5KP3A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to equilenin; d40n, y57(cl-y)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
127
structure length
126
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title A Critical Test of the Electrostatic Contribution to Catalysis with Noncanonical Amino Acids in Ketosteroid Isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
total genus 34
structure length 126
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2016-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5kp3A00
1OH0A 1JB5A 1S5AA 4HKVB 5FW5A 5DRVA 3IPTA 1CQSA 4HM6B 2BNGA 3EN1B 5CLKA 2HMMB 3OWSA 4XDWA 5IG0A 1IDPA 4PEJA 3GZYB 5KP1A 5IERA 1OHOA 4N3VA 3FF2A 3NM2A 3FH1A 2IMJA 3FKAA 4IIAA 3A76A 1E3RA 3FGYA 4XBTA 4HM4B 5D81A 2GXFA 2GBXB 1GYBA 1U5OA 2HMNB 5JPPA 5D82A 2XRXB 1JB4A 3STDA 3SOYA 2YFLB 1JKGA 1OCVA 1UUWB 4H3UA 1TUHA 3GWRA 3BB9A 5AEUB 3K7CA 1W02A 2JQ5A 4HM8B 1QMAA 1K41A 3S5CA 6STDA 1OPYA 3UNLA 3RGAA 3B4PA 3GZBA 3D9RA 3HK4A 1ZX2A 1OGZA 4HM1B 2HMJB 1GS3A 4HM3B 1O7NB 3CU3A 3H51A 3LZAA 3EF8A 1A2KA 4Q53A 4XBYA 3HX8A 2BMQB 3CNXA 5JPUA 2CKFB 3G16A 3NBRA 1STDA 2UX0A 4R1KA 4XDVA 8CHOA 1ISKA 2K54A 3FF0A 1O7GB 1EG9B 2YFIB 1O7MB 3DUKA 4J9AA 3CPOA 4X2OA 3NUVA 4WWUC 1JN5A 5CK6A 3JUPA 3ROBA 4WYKA 3JUOA 3Q90A 4HZBB 5CF1A 1OHSA 3HZPA 1E3VA 1SJWA 1HKXA 1DMNA 3GZRA 4X2HA 1TP6A 2R4IA 1ASKA 3F9SA 3T8UA 1QJGA 3K0ZA 3OWUA 2BMRB 4MJDA 2Z7AA 1BUQA 1O7HB 5TGNA 3EQQB 3B8LA 1OHPA 1OGXA 1AR0A 2HMLB 5D83A 2INXA 3JUMA 3MKIA 5DREA 4HM2B 4HVNA 1ULJB 1JN5B 1JB2A 1GY6A 4R9KA 4WYKB 3B7CA 1C7HA 3EX9A 4HM0B 3F7SA 4L7KA 3GZXB 3DZLA 2HMKB 2F98A 3SEDA 5AEWB 2I9WA 2BMOB 4WP5A 5IEPA 5AIGA 2QGUA 5AIHA 1W6YA 3WMDA 3BLZA 5KP4A 3EJVA 1GY7A 4L8PA 3OWYA 3DM8A 2GEYA 3MHEA 3H3HA 1JKGB 2XSHB 4FCJA 4RZMA 1W01A 1DMMA 3NXJA 1O7WB 3F8HA 3F8XA 2F99A 5IENA 4ORLA 1OF5A 5IF6A 3CNMA 1OUNA 4XB5A 1Z1SA 4CDLA 3NV0A 3VGNA 3F40A 2PZVA 4R9LA 3DMCA 5AIIA 2RCDA 1NWWA 3VSYA 3JUNA 2HMOB 5CF2A 2B1XB 3LYGA 4K1VA 3ER7A 3MYTA 3MSOA 4OVMA 4I4KA 3ECFA 4HM7B 2F86B 1O7PB 3MG3A 1E97A 3EBTA 4J8TA 2RFRA 3EN8A 1GY5A 2A15A 3SOAA 3OX9A 2XSOB 5BXQA 3E99A 5IG4A 1NDOB 3EBYA 2STDA 1OF5B 4GB5A 1ZO2A 2W2CA 2OWPA 3OXAA 5STDA 3NV0B 5AIFA 4LMIA 1WQLB 3B4OA 3FZWA 4HM5B 3KZTA 4L8OA 3G0KA 3M8CA 4XBXA 1NU3A 4STDA 3T8NA 1Q40A 1UUVB 3MG1A 5G2GA 3FSDA 4OUQA 2XR8B 2Z76A 5IG5A 4FCMA 3I0YA 2B24B 2RGQA 3RGRA 3F7XA 2QIYA 5AI1A 2Z77A 1ULIB 5KP3A 5BVBA 7STDA 3KSPA 3UJMA 3OV4A 3EHCA 4LGQA 4XM4A 3KKGA 2YFJB 5IG3A 3NHXA 5CXOA 4U13A 3KE7A 3GRDA 2CHCA 4HZ9B 1Q42A 5IEOA 3MG2A 4LEHA 1Q40B 4HJLB 3F14A 2GEXA 3FLJA 5HGRA 1W00A 2GBWB 4K1UA 1VZZA 3DXOA 3JUQA 1EA2A 3EC9A 4KVHA 3G8ZA 1DMQA 5EVHA
chains in the Genus database with same CATH superfamily
1MWSA 1OH0A 1JB5A 1LNIA 1S5AA 4HKVB 1N5PA 5FW5A 3CCJ3 5DRVA 2RSXA 3X3ZA 1UCJA 3JVCA 3VF1A 1FGMA 3PS8A 3QRDA 2XF3A 4KFEA 1TU5A 1FGQA 2WGOA 1RCKA 1JBRA 1WTHA 2AADA 1UI8A 3IPTA 1RLSA 1CQSA 3LXUX 4HM6B 4BIRA 1GD4A 4LZIA 1NNVA 5JBSA 2BNGA 3EN1B 3LH4A 5CLKA 4GL6A 2HMMB 3OWSA 1WMNA 2W56A 4XDWA 4AKZA 5IG0A 3G6E3 2CG1A 2L1SA 3BNEA 1UGHI 3D5GA 1IDPA 3AMOB 4PEJA 3GZYB 5KP1A 5IERA 3AHWA 1FUWA 1OHOA 1DETA 1T5YA 3SYUA 1LRAA 1Q7HA 1X1XA 2RNTA 1UCKA 3IJEB 4JF8A 4N3VA 2CX1A 1A67A 1GSPA 2KXGA 1IVUA 3FF2A 3HIIA 1YGEA 1HU9A 1I2GA 2F56A 1JNQA 1I8VA 3FH1A 3NM2A 1AVKA 1FW7A 5I97A 2Y73A 1BNJA 4O2HA 1B3SA 1EKMA 4LSOA 1W2B2 2IMJA 1K734 3FKAA 2D1WA 4IIAA 4R4KA 3SLUA 1J2BA 3NQZA 3A76A 1E3RA 3FG4A 3FGYA 4XBTA 4AKYA 1UW1A 4HM4B 5D81A 4CPKA 4EV5A 1PFPA 2GXFA 2GBXB 4RBNA 2E2VA 1K28A 1GYBA 1U5OA 2HMNB 4JRFA 5D82A 2XRXB 1JB4A 4QWTA 3STDA 1B2SA 1LOYA 5JPPA 4N6MA 3G713 3N9HA 1FA3A 2CFKA 1CYUA 4G1MB 3L0RA 3D5IA 1SQWA 3SOYA 5AYRB 2W56B 5HOHA 2YFLB 1JKGA 1OCVA 4BL2A 1UUWB 2W04A 1RNBA 2PNCA 4H3UA 3CD63 4O8SA 3CCS3 1VQ43 1TUHA 3GWRA 3BB9A 1RSNA 1BAOA 1BNIA 1BVIA 3Q3FA 2CH9A 5AEUB 3NM7A 1G02A 3S28A 2OQEC 3K7CA 1WMOA 1YIT3 2C4BA 3PZWA 1L5GB 1W02A 1RDSA 4EV2A 3DY5A 3EE1A 1HYFA 1RKYA 4EC6A 2JDIH 2CW9A 2JQ5A 1IVXA 1BRJA 1JRQA 3PXMA 1VQO3 1RGFA 4HM8B 2H0IA 1QAKA 1U8CB 4FCZA 5AYSC 3U1WA 2AAEA 1I2EA 1QMAA 3KCHA 1K41A 1LXEA 1YVSA 3S5CA 2IYJA 2CFWA 1PU4A 3CCR3 2W6JH 4N6OB 1BRNL 1V74A 5IW9A 1BGSA 6STDA 1MOLA 1OPYA 3UNLA 2HOHA 3BNBA 3RGAA 1JZOA 3I553 1I0XA 3B4PA 2KF6A 3GZBA 1TFOA 3TDGA 3D9RA 1SARA 3QK9A 2O3OA 2XFTA 3HK4A 2KAAA 1BU4A 2Z6BA 3EB8A 6GSPA 1ZX2A 1OGZA 3GSPA 3NBBA 4HM1B 3WOFB 1T2HA 2HMJB 1YJW3 1A2PA 1GS3A 4HM3B 1QAFA 4GHOA 1SIHA 4HAAA 1O7NB 3CU3A 3H51A 3LZAA 3EF8A 2OOVA 1G0TA 1A2KA 1N5HA 4O02B 2BT3A 4Q53A 2C11A 1BNEA 3UB1A 2L4VA 4HOHA 1MWRA 3Q2PA 1YJ93 1VQ53 5ELUA 3ZG0A 5G1KA 3CCL3 3DGOA 4XBYA 3DGNA 3HX8A 1B2UA 2BMQB 3CNXA 1TTOA 3HOHA 2CKFB 3G16A 3PCSA 1MGWA 5JPUA 3CPW2 3NBRA 3LT9A 2KF4A 4N6TA 1STDA 2UX0A 4R80A 1W2ZA 4R1KA 1RRHA 4XDVA 8CHOA 1B2ZA 2K54A 3CCM3 1BRSA 1ZGXA 3FF0A 1O7GB 1ISKA 1EG9B 2YFIB 1O7MB 3DUKA 4J9AA 4MMYB 4N6UA 1BANA 3OW22 1FGOA 2CX0A 1IVVA 3CPOA 4X2OA 1DVCA 3NUVA 1VQ93 3AGNA 3PGBA 1F8NA 2F5MA 2CFDA 4WWUC 1JN5A 5CK6A 3JUPA 1LVNA 2BIRA 1LQGC 3ROBA 1AVLA 1G96A 1X1WA 2KF3A 4WYKA 2ZA4A 3JUOA 1I3IA 1IT8A 3MWZA 3Q90A 4HZBB 3HIGA 1JBTA 5CF1A 1OHSA 3HZPA 1PYLA 1E3VA 1AY7A 4N6NB 3UL6A 1V57A 1SJWA 2P38A 4MMXB 1ROVA 4KT3B 1HKXA 1RHLA 5M18A 1DMNA 1HZ1A 3GZRA 3LTCA 1TP6A 4X2HA 1FYSA 1Q824 1FUTA 2R4IA 1ASKA 1LQMB 3F9SA 2MC8A 4FR9A 1RJOA 2ZHXB 1IV7A 4HBRA 3T8UA 1LOXA 5GSPA 1QJGA 3K0ZA 1KQS2 3OWUA 2BMRB 2W0QA 1DE3A 1A2VA 1IVWA 4MJDA 2Y74A 2Z7AA 1BUQA 1O7HB 2WOHA 2IUKA 5TGNA 2XFSA 3EQQB 3B8LA 3LTAA 4ILFA 1OHPA 1OGXA 5ELJA 1AR0A 2HMLB 2UUGC 5D83A 1UCLA 1YIJ3 5BU4A 2INXA 3AHSA 3JUMA 4OK0A 3J7Yd 3BU4A 3MKIA 1FGTA 3G4S3 5DREA 1NB3I 4HM2B 1LNHA 4HVNA 1ULJB 1VQN3 4MEIA 1IK3A 1JN5B 1JB2A 1VQM3 1GY6A 1YNVX 3WHOA 1R4CA 3NBJA 4R9KA 3SXXA 4WYKB 1VQ73 2CG0A 3B7CA 1C7HA 5EEOA 1CEWI 3WA2X 3EX9A 4HM0B 3F7SA 3HI7A 3V92A 1AV4A 1I3FA 4L7KA 2KF5A 1FZUA 3Q1CA 1B2XA 1MWUA 3GZXB 3X41A 3DZLA 2HMKB 1BRGA 2F98A 3SEDA 3CCV3 3NQYA 1UDII 4CJNA 3T0UA 1BIRA 5AEWB 1ZS7A 3DGMA 1JV2B 1N9EA 3DH2A 3LT8A 2I9WA 2BMOB 3D79A 2CFGA 4K90B 4KFDA 3BIRA 4WP5A 5IEPA 2QEX3 2OTJ3 4NHFA 1K9M4 5AIGA 4BL3A 2W03A 4RNZA 4FMDA 1YGWA 3NX0A 1BUJA 1RRLA 2QGUA 5AIHA 2BHMA 2K3DA 1W6YA 3AGOA 3WMDA 4IPBA 2H0HA 2D42A 3BLZA 1Q7Y4 1D6UA 1TFKA 2P09A 5KP4A 1T2IA 3EJVA 3LOYA 2M7OA 3KFQC 3URPA 4ZM8A 3ALAA 1GY7A 3MPHA 4L8PA 3S27A 1BSAA 4MMZB 3OWYA 3KSED 3DM8A 1GOYA 2GEYA 1CH0A 3H3HA 1JKGB 3MHEA 1BRHA 1GMPA 1RN4A 2XSHB 4FCJA 1W4NA 2LYXA 1BNGA 2WOFA 4J5KA 3S29A 3I563 4HYZA 4RZMA 5FGOA 2OQEA 3WR2A 1W01A 3RNTA 1WMPA 3IMAB 2ML5A 1DMMA 1RGGA 2OCTA 3NXJA 1RTUA 1TRPA 3WDGB 9RNTA 1O7WB 3CMA3 3F8HA 3F8XA 2F99A 3UL5A 4DKIA 4BTXA 2BU4A 3N54B 5IENA 1A90A 1RMSA 1BOXA 1BNFA 1MWTA 2W9PA 1JBSA 1SPUA 3PYJA 1I0VA 1SIIA 1NJI4 1IQXA 2CWUA 3AMOA 4ORLA 1OF5A 5IF6A 1GMRA 1OUNA 1RGCA 3CNMA 3PCRA 4XB5A 2KRTA 3SVAA 1IT7A 3K63A 1Z1SA 1V58A 4CDLA 3NV0A 2IUJA 3VGNA 1DVDA 2SARA 1C54A 3F40A 2PZVA 1CYVA 4R9LA 2W9QA 3DMCA 3KIIA 5AIIA 2RCDA 1NWWA 2IY2A 2WO0A 3VSYA 1KD14 3JUNA 4KFFA 4TX4A 1NO3A 2HMOB 5CF2A 2B1XB 3LYGA 5EQLA 4K1VA 4LYLB 3CC23 1EEJA 2C10A 5RNTA 1M1K4 2GU1A 3ER7A 2FGTA 2ZDJA 4O3VA 2P0MA 3D3LA 3MYTA 1KC84 1RGHA 3MSOA 4OVMA 4I4KA 2CK3H 4FMAA 4EXRA 1B27A 3ECFA 4HM7B 2F86B 1TJDA 1O7PB 5G1LA 1YHQ3 3MG3A 3N8BA 1E97A 3EBTA 1WNHA 1RN1A 4J8TA 1EUIC 2RFRA 2CWVA 2UGIA 3EN8A 1MGRA 1GY5A 2A15A 3SOAA 3CCE3 3OX9A 2XSOB 2IA7A 3E99A 4RNTA 3WODG 5BIRA 5BXQA 3BNDA 5IG4A 3S67A 1M904 1NDOB 2RBIA 3EBYA 5A0OB 2STDA 4BTWA 2V1LA 1OF5B 4GB5A 2KCDA 4WFOA 1US1A 4KZ1A 1RGLA 1GOVA 3D4AA 3X3YA 1ZO2A 1TIJA 2OWPA 2W2CA 1STFI 3CC43 3OXAA 5STDA 3CXC2 3FG1A 2ML6A 1RGEA 3CC73 3V99A 3NV0B 1Y4KA 4FMCA 3CCQ3 3FG3A 1YJN3 2F5WA 1K8A4 5AIFA 1KSIA 3KN4A 3X3XA 3ZFZA 2H0GA 2O9UX 2XH9A 4LMIA 1S723 1RNTA 1D6YA 1WQLB 4EYCA 1I2FA 3B4OA 3FZWA 1RCLA 1B20A 1RGAA 4HM5B 2XEPA 3KZTA 4NPBA 4BTYA 1VQP3 1VQK3 7GSPA 3WA3A 4L8OA 3G0KA 1X1YA 2E2UA 3M8CA 3O8YA 4FMBA 1IV9A 2WGQA 1M1XB 4XBXA 1YVBI 3U97A 1B2MA 1UUGB 1NU3A 3BNCA 1IQYA 4STDA 4AEQA 3T8NA 1Q40A 1UUVB 1VQ63 1PY3A 1QALA 3V98A 1N9JA 1GMQA 3MG1A 1GD3A 1RGKA 3FSDA 5G2GA 1IYYA 4OUQA 1YI23 1BSCA 4H61A 5LC7A 2XR8B 2Z76A 5IG5A 1Q814 2P0XA 4FCMA 3I0YA 4N6V0 4WHAA 1UCIA 2CIUA 1Q864 3A5EA 2SBLA 2B24B 1AQZA 1I70A 2RGQA 1LOWA 2OOVC 3RGRA 1T3BA 3F7XA 2QIYA 1BNSA 5AI1A 3CME3 1W6GA 2P05A 2Z77A 4J5GA 2FXTA 2YX9A 1W6CA 2LQVA 1N8R4 1ULIB 5KP3A 4CCVA 5BVBA 2Q07A 7STDA 3KSPA 1BSDA 3UJMA 2F4YA 3X40A 2QA43 3OV4A 1W5ZA 4GSPA 3EHCA 2FNQA 4LGQA 4XM4A 3KKGA 2YFJB 1TRQA 5IG3A 1JZDA 5M19A 2CWTA 2GU3A 1BSBA 4IT7A 1BRIA 1DYUA 1FGRA 1X1UA 3X42A 2E2TA 3LTDA 1N8QA 2R41A 3NHXA 4I5QA 5CXOA 1B21A 1RN7A 4U13A 3KE7A 3GRDA 6RNTA 2CHCA 1W7CA 4HZ9B 1BRKA 1NB5I 3RDEA 3DGLA 1Q42A 1OACA 8RNTA 1VQL3 5IEOA 2MF7A 3K9MC 3MG2A 4LEHA 3WOEB 1BNRA 1FUSA 1Q40B 1QVG2 4HJLB 1MNLA 3F14A 4N6LA 1LOVA 1EQKA 3FCSB 2GEXA 1KWIA 2K0MA 3FLJA 5HGRA 1W00A 1M9GA 2J8XB 2ZL8A 3LTBA 1IQ8A 1Q9EA 2GBWB 4K1UA 1JJ22 1VZZA 1GOUA 3DXOA 4RNYA 1D6ZA 7RNTA 1VQQA 1UGIA 3JUQA 3CCU3 1R4YA 2XGNA 5M1AA 1EA2A 3EC9A 3GAXA 4KVHA 1ROAA 2GSPA 5LC6A 3DGYA 1VQ83 3SX1A 4BU4A 1QVF2 1BSEA 1IU7A 2XGLA 3ZG5A 3G8ZA 1DMQA 4EW5A 2CFLA 4NREA 2OTL3 1UI7A 2BO9B 4K61A 3LMLA 4EBGA 5EVHA 3K5TA 2CC3A
chains in the Genus database with same CATH topology
1OH0A 1JB5A 1S5AA 4HKVB 1N5PA 5FW5A 3CCJ3 5DRVA 2RSXA 3X3ZA 3JVCA 3VF1A 1FGMA 3PS8A 3QRDA 2XF3A 4KFEA 1TU5A 1FGQA 2WGOA 1WTHA 1UI8A 3IPTA 1CQSA 3LXUX 4HM6B 1GD4A 4LZIA 5JBSA 2BNGA 3EN1B 3LH4A 5CLKA 4GL6A 2HMMB 3OWSA 1WMNA 2W56A 4XDWA 4AKZA 5IG0A 3G6E3 2CG1A 3BNEA 1IDPA 3AMOB 4PEJA 3GZYB 5KP1A 5IERA 1FUWA 1OHOA 1T5YA 3IJEB 4JF8A 4N3VA 1A67A 2KXGA 1IVUA 3FF2A 3HIIA 1YGEA 1HU9A 1JNQA 3NM2A 3FH1A 1AVKA 5I97A 2Y73A 4O2HA 1K734 1EKMA 4LSOA 1W2B2 2IMJA 3FKAA 2D1WA 4IIAA 4R4KA 3SLUA 1J2BA 3NQZA 3A76A 1E3RA 3FG4A 3FGYA 4XBTA 4AKYA 1UW1A 4HM4B 5D81A 4EV5A 1PFPA 2GXFA 2GBXB 4RBNA 2E2VA 1K28A 1GYBA 1U5OA 2HMNB 4JRFA 5D82A 2XRXB 1JB4A 4QWTA 3STDA 5JPPA 3G713 4N6MA 1FA3A 3N9HA 2CFKA 1CYUA 4G1MB 3L0RA 1SQWA 3SOYA 5AYRB 2W56B 2YFLB 1JKGA 1OCVA 1UUWB 2W04A 2PNCA 4H3UA 3CD63 4O8SA 3CCS3 1VQ43 1TUHA 3GWRA 3BB9A 2CH9A 5AEUB 3NM7A 3S28A 2OQEC 3K7CA 1WMOA 1YIT3 3PZWA 1L5GB 1W02A 4EV2A 3DY5A 3EE1A 1RKYA 4EC6A 2JDIH 2CW9A 2JQ5A 1IVXA 1JRQA 3PXMA 1VQO3 4HM8B 1QAKA 1U8CB 4FCZA 5AYSC 3U1WA 1QMAA 1K41A 1LXEA 3S5CA 2CFWA 1PU4A 3CCR3 2W6JH 4N6OB 1V74A 5IW9A 6STDA 1MOLA 1OPYA 3UNLA 3BNBA 3RGAA 3I553 3B4PA 3GZBA 3TDGA 1TFOA 3D9RA 3QK9A 2O3OA 2XFTA 3HK4A 2Z6BA 3EB8A 1ZX2A 1OGZA 3NBBA 4HM1B 3WOFB 2HMJB 1YJW3 1GS3A 4HM3B 1QAFA 1SIHA 1O7NB 3CU3A 3H51A 3LZAA 3EF8A 2OOVA 1N5HA 1A2KA 4O02B 2BT3A 4Q53A 2C11A 3UB1A 2L4VA 1YJ93 3Q2PA 1VQ53 5ELUA 3CCL3 3DGOA 4XBYA 3DGNA 3HX8A 2BMQB 3CNXA 3PCSA 5JPUA 3CPW2 2CKFB 3G16A 3NBRA 3LT9A 4N6TA 1STDA 2UX0A 4R80A 1W2ZA 4R1KA 1RRHA 4XDVA 8CHOA 3CCM3 2K54A 1ISKA 3FF0A 1O7GB 1EG9B 2YFIB 1O7MB 3DUKA 4J9AA 4MMYB 4N6UA 3OW22 1FGOA 1IVVA 3CPOA 4X2OA 1DVCA 3NUVA 1VQ93 3PGBA 1F8NA 2CFDA 4WWUC 1JN5A 5CK6A 3JUPA 1LVNA 3ROBA 1AVLA 1G96A 4WYKA 3JUOA 3MWZA 1IT8A 3Q90A 4HZBB 3HIGA 5CF1A 1OHSA 3HZPA 4N6NB 1E3VA 3UL6A 1SJWA 2P38A 4MMXB 1ROVA 1HKXA 1DMNA 3GZRA 3LTCA 1TP6A 4X2HA 1Q824 2R4IA 1ASKA 3F9SA 2MC8A 4FR9A 1RJOA 4HBRA 1IV7A 3T8UA 1LOXA 1QJGA 3K0ZA 1KQS2 3OWUA 2BMRB 2W0QA 1A2VA 1IVWA 4MJDA 2Y74A 2Z7AA 1BUQA 1O7HB 2WOHA 2IUKA 5TGNA 2XFSA 3EQQB 3B8LA 3LTAA 1OHPA 1OGXA 5ELJA 1AR0A 2HMLB 5D83A 1YIJ3 2INXA 3JUMA 3J7Yd 4OK0A 3MKIA 1FGTA 3G4S3 5DREA 1NB3I 4HM2B 1LNHA 4HVNA 1ULJB 1VQN3 4MEIA 1IK3A 1JN5B 1JB2A 1VQM3 1GY6A 1R4CA 3NBJA 4R9KA 3SXXA 4WYKB 1VQ73 2CG0A 3B7CA 1C7HA 5EEOA 1CEWI 3WA2X 3EX9A 4HM0B 3F7SA 3HI7A 3V92A 1AV4A 4L7KA 3Q1CA 3X41A 3GZXB 3DZLA 2HMKB 2F98A 3SEDA 3CCV3 3NQYA 3T0UA 5AEWB 3DGMA 1JV2B 1N9EA 3LT8A 2I9WA 2BMOB 4K90B 2CFGA 4KFDA 4WP5A 5IEPA 2QEX3 2OTJ3 4NHFA 1K9M4 5AIGA 2W03A 4RNZA 4FMDA 3NX0A 1RRLA 2QGUA 5AIHA 2BHMA 1W6YA 3WMDA 4IPBA 2D42A 3BLZA 1Q7Y4 1D6UA 1TFKA 2P09A 5KP4A 3EJVA 3LOYA 2M7OA 3KFQC 4ZM8A 3ALAA 1GY7A 3MPHA 4L8PA 3S27A 4MMZB 3OWYA 3KSED 3DM8A 2GEYA 3MHEA 3H3HA 1JKGB 2XSHB 4FCJA 1W4NA 2LYXA 2WOFA 3S29A 3I563 4HYZA 4RZMA 5FGOA 2OQEA 1W01A 1WMPA 3IMAB 2ML5A 1DMMA 3NXJA 2OCTA 3WDGB 3CMA3 1O7WB 3F8HA 3F8XA 2F99A 3UL5A 4BTXA 3N54B 5IENA 1A90A 2W9PA 1SPUA 3PYJA 1SIIA 1NJI4 1IQXA 2CWUA 3AMOA 4ORLA 1OF5A 5IF6A 3CNMA 1OUNA 3PCRA 4XB5A 2KRTA 3SVAA 1IT7A 3K63A 1Z1SA 4CDLA 3NV0A 2IUJA 3VGNA 1DVDA 3F40A 2PZVA 1CYVA 4R9LA 2W9QA 3DMCA 3KIIA 5AIIA 2RCDA 1NWWA 2WO0A 3VSYA 1KD14 3JUNA 4KFFA 4TX4A 1NO3A 2HMOB 5CF2A 2B1XB 3LYGA 5EQLA 4K1VA 3CC23 2C10A 1M1K4 2GU1A 3ER7A 2FGTA 2ZDJA 4O3VA 2P0MA 3D3LA 3MYTA 1KC84 3MSOA 4OVMA 4I4KA 2CK3H 4FMAA 4EXRA 3ECFA 4HM7B 2F86B 1O7PB 1YHQ3 3MG3A 3N8BA 1E97A 3EBTA 1WNHA 4J8TA 2RFRA 2CWVA 3EN8A 3CCE3 1GY5A 2A15A 3SOAA 3OX9A 2XSOB 2IA7A 3E99A 3WODG 5BXQA 3BNDA 5IG4A 3S67A 1M904 1NDOB 3EBYA 5A0OB 2STDA 4BTWA 2V1LA 1OF5B 4GB5A 2KCDA 4WFOA 1US1A 4KZ1A 3X3YA 1ZO2A 1TIJA 2OWPA 2W2CA 1STFI 3CC43 3OXAA 5STDA 3CXC2 3FG1A 2ML6A 3CC73 3V99A 3NV0B 1Y4KA 4FMCA 3CCQ3 3FG3A 1YJN3 1K8A4 5AIFA 1KSIA 3KN4A 3X3XA 2O9UX 2XH9A 4LMIA 1S723 1D6YA 1WQLB 4EYCA 3B4OA 3FZWA 4HM5B 2XEPA 3KZTA 4BTYA 1VQP3 1VQK3 3WA3A 4L8OA 3G0KA 2E2UA 3M8CA 3O8YA 4FMBA 1IV9A 2WGQA 1M1XB 4XBXA 1YVBI 3U97A 1NU3A 3BNCA 1IQYA 4STDA 4AEQA 3T8NA 1Q40A 1UUVB 1VQ63 3V98A 1QALA 1N9JA 3MG1A 1GD3A 3FSDA 5G2GA 4OUQA 1YI23 4H61A 5LC7A 2XR8B 2Z76A 5IG5A 1Q814 2P0XA 4FCMA 3I0YA 4N6V0 4WHAA 2CIUA 1Q864 2SBLA 2B24B 2RGQA 2OOVC 3RGRA 3F7XA 2QIYA 5AI1A 3CME3 1W6GA 2P05A 2Z77A 2FXTA 2YX9A 1W6CA 2LQVA 1N8R4 1ULIB 5KP3A 4CCVA 5BVBA 2Q07A 7STDA 3KSPA 3UJMA 3X40A 2QA43 3OV4A 1W5ZA 3EHCA 2FNQA 4LGQA 4XM4A 3KKGA 2YFJB 5IG3A 2CWTA 2GU3A 4IT7A 1DYUA 1FGRA 3X42A 2E2TA 3LTDA 1N8QA 3NHXA 5CXOA 1RN7A 4U13A 3KE7A 3GRDA 2CHCA 1W7CA 4HZ9B 1NB5I 3RDEA 3DGLA 1Q42A 1OACA 1VQL3 5IEOA 2MF7A 3K9MC 3MG2A 4LEHA 3WOEB 1Q40B 1QVG2 4HJLB 1MNLA 3F14A 4N6LA 1EQKA 3FCSB 2GEXA 1KWIA 2K0MA 3FLJA 5HGRA 1W00A 1M9GA 2ZL8A 3LTBA 1IQ8A 2GBWB 4K1UA 1JJ22 1VZZA 3DXOA 4RNYA 1D6ZA 3CCU3 3JUQA 2XGNA 1EA2A 3EC9A 3GAXA 4KVHA 1ROAA 5LC6A 1VQ83 3SX1A 1QVF2 1IU7A 2XGLA 3G8ZA 1DMQA 2CFLA 4NREA 2OTL3 1UI7A 2BO9B 4K61A 3LMLA 4EBGA 5EVHA 3K5TA 2CC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OH0 A;  1JB5 A;  1S5A A;  4HKV B;  5FW5 A;  5DRV A;  3IPT A;  1CQS A;  4HM6 B;  2BNG A;  3EN1 B;  5CLK A;  2HMM B;  3OWS A;  4XDW A;  5IG0 A;  1IDP A;  4PEJ A;  3GZY B;  5KP1 A;  5IER A;  1OHO A;  4N3V A;  3FF2 A;  3NM2 A;  3FH1 A;  2IMJ A;  3FKA A;  4IIA A;  3A76 A;  1E3R A;  3FGY A;  4XBT A;  4HM4 B;  5D81 A;  2GXF A;  2GBX B;  1GYB A;  1U5O A;  2HMN B;  5JPP A;  5D82 A;  2XRX B;  1JB4 A;  3STD A;  3SOY A;  2YFL B;  1JKG A;  1OCV A;  1UUW B;  4H3U A;  1TUH A;  3GWR A;  3BB9 A;  5AEU B;  3K7C A;  1W02 A;  2JQ5 A;  4HM8 B;  1QMA A;  1K41 A;  3S5C A;  6STD A;  1OPY A;  3UNL A;  3RGA A;  3B4P A;  3GZB A;  3D9R A;  3HK4 A;  1ZX2 A;  1OGZ A;  4HM1 B;  2HMJ B;  1GS3 A;  4HM3 B;  1O7N B;  3CU3 A;  3H51 A;  3LZA A;  3EF8 A;  1A2K A;  4Q53 A;  4XBY A;  3HX8 A;  2BMQ B;  3CNX A;  5JPU A;  2CKF B;  3G16 A;  3NBR A;  1STD A;  2UX0 A;  4R1K A;  4XDV A;  8CHO A;  1ISK A;  2K54 A;  3FF0 A;  1O7G B;  1EG9 B;  2YFI B;  1O7M B;  3DUK A;  4J9A A;  3CPO A;  4X2O A;  3NUV A;  4WWU C;  1JN5 A;  5CK6 A;  3JUP A;  3ROB A;  4WYK A;  3JUO A;  3Q90 A;  4HZB B;  5CF1 A;  1OHS A;  3HZP A;  1E3V A;  1SJW A;  1HKX A;  1DMN A;  3GZR A;  4X2H A;  1TP6 A;  2R4I A;  1ASK A;  3F9S A;  3T8U A;  1QJG A;  3K0Z A;  3OWU A;  2BMR B;  4MJD A;  2Z7A A;  1BUQ A;  1O7H B;  5TGN A;  3EQQ B;  3B8L A;  1OHP A;  1OGX A;  1AR0 A;  2HML B;  5D83 A;  2INX A;  3JUM A;  3MKI A;  5DRE A;  4HM2 B;  4HVN A;  1ULJ B;  1JN5 B;  1JB2 A;  1GY6 A;  4R9K A;  4WYK B;  3B7C A;  1C7H A;  3EX9 A;  4HM0 B;  3F7S A;  4L7K A;  3GZX B;  3DZL A;  2HMK B;  2F98 A;  3SED A;  5AEW B;  2I9W A;  2BMO B;  4WP5 A;  5IEP A;  5AIG A;  2QGU A;  5AIH A;  1W6Y A;  3WMD A;  3BLZ A;  5KP4 A;  3EJV A;  1GY7 A;  4L8P A;  3OWY A;  3DM8 A;  2GEY A;  3MHE A;  3H3H A;  1JKG B;  2XSH B;  4FCJ A;  4RZM A;  1W01 A;  1DMM A;  3NXJ A;  1O7W B;  3F8H A;  3F8X A;  2F99 A;  5IEN A;  4ORL A;  1OF5 A;  5IF6 A;  3CNM A;  1OUN A;  4XB5 A;  1Z1S A;  4CDL A;  3NV0 A;  3VGN A;  3F40 A;  2PZV A;  4R9L A;  3DMC A;  5AII A;  2RCD A;  1NWW A;  3VSY A;  3JUN A;  2HMO B;  5CF2 A;  2B1X B;  3LYG A;  4K1V A;  3ER7 A;  3MYT A;  3MSO A;  4OVM A;  4I4K A;  3ECF A;  4HM7 B;  2F86 B;  1O7P B;  3MG3 A;  1E97 A;  3EBT A;  4J8T A;  2RFR A;  3EN8 A;  1GY5 A;  2A15 A;  3SOA A;  3OX9 A;  2XSO B;  5BXQ A;  3E99 A;  5IG4 A;  1NDO B;  3EBY A;  2STD A;  1OF5 B;  4GB5 A;  1ZO2 A;  2W2C A;  2OWP A;  3OXA A;  5STD A;  3NV0 B;  5AIF A;  4LMI A;  1WQL B;  3B4O A;  3FZW A;  4HM5 B;  3KZT A;  4L8O A;  3G0K A;  3M8C A;  4XBX A;  1NU3 A;  4STD A;  3T8N A;  1Q40 A;  1UUV B;  3MG1 A;  5G2G A;  3FSD A;  4OUQ A;  2XR8 B;  2Z76 A;  5IG5 A;  4FCM A;  3I0Y A;  2B24 B;  2RGQ A;  3RGR A;  3F7X A;  2QIY A;  5AI1 A;  2Z77 A;  1ULI B;  5KP3 A;  5BVB A;  7STD A;  3KSP A;  3UJM A;  3OV4 A;  3EHC A;  4LGQ A;  4XM4 A;  3KKG A;  2YFJ B;  5IG3 A;  3NHX A;  5CXO A;  4U13 A;  3KE7 A;  3GRD A;  2CHC A;  4HZ9 B;  1Q42 A;  5IEO A;  3MG2 A;  4LEH A;  1Q40 B;  4HJL B;  3F14 A;  2GEX A;  3FLJ A;  5HGR A;  1W00 A;  2GBW B;  4K1U A;  1VZZ A;  3DXO A;  3JUQ A;  1EA2 A;  3EC9 A;  4KVH A;  3G8Z A;  1DMQ A;  5EVH A; 
#chains in the Genus database with same CATH topology
 1MWS A;  1OH0 A;  1JB5 A;  1LNI A;  1S5A A;  4HKV B;  1N5P A;  5FW5 A;  3CCJ 3;  5DRV A;  2RSX A;  3X3Z A;  1UCJ A;  3JVC A;  3VF1 A;  1FGM A;  3PS8 A;  3QRD A;  2XF3 A;  4KFE A;  1TU5 A;  1FGQ A;  2WGO A;  1RCK A;  1JBR A;  1WTH A;  2AAD A;  1UI8 A;  3IPT A;  1RLS A;  1CQS A;  3LXU X;  4HM6 B;  4BIR A;  1GD4 A;  4LZI A;  1NNV A;  5JBS A;  2BNG A;  3EN1 B;  3LH4 A;  5CLK A;  4GL6 A;  2HMM B;  3OWS A;  1WMN A;  2W56 A;  4XDW A;  4AKZ A;  5IG0 A;  3G6E 3;  2CG1 A;  2L1S A;  3BNE A;  1UGH I;  3D5G A;  1IDP A;  3AMO B;  4PEJ A;  3GZY B;  5KP1 A;  5IER A;  3AHW A;  1FUW A;  1OHO A;  1DET A;  1T5Y A;  3SYU A;  1LRA A;  1Q7H A;  1X1X A;  2RNT A;  1UCK A;  3IJE B;  4JF8 A;  4N3V A;  2CX1 A;  1A67 A;  1GSP A;  2KXG A;  1IVU A;  3FF2 A;  3HII A;  1YGE A;  1HU9 A;  1I2G A;  2F56 A;  1JNQ A;  1I8V A;  3FH1 A;  3NM2 A;  1AVK A;  1FW7 A;  5I97 A;  2Y73 A;  1BNJ A;  4O2H A;  1B3S A;  1EKM A;  4LSO A;  1W2B 2;  2IMJ A;  1K73 4;  3FKA A;  2D1W A;  4IIA A;  4R4K A;  3SLU A;  1J2B A;  3NQZ A;  3A76 A;  1E3R A;  3FG4 A;  3FGY A;  4XBT A;  4AKY A;  1UW1 A;  4HM4 B;  5D81 A;  4CPK A;  4EV5 A;  1PFP A;  2GXF A;  2GBX B;  4RBN A;  2E2V A;  1K28 A;  1GYB A;  1U5O A;  2HMN B;  4JRF A;  5D82 A;  2XRX B;  1JB4 A;  4QWT A;  3STD A;  1B2S A;  1LOY A;  5JPP A;  4N6M A;  3G71 3;  3N9H A;  1FA3 A;  2CFK A;  1CYU A;  4G1M B;  3L0R A;  3D5I A;  1SQW A;  3SOY A;  5AYR B;  2W56 B;  5HOH A;  2YFL B;  1JKG A;  1OCV A;  4BL2 A;  1UUW B;  2W04 A;  1RNB A;  2PNC A;  4H3U A;  3CD6 3;  4O8S A;  3CCS 3;  1VQ4 3;  1TUH A;  3GWR A;  3BB9 A;  1RSN A;  1BAO A;  1BNI A;  1BVI A;  3Q3F A;  2CH9 A;  5AEU B;  3NM7 A;  1G02 A;  3S28 A;  2OQE C;  3K7C A;  1WMO A;  1YIT 3;  2C4B A;  3PZW A;  1L5G B;  1W02 A;  1RDS A;  4EV2 A;  3DY5 A;  3EE1 A;  1HYF A;  1RKY A;  4EC6 A;  2JDI H;  2CW9 A;  2JQ5 A;  1IVX A;  1BRJ A;  1JRQ A;  3PXM A;  1VQO 3;  1RGF A;  4HM8 B;  2H0I A;  1QAK A;  1U8C B;  4FCZ A;  5AYS C;  3U1W A;  2AAE A;  1I2E A;  1QMA A;  3KCH A;  1K41 A;  1LXE A;  1YVS A;  3S5C A;  2IYJ A;  2CFW A;  1PU4 A;  3CCR 3;  2W6J H;  4N6O B;  1BRN L;  1V74 A;  5IW9 A;  1BGS A;  6STD A;  1MOL A;  1OPY A;  3UNL A;  2HOH A;  3BNB A;  3RGA A;  1JZO A;  3I55 3;  1I0X A;  3B4P A;  2KF6 A;  3GZB A;  1TFO A;  3TDG A;  3D9R A;  1SAR A;  3QK9 A;  2O3O A;  2XFT A;  3HK4 A;  2KAA A;  1BU4 A;  2Z6B A;  3EB8 A;  6GSP A;  1ZX2 A;  1OGZ A;  3GSP A;  3NBB A;  4HM1 B;  3WOF B;  1T2H A;  2HMJ B;  1YJW 3;  1A2P A;  1GS3 A;  4HM3 B;  1QAF A;  4GHO A;  1SIH A;  4HAA A;  1O7N B;  3CU3 A;  3H51 A;  3LZA A;  3EF8 A;  2OOV A;  1G0T A;  1A2K A;  1N5H A;  4O02 B;  2BT3 A;  4Q53 A;  2C11 A;  1BNE A;  3UB1 A;  2L4V A;  4HOH A;  1MWR A;  3Q2P A;  1YJ9 3;  1VQ5 3;  5ELU A;  3ZG0 A;  5G1K A;  3CCL 3;  3DGO A;  4XBY A;  3DGN A;  3HX8 A;  1B2U A;  2BMQ B;  3CNX A;  1TTO A;  3HOH A;  2CKF B;  3G16 A;  3PCS A;  1MGW A;  5JPU A;  3CPW 2;  3NBR A;  3LT9 A;  2KF4 A;  4N6T A;  1STD A;  2UX0 A;  4R80 A;  1W2Z A;  4R1K A;  1RRH A;  4XDV A;  8CHO A;  1B2Z A;  2K54 A;  3CCM 3;  1BRS A;  1ZGX A;  3FF0 A;  1O7G B;  1ISK A;  1EG9 B;  2YFI B;  1O7M B;  3DUK A;  4J9A A;  4MMY B;  4N6U A;  1BAN A;  3OW2 2;  1FGO A;  2CX0 A;  1IVV A;  3CPO A;  4X2O A;  1DVC A;  3NUV A;  1VQ9 3;  3AGN A;  3PGB A;  1F8N A;  2F5M A;  2CFD A;  4WWU C;  1JN5 A;  5CK6 A;  3JUP A;  1LVN A;  2BIR A;  1LQG C;  3ROB A;  1AVL A;  1G96 A;  1X1W A;  2KF3 A;  4WYK A;  2ZA4 A;  3JUO A;  1I3I A;  1IT8 A;  3MWZ A;  3Q90 A;  4HZB B;  3HIG A;  1JBT A;  5CF1 A;  1OHS A;  3HZP A;  1PYL A;  1E3V A;  1AY7 A;  4N6N B;  3UL6 A;  1V57 A;  1SJW A;  2P38 A;  4MMX B;  1ROV A;  4KT3 B;  1HKX A;  1RHL A;  5M18 A;  1DMN A;  1HZ1 A;  3GZR A;  3LTC A;  1TP6 A;  4X2H A;  1FYS A;  1Q82 4;  1FUT A;  2R4I A;  1ASK A;  1LQM B;  3F9S A;  2MC8 A;  4FR9 A;  1RJO A;  2ZHX B;  1IV7 A;  4HBR A;  3T8U A;  1LOX A;  5GSP A;  1QJG A;  3K0Z A;  1KQS 2;  3OWU A;  2BMR B;  2W0Q A;  1DE3 A;  1A2V A;  1IVW A;  4MJD A;  2Y74 A;  2Z7A A;  1BUQ A;  1O7H B;  2WOH A;  2IUK A;  5TGN A;  2XFS A;  3EQQ B;  3B8L A;  3LTA A;  4ILF A;  1OHP A;  1OGX A;  5ELJ A;  1AR0 A;  2HML B;  2UUG C;  5D83 A;  1UCL A;  1YIJ 3;  5BU4 A;  2INX A;  3AHS A;  3JUM A;  4OK0 A;  3J7Y d;  3BU4 A;  3MKI A;  1FGT A;  3G4S 3;  5DRE A;  1NB3 I;  4HM2 B;  1LNH A;  4HVN A;  1ULJ B;  1VQN 3;  4MEI A;  1IK3 A;  1JN5 B;  1JB2 A;  1VQM 3;  1GY6 A;  1YNV X;  3WHO A;  1R4C A;  3NBJ A;  4R9K A;  3SXX A;  4WYK B;  1VQ7 3;  2CG0 A;  3B7C A;  1C7H A;  5EEO A;  1CEW I;  3WA2 X;  3EX9 A;  4HM0 B;  3F7S A;  3HI7 A;  3V92 A;  1AV4 A;  1I3F A;  4L7K A;  2KF5 A;  1FZU A;  3Q1C A;  1B2X A;  1MWU A;  3GZX B;  3X41 A;  3DZL A;  2HMK B;  1BRG A;  2F98 A;  3SED A;  3CCV 3;  3NQY A;  1UDI I;  4CJN A;  3T0U A;  1BIR A;  5AEW B;  1ZS7 A;  3DGM A;  1JV2 B;  1N9E A;  3DH2 A;  3LT8 A;  2I9W A;  2BMO B;  3D79 A;  2CFG A;  4K90 B;  4KFD A;  3BIR A;  4WP5 A;  5IEP A;  2QEX 3;  2OTJ 3;  4NHF A;  1K9M 4;  5AIG A;  4BL3 A;  2W03 A;  4RNZ A;  4FMD A;  1YGW A;  3NX0 A;  1BUJ A;  1RRL A;  2QGU A;  5AIH A;  2BHM A;  2K3D A;  1W6Y A;  3AGO A;  3WMD A;  4IPB A;  2H0H A;  2D42 A;  3BLZ A;  1Q7Y 4;  1D6U A;  1TFK A;  2P09 A;  5KP4 A;  1T2I A;  3EJV A;  3LOY A;  2M7O A;  3KFQ C;  3URP A;  4ZM8 A;  3ALA A;  1GY7 A;  3MPH A;  4L8P A;  3S27 A;  1BSA A;  4MMZ B;  3OWY A;  3KSE D;  3DM8 A;  1GOY A;  2GEY A;  1CH0 A;  3H3H A;  1JKG B;  3MHE A;  1BRH A;  1GMP A;  1RN4 A;  2XSH B;  4FCJ A;  1W4N A;  2LYX A;  1BNG A;  2WOF A;  4J5K A;  3S29 A;  3I56 3;  4HYZ A;  4RZM A;  5FGO A;  2OQE A;  3WR2 A;  1W01 A;  3RNT A;  1WMP A;  3IMA B;  2ML5 A;  1DMM A;  1RGG A;  2OCT A;  3NXJ A;  1RTU A;  1TRP A;  3WDG B;  9RNT A;  1O7W B;  3CMA 3;  3F8H A;  3F8X A;  2F99 A;  3UL5 A;  4DKI A;  4BTX A;  2BU4 A;  3N54 B;  5IEN A;  1A90 A;  1RMS A;  1BOX A;  1BNF A;  1MWT A;  2W9P A;  1JBS A;  1SPU A;  3PYJ A;  1I0V A;  1SII A;  1NJI 4;  1IQX A;  2CWU A;  3AMO A;  4ORL A;  1OF5 A;  5IF6 A;  1GMR A;  1OUN A;  1RGC A;  3CNM A;  3PCR A;  4XB5 A;  2KRT A;  3SVA A;  1IT7 A;  3K63 A;  1Z1S A;  1V58 A;  4CDL A;  3NV0 A;  2IUJ A;  3VGN A;  1DVD A;  2SAR A;  1C54 A;  3F40 A;  2PZV A;  1CYV A;  4R9L A;  2W9Q A;  3DMC A;  3KII A;  5AII A;  2RCD A;  1NWW A;  2IY2 A;  2WO0 A;  3VSY A;  1KD1 4;  3JUN A;  4KFF A;  4TX4 A;  1NO3 A;  2HMO B;  5CF2 A;  2B1X B;  3LYG A;  5EQL A;  4K1V A;  4LYL B;  3CC2 3;  1EEJ A;  2C10 A;  5RNT A;  1M1K 4;  2GU1 A;  3ER7 A;  2FGT A;  2ZDJ A;  4O3V A;  2P0M A;  3D3L A;  3MYT A;  1KC8 4;  1RGH A;  3MSO A;  4OVM A;  4I4K A;  2CK3 H;  4FMA A;  4EXR A;  1B27 A;  3ECF A;  4HM7 B;  2F86 B;  1TJD A;  1O7P B;  5G1L A;  1YHQ 3;  3MG3 A;  3N8B A;  1E97 A;  3EBT A;  1WNH A;  1RN1 A;  4J8T A;  1EUI C;  2RFR A;  2CWV A;  2UGI A;  3EN8 A;  1MGR A;  1GY5 A;  2A15 A;  3SOA A;  3CCE 3;  3OX9 A;  2XSO B;  2IA7 A;  3E99 A;  4RNT A;  3WOD G;  5BIR A;  5BXQ A;  3BND A;  5IG4 A;  3S67 A;  1M90 4;  1NDO B;  2RBI A;  3EBY A;  5A0O B;  2STD A;  4BTW A;  2V1L A;  1OF5 B;  4GB5 A;  2KCD A;  4WFO A;  1US1 A;  4KZ1 A;  1RGL A;  1GOV A;  3D4A A;  3X3Y A;  1ZO2 A;  1TIJ A;  2OWP A;  2W2C A;  1STF I;  3CC4 3;  3OXA A;  5STD A;  3CXC 2;  3FG1 A;  2ML6 A;  1RGE A;  3CC7 3;  3V99 A;  3NV0 B;  1Y4K A;  4FMC A;  3CCQ 3;  3FG3 A;  1YJN 3;  2F5W A;  1K8A 4;  5AIF A;  1KSI A;  3KN4 A;  3X3X A;  3ZFZ A;  2H0G A;  2O9U X;  2XH9 A;  4LMI A;  1S72 3;  1RNT A;  1D6Y A;  1WQL B;  4EYC A;  1I2F A;  3B4O A;  3FZW A;  1RCL A;  1B20 A;  1RGA A;  4HM5 B;  2XEP A;  3KZT A;  4NPB A;  4BTY A;  1VQP 3;  1VQK 3;  7GSP A;  3WA3 A;  4L8O A;  3G0K A;  1X1Y A;  2E2U A;  3M8C A;  3O8Y A;  4FMB A;  1IV9 A;  2WGQ A;  1M1X B;  4XBX A;  1YVB I;  3U97 A;  1B2M A;  1UUG B;  1NU3 A;  3BNC A;  1IQY A;  4STD A;  4AEQ A;  3T8N A;  1Q40 A;  1UUV B;  1VQ6 3;  1PY3 A;  1QAL A;  3V98 A;  1N9J A;  1GMQ A;  3MG1 A;  1GD3 A;  1RGK A;  3FSD A;  5G2G A;  1IYY A;  4OUQ A;  1YI2 3;  1BSC A;  4H61 A;  5LC7 A;  2XR8 B;  2Z76 A;  5IG5 A;  1Q81 4;  2P0X A;  4FCM A;  3I0Y A;  4N6V 0;  4WHA A;  1UCI A;  2CIU A;  1Q86 4;  3A5E A;  2SBL A;  2B24 B;  1AQZ A;  1I70 A;  2RGQ A;  1LOW A;  2OOV C;  3RGR A;  1T3B A;  3F7X A;  2QIY A;  1BNS A;  5AI1 A;  3CME 3;  1W6G A;  2P05 A;  2Z77 A;  4J5G A;  2FXT A;  2YX9 A;  1W6C A;  2LQV A;  1N8R 4;  1ULI B;  5KP3 A;  4CCV A;  5BVB A;  2Q07 A;  7STD A;  3KSP A;  1BSD A;  3UJM A;  2F4Y A;  3X40 A;  2QA4 3;  3OV4 A;  1W5Z A;  4GSP A;  3EHC A;  2FNQ A;  4LGQ A;  4XM4 A;  3KKG A;  2YFJ B;  1TRQ A;  5IG3 A;  1JZD A;  5M19 A;  2CWT A;  2GU3 A;  1BSB A;  4IT7 A;  1BRI A;  1DYU A;  1FGR A;  1X1U A;  3X42 A;  2E2T A;  3LTD A;  1N8Q A;  2R41 A;  3NHX A;  4I5Q A;  5CXO A;  1B21 A;  1RN7 A;  4U13 A;  3KE7 A;  3GRD A;  6RNT A;  2CHC A;  1W7C A;  4HZ9 B;  1BRK A;  1NB5 I;  3RDE A;  3DGL A;  1Q42 A;  1OAC A;  8RNT A;  1VQL 3;  5IEO A;  2MF7 A;  3K9M C;  3MG2 A;  4LEH A;  3WOE B;  1BNR A;  1FUS A;  1Q40 B;  1QVG 2;  4HJL B;  1MNL A;  3F14 A;  4N6L A;  1LOV A;  1EQK A;  3FCS B;  2GEX A;  1KWI A;  2K0M A;  3FLJ A;  5HGR A;  1W00 A;  1M9G A;  2J8X B;  2ZL8 A;  3LTB A;  1IQ8 A;  1Q9E A;  2GBW B;  4K1U A;  1JJ2 2;  1VZZ A;  1GOU A;  3DXO A;  4RNY A;  1D6Z A;  7RNT A;  1VQQ A;  1UGI A;  3JUQ A;  3CCU 3;  1R4Y A;  2XGN A;  5M1A A;  1EA2 A;  3EC9 A;  3GAX A;  4KVH A;  1ROA A;  2GSP A;  5LC6 A;  3DGY A;  1VQ8 3;  3SX1 A;  4BU4 A;  1QVF 2;  1BSE A;  1IU7 A;  2XGL A;  3ZG5 A;  3G8Z A;  1DMQ A;  4EW5 A;  2CFL A;  4NRE A;  2OTL 3;  1UI7 A;  2BO9 B;  4K61 A;  3LML A;  4EBG A;  5EVH A;  3K5T A;  2CC3 A; 
#chains in the Genus database with same CATH homology
 1OH0 A;  1JB5 A;  1S5A A;  4HKV B;  1N5P A;  5FW5 A;  3CCJ 3;  5DRV A;  2RSX A;  3X3Z A;  3JVC A;  3VF1 A;  1FGM A;  3PS8 A;  3QRD A;  2XF3 A;  4KFE A;  1TU5 A;  1FGQ A;  2WGO A;  1WTH A;  1UI8 A;  3IPT A;  1CQS A;  3LXU X;  4HM6 B;  1GD4 A;  4LZI A;  5JBS A;  2BNG A;  3EN1 B;  3LH4 A;  5CLK A;  4GL6 A;  2HMM B;  3OWS A;  1WMN A;  2W56 A;  4XDW A;  4AKZ A;  5IG0 A;  3G6E 3;  2CG1 A;  3BNE A;  1IDP A;  3AMO B;  4PEJ A;  3GZY B;  5KP1 A;  5IER A;  1FUW A;  1OHO A;  1T5Y A;  3IJE B;  4JF8 A;  4N3V A;  1A67 A;  2KXG A;  1IVU A;  3FF2 A;  3HII A;  1YGE A;  1HU9 A;  1JNQ A;  3NM2 A;  3FH1 A;  1AVK A;  5I97 A;  2Y73 A;  4O2H A;  1K73 4;  1EKM A;  4LSO A;  1W2B 2;  2IMJ A;  3FKA A;  2D1W A;  4IIA A;  4R4K A;  3SLU A;  1J2B A;  3NQZ A;  3A76 A;  1E3R A;  3FG4 A;  3FGY A;  4XBT A;  4AKY A;  1UW1 A;  4HM4 B;  5D81 A;  4EV5 A;  1PFP A;  2GXF A;  2GBX B;  4RBN A;  2E2V A;  1K28 A;  1GYB A;  1U5O A;  2HMN B;  4JRF A;  5D82 A;  2XRX B;  1JB4 A;  4QWT A;  3STD A;  5JPP A;  3G71 3;  4N6M A;  1FA3 A;  3N9H A;  2CFK A;  1CYU A;  4G1M B;  3L0R A;  1SQW A;  3SOY A;  5AYR B;  2W56 B;  2YFL B;  1JKG A;  1OCV A;  1UUW B;  2W04 A;  2PNC A;  4H3U A;  3CD6 3;  4O8S A;  3CCS 3;  1VQ4 3;  1TUH A;  3GWR A;  3BB9 A;  2CH9 A;  5AEU B;  3NM7 A;  3S28 A;  2OQE C;  3K7C A;  1WMO A;  1YIT 3;  3PZW A;  1L5G B;  1W02 A;  4EV2 A;  3DY5 A;  3EE1 A;  1RKY A;  4EC6 A;  2JDI H;  2CW9 A;  2JQ5 A;  1IVX A;  1JRQ A;  3PXM A;  1VQO 3;  4HM8 B;  1QAK A;  1U8C B;  4FCZ A;  5AYS C;  3U1W A;  1QMA A;  1K41 A;  1LXE A;  3S5C A;  2CFW A;  1PU4 A;  3CCR 3;  2W6J H;  4N6O B;  1V74 A;  5IW9 A;  6STD A;  1MOL A;  1OPY A;  3UNL A;  3BNB A;  3RGA A;  3I55 3;  3B4P A;  3GZB A;  3TDG A;  1TFO A;  3D9R A;  3QK9 A;  2O3O A;  2XFT A;  3HK4 A;  2Z6B A;  3EB8 A;  1ZX2 A;  1OGZ A;  3NBB A;  4HM1 B;  3WOF B;  2HMJ B;  1YJW 3;  1GS3 A;  4HM3 B;  1QAF A;  1SIH A;  1O7N B;  3CU3 A;  3H51 A;  3LZA A;  3EF8 A;  2OOV A;  1N5H A;  1A2K A;  4O02 B;  2BT3 A;  4Q53 A;  2C11 A;  3UB1 A;  2L4V A;  1YJ9 3;  3Q2P A;  1VQ5 3;  5ELU A;  3CCL 3;  3DGO A;  4XBY A;  3DGN A;  3HX8 A;  2BMQ B;  3CNX A;  3PCS A;  5JPU A;  3CPW 2;  2CKF B;  3G16 A;  3NBR A;  3LT9 A;  4N6T A;  1STD A;  2UX0 A;  4R80 A;  1W2Z A;  4R1K A;  1RRH A;  4XDV A;  8CHO A;  3CCM 3;  2K54 A;  1ISK A;  3FF0 A;  1O7G B;  1EG9 B;  2YFI B;  1O7M B;  3DUK A;  4J9A A;  4MMY B;  4N6U A;  3OW2 2;  1FGO A;  1IVV A;  3CPO A;  4X2O A;  1DVC A;  3NUV A;  1VQ9 3;  3PGB A;  1F8N A;  2CFD A;  4WWU C;  1JN5 A;  5CK6 A;  3JUP A;  1LVN A;  3ROB A;  1AVL A;  1G96 A;  4WYK A;  3JUO A;  3MWZ A;  1IT8 A;  3Q90 A;  4HZB B;  3HIG A;  5CF1 A;  1OHS A;  3HZP A;  4N6N B;  1E3V A;  3UL6 A;  1SJW A;  2P38 A;  4MMX B;  1ROV A;  1HKX A;  1DMN A;  3GZR A;  3LTC A;  1TP6 A;  4X2H A;  1Q82 4;  2R4I A;  1ASK A;  3F9S A;  2MC8 A;  4FR9 A;  1RJO A;  4HBR A;  1IV7 A;  3T8U A;  1LOX A;  1QJG A;  3K0Z A;  1KQS 2;  3OWU A;  2BMR B;  2W0Q A;  1A2V A;  1IVW A;  4MJD A;  2Y74 A;  2Z7A A;  1BUQ A;  1O7H B;  2WOH A;  2IUK A;  5TGN A;  2XFS A;  3EQQ B;  3B8L A;  3LTA A;  1OHP A;  1OGX A;  5ELJ A;  1AR0 A;  2HML B;  5D83 A;  1YIJ 3;  2INX A;  3JUM A;  3J7Y d;  4OK0 A;  3MKI A;  1FGT A;  3G4S 3;  5DRE A;  1NB3 I;  4HM2 B;  1LNH A;  4HVN A;  1ULJ B;  1VQN 3;  4MEI A;  1IK3 A;  1JN5 B;  1JB2 A;  1VQM 3;  1GY6 A;  1R4C A;  3NBJ A;  4R9K A;  3SXX A;  4WYK B;  1VQ7 3;  2CG0 A;  3B7C A;  1C7H A;  5EEO A;  1CEW I;  3WA2 X;  3EX9 A;  4HM0 B;  3F7S A;  3HI7 A;  3V92 A;  1AV4 A;  4L7K A;  3Q1C A;  3X41 A;  3GZX B;  3DZL A;  2HMK B;  2F98 A;  3SED A;  3CCV 3;  3NQY A;  3T0U A;  5AEW B;  3DGM A;  1JV2 B;  1N9E A;  3LT8 A;  2I9W A;  2BMO B;  4K90 B;  2CFG A;  4KFD A;  4WP5 A;  5IEP A;  2QEX 3;  2OTJ 3;  4NHF A;  1K9M 4;  5AIG A;  2W03 A;  4RNZ A;  4FMD A;  3NX0 A;  1RRL A;  2QGU A;  5AIH A;  2BHM A;  1W6Y A;  3WMD A;  4IPB A;  2D42 A;  3BLZ A;  1Q7Y 4;  1D6U A;  1TFK A;  2P09 A;  5KP4 A;  3EJV A;  3LOY A;  2M7O A;  3KFQ C;  4ZM8 A;  3ALA A;  1GY7 A;  3MPH A;  4L8P A;  3S27 A;  4MMZ B;  3OWY A;  3KSE D;  3DM8 A;  2GEY A;  3MHE A;  3H3H A;  1JKG B;  2XSH B;  4FCJ A;  1W4N A;  2LYX A;  2WOF A;  3S29 A;  3I56 3;  4HYZ A;  4RZM A;  5FGO A;  2OQE A;  1W01 A;  1WMP A;  3IMA B;  2ML5 A;  1DMM A;  3NXJ A;  2OCT A;  3WDG B;  3CMA 3;  1O7W B;  3F8H A;  3F8X A;  2F99 A;  3UL5 A;  4BTX A;  3N54 B;  5IEN A;  1A90 A;  2W9P A;  1SPU A;  3PYJ A;  1SII A;  1NJI 4;  1IQX A;  2CWU A;  3AMO A;  4ORL A;  1OF5 A;  5IF6 A;  3CNM A;  1OUN A;  3PCR A;  4XB5 A;  2KRT A;  3SVA A;  1IT7 A;  3K63 A;  1Z1S A;  4CDL A;  3NV0 A;  2IUJ A;  3VGN A;  1DVD A;  3F40 A;  2PZV A;  1CYV A;  4R9L A;  2W9Q A;  3DMC A;  3KII A;  5AII A;  2RCD A;  1NWW A;  2WO0 A;  3VSY A;  1KD1 4;  3JUN A;  4KFF A;  4TX4 A;  1NO3 A;  2HMO B;  5CF2 A;  2B1X B;  3LYG A;  5EQL A;  4K1V A;  3CC2 3;  2C10 A;  1M1K 4;  2GU1 A;  3ER7 A;  2FGT A;  2ZDJ A;  4O3V A;  2P0M A;  3D3L A;  3MYT A;  1KC8 4;  3MSO A;  4OVM A;  4I4K A;  2CK3 H;  4FMA A;  4EXR A;  3ECF A;  4HM7 B;  2F86 B;  1O7P B;  1YHQ 3;  3MG3 A;  3N8B A;  1E97 A;  3EBT A;  1WNH A;  4J8T A;  2RFR A;  2CWV A;  3EN8 A;  3CCE 3;  1GY5 A;  2A15 A;  3SOA A;  3OX9 A;  2XSO B;  2IA7 A;  3E99 A;  3WOD G;  5BXQ A;  3BND A;  5IG4 A;  3S67 A;  1M90 4;  1NDO B;  3EBY A;  5A0O B;  2STD A;  4BTW A;  2V1L A;  1OF5 B;  4GB5 A;  2KCD A;  4WFO A;  1US1 A;  4KZ1 A;  3X3Y A;  1ZO2 A;  1TIJ A;  2OWP A;  2W2C A;  1STF I;  3CC4 3;  3OXA A;  5STD A;  3CXC 2;  3FG1 A;  2ML6 A;  3CC7 3;  3V99 A;  3NV0 B;  1Y4K A;  4FMC A;  3CCQ 3;  3FG3 A;  1YJN 3;  1K8A 4;  5AIF A;  1KSI A;  3KN4 A;  3X3X A;  2O9U X;  2XH9 A;  4LMI A;  1S72 3;  1D6Y A;  1WQL B;  4EYC A;  3B4O A;  3FZW A;  4HM5 B;  2XEP A;  3KZT A;  4BTY A;  1VQP 3;  1VQK 3;  3WA3 A;  4L8O A;  3G0K A;  2E2U A;  3M8C A;  3O8Y A;  4FMB A;  1IV9 A;  2WGQ A;  1M1X B;  4XBX A;  1YVB I;  3U97 A;  1NU3 A;  3BNC A;  1IQY A;  4STD A;  4AEQ A;  3T8N A;  1Q40 A;  1UUV B;  1VQ6 3;  3V98 A;  1QAL A;  1N9J A;  3MG1 A;  1GD3 A;  3FSD A;  5G2G A;  4OUQ A;  1YI2 3;  4H61 A;  5LC7 A;  2XR8 B;  2Z76 A;  5IG5 A;  1Q81 4;  2P0X A;  4FCM A;  3I0Y A;  4N6V 0;  4WHA A;  2CIU A;  1Q86 4;  2SBL A;  2B24 B;  2RGQ A;  2OOV C;  3RGR A;  3F7X A;  2QIY A;  5AI1 A;  3CME 3;  1W6G A;  2P05 A;  2Z77 A;  2FXT A;  2YX9 A;  1W6C A;  2LQV A;  1N8R 4;  1ULI B;  5KP3 A;  4CCV A;  5BVB A;  2Q07 A;  7STD A;  3KSP A;  3UJM A;  3X40 A;  2QA4 3;  3OV4 A;  1W5Z A;  3EHC A;  2FNQ A;  4LGQ A;  4XM4 A;  3KKG A;  2YFJ B;  5IG3 A;  2CWT A;  2GU3 A;  4IT7 A;  1DYU A;  1FGR A;  3X42 A;  2E2T A;  3LTD A;  1N8Q A;  3NHX A;  5CXO A;  1RN7 A;  4U13 A;  3KE7 A;  3GRD A;  2CHC A;  1W7C A;  4HZ9 B;  1NB5 I;  3RDE A;  3DGL A;  1Q42 A;  1OAC A;  1VQL 3;  5IEO A;  2MF7 A;  3K9M C;  3MG2 A;  4LEH A;  3WOE B;  1Q40 B;  1QVG 2;  4HJL B;  1MNL A;  3F14 A;  4N6L A;  1EQK A;  3FCS B;  2GEX A;  1KWI A;  2K0M A;  3FLJ A;  5HGR A;  1W00 A;  1M9G A;  2ZL8 A;  3LTB A;  1IQ8 A;  2GBW B;  4K1U A;  1JJ2 2;  1VZZ A;  3DXO A;  4RNY A;  1D6Z A;  3CCU 3;  3JUQ A;  2XGN A;  1EA2 A;  3EC9 A;  3GAX A;  4KVH A;  1ROA A;  5LC6 A;  1VQ8 3;  3SX1 A;  1QVF 2;  1IU7 A;  2XGL A;  3G8Z A;  1DMQ A;  2CFL A;  4NRE A;  2OTL 3;  1UI7 A;  2BO9 B;  4K61 A;  3LML A;  4EBG A;  5EVH A;  3K5T A;  2CC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...