 3G0EA 3OS3A 5I3RA 4DLJA 5BMMA 5GINE 4L45A 1PKGA 2JAMA 4FV3A 1R0PA 1WZYA 3IDBA 5IUHA 5JFXA 4UX9A 4NZWB 1Z9XA 2XVDA 4CMTA 3U54A 3NVKI 4V05A 2PE2A 2BFYA 3R22A 2F2CB 3O8PA 4QP6A 2G1TA 3NYXA 4RQKA 2BHHA 5AA9A 3FI4A 5AAFA 4EHZA 4AW1A 3EOCA 3ZBFA 3DXQA 3LXNA 4UB7A 3BU6A 3KEXA 2ITTA 2VU3A 3OD6X 1QCFA 3QZHA 4BIBA 4EQUA 3C5IA 1OL6A 2Z8CA 4NJDA 4IC7A 4FV1A 4JL9A 3SGCA 2VTTA 4QNYA 3PRIA 2CGXA 4GKIA 5EM7A 2FSLX 4FIJA 4O38A 5KMMA 2FA2A 2XUUA 5IKWA 2JDTA 5HVYA 2IVTA 4XP3A 1JBPE 1U4DA 4AZTA 4Y5QA 5LMAA 4FVQA 1MUOA 1OUKA 1PJKA 3QUEA 4FICA 4PRJA 2I1MA 4PUZA 4F4PA 5IPJA 4BZNA 2IPXA 2FVDA 3ETAA 4G3FA 3PSCA 5EHLA 1BL6A 3QXPA 3RPRA 3ZUUA 2PVKA 3OW3A 2VWYA 4FGBA 4E5AX 3QRIA 3NR9A 4I0RA 4XOYA 5H2UA 5I9XA 5DOSA 2RFNA 2I0YA 3NW6A 4DEHA 4HVHA 3POZA 4ITJA 4J1RA 3TT0A 3PZHA 3ANRA 5EKNA 5CT0A 3QZGA 4HZRA 4R3CA 3RPOA 4JIAA 3PVGA 3QWJA 4D4VA 1BL7A 5E7RA 3EL7A 4TWCA 3R9OA 5HIDA 4CKJA 2C69A 2J7TA 2R9SA 4YC6A 4BR3A 3KXHA 3EN7A 4OTQA 3ENHA 4ZMEA 5DE2A 4EHGA 3OFMA 4P2KA 3EQDA 4IAKA 4GYIA 5AUYA 1Q99A 4NT4A 3Q52A 2OF2A 2XNGA 3LFCA 3QCQA 3FLNC 3SX9A 3TNQB 2ITQA 4UMTA 2HZ4A 2VO3A 3MN3A 2QI8A 4U0IA 2W7XA 4ACGA 4NK9A 4HW7A 1PRYA 4K33A 2OLCA 5HD4A 2WQNA 4M7IA 1ZRZA 3RM7A 4U3ZA 5T3QA 3CQEA 3EKNA 3PG1A 4PDSA 5CSHA 1M2RA 2CKEA 2PVLA 3UVRA 4AGDA 3OUNB 4FI1A 3ZSIA 4O0XA 5JMSA 2WEIA 4D4SA 3ET7A 1YXUA 4WT6A 4FNXA 2P2HA 4IACA 3VUTA 1H07A 3LW0A 4L67A 4I6FA 3RNYA 3BRBA 3FI3A 2AYPA 3H0YA 3R04A 1NA7A 1TQPA 4PNIA 4QMUA 3EYGA 3U6JA 5I9WA 3BV3A 5DYJA 2OI4X 3ZLSA 2HAKA 4R7IA 5CLPA 3TNHA 1M2QA 3CS9A 1CKIA 4BDJA 2HY81 4ASZA 3DJ6A 1Q5KA 2BROA 1X8BA 4AN2A 4DH5A 2XNMA 3MTLA 2VO0A 3UOHA 2OW3A 4FV5A 5BVFA 4ZP5A 3UVPA 5D1JA 1PHKA 1ZLTA 3V6SA 2EXMA 4HNIA 1NVQA 3QZFA 4RFYA 4QMLA 4EBVA 1PXJA 2EU9A 4IC8A 3PY0A 3DV3A 4GYGA 3WI6A 4YZNA 4NFMA 3NNVA 2VTMA 3RM6A 4NM5A 5HNGA 3PXRA 3CGFA 1WVWA 3QU0A 5H8EA 3K3IA 2W0JA 5IQBA 3ODYX 3ZYAA 4MXYA 2PE0A 3W10A 4ANSA 3CEKA 4RIXA 4V01A 3A60A 3TV7A 5IQAA 3ZM9A 1DI8A 2QD9A 4YUQA 5JH6A 2ONLC 5IEYA 2BKKA 4G1WA 4GW8A 4ERWA 3FUPA 2X8EA 5CEKA 4L53A 2X8DA 3VUMA 4A9SA 3NGAA 3P1AA 3NSZA 5E8ZA 4BICA 1WBOA 3MH1A 4CNHA 4FTCA 2CKOA 4MYGA 4DLIA 2J6MA 3EFKA 4B8MA 1YI4A 5IA4A 2R7BA 1F3MC 5HQ0A 3HECA 3HV4A 2R3GA 3QD0A 5FTOA 3AMYA 3NAXA 3QRUA 4ORKA 4QO9A 4AF3A 4A4LA 2P3GX 2G2FA 2HW7A 2CPKE 3DXPA 3UYSA 4FYNA 4MHAA 3QRKA 4CFVA 1YXTA 5CANA 3OWLA 2OZAA 3LCOA 3QRTA 2QOQA 4GK2A 5CEPA 3SOAA 5FXRA 4U6RA 4NW6A 4C37A 3RZBA 2WQMA 4QMXA 5AIKA 4MXAA 4FOCA 2PZIA 3FXXA 4QPSA 4X2NA 1E1VA 2UW3A 5IU2A 3HX4A 5KMIA 2OH0E 3UOLA 4AAAA 2WU6A 2R3KA 4TYIA 4FKGA 4RZWA 2OIBA 3T9IA 3PE2A 3BGQA 3II5A 4Z9LA 5AP4A 2ZJWA 3R7GA 4XMOA 4I94A 4JIKA 3NUXA 4LL5A 4X3FC 1JSUA 2CGWA 3FJQE 4FKWA 2W4OA 3W1FA 2GS7A 1WBNA 4YNEA 2W17A 2VX0A 3EQBA 5AIRA 5HG9A 3A7FA 4FKJA 2WD1A 2VTHA 5LARA 3ZDIA 2B4SB 4H39A 4CEGA 3D5XA 4EOJA 3MV5A 5J7BA 2JLDA 3DK3A 1H00A 4QP8A 4BDFA 4FIFA 4EH4A 5FG8A 3MVJA 4FTOA 5ICPA 3U87A 2PULA 4C4FA 1OKZA 4OAVB 4HGSA 1YW2A 2XK3A 2C1BA 3RK5A 2YM3A 3EQHA 2GNIA 4Y8DA 4KBCA 1ZWSA 3OXTA 2EXEA 2OZAB 4AT4A 1AGWA 1PXIA 2C68A 2IN6A 3DAKA 4YSJA 4MEDA 4EWQA 1WBSA 3JPVA 2XH5A 2FH9A 1UA2A 3AD6A 2CN5A 3QQUA 2ZB0A 2CGUA 2BAQA 3ZO3A 1XR1A 1U46A 2YM5A 4MX9A 3FI2A 4O7TA 4NIFA 1GIJA 3E8NA 4MWIA 3WYXA 2V5QA 4FSWA 1ZYJA 4C33A 1PW2A 3C4ZA 4IQ6A 4FTJA 4FSTA 5EFQA 3ZUTA 3ZSGA 3ZXZA 2SRCA 3A99A 3C4EA 3CTQA 3VW6A 3MYGA 3D7ZA 4YJTA 3TL8A 4QPAA 3D7TB 3QD2B 5B2LA 4USEA 2ITXA 4TWNA 3NMUF 1NVRA 2CNUA 1IR3A 4EL9A 5FDPA 4DFNA 3CTHA 4RC4A 3TI1A 3PA3A 2QOHA 2XCHA 3KY2A 4K1BA 3ZXTA 1H8FA 2QOFA 1WMKA 4J99A 5ITAA 4L42A 2OJFE 4V0GB 5AR8A 2J0JA 3WILA 1SM2A 3I7BA 3VWAA 2XMYA 3QKMA 2ZV2A 2OFVA 3G6GA 3FMNA 4E3CA 5M55A 3UO6A 4ZTNA 2BDJA 3RK9A 3UYTA 5HBEA 2PZ5A 3EB0A 3S1HA 3V8WA 4B6LA 3CPCA 4ZSEA 2WGJA 4FK6A 5F1ZA 2C6OA 1HOWA 1K9AA 5J9LA 1IAJA 2ZM1A 4ZZOA 3MIAA 3M1SA 3FY0A 3SDJA 3H3CA 5CNOA 3FL5A 3E93A 2C6EA 1KV2A 2B9JA 1FVVA 2WOTA 3Q4UA 1H26A 4X6QC 4FEUA 2W1GA 2WMTA 2B9HA 2BALA 4GU6A 4BCIA 3VW8A 1K3AA 3Q4CA 4B8LA 5HCYA 2P0CA 4FSYA 1UKHA 5EHOA 2GTNA 2WTIA 4OR5A 4QMYA 2IJMA 4FG7A 3ORKA 4YBJA 5BVKA 3VJOA 5CX9A 3R8VA 1XO2B 5AV2A 1J7LA 2Y9QA 3SRVB 3TG1A 4J53A 4MWHA 4R3PA 3LZBA 3CY3A 5AX3A 4RJ5A 3HRCA 3UZRA 4DFZE 3H10A 3LXLA 5DRDA 2FYSA 4CZYB 2Y4IB 3ZHPC 1H27A 1V1KA 4O1OA 2XZSA 3ORZA 1GZ8A 3EIDA 1O6LA 2ETKA 2NRUA 4JDKA 5AWMA 4NKSA 4APPA 3I7CA 2C47A 1YXXA 4ZS0A 4TWPA 4YHFA 3BQCA 1T45A 4QYYA 5EDQA 4CLJA 3KC3A 1B38A 4RJ6A 2C0OA 4TYHB 4F0IA 1YOMA 3TWJA 4BI2A 5LVOA 3F66A 2XP2A 3KRXA 3T3UA 4CMOA 2B7AA 3NCZA 1UU7A 3G0FA 5GZ8A 2OWBA 4M8TA 3D83A 1OECA 3IO7A 3O96A 5DEWA 4NJ3A 5AP7A 5GHVA 1JOWB 3FMLA 3D5UA 2X7FA 2JAVA 4CCBA 4UWCA 4YPSA 4O7VA 2BRGA 1OL5A 1I44A 1KE8A 2UVXA 3LJ2A 4EK4A 4KS8A 3O0GA 1BI7A 5AP2A 2QC6A 2OIQA 4DG0E 3SHEA 3P08A 2GS2A 2WIHA 3NYNA 4FMQA 4IAFA 3SQQA 5IG1A 3A4PA 2H8HA 3HRFA 3ZS5A 2IO6A 1XKKA 5IMXA 5EKOA 2WQOA 2F49A 3V01A 1YHWA 3V8TA 4EZ5A 4E5WA 4DBNA 2XJ2A 4O6LA 3ZRLA 3BHTA 1LR4A 3MH2A 1M7QA 2IWIA 4TKSA 4E6CA 1GJOA 3EN9A 5AP1A 2O2UA 3MFSA 1J1CA 2PVYA 2WMVA 3PVUA 4IB5A 4YTCA 2QQ7A 3KU2A 2O5KA 5HD7A 4DTBA 3LPBA 3R1SA 1WVXA 2WOUA 4CYIA 3QYZA 1G3NA 3VF9A 3NS9A 3UPZA 2VTNA 1CKPA 1Q97A 3UNKA 4I23A 5E8SA 3V04A 1M17A 3BIZA 2A0CX 4I0SA 3PLAE 4XV1A 4EHVA 4O0WA 1VYWA 3FXZA 1G8SA 3IGGA 1UU8A 3VBQA 2GHLA 4O0SA 4PMTA 3BQRA 4O82A 5BVOA 3MWUA 3ZZEA 4BTKA 1YVJA 5M4FA 3EMGA 4BCKA 2UZWE 5KKRB 3GB2A 1J1BA 1XH6A 3EH9A 1XBBA 3M11A 1PYXA 3SXFA 1XH7A 2FO0A 4N0SA 4LL0A 4NW5A 3DBQA 2NO3A 4PL4A 3AGMA 4KS7A 4LYNA 1YI3A 4RG0A 4R78A 2VAGA 1SMHA 4XBUA 2ITZA 2QO9A 2WTDA 3LFFA 3Q6WA 1XQZA 4PQNA 1OBGA 3I79A 4D2RA 1MQ4A 2VX1A 3GENA 2HW6A 3B8RA 3DKOA 5HOAA 3TACA 4EJ7A 4KABA 4RPVA 4G17A 2J90A 3FL4A 4TL0A 4QQJA 4FSQA 1ZMUA 4FSZA 2BKZA 3FYJX 3WZUA 3E62A 2YIXA 2ZB1A 3HP2A 3VS2A 5FM2A 5TR6A 4MXXA 1FOTA 1XHAA 1U54B 4WNPA 3TUCA 4O2ZA 2R3RA 5A4LA 4EOQA 4PTEA 5CAVA 2PPQA 5E8TA 2RFDA 4GUEA 1H1RA 2XIKA 1NY3A 5HEZA 1U59A 3R83A 4RX5A 4AE6A 2IZRA 4CG9A 5AV4A 2HIWA 2XNNA 3KK9A 4I41A 3DZQA 4WG3A 5KMOA 2YM8A 4PPBA 5IQEA 1YXSA 3NEWA 2CLQA 3PVBA 2AC3A 1BMKA 3B8QA 3D7TA 4GFMA 3DDQA 4ARKA 1K2PA 3VO3A 4BBMA 2X2KA 3AMBA 4U97A 2XJ1A 1A9UA 4X21A 4GRBA 3R7IA 4C61A 5BNJA 4AOIA 1WCCA 2W5HA 3EZRA 5E8XA 3FAAA 4DH1A 5DR2A 3VHKA 3TJDA 2Q0NA 3PE1A 5DEYA 5EW9A 5I5ZA 3NCGA 4CRLA 3KVWA 4U79A 2WEVA 5EQPA 3VVHA 3IECA 2B52A 3VS5A 3MY0A 4RWLA 2W9ZB 5M44A 3Q3BA 1W98A 2YERA 4FTQA 2HELA 3GT8A 4Q5HA 3TIZA 4EI4A 5JRQA 4R77A 2QNJA 5HKMA 2YAAA 3QQHA 3KFAA 3ACJA 4FKVA 4WD5A 4D2VA 1Q24A 4TY1A 4ZJIA 3VS4A 3MSSA 4J7BA 4NU1A 3BE2A 4UWYA 2HZ0A 3V6RA 2C3IB 1ERKA 3DNEA 2JKQA 3BWFA 3DK6A 3L9NA 5ETFA 4I6QA 3GBZA 3QTXA 3KMWA 5KE0A 3ZRMA 4KA3A 3ZC6A 3A8XA 4BKJA 2WU7A 4YLLA 5EM8A 4FG8A 3G90X 4C4HA 2YABA 3KN6A 4D58A 3CP9A 3WZKA 3U9NA 4I5HA 5ETAA 2B53A 3QF9A 4IJ9A 4ANBA 4O0RA 2AC5A 5T6KA 5L2SA 4JBOA 4I1ZA 2W1DA 4GKHA 3ELJA 4M14A 4XV2A 3AQVA 4X2JA 5LCJA 3BCEA 4TTHB 5JN2A 5FM3A 3UG2A 4RC3A 4FYOA 4A4XA 1UNGA 4QOXA 3UE4A 4O7SA 3TKIA 4AG8A 4UWBA 2I40A 5B2MA 3RCJA 5HTIA 5IISA 2O64A 4G6LA 3WIKA 4DYMA 2PU8A 2BMCA 5AR2A 2QG5A 2XBJA 3DAEA 3DGKA 3FMMA 4LV5A 2PUNA 2BILB 4XG6A 4FEVA 4KNBA 3K2LA 4ITHA 5ANJA 4GG5A 3A7HA 4IBMA 3OUKA 5E90A 4ZLZA 4EKKA 5K5XA 2PMNX 1Q41A 4MXOA 4G3DA 2PYWA 3L9MA 5C8MA 3R1YA 4O0UA 3E5AA 5FEDA 3OXIA 2BPMA 3JR1A 5IQFA 3DTWA 4RJ4A 1JSVA 1ZOHA 4CLIA 2O65A 4UY9A 4OLIA 3RPSA 1OIYA 3OHTA 3GCQA 4MD7E 3IOKA 4U41A 5HE0A 3CSVA 4EK8A 5CF5A 4A07A 4S34A 3ZU7A 4N4SA 3LCSA 4BDDA 5KBRA 5EQEA 3FPQA 3COKA 3GUBA 3W33A 5EI2A 5DFPA 4HGLA 2JGZA 3LCDA 5J1VA 2Y8OA 3QCYA 4CFMA 5K5NA 5EM5A 2YLEA 3EQPA 2H9VA 4RIYB 2XNBA 5C8KA 3ATTA 4DITA 3D5VA 4KAOA 4AW2A 2BRHA 3MI9A 5CF6A 4K77A 1PYEA 2B9IA 3L9PA 4J95A 4XP2A 5CXHA 4D4YA 2UZBA 3RBWA 4X0MA 4E6AA 3SXSA 5DA3A 3GU8A 4ZTLA 3QGYA 2GS6A 2OJJA 4FUYA 2PZPA 4NWMA 5LVLA 1GAGA 5BVDA 4XG8A 2HXQA 3FZSA 5DT4A 5D41A 3VBTA 4JG8A 4LRKA 5C1QB 5FBNC 2BIKB 5H8GA 3KGAA 3D4QA 4PMSA 4BF2A 4E4LA 4EJNA 4ZAUA 4NL0A 3Q96A 1JWHA 3CR0A 2BRBA 5JKGA 1H0WA 4ANMA 5DT0A 5DT3A 2O8YA 2ETMA 4FKIA 1P2AA 2RSVA 2F4JA 2XK4A 3RWPA 4IZYA 4QMQA 3QQKA 3P78A 4RSSA 1FINA 2J9MA 2I0HA 3EWHA 2W06A 2G2IA 4K9YA 2W1ZA 2P33A 4USDA 1BI8A 2R0UA 5ANKA 4QRCA 3BU5A 2BDFA 3Q4TA 5HBHA 3RHXA 1PXNA 2BAKA 4LG4A 3NNUA 5LCKA 4RT7A 3FMKA 3P7CA 1JVPP 3A8WA 4I6BA 3OWKA 5I9UA 1WBWA 2REIA 4C62A 3DA6A 2QU6A 1ZMVA 4F1TA 5CALA 3UVQA 2CCHA 3PXYA 4D0WA 4XRJA 5CT7A 4G3CA 2VTPA 4JDHA 3FV8A 3W8LA 1Y6AA 3R7OA 2ZDTA 4JQ7A 5KNJA 1LP4A 2RG6A 3AC8A 1PMNA 2X81A 3MA6A 1CTPE 4AN3A 4BDAA 4IXPA 4TT7A 2RL5A 4OBPA 4QTCA 4O81A 1IRKA 3HDMA 3EN6A 3MY5A 4G6OA 2J2IB 3NRMA 3OC1A 3HV5A 4C3RA 4JX3A 4BDIA 1YDTE 3TDVA 5M06A 4W4YA 3LFDA 2RF9A 4EOKA 3KMUA 4W9WA 3V5PA 4LGDA 4U43A 2R3MA 3D15A 4AA5A 3SG8A 5DGZA 1M2PA 5IA1A 4MF1A 2Y4IC 3FLYA 3ULZA 4YJSA 4W9XA 4ZTSA 3WF9A 2OSCA 3EFWA 3FMDA 4F0FA 2F7XE 3ZOSA 4H3BA 2QOCA 5A4EA 5JZJA 4O91A 3PY1A 1XH4A 4YJOA 2C5XA 4BKYA 4UYNA 4BKZA 4M0ZA 4AUAA 2QLQA 4IX5A 3BE9A 4JR3A 4OUCA 1O9UA 4NM3A 5ANIA 4DCAA 2KULA 3GU5A 3LMIA 3LCTA 2YA9A 1NXKA 2W4KA 3F9NA 5DLSA 4JLCA 5J9ZA 3BHYA 5L2QA 3GP0A 2UZOA 4MK0A 4MXCA 4BDGA 4D0XA 3LJ1A 4FODA 4E73A 1ZMWA 3CCNA 3NLBA 4MNFA 4NH1A 3VS1A 4TYHA 3V3VA 4DFXE 3M2WA 2HOGA 4U40A 5HE2A 5K0XA 4AA0A 3A2CA 4FTIA 3O17A 3AG9A 3UZPA 1YOJA 2PMIA 3FKNA 2JKKA 2IG7A 3G6HA 4ZY5A 3ORNA 2VWWA 4IAZA 3GGFA 3JUHA 1KUTA 3LCKA 2OKRA 3IKAA 1H01A 3SD0A 4EQMA 5LJJA 4I5MA 2BRMA 5JGAA 4F9BA 4RFZA 2C6IA 4L3PA 5D11A 4J98A 4FV7A 4FV0A 3C9WA 3QTSA 4JJRA 1V0OA 2NNWB 2ZOQA 3NNWA 3S3IA 2VTAA 3LFSA 3OY1A 4O7LA 5GIPE 2HCKA 5ANGA 4EK6A 5CYIA 3OBJA 5EK7A 3D14A 4AU8A 3IS5A 3AT3A 3T3VA 4XHKB 3ZMMA 1ZYLA 1M52A 3DJ5A 4MQ2A 5DR9A 5I3OA 3ULIA 4EH7A 4ACHA 4BYJA 3LLTA 3FYKX 1BX6A 2A4LA 4LRMA 3PXQA 4QMPA 5E8WA 1CKJA 3WF8A 3IOPA 2YDKA 4ZSJA 3UDBA 2O3PA 4ALVA 4XS2A 2A1AB 4YZCA 1RJBA 3QC4A 4Y73A 3UG1A 5HG8A 3BELA 4AZSA 4R5SA 3R02A 3VBXA 3GNIB 4DFUA 2G2HA 4ANLA 3IONA 5GIOE 4A06A 5HIBA 1OIUA 3RP9A 3D94A 3F82A 4L52A 4EH5A 4UMRA 4JOAA 4X2KA 4GU9A 2Z7SA 4X3FB 4EYMA 5LMBA 1CDKA 3Q6UA 4USFA 4RX9A 2JKMA 4FV8A 2X0GA 4GCJA 2E9OA 5A14A 2YCSA 1JKTA 2W5AA 2RFEA 1P4OA 3DFAA 4QNAA 1KSWA 2X4ZA 3O7LD 4IB0A 3RJCA 2H6DA 5M51A 4M12A 2OF4A 4IEBA 3DBDA 3E92A 4CYJA 5CSPA 3FMJA 3QTUA 2PZRA 2QOIA 3DU8A 4J8MA 1ZY5A 3OT3A 2ETRA 4EH3A 5JGBA 4XH6A 4QP3A 1UU3A 1JKKA 5CZIA 4F1MA 3C0IA 1GZKA 2WAJA 3VS0A 3C1XA 2VRXA 2EXCX 3GC9A 1FGKA 3Q60A 3OP5A 3IDPA 3FDNA 3W18A 5FBOA 3R6XA 2XIRA 5FTQA 4F7NA 3GFWA 4IB1A 4D4RA 3TZ9A 3UQFA 4F08A 1JPAA 4CT2A 2BDWA 5DHJA 1RQQA 4XG4A 3QKKA 3NUSA 2CNVA 2PZYA 4LI5A 5K3YA 5KMKA 4DH3A 1UV5A 3AD5A 1PMUA 2XKFA 3KRJA 4IZ5A 1RE8A 5ETIA 2UVYA 4XJ0A 2VTJA 3P4KA 3PPZA 2UZTA 2XKDA 2R3HA 4ZZMA 3EQCA 5A46A 1WBPA 2BHEA 3A7GA 5EYKA 5L8JA 3SOCA 4BHNA 4EOLA 4UXLA 1YDSE 5DN3A 4QMMA 5M07A 5A6NA 3BPRA 3HL7A 5ETCA 2WO6A 4J96A 4F7LA 4DFYA 2DYLA 2IZTA 4QTEA 4S31A 5L6WL 1WVYA 4C38A 3P86A 4TWOA 4TN6A 5FP6A 4GT4A 3KF7A 3PUPA 4E26A 3QZIA 4HVIA 1E9HA 1LEWA 1OZ1A 1H24A 5D10A 3PYYA 2B54A 5AM6A 3KULA 5K9IA 3FMEA 5HLPA 4AT5A 2EB3A 3CY2A 4RIYA 3F2RA 4LOPA 2R2PA 4EC9A 3HA8A 5BYYA 1OKVA 2WNTA 5CI7A 4BZOA 3KXMA 4PPCA 3DPKA 5TE0A 3F5PA 3D2IA 2YACA 2YN8A 4ID7A 5IZFA 3AD4A 4GFGA 4GK4A 2CKQA 3CE3A 2ITUA 2YWVA 5HBJA 4LOOA 4CZTA 1Y91A 3IW7A 4LM5A 4DC2A 2YAKA 3FSFA 4D2SA 1BKXA 4GH2A 2XRWA 1TQIA 4L7SA 1CSNA 2QOOA 4M3QA 4Y95A 1ZXEA 4BCMA 5BX0A 1E1XA 4AFEA 3SRVA 2YISA 3R01A 3WF7A 2P4IA 4AOTA 2BUJA 3W2CA 1OUYA 5HLWA 5FTGA 3MH3A 4PX6A 1NVSA 3IDCA 3PWDA 1PY5A 4WG5A 3SXRA 4A9UA 1YKRA 1XH8A 2UW4A 4YJVA 3VQUA 4CD0A 5L3AA 1DAYA 4PNKA 4FEQA 4RA5A 3U8WA 2ONLA 4OT5A 4G9RA 3AC4A 5CQWA 1YHSA 1YWVA 3QTRA 4DHFA 4AWIA 4FV9A 4CFFA 4E8AA 2Q83A 5I9YA 4F6WA 4Y85A 4F7SA 3LFNA 4X2FA 3H30A 3OW4A 4YNOA 3RPYA 5F20A 2CCIA 2VO7A 4IX3A 5FXSA 4FR4A 3I6UA 3HMOA 4B7TA 3ZSHA 4ANOA 3AGLA 4GVJA 3IPHA 1W82A 4EUTA 3PXFA 3OF0A 3AT2A 3GCPA 5EHYA 1UU9A 5AUUA 3EFLA 2JKOA 4ZTMA 4H05A 1KE7A 1SVHA 2VWIA 3A61A 3TV6A 1UNLA 2W1EA 3BYOA 3QFVA 4M68A 5EQYA 4FKTA 2C6DA 5E4HA 3QA8A 4NTSA 4WNOA 4UV0A 3W16A 1R3CA 5J8IA 2OO8X 4MD9E 3BGPA 4TYJA 4OW8A 4V0GA 2WMUA 3QTQA 5HG5A 1V0BA 2WTJA 4Z7HA 5EH0A 5I9VA 1FMOE 4Z3VA 5HVKA 2WTKC 3FZPA 3KXNA 4RX7A 5CEMA 5M4UA 3UC3A 4ZJVA 5FRIA 3E63A 4ZSGA 4PL3A 2O63A 3TEIA 3GC0A 3LE6A 4ASXA 3FZRA 3TZ8A 3HMIA 5IF1A 4F6UA 4ZEGA 4QMTA 2X9FA 4QYGA 4WHZA 5DVRA 2W1FA 3IG7A 4ACMA 2VO6A 5DI1A 5LMKC 2VTRA 3TKUA 1PMVA 4DGLC 4GV1A 3VC4A 4U42A 4FL2A 4YZMA 5CU3A 3ZFYA 3Q53A 4BDKA 5BQ0A 3QA0A 5TF9A 1KOBA 4GJ2A 3Q2MA 1Q62A 3S2PA 1KE9A 4FT0A 3SW4A 3CKXA 2J0MB 4M15A 4FG9A 2JITA 4DTKA 3REPA 3UMXA 5HO7A 4KIOA 4M67A 2XS0A 3ITZA 5HLNA 3DAJA 4I6HA 4PF4A 4EKLA 4L3LA 4RVMA 4N57A 2F7ZE 3R73A 3S0OA 2QURA 4W4WA 5IH4A 4FTLA 2W1CA 3UO4A 4C36A 4YLJA 3FI8A 2X39A 4QMWA 3CJFA 1VZOA 4NFNA 2J5EA 5AA8A 2XNEA 5CSXA 5E91A 2FUMA 1JAMA 2I0VA 1BUHA 3HKOA 3VHEA 2EUFB 4Z16A 2W99B 4XG2A 1HCLA 4PMPA 4B4LA 5KMJA 4FKUA 1WBVA 3SV0A 2A27A 3F2NA 3PDTA 1QL6A 4YTHA 4GG7A 2QOLA 3ROYA 4EK3A 2GFCA 2ZV7A 2F9GA 2PVFA 4RWKA 5HICA 2VNWA 5EOLA 4WSQA 1ZYSA 2QR8A 4IAYA 5ACBC 3U4WA 4YHTA 3VIDA 5L2TA 3VF8A 2BAJA 1MRVA 3BV2A 4H1MA 4KB8A 4BCNA 4EZ3A 3RHKA 5M4CA 1VYZA 1Q8YA 4LMNA 4PWNA 3I0QA 5EDPA 4OTIA 3FC1X 5CU4A 1PXMA 3KREA 3IK3A 4I92A 4D5HA 3Q5ZA 2XK6A 3R1NA 4YZBA 4FKOA 2I0EA 4OGRA 1PF8A 2XK7A 4BBEA 4W4XA 5JK3A 5M53A 1CMKE 3UP2A 1QPDA 2PUUA 3SLSA 5KUPA 3K5UA 2V62A 4BWXA 4NCTC 4IFGA 4X7QA 2CMWA 4DN5A 5IQGA 4FTKA 4QTBA 4L44A 4RIOA 3HGKA 3Q4ZA 4RJ3A 3UTOA 3WZDA 2UW6A 4AZFA 4EK5A 4JAIA 3MFTA 2VTIA 1H1WA 3KXZA 3OMVA 4YC8A 4C3FA 5M08A 5DWRA 4ZY6A 4ITIA 3PIXA 4KBKA 4JX7A 5HO8A 4RX8A 4AZEA 4ZLYA 5B2KA 4YLKA 3M42A 5AV3A 3FXWA 4DEGA 4ANQA 1Y57A 3MJ2A 3UIXA 2BCJA 4O7RA 4D1SA 1ATPE 3GU4A 3P79A 4QQTA 5HTCA 3SG9A 4LGGA 4KBAA 4MTAA 4ZS4A 4EOIA 4C0TA 5J79A 5EG3A 1L3RE 4XG3A 3VS3A 4ZTRA 5ANOA 4U3YA 3JVRA 2YEXA 3HVCA 5KMNA 2V0DA 1ZZLA 4U7ZA 3FY2A 1TKIA 5A4CA 5IA0A 3WE4A 5AP6A 3NW7A 4BDHA 4S30A 3QX2A 2QKWB 4J52A 3IW4A 4RGJA 2PE1A 3ID6C 3EFJA 2HENA 5A9UA 3DTCA 4IB3A 2ZAZA 4E4XA 3OG7A 2HWOA 2OBJA 3KA0A 3QHWA 4IDVA 5CAPA 1SVGA 3QALE 2ZVAA 2ZDUA 4BTMA 3W55A 3MPAA 4QYEA 3PXZA 3DDPA 4O86A 3PFQA 2C4GA 1XH5A 2J0KA 4IADA 5EM6A 5BYLA 2QHNA 3JY0A 5FEQA 4BDEA 2WQEA 4GT3A 3ZEWA 2CJMA 5AUXA 4GL9A 3KCFA 4PV0A 3QL8A 3QTWA 3PP0A 5E1EA 5AV0A 4DG3E 5J9YA 4JBVA 5HE1A 3KKVA 2CHLA 4ZMFA 4D5KA 3DBCA 3MDYA 5AAGA 5HESA 1OVEA 2Q0BA 3TV4A 1JLUE 2NPQA 4FZFB 2A2AA 4WRGA 4ZZNA 1DS5A 4L01A 2OXYA 3NWWA 2JDOA 5FEEA 2R3QA 3EQIA 3GVUA 4U81A 1I09A 1QPJA 3O2MA 3IQ7A 1MP8A 4QMVA 3LFEA 3ZZWA 4F65A 3I1AA 1F5QA 4CSVA 4YJRA 3VBVA 4O0TA 3HUBA 4NCTA 3PXKA 5HGIA 4Q9ZA 4LOQA 5C01A 2UZDA 3QLGA 4QQ5A 3R30A 2PSQA 2CSNA 4FNZA 3KF4A 3BHVA 4K8AA 4LFIA 2ESMA 4W8DA 1OBDA 4ASDA 4C34A 3I5ZA 3UIBA 3DKGA 5CENA 4UXQA 3BYUA 2QODA 4PDOA 5DPVA 4TYGA 3KRLA 3ZONA 4HVGA 5FXQA 2X4FA 5FQDC 2C1AA 4AGCA 2JEDA 4F6SA 3EN4A 1R39A 5KO1A 2QONA 3PA4A 2PVHA 2VV9A 5I4NA 3IW5A 4C59A 1PXPA 2XEYA 3PWYA 3QHRA 3E88A 3R28A 5KBQA 2HK5A 3F3TA 3LM0A 5GJFA 1H0VA 3DQWA 5IUGA 4MVFA 2UZNA 3JYAA 2GNGA 4YPDA 5D7VA 2GNFA 3MFRA 4N6YA 4AA4A 3WBLA 2R3IA 1B39A 5CASA 1OKYA 2XJ0A 5C4KA 4MBLA 4ACCA 5JEBA 3DQXA 3VBYA 3T8OA 2IZUA 4RVKA 3I5NA 2BZHB 3ZH8A 2PVJA 4QMSA 3WOWA 1FVRA 5KHWA 2XRUA 4OTRA 2H34A 3P23A 5KZIA 4PY1A 1A06A 5F94A 5HNIX 2YLFA 5BVEA 1O6KA 3VUDA 3EN5A 1ZZ2A 2C30A 3PG3A 3PSBA 1OIRA 1O6YA 3QTZA 4ZOGA 4R5YA 5EI8A 3TN8A 2ZV8A 4DGOA 4EOSA 1FBNA 4F9CA 3AC3A 5TT7A 2HZIA 3O51A 4F9YA 3RNIA 4G3EA 3LMGA 5AFVA 3JS2A 2XIZA 4WO5A 5HORA 3KMMA 4I0TA 3LKMA 5JFVA 1DI9A 5I9ZA 2YIQA 4DTAA 5CF8A 2WMXA 3B2WA 3RI1A 4E4MA 3MFUA 4EQCA 4JQ8A 4O7YA 3HMNA 1SVEA 3LOKA 4EYJA 1KWPA 4IVCA 3F3WA 3SAYA 1YHVA 5AR7A 5LQFA 3R7VA 3DJ7A 2ZM4A 4IVBA 4MCVA 4E1ZA 4I5CA 3C4WA 2GNJA 3E3BX 4IAAA 1HCKA 4JG7A 3VNTA 4CZUA 5A6OA 1BLXA 4P7EA 1PMEA 5CVHA 3RGFA 3RTPA 4BB4A 5M4IA 4EH2A 2KTYA 5IQDA 5IQCA 2J0LA 2OZOA 2QVSE 2Y0AA 2Z60A 5HHWA 4CKIA 5H3QA 5EYDA 4FIIA 4Y72A 4C8BA 3BYSA 3RCDA 4CVAA 5JGDA 4DGNA 3DOGA 4QTAA 3SW7A 1UVRA 4EZ7A 3VJNA 1XBCA 4MD8E 4E5BA 5IQIA 4LGHA 3LXKA 3ZLXA 2WMSA 4FSRA 4DEDA 4K2RA 3BX5A 5AUZA 2GQGA 4YURA 4IIRA 3TNPC 5D7AA 4U5JA 5HE3A 3TZMA 4HZSA 4I4FA 4A9RA 3O23A 4I20A 1CM8A 4Y5HA 3TCPA 4D9UA 5IEVA 4EHEA 3CXWA 5CQUA 3MB7A 4BCQA 5AJQA 4M13A 2ACXA 4XP0A 4GEOA 3LLAA 5AADA 3MY1A 3K54A 3U6HA 1VJYA 3QD3A 3COHA 2J50A 3IGOA 3UOKA 5L6OA 3BBWA 3UZTA 4BIDA 3Q04A 3BLRA 2RIOA 1GZOA 4GJ3A 5LWNA 4MNEA 5EYMA 1OB3A 5IDPA 1URWA 3ODZX 3TTIA 1YRPA 2YJRA 4CMUA 3NAYA 5J5SA 2X6DA 2OK1A 3UIUA 2FSOX 1Z5MA 4ZY4A 2VUWA 4J97A 3GOKA 5AP0A 4U44A 2XK8A 1REJA 2JIVA 3KL8A 4AOJA 4O1PA 4JQEA 5IUIA 2PWLA 4C4JA 1VEBA 4KWPA 4UZHA 5CEOA 4L46A 2UV2A 2WMQA 4HCTA 5HVJA 2XF0A 3Q32A 4WRSA 1H1QA 4BZDA 2HWPA 2VWBA 2OGVA 2VN9A 1YWNA 3F88A 3FMHA 5AR3A 1Q4LA 4FTTA 4HGTA 4QQCA 3F5UA 4QP9A 2PMOX 3ZFXA 4BCJA 3ZCLA 2Z2WA 2VTSA 3FZTA 1IAHA 3QD4A 1ZY4A 2VGOA 4H3PA 4JS8A 4M97A 4MXZA 3CKWA 4CFWA 3N4VA 3HUCA 3P7BA 1TVOA 3QQLA 4D9TA 4RWIA 5AUTA 5BPYA 2ZYBA 3LXPA 1W0XC 1GOLA 4FKRA 4M66A 3NW5A 3RAKA 4QYFA 4FKLA 2GQRA 5A4TA 3LQ5A 1ZYDA 4IM2A 2YCFA 4XV9A 4FVRA 4NIFB 1J3HA 2BR1A 3OCTA 2C5NA 3PVWA 4FV6A 3Q5IA 4C2WA 1XWSA 3QXOA 4TZRA 4QP2A 3O7LB 4TNDA 2WELA 2F7EE 1S9JA 3MGYA 3R7UA 3P0MA 2LAVA 4BRXA 2DQ7X 4FF8A 4OTDA 3GQIA 3DBFA 3GCUA 1JKLA 4ALUA 4KIKB 3VUGA 2R64A 4HCVA 3PJCA 4YJNA 2OXXA 2VTQA 4IWPA 2Y6OA 2OICA 4O84A 1U54A 3P5KA 4FTMA 4NTTA 5BUIA 4F63A 5A54A 4DEBA 3MA3A 2Z7LA 3L1SA 4A7CA 5BMSA 3OWJA 5JFWA 3UNZA 4M69B 4U80A 3GOPA 4IANA 3W32A 4HYSA 4IMYA 4QYHA 4QMNA 4R3RA 2BZKB 4FSMA 2DUVA 4Y46A 4NM0A 1PXLA 1UNHA 2E9PA 4IZAA 4XLIA 5JSMA 3H9OA 2VGPA 5JRSA 2OJ9A 3H9FA 3PIYA 3QGWA 2P55A 4IAIA 2RG5A 4C4EA 1OI9A 2F57A 3KRWA 2CDZA 4HYUA 5E8VA 3G5DA 3R9DA 4BI1A 3UMWA 4GSBA 4TW9A 4GMYA 5C03A 3WARA 4OTPA 3DB8A 3LJ0A 4PL5A 4QMZA 4WUAA 5AV1A 3F3UA 3F5GA 3FBVA 3KXGA 4KKHA 3NVMB 3NUAA 3G9LX 3LVPA 2RGPA 1GIIA 4DF3A 2VTOA 3VBWA 2IVSA 2OJIA 5HO6A 3N4UA 2JDVA 2XCKA 3BWJA 4O27B 3RK7A 2BZIB 5KZ0A 1ZAOA 5FP5A 2YCQA 4AW0A 5M57A 1YOLA 2JBPA 2UW0A 4ZTQA 2C5OA 3TJCA 4RA4A 3R00A 3ZTXA 3Q9XA 4D2PA 2W4JA 3QYWA 1SNXA 3MH0A 4O0YA 3NDMA 2C5YA 4Z7GA 2PMLX 4AFJA 5GZAA 5IA5A 3VS6A 4KRDA 4IW0A 3BLHA 4KIPA 4YJPA 4XV3A 1J7IA 1NT2A 3ZDUA 4DT8A 3ZO4A 3H9RA 4FGRA 5HZNA 5AEPA 5LVMA 4EOMA 2R3OA 2LGCA 4FSUA 4BCGA 2ZMCA 3CQUA 3U9CA 4CFXA 3UO5A 3SKCA 3QWKA 3QCSA 2J51A 4JRNA 4U9AA 4F1OA 2YDJA 4E6QA 1YWRA 4YSMA 4UN0C 1OL2A 4OAUC 4P4CA 2CN8A 3CLYA 1H28A 4TYEA 5C9CA 2IW8A 4FIHA 4X3JA 4A9TA 2BTRA 3FPMA 2C3LA 5AMNA 3LHJA 4N70A 4J71A 3R2BA 4AZVA 2V22A 2Z02A 3FHRA 2QOBA 4CRSA 2X7OA 3ZEPA 3SC1A 4KD1A 2E9VA 3AC1A 3HMMA 4AN9A 4BCHA 3HLLA 3NNXA 2VTLA 4XG7A 3GFEA 4JNWA 4XOZA 3ORTA 4WIHA 5E9EA 4KSPA 3DKCA 4G5PA 2F2UA 4JR7A 5LXMA 2B9FA 5EOBA 3LFBA 3C0HA 3UGCA 4UEUA 5AR5A 4IFCA 4Q5EA 4F9AA 2GNHA 4YZ9A 4JBQA 4YBKA 4JG6A 4JXFA 4H58A 4DG2E 1V0PA 1WBTA 5CVFA 4B9DA 4P90A 5A3XA 1GIHA 2R3FA 3BZ3A 5M09A 4HGEA 4B0GA 4FZ7A 4H1JA 5JT2A 1IA9A 4RRVA 4RWJA 2YZAA 1YDRE 2BIYA 3W2SA 3LFQA 3PJ2A 1ZYCA 4EC8A 2YHVA 4MF0A 4YZDA 5F4NA 5AAEA 3QCXA 4TXCA 2EB2A 2UZUE 1H08A 4ZLOA 3PJ3A 4AGWA 4CV9A 3F7WA 5FUTA 3WF5A 4HVDA 3QUDA 2JDRA 2JFMA 5AM7A 5CU0A 3GXLA 3UJGA 2QR7A 4R8QA 2YFXA 4D2TA 4RVLA 2C6KA 2Z7QA 4P5ZA 2I6LA 5HU9A 1SYKA 4IJPA 3S95A 4YU2A 1OGUA 3GI3A 4K6ZA 1UKIA 2X1NA 3R21A 3GQLA 4FKPA 4RLLA 1G8AA 2XNOA 3OCBA 3V5TA 1IASA 5JFSA 3PY3A 1KE5A 3AC5A 4UBAA 4AE9A 2PVRA 3ROCA 4GS6A 2VWVA 3CGOA 2JD5A 3E87A 5HIEA 3TM0A 4BY9E 2ZM3A 4M69A 3ZLYA 4CQEA 3ORMA 3OTVA 1U5RA 3Q9YA 5GNKA 5HX6A 2GPHA 4KKEA 4KKGA 3FLQA 3HRBA 1QPEA 2JC6A 2DS1A 3LIJA 4S2ZA 2R3JA 1KE6A 3ALOA 3KXXA 4BIEA 2GHGA 2UUEA 5CXZA 5IH5A 3ZC5A 3MPTA 3NYVA 4FNWA 4RJ7A 3UPXA 4CQGA 2P2IA 3R8LA 3ENMA 2YIWA 3BLQA 4XYFA 1GY3A 3VUHA 3WYYA 3R1QA 4RZVA 4BHZA 4PP7A 5ACKA 4C2VA 2VWUA 3CQWA 3OROA 5AX9A 4CTBA 1Y8YA 3AMAA 4AW5A 4M0YA 5BVNA 2EVAA 3CTJA 3RAIA 5C8NA 2J4ZA 3BHUA 3QLFA 2JFLA 4L9IA 5DBXA 5IMEA 3ZUVA 4UALA 5GJDA 2UW8A 5C27A 2ITPA 3UC4A 1XBAA 3LMHA 5HCXA 2GSFA 4TRLA 3R8ZA 1Q3DA 3DY7A 5HX8A 4FL3A 4WUNA 5GZ9A 3C5UA 3OCSA 4K0YA 5AP3A 3V5JA 4DINA 3KN5A 1H4LA 3QRJA 4XCUA 3EHAA 1Q8TA 4K11A 3HP5A 1FPUA 1OPKA 2R0IA 3G51A 3E8EA 4PPAA 4RLKA 4FE2A 3HYHA 3TKHA 3NIZA 4HPUE 3R71A 4ZTHA 3O71A 4PTCA 1OPLA 3JXWA 4LV8A 4F99A 1W84A 3HA6A 3F61A 1JSTA 4L7FA 5HNBA 3VULA 2QOKA 1G5SA 4BBFA 2IVVA 3EL8A 3DCVA 2HY0A 5K4JA 4I21A 3ZLWA 5IEXA 5B0XA 4E7WA 4GIHA 3QTIA 3V8SA 4YMJA 3Q2JA 4FKQA 4DCEA 5K0KA 3HAMA 3BKBA 4GUBA 4LUEA 2R3PA 2XYNA 5DR6A 4NYEA 1VR2A 4EOPA 5LVNA 2YJSA 3SVVA 4FIGA 4U8ZA 1W7HA 1APME 2XM9A 4DA5A 3DNDA 3I81A 3W2PA 3NUPA 4F7JA 3E64A 3ORXA 5FD2A 1R1WA 2IW6A 4JVGA 3COIA 3DB6A 4C35A 3V5LA 3U6IA 2RFSA 2JIUA 3RMFA 4WBOA 2CGVA 1Q8ZA 4OBOA 4HNFA 4I24A 5TOZA 1FQ1B 5LMKA 3UQCA 3TDWA 1OL7A 3D9VA 3L8PA 3I4BA 4II5A 4IX4A 3OOGA 4ASEA 4BCPA 1ZOGA 4ZSAA 3LAUA 4S33A 4Y83A 4FTUA 2WMBA 5ANDA 4AACA 4EWHA 4TNBA 3PTGA 3FHIA 1DM2A 1PXKA 5BUJA 5EYCA 5CVGA 4AP7A 1FVTA 3B2TA 1OM1A 3C50A 3CC6A 5FLFA 4D55A 3HDNA 2C0IA 3C7QA 2XYUA 5TO8A 4AGUA 4I4EA 3FC2A 2HXLA 4BWKA 3FKLA 5BUEA 4BYIA 4O7NA 3ZRKA 3GC8A 3ZO2A 5CSVA 3TNIA 4PMMA 4O2PA 2WIPA 1XH9A 4UMQA 5HI2A 3S00A 2UZLA 4O96A 4YO6A 1WFCA 3OWPA 3FE3A 5HTBA 3HAVA 2FSTX 5JQ8A 4JDIA 1EH4A 2UW5A 3ACKA 3E8CA 3OY3A 4ACDA 3F5XA 3Q9WA 3WF6A 3MVHA 2R5TA 2QO7A 4FZAB 4ZXTA 5HG7A 1Q61A 2IW9A 3VRYA 2C5VA 4L68A 2XBAA 4RQVA 4EH6A 1IG1A 3W2QA 2WKMA 3GCVA 5L2WA 1P14A 3Q9ZA 3MBLA 3S4QA 4I22A 4JDJA 3BGZA 2ITNA 3R63A 4C02A 4E20A 2NP8A 2YIYA 2X2LA 3C13A 3R8MA 2ZV9A 5D9HA 2V55A 1NW1A 4IZ7A 3WZJA 5T68A 2GNLA 4ERKA 4QP1A 3HZTA 4BDBA 3PA5A 5E8UA 5D12A 1OMWA 2GHMA 4L00A 5CEIA 4W4VA 4BGGA 4LMUA 4MNEB 4FEXA 3PPKA 3ZM4A 5G1XA 1B6CB 1M14A 2OG8A 2YM4A 3ALNA 3HEGA 4QP4A 3L8XA 2R7IA 5AR4A 2OFUA 4CT1A 3TUDA 3L9LA 5I0BA 2WTKB 4ZIMA 3QAME 3CIKA 5L2IA 4ENYA 2W1HA 2OJGA 4FBXA 3PSDA 1STCE 1ZOEA 5FWKK 1BYGA 4WBBB 4PDPA 4YJUA 4WNMA 3CPBA 4DFBA 3U51A 5ANEA 3PJ8A 3P9JA 4FK3A 1Z57A 2QU5A 3FZOA 3IW8A 3LQ8A 4R1VA 5GJGA 5HU3A 4L3JA 4IVDA 1IEPA 3R0TA 3U4UA 3O50A 1LUFA 3AOXA 4G6NA 4N6ZA 2O0UA 3G2FA 4XG9A 1Y6BA
chains in the Genus database with same CATH superfamily
4IE9A 4CFUA 3VRZA 3BHHA 3OEZA 3OTUA 1A48A 1AD5A 2PUPA 5E8YA 2G9XA 3BL7A 1IA8A 2CKPA 4MAOA 4X3FA 3D0EA 4BDCA 2B1PA 2VD5A 2VWXA 4G34A 4BCFA 2R3NA 5CY3A 4OT6A 1U5QA 4EONA 4K18A 3VAPA 2ERZE 4LQMA 3E3PA 3MTFA 3CBLA 4GFOA 4ENXA 3KCKA 4KSQA 1KV1A 4BTFA 3OZ6A 4O6EA 3FQEA 4BWPA 5CAOA 1T46A 3RALA 1TQMA 5DNRA 3E8DA 2XM8A 3F69A 4S32A 3KULB 4IH8A 5DMZA 1MRUA 3EQGA 1UWJA 1Q3WA 4JRVA 4O83A 3DK7A 3OBGA 1URCA 3W0SA 2R3LA 1PKDA 3QQGA 3ORIA 1H1SA 4KIKA 2EWAA 5IA2A 2HZNA 3L8SA 4KUJA 4MQ1A 5AUVA 2UVZA 3GU7A 3BYVA 4KIQA 5KMLA 4CFNA 1OITA 3DXNA 3EYHA 4RBLA 3F3ZA 3R8UA 3ANQA 4FTAA 1OIQA 3LFAA 4C57A 1FMKA 3FQHA 2C6MA 4DEAA 4O7ZA 4WA9A 2WZJA 4BJJB 5CU6A 5IQHA 4QTDA 4I93A 2IEWA 2QO2A 2UW9A 5CI6A 4YHJA 3FEGA 2PVMA 4FUXA 4O21A 4XLVA 4XNEA 4YGAA 5LOHA 3UOJA 5DIAA 5B7VA 4MKCA 3V51A 3ORLA 4G5JA 4L6QA 4M84A 3N9XA 3AC2A 4KRCA 2WB8A 4R6VA 1AQ1A 2CNQA 2G01A 4CG8A 3VUIA 4OTGA 3OCGA 4PTGA 5F95A 5IA3A 4WNKA 2ITYA 2PHKA 3UODA 4I5PA 3PPJA 4HCUA 4HPTE 2BFXA 2NRYA 4FTNA 4BFMA 3NX8A 3L8VA 2B0QA 1YI6A 4O4DA 3MPMA 4W8EA 4O7WA 1REKA 4EH8A 4G16A 3C4XA 5LVPA 4DHZA 3PIZA 3VUKA 4C3PA 3BEGA 3EQFA 2X9EA 1OL1A 5AP5A 4L8MA 4XUFA 3V5QA 4IWDA 2X7GA 3KB7A 1PXOA 3QKLA 4O0VA 4OTWA 4NUSA 4YTIA 4YTFA 2WXVA 4HYIA 3K3JA 3DBEA 4RIWA 2AUHA 2YWPA 3MW1A 4RJ8A 3G33A 2PK9A 3NUNA 4FT7A 5F9EA 5A4QA 2XAOA 4DH8A 1JKSA 1RDQE 4RFMA 3SA0A 4FT5A 3QUPA 3FLZA 3OT8A 3PP1A 3TTJA 4R1YA 2WMRA 3DZOA 2PVNA 4AXAA 3KVXA 5EI6A 3UIMA 1XJDA 2XNPA 5CEQA 5KKRC 1RW8A 3OOMA 5C26A 2VNYA 5AUWA 2QLUA 4UYAA 2W05A 3JY9A 2X0QA 4O4CA 1UWHA 1H25A 4F70A 5JQ5A 4D1ZA 4RIWB 3QBNA 2GQSA 5CSWA 5CU2A 4ZK5A 4HVSA 2PTKA 3HNGA 4X2GA 5G6VA 2BTSA 2X2MA 3F2AA 3C51A 4EOOA 2WTCA 2OIDA 3RKBA 3R9RA 2A19B 3HMPA 3MESA 3DKFA 1W83A 2E9UA 4FA2A 3KRRA 4A9YA 4NEUA 5J5TA 4QMOA 3CD3A 3TZ7A 3NUUA 5CTPA 4JAJA 4LRJA 4FX3A 3I60A 2ERKA 1Y8GA 2GU8A 2CLXA 2X0PA 4BGHA 4G2FA 4DEEA 4DE4A 4YJQA 2RKUA 2C3JA 2Y4PA 4DH7A 4FKSA 3PJ1A 4G3GA 4WKQA 2JDSA 3GU6A 2QG7A 3COMA 3E7VA 3VS7A 2J0IA 2OU7A 2NYAA 4Q2AA 4GT5A 4MBIA 3WE8A 5J87A 1QMZA 3QQJA 3RVGA 2C0TA 3A62A 1W8CA 3A7JA 4XRLA 3NPCA 4Q9SA 3RINA 4FEWA 3MVMA 2XIXA 4MBJA 3OXZA 1QPCA 3A4OX 4R7HA 4TPTA 3H0ZA 3MJ1A 3UQGA 4QPMA 3HV6A 3D2KA 5J7HA 2XEZA 1J7UA 4FV4A 3N4TA 4DGMA 1Q8UA 2JBOA 2XK9A 5H9BA 1S9IA 4KINA 4AX8A 2WFYA 5CS6A 2Y7JA 3VQHA 3POOA 3FSKA 3C4FA 4WSYA 4GIIA 1SZMA 3EKKA 4F9WA 3ZFMA 4QDVA 3GC7A 3R2YA 4HYHA 4L43A 5H8BA 3NIEA 4C4IA 3TUBA 2GDOA 2IVUA 3DT1A 3DLZA 3IW6A 2JIIA 4X6RA 4PDYA 4DDGA 4YP8A 2FGIA 1R78A 3MVLA 4PP9A 4ALWA 2J5FA 2XIYA 3F6XA 1H1PA 4P5QA 4FOBA 4FV2A 3VN9A 3MB6A 4C4GA 3R9HA 4QD6A 5L8LA 3P7AA 4FIEA 2X8IA 3O8TA 4EBWA 3CJGA 5CF4A 2GTMA 1L8TA 3V5WA 1P4FA 1LPUA 4V04A 4EEVA 3O8UA 5EW8A 4J8NA 4UMUA 4DHIB 2W1IA 4DAWA 2WMAA 4FVPA 3R9NA 4IM0A 4FT9A 1Q8WA 3ATSA 4XBRA 1OPJA 3C4CA 4CXAA 3TIYA 4XEYA 3UBDA 2PUIA 2H96A 1MRYA 2VZ6A 4E93A 4D28A 4NM7A 1JQHA 5CZHA 4H36A 3R8PA 3PLSA 5CAUA 2X6EA 3TNWA 5LWMA 3LQ3A 2ZMDA 3QX4A 2WHBA 3H4JA 2XKCA 2V7AA 4CGAA 3F3VA 5L8KA 4BI0A 2I7QA 2W5BA 3FLSA 4A4OA 4IVAA 3DS6A 3HV7A 4F0GA 4UMPA 5KHXA 2QHMA 5L4QA 3W0PA 1LEZA 1DAWA 3I6WA 3R7EA 3BU3A 4MUQA 1ND4A 3BYMA 3QC9A 5BVWA 3RAWA 4QT1A 1MQBA 2Z7RA 2E9NA 2ITVA 5E92A 1M7NA 4IWOA 4D2WA 3OVVA 5DG5A 2YZLA 1GNGA 5JZNA 4OTFA 2FB8A 3GEQA 2X0OA 1J91A 4BVUA 1JNKA 5J1WA 2YIRA 4NKAA 5FDXA 3FWQA 2GMXA 4C58A 4EUUA 4ZJJA 2YCRA 2ITOA 2UW7A 3FLWA 4RIXB 5CAQA 2GFSA 4IM3A 3W2RA 4BL1A 4YO4A 4D1XA 2WTWA 2QCSA 4CTCA 4BTJA 4EH9A 4U45A 3D5WA 4R7BA 3ZO1A 3HV3A 3KQ7A 3R7YA 4BC6A 2B55A 4WG4A 1R0EA 4YC3A 3G9NA 3UNJA 3EZVA 1FGIA 1WAKA 4OTHA 5E1SA 3W2OA 4JT3A 4HOKA 4B99A 2G15A 2OH4A 4RVTA 3PZEA 4DEIA 4EORA 4OBQA 4GVAA 5L6PA 3RPVA 3MS9A 3KIOC 4DT9A 4CV8A 2UZEA 4CKRA 2WPAA 4IX6A 2WMWA 3WIGA 2VX3A 2YDIA 3DLSA 4LUDA 3GCSA 3K5VA 3BL9A 3NUYA 4AZWA 3KK8A 4AT3A 4ZSLA 4Z55A 5M56A 5HCZA 1YXVA 2FSMX 2QKRA 2WTVA 2YM7A 3FQSA 3QQFA 4FT3A 4QP7A 5CNNA 5DRBA 4ONAA 5C4LA 4C7TA 4DGGA 3ERKA 1YQJA 3BI6A 4RC2A 2R4BA 4YR8A 2AQXA 3BBTB 3JVSA 3E7OA 1ZARA 3T9TA 2UZVA 2HYYA 4FZ6A 4IDTA 4O22A 4AS0A 4F09A 4DBXA 4XX9A 3ZBXA 3WZEA 1GZNA 4FC0A 1F0QA 1P5EA 1KOAA 2ITWA 4E4NA 2C6TA 3FKOA 3UP7A 3A7IA 2VWZA 4HJOA 3AT4A 2YM6A 2Y6MA 2V7OA 3TXOA 2GCDA 2C3KA 3I0OA 4UZDA 2PY3A 5DH3A 3DFCB 4ANNA 4MH7A 4H3QA 3RAHA 4BGQA 3FZ1A 4G31A 3RWQA 3AXWA 3NZ0A 3RZFA 5IDNA 2BVAA 4APCA 5IH6A 5KX8A 3U55A 3MIYA 2WQBA 3ORPA 4CCUA 5EW3A 2DWBA 2IZSA 2XA4A 4FL1A 4RMZA 2OXDA 4LV7A 3N51A 2E2BA 3LM5A 4FNYA 3NYOA 4F64A 2XB7A 4IHPA 2BRNA 4FZDB 2C6LA 5EDRA 3F7ZA 5CWZA 3G15A 3BEAA 3THBA 5K4IA 2XKEA 1OKWA 4I3ZA 4JBPA 4WOVA 5BYZA 2W96B 3PRFA 4IWQA 5KCVA 2YITA 4DFLA 4AQCA 4E6DA 2W9FB 4BN1A 3W8QA 3C0GA 1SNUA 4FSNA 3EQRA 5J95A 5FGKA 5TKDA 4GK3A 3EJ1A 2BZJA 4JI9A 2PL0A 4FTRA 3OEFX 4NSTA 3CD8A 4BCOA 4G9CA 3G0EA 3OS3A 5I3RA 4DLJA 5BMMA 5GINE 4L45A 1PKGA 2JAMA 4FV3A 1R0PA 1WZYA 3IDBA 5IUHA 5JFXA 4UX9A 4NZWB 1Z9XA 2XVDA 4CMTA 3U54A 3NVKI 4V05A 2PE2A 2BFYA 3R22A 2F2CB 3O8PA 4QP6A 2G1TA 3NYXA 4RQKA 2BHHA 5AA9A 3FI4A 5AAFA 4EHZA 4AW1A 3EOCA 3ZBFA 3DXQA 3LXNA 4UB7A 3BU6A 3KEXA 2ITTA 2VU3A 3OD6X 1QCFA 3QZHA 4BIBA 4EQUA 3C5IA 1OL6A 2Z8CA 4NJDA 4IC7A 4FV1A 4JL9A 3SGCA 2VTTA 4QNYA 3PRIA 2CGXA 4GKIA 5EM7A 2FSLX 4FIJA 4O38A 5KMMA 2FA2A 2XUUA 5IKWA 2JDTA 5HVYA 2IVTA 4XP3A 1JBPE 1U4DA 4AZTA 4Y5QA 5LMAA 4FVQA 1MUOA 1OUKA 1PJKA 3QUEA 4FICA 4PRJA 2I1MA 4PUZA 4F4PA 5IPJA 4BZNA 2IPXA 2FVDA 3ETAA 4G3FA 3PSCA 5EHLA 1BL6A 3QXPA 3RPRA 3ZUUA 2PVKA 3OW3A 2VWYA 4FGBA 4E5AX 3QRIA 3NR9A 4I0RA 4XOYA 5H2UA 5I9XA 5DOSA 2RFNA 2I0YA 3NW6A 4FRFA 4DEHA 3POZA 4ITJA 4J1RA 3TT0A 4HVHA 3PZHA 3ANRA 5EKNA 5CT0A 3QZGA 4HZRA 4R3CA 3RPOA 4JIAA 3PVGA 3QWJA 4D4VA 1BL7A 5E7RA 3EL7A 4TWCA 3R9OA 5HIDA 4CKJA 2C69A 2J7TA 2R9SA 4YC6A 4BR3A 3KXHA 3EN7A 4OTQA 3ENHA 4ZMEA 5DE2A 4EHGA 3OFMA 4P2KA 3EQDA 4IAKA 4GYIA 5AUYA 1Q99A 4NT4A 3Q52A 2OF2A 2XNGA 3LFCA 3QCQA 3FLNC 3SX9A 3TNQB 2ITQA 4UMTA 2HZ4A 2VO3A 3MN3A 2QI8A 4U0IA 2W7XA 4ACGA 4NK9A 4HW7A 1PRYA 4K33A 2OLCA 5HD4A 2WQNA 4M7IA 1ZRZA 3RM7A 4U3ZA 5T3QA 3CQEA 3EKNA 3PG1A 4PDSA 5CSHA 1M2RA 2CKEA 2PVLA 3UVRA 4AGDA 3OUNB 4FI1A 3ZSIA 4O0XA 5JMSA 2WEIA 4D4SA 3ET7A 1YXUA 4WT6A 4FNXA 2P2HA 4IACA 3VUTA 1H07A 3LW0A 4L67A 4I6FA 3RNYA 3BRBA 3FI3A 2AYPA 3H0YA 3R04A 1NA7A 1TQPA 4PNIA 4QMUA 3EYGA 3U6JA 5I9WA 3BV3A 5DYJA 2OI4X 3ZLSA 2HAKA 4R7IA 5CLPA 3TNHA 1M2QA 3CS9A 1CKIA 4BDJA 2HY81 4ASZA 3DJ6A 1Q5KA 2BROA 1X8BA 4AN2A 4DH5A 2XNMA 3MTLA 2VO0A 3UOHA 3UDTA 2OW3A 4FV5A 5BVFA 4ZP5A 3UVPA 5D1JA 1PHKA 1ZLTA 3V6SA 2EXMA 4HNIA 1NVQA 3QZFA 4RFYA 4QMLA 4EBVA 1PXJA 2EU9A 4IC8A 3PY0A 3DV3A 4GYGA 3WI6A 4YZNA 4NFMA 3NNVA 2VTMA 3RM6A 4NM5A 5HNGA 3PXRA 3CGFA 1WVWA 3QU0A 5H8EA 1TZDA 3K3IA 2W0JA 5IQBA 3ODYX 3ZYAA 4MXYA 2PE0A 3W10A 4ANSA 3CEKA 4RIXA 4V01A 3A60A 3TV7A 5IQAA 3ZM9A 1DI8A 2QD9A 4YUQA 5JH6A 2ONLC 5IEYA 2BKKA 4G1WA 4GW8A 4ERWA 3FUPA 2X8EA 5CEKA 4L53A 2X8DA 3VUMA 4A9SA 3NGAA 3P1AA 3NSZA 5E8ZA 4BICA 1WBOA 3MH1A 4CNHA 4FTCA 2CKOA 4MYGA 4DLIA 4AQKA 2J6MA 3EFKA 4B8MA 1YI4A 5IA4A 2R7BA 1F3MC 5HQ0A 3HECA 3HV4A 2R3GA 3QD0A 5FTOA 3AMYA 3NAXA 3QRUA 4ORKA 4QO9A 4AF3A 4A4LA 2P3GX 2G2FA 2HW7A 2CPKE 3DXPA 3UYSA 4FYNA 4MHAA 3QRKA 4CFVA 1YXTA 5CANA 3OWLA 2OZAA 3LCOA 3QRTA 2QOQA 4GK2A 5CEPA 3SOAA 5FXRA 4U6RA 4NW6A 4C37A 3RZBA 2WQMA 4QMXA 5AIKA 4MXAA 4FOCA 2PZIA 3FXXA 4QPSA 4X2NA 1E1VA 2UW3A 5IU2A 3HX4A 5KMIA 2OH0E 3UOLA 4AAAA 2WU6A 2R3KA 4TYIA 4FKGA 4RZWA 2OIBA 3T9IA 3PE2A 3BGQA 3II5A 4Z9LA 5AP4A 2ZJWA 3R7GA 4XMOA 4I94A 4JIKA 3NUXA 4LL5A 4X3FC 1JSUA 2CGWA 3FJQE 4FKWA 2W4OA 4JMQA 3W1FA 2GS7A 1WBNA 4YNEA 2W17A 2VX0A 3EQBA 5AIRA 5HG9A 3A7FA 4FKJA 2WD1A 2VTHA 5LARA 3ZDIA 2B4SB 4H39A 4CEGA 3D5XA 3BLAA 4EOJA 3MV5A 5J7BA 2JLDA 3DK3A 1H00A 4QP8A 4BDFA 4FIFA 4EH4A 5FG8A 3MVJA 4FTOA 5ICPA 3U87A 2PULA 4C4FA 1OKZA 4OAVB 4HGSA 1YW2A 2XK3A 2C1BA 3RK5A 2YM3A 3EQHA 2GNIA 4Y8DA 4KBCA 1ZWSA 3OXTA 2EXEA 2OZAB 4AT4A 1AGWA 1PXIA 2C68A 2IN6A 3DAKA 4YSJA 4MEDA 4EWQA 1WBSA 3JPVA 2XH5A 2FH9A 1UA2A 3AD6A 2CN5A 3QQUA 2ZB0A 2CGUA 2BAQA 3ZO3A 1XR1A 1U46A 2YM5A 4MX9A 3FI2A 4O7TA 4NIFA 1GIJA 3E8NA 4MWIA 3WYXA 2V5QA 4FSWA 1ZYJA 4C33A 1PW2A 3C4ZA 4IQ6A 4FTJA 4FSTA 5EFQA 3ZUTA 3ZSGA 3ZXZA 2SRCA 3A99A 3C4EA 3CTQA 4BJJA 3VW6A 3MYGA 3D7ZA 4YJTA 3TL8A 4QPAA 3D7TB 3QD2B 5B2LA 4USEA 2ITXA 4TWNA 3NMUF 1NVRA 2CNUA 3TMOA 1IR3A 4EL9A 5FDPA 4DFNA 3CTHA 4RC4A 3TI1A 3PA3A 2QOHA 2XCHA 3KY2A 4K1BA 3ZXTA 1H8FA 2QOFA 1WMKA 4J99A 5ITAA 4L42A 2OJFE 4V0GB 5AR8A 2J0JA 3WILA 1SM2A 3I7BA 3VWAA 2XMYA 3QKMA 2ZV2A 2OFVA 3G6GA 3FMNA 4E3CA 5M55A 3UO6A 4ZTNA 2BDJA 3RK9A 3UYTA 5HBEA 2PZ5A 3EB0A 3S1HA 3V8WA 4B6LA 3CPCA 4ZSEA 2WGJA 4FK6A 5F1ZA 2C6OA 1HOWA 1K9AA 5J9LA 1IAJA 2ZM1A 4ZZOA 3MIAA 3M1SA 3FY0A 3SDJA 3H3CA 5CNOA 3FL5A 3E93A 2C6EA 1KV2A 2B9JA 1FVVA 2WOTA 3Q4UA 1H26A 4X6QC 4FEUA 2W1GA 2WMTA 2B9HA 2BALA 4GU6A 4BCIA 3VW8A 1K3AA 3Q4CA 4B8LA 1XMMA 5HCYA 2P0CA 4FSYA 1UKHA 5EHOA 2GTNA 2WTIA 4OR5A 4QMYA 2IJMA 4FG7A 3ORKA 4YBJA 5BVKA 3VJOA 5CX9A 3R8VA 1XO2B 5AV2A 1J7LA 2Y9QA 3SRVB 3TG1A 4J53A 4MWHA 4R3PA 3LZBA 3CY3A 5AX3A 4RJ5A 3HRCA 3UZRA 4DFZE 3H10A 3LXLA 5DRDA 2FYSA 4CZYB 2Y4IB 3ZHPC 1H27A 1V1KA 4O1OA 2XZSA 3ORZA 1GZ8A 3EIDA 1O6LA 2ETKA 2NRUA 3AKLA 4JDKA 5AWMA 4NKSA 4APPA 3I7CA 2C47A 1YXXA 4ZS0A 4TWPA 4YHFA 3BQCA 1T45A 4QYYA 5EDQA 4CLJA 3KC3A 1B38A 4RJ6A 2C0OA 4TYHB 4F0IA 1YOMA 3TWJA 4BI2A 5LVOA 3F66A 2XP2A 3KRXA 3T3UA 4CMOA 2B7AA 3NCZA 1UU7A 3G0FA 5GZ8A 2OWBA 4M8TA 3D83A 1OECA 3IO7A 3O96A 5DEWA 4NJ3A 5AP7A 5GHVA 1JOWB 3FMLA 3D5UA 2X7FA 2JAVA 4CCBA 4UWCA 4YPSA 4O7VA 2BRGA 1OL5A 1I44A 1KE8A 2UVXA 3LJ2A 4EK4A 4KS8A 3O0GA 1BI7A 5AP2A 2QC6A 2OIQA 4DG0E 3SHEA 3P08A 2GS2A 2WIHA 3NYNA 4FMQA 4IAFA 3SQQA 5IG1A 3A4PA 2H8HA 3HRFA 3ZS5A 2IO6A 1XKKA 5IMXA 5EKOA 2WQOA 2F49A 3V01A 1YHWA 3V8TA 4EZ5A 4E5WA 4DBNA 2XJ2A 4O6LA 3ZRLA 3BHTA 1LR4A 3MH2A 1M7QA 2IWIA 4TKSA 4E6CA 1GJOA 3EN9A 1OGYA 5AP1A 2O2UA 3MFSA 1J1CA 2PVYA 2WMVA 3PVUA 4IB5A 4YTCA 2QQ7A 3KU2A 2O5KA 5HD7A 4DTBA 3LPBA 3R1SA 1WVXA 2WOUA 4CYIA 3QYZA 1G3NA 3VF9A 3NS9A 3UPZA 2VTNA 1CKPA 1Q97A 3UNKA 4I23A 5E8SA 3V04A 1M17A 3BIZA 2A0CX 4I0SA 3PLAE 4XV1A 4EHVA 4O0WA 1VYWA 3FXZA 1G8SA 3IGGA 1UU8A 3VBQA 2GHLA 4O0SA 4PMTA 3BQRA 4O82A 5BVOA 3MWUA 3ZZEA 4BTKA 1YVJA 5M4FA 3EMGA 4BCKA 4LDTA 2UZWE 5KKRB 3GB2A 1J1BA 1XH6A 3EH9A 1XBBA 3M11A 1PYXA 3SXFA 1XH7A 2FO0A 4N0SA 4LL0A 4NW5A 3DBQA 2NO3A 4PL4A 3AGMA 4KS7A 4LYNA 1YI3A 4RG0A 4R78A 2VAGA 1SMHA 4XBUA 2ITZA 2QO9A 2WTDA 3LFFA 3Q6WA 1XQZA 4PQNA 1OBGA 3I79A 4D2RA 1MQ4A 2VX1A 3GENA 2HW6A 3B8RA 3DKOA 5HOAA 3TACA 4EJ7A 4KABA 4RPVA 4G17A 2J90A 3FL4A 4TL0A 4QQJA 4FSQA 1ZMUA 4FSZA 2BKZA 3FYJX 3WZUA 3E62A 2YIXA 2ZB1A 3HP2A 3VS2A 5FM2A 5TR6A 4MXXA 1FOTA 1XHAA 1U54B 4WNPA 3TUCA 4O2ZA 2R3RA 5A4LA 4EOQA 4PTEA 2XAMA 5CAVA 2PPQA 5E8TA 2RFDA 4GUEA 1H1RA 2XIKA 1NY3A 5HEZA 1U59A 3R83A 4RX5A 4AE6A 2IZRA 4CG9A 5AV4A 2HIWA 2XNNA 3KK9A 4I41A 3DZQA 4WG3A 5KMOA 2YM8A 4PPBA 5IQEA 1YXSA 3NEWA 2CLQA 3PVBA 2AC3A 1BMKA 3B8QA 3D7TA 4GFMA 3DDQA 4ARKA 1K2PA 3VO3A 4BBMA 3PFYA 2X2KA 3AMBA 4U97A 2XJ1A 1A9UA 4X21A 4GRBA 3R7IA 4C61A 5BNJA 4AOIA 1WCCA 2W5HA 3EZRA 5E8XA 3FAAA 4DH1A 5DR2A 3VHKA 3TJDA 2Q0NA 3PE1A 5DEYA 5EW9A 5I5ZA 3NCGA 4CRLA 3KVWA 4U79A 2WEVA 5EQPA 3VVHA 3IECA 2B52A 3VS5A 3MY0A 4RWLA 2W9ZB 5M44A 3Q3BA 1W98A 2YERA 4FTQA 2HELA 3GT8A 4Q5HA 3TIZA 4EI4A 5JRQA 4R77A 2QNJA 5HKMA 2YAAA 3QQHA 3KFAA 3ACJA 4FKVA 4WD5A 4D2VA 1Q24A 4TY1A 4ZJIA 3VS4A 3MSSA 4J7BA 4NU1A 3BE2A 4UWYA 2HZ0A 3V6RA 2C3IB 1ERKA 3DNEA 2JKQA 3BWFA 3DK6A 3L9NA 5ETFA 4I6QA 3GBZA 3QTXA 3KMWA 5KE0A 3ZRMA 4KA3A 3ZC6A 3A8XA 4BKJA 2WU7A 4YLLA 5EM8A 4FG8A 3G90X 4C4HA 2YABA 3KN6A 4D58A 3CP9A 3WZKA 3U9NA 4I5HA 5ETAA 2B53A 3QF9A 4IJ9A 4ANBA 4O0RA 2AC5A 5T6KA 5L2SA 4JBOA 4I1ZA 1G8JA 2W1DA 4GKHA 3ELJA 4M14A 4XV2A 3AQVA 4X2JA 5LCJA 3BCEA 4TTHB 5JN2A 5FM3A 3UG2A 4RC3A 4FYOA 4AXEA 4A4XA 1UNGA 4QOXA 3UE4A 4O7SA 3TKIA 4AG8A 4UWBA 2I40A 5B2MA 3RCJA 5HTIA 5IISA 2O64A 4G6LA 3WIKA 4DYMA 2PU8A 2BMCA 5AR2A 2QG5A 2XBJA 3DAEA 3DGKA 3FMMA 4LV5A 2PUNA 2BILB 4XG6A 4FEVA 4KNBA 3K2LA 4ITHA 5ANJA 4GG5A 3A7HA 4IBMA 3OUKA 5E90A 4ZLZA 4EKKA 5K5XA 2PMNX 1Q41A 4MXOA 4G3DA 2PYWA 3L9MA 5C8MA 3R1YA 4O0UA 3E5AA 5FEDA 4AXFA 3OXIA 2BPMA 3JR1A 5IQFA 3DTWA 4RJ4A 1JSVA 1ZOHA 4CLIA 2O65A 4UY9A 4OLIA 3RPSA 4F78A 1OIYA 3OHTA 3GCQA 4MD7E 3IOKA 4U41A 5HE0A 3CSVA 4EK8A 5CF5A 4A07A 4S34A 3ZU7A 4N4SA 3LCSA 4BDDA 5KBRA 5EQEA 3FPQA 3COKA 3GUBA 3W33A 5EI2A 5DFPA 4HGLA 2JGZA 3LCDA 5J1VA 2Y8OA 3QCYA 4CFMA 5K5NA 5EM5A 2YLEA 3EQPA 1XMLA 2H9VA 4RIYB 2XNBA 5C8KA 3ATTA 4DITA 3D5VA 4KAOA 4AW2A 2BRHA 3MI9A 5CF6A 4K77A 1PYEA 2B9IA 3L9PA 4J95A 4XP2A 5CXHA 4D4YA 2UZBA 3RBWA 4X0MA 4E6AA 3SXSA 5DA3A 3GU8A 4ZTLA 3QGYA 2GS6A 2OJJA 4FUYA 2PZPA 4NWMA 5LVLA 1GAGA 5BVDA 4XG8A 1TFFA 2HXQA 3FZSA 5DT4A 5D41A 3VBTA 4JG8A 4LRKA 5C1QB 5FBNC 2BIKB 5H8GA 3KGAA 3D4QA 4PMSA 4BF2A 4E4LA 4EJNA 4ZAUA 4NL0A 3Q96A 1JWHA 3CR0A 2BRBA 5JKGA 1H0WA 4ANMA 5DT0A 5DT3A 2O8YA 1G8KA 4DHJA 2ETMA 4FKIA 1P2AA 2RSVA 2F4JA 2XK4A 3RWPA 4IZYA 4QMQA 3QQKA 3P78A 4RSSA 1FINA 2J9MA 2I0HA 3EWHA 2W06A 2G2IA 4K9YA 2W1ZA 2P33A 4USDA 1BI8A 2R0UA 5ANKA 4QRCA 3BU5A 2BDFA 3Q4TA 5HBHA 3RHXA 4AXCA 1PXNA 2BAKA 4LG4A 3NNUA 5LCKA 4RT7A 3FMKA 3P7CA 1JVPP 3A8WA 4I6BA 3OWKA 5I9UA 1WBWA 2REIA 4C62A 3DA6A 2QU6A 1ZMVA 4F1TA 5CALA 3UVQA 2CCHA 3PXYA 4D0WA 4XRJA 5CT7A 4G3CA 2VTPA 4JDHA 3FV8A 3W8LA 1Y6AA 3R7OA 2ZDTA 4JQ7A 5KNJA 1LP4A 2RG6A 3AC8A 1PMNA 2X81A 3MA6A 1CTPE 4AN3A 4BDAA 4IXPA 4TT7A 2RL5A 4OBPA 4QTCA 4O81A 1IRKA 3HDMA 3EN6A 3MY5A 4G6OA 2J2IB 3NRMA 3OC1A 3HV5A 4C3RA 4JX3A 4BDIA 1YDTE 3TDVA 5M06A 4W4YA 3LFDA 2RF9A 4EOKA 3KMUA 4W9WA 3V5PA 4LGDA 4U43A 2R3MA 3D15A 4AA5A 3SG8A 5DGZA 1M2PA 5IA1A 4MF1A 2Y4IC 3FLYA 3ULZA 4YJSA 4W9XA 4ZTSA 3WF9A 2OSCA 3EFWA 3FMDA 4F0FA 2F7XE 3ZOSA 4H3BA 2QOCA 5A4EA 5JZJA 4O91A 3PY1A 1XH4A 4YJOA 2C5XA 4BKYA 4UYNA 4BKZA 4M0ZA 4AUAA 2QLQA