5KP3A

Crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to equilenin; d40n, y57(cl-y)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
127
structure length
126
Chain Sequence
MNLPTAQEVQGLMARYIELVDVGDIEAIVQMYADDATVENPFGQPPIHGREQIAAFRQGLGGGKVRACLTGPVRASHNGCGAMPFRVEMVWNGQPCALDVIDVMRFDEHGRIQTMQAYWSEVNLSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Critical Test of the Electrostatic Contribution to Catalysis with Noncanonical Amino Acids in Ketosteroid Isomerase.
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
total genus 34
structure length 126
sequence length 127
chains with identical sequence B
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2016-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12680 SnoaL_2 SnoaL-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 5kp3A00
1JKGB 1UUVB 5JPPA 2HMNB 3OWUA 3G8ZA 4HM2B 5AIIA 5FW5A 1OHOA 4OUQA 1NWWA 2RCDA 4R9KA 4XDVA 5IEOA 1Q40B 2GEYA 3F7SA 2HMOB 3F40A 3FGYA 4Q53A 3EN8A 4K1UA 3MG1A 5IERA 1SJWA 3GZYB 1K41A 2BNGA 2GEXA 2RFRA 3DXOA 3MG3A 4HZBB 3FLJA 4HM8B 2QIYA 2QGUA 1STDA 3EF8A 1E3VA 3MG2A 4R9LA 1JKGA 5AIGA 5EVHA 4WYKB 3GWRA 3NUVA 3NV0B 5BXQA 3CNMA 3HZPA 4FCJA 1TP6A 3DUKA 3HX8A 1EA2A 4PEJA 4HM4B 4X2OA 1AR0A 1EG9B 4XBYA 2OWPA 1BUQA 1OGXA 3FKAA 5KP1A 1O7NB 3NM2A 3RGRA 4CDLA 2YFIB 1QMAA 1E97A 1OGZA 1HKXA 3D9RA 3NXJA 3HK4A 4LMIA 3B8LA 3CNXA 5STDA 5CK6A 1UUWB 1WQLB 2CHCA 5HGRA 2HMKB 3FZWA 5KP4A 3MSOA 3FF0A 1OHPA 5IF6A 1GY6A 3NV0A 5IENA 1ASKA 3DM8A 4N3VA 1U5OA 2BMRB 1OHSA 3OV4A 4HKVB 1JB4A 3RGAA 4GB5A 3F7XA 2GXFA 4XM4A 3LZAA 2W2CA 3F9SA 2GBXB 1QJGA 1DMMA 4U13A 4FCMA 2F86B 1GY5A 4HJLB 4R1KA 3EX9A 3MKIA 4WP5A 3T8UA 4J8TA 3OWYA 2YFJB 1JB5A 3EBYA 3NBRA 1W01A 4HM3B 4L7KA 5KP3A 2Z77A 8CHOA 1Z1SA 3BB9A 4HM0B 1OUNA 1Q40A 2B1XB 2IMJA 3DZLA 3H3HA 1TUHA 5D82A 5G2GA 7STDA 5IG4A 4L8PA 2BMOB 4HM1B 3B7CA 6STDA 1W00A 4ORLA 3EJVA 4XDWA 2JQ5A 2I9WA 1DMNA 2F98A 4HM5B 3SOAA 1O7PB 2F99A 3GZXB 3OXAA 4XBTA 2XSOB 4K1VA 3S5CA 5AIHA 3UNLA 3SEDA 1O7WB 3WMDA 4XBXA 4H3UA 4XB5A 1GS3A 2GBWB 1W02A 4WWUC 5AEWB 3UJMA 1A2KA 1O7MB 2XRXB 2HMLB 1S5AA 1NDOB 1O7GB 2HMMB 3LYGA 3JUPA 3F14A 4WYKA 1E3RA 1C7HA 3FH1A 3JUQA 4STDA 3A76A 5AEUB 3F8XA 1JN5B 3CPOA 4L8OA 3EQQB 1NU3A 3FF2A 4OVMA 4I4KA 3STDA 2K54A 2BMQB 5CLKA 5BVBA 3Q90A 3SOYA 1OF5A 1ULIB 4J9AA 3DMCA 3VSYA 5JPUA 3T8NA 5AIFA 3MYTA 1IDPA 2Z7AA 2XSHB 3I0YA 3MHEA 1JN5A 2STDA 2Z76A 3K7CA 4HVNA 4IIAA 3CU3A 4LGQA 1OCVA 3OWSA 2A15A 1CQSA 4MJDA 1ISKA 3KKGA 4KVHA 3NHXA 5D81A 3E99A 3EC9A 4X2HA 5DRVA 3FSDA 4RZMA 5CXOA 5CF2A 1OF5B 1OH0A 3KZTA 2INXA 2CKFB 2PZVA 3EN1B 3B4PA 3ER7A 3G16A 1W6YA 3M8CA 3KE7A 3F8HA 4HZ9B 5IG5A 3KSPA 3BLZA 1GY7A 4HM6B 2RGQA 5IEPA 2B24B 3ROBA 5CF1A 2R4IA 5D83A 3JUNA 1ZX2A 5IG0A 3JUMA 3G0KA 3GZBA 2HMJB 5AI1A 3ECFA 3IPTA 5DREA 2UX0A 3VGNA 3GRDA 3B4OA 1GYBA 3OX9A 1JB2A 2XR8B 4HM7B 3EBTA 4LEHA 3EHCA 3JUOA 2YFLB 1DMQA 1O7HB 3GZRA 1OPYA 1ULJB 3H51A 1ZO2A 3K0ZA 5TGNA 1VZZA 5IG3A 1Q42A
chains in the Genus database with same CATH superfamily
1UCIA 1HU9A 3ZFZA 1FGRA 2CWUA 1ZGXA 2OCTA 3S28A 2HMNB 2F4YA 4OK0A 5FW5A 2AADA 4OUQA 4R9KA 3S67A 2RCDA 1IVVA 1RLSA 2J8XB 1W6GA 1Q40B 4KFEA 3F40A 3FGYA 1BGSA 4Q53A 3WOEB 3MG1A 3CCV3 3FLJA 4HM8B 4BU4A 1AVLA 1GSPA 1N8QA 2CFLA 3EF8A 3MG2A 5BXQA 2H0IA 1S723 3GWRA 1I2EA 3NUVA 3I553 3CCJ3 2F5MA 1TFOA 1BSEA 2W9PA 1TP6A 1BRNL 5ELJA 3HX8A 3SVAA 4HM4B 1JZOA 1BUQA 1LOXA 1CEWI 3PYJA 4WHAA 5FGOA 1BIRA 4BL2A 3DGYA 2F5WA 3RGRA 1BRIA 1OGZA 3D9RA 1VQ73 5CK6A 1UUWB 2CHCA 5HGRA 2HMKB 2ZA4A 4BTYA 1JBRA 3FF0A 1MWRA 1A67A 4TX4A 4EV2A 5IENA 1ASKA 4N3VA 1IT7A 1BNSA 1U5OA 2BMRB 2OQEC 1BRJA 4GB5A 1IYYA 1BVIA 3LZAA 1B2ZA 2FXTA 2GBXB 2RBIA 2SBLA 3FCSB 3WA2X 3ALAA 2F86B 2RSXA 4WP5A 4BIRA 1YHQ3 3MKIA 4AEQA 4HM3B 1RHLA 3EBYA 1UUGB 4LZIA 5KP3A 4L7KA 3DGOA 4HYZA 3KFQC 1Z1SA 1OUNA 3WDGB 2B1XB 1LOYA 1VQ53 1RTUA 4GSPA 1B2SA 2M7OA 3PXMA 4O8SA 4RNTA 1I0XA 2BIRA 7STDA 3G4S3 3J7Yd 1YGWA 5M18A 2W6JH 6STDA 3I563 1Q7Y4 3DGMA 2F99A 1FGTA 1YJ93 5AIHA 1LRAA 3BNCA 3D5IA 4H3UA 1GS3A 2GBWB 4FMDA 5AEWB 1JRQA 3PCSA 3UJMA 1O7MB 2D1WA 4AKZA 3G6E3 1NDOB 1G96A 3F14A 3RNTA 1DVDA 3A76A 1QVF2 6RNTA 2E2TA 1BNFA 4OVMA 3V98A 3STDA 2H0GA 2P0MA 2W9QA 2ML6A 4N6LA 1W2B2 3DGLA 3SLUA 4J9AA 1TTOA 3DMCA 1FW7A 3T8NA 5AIFA 4BTWA 2Z7AA 2CX1A 2STDA 4HVNA 1GMRA 3O8YA 5G1LA 1FA3A 1FUWA 3KKGA 1IV7A 4H61A 4KVHA 5CF2A 3N54B 2IY2A 1IT8A 1Q824 3FG4A 2CKFB 1YI23 3EN1B 2V1LA 5LC7A 1MWSA 2ZL8A 3KCHA 5IG5A 1MOLA 3KSPA 1VQP3 1K8A4 1GOVA 2RGQA 3HIGA 3AMOA 4KZ1A 1JNQA 2R4IA 5D83A 5AI1A 2XGNA 2CWVA 1UI7A 2UX0A 1VQ63 1RCKA 3GRDA 3B4OA 2GU3A 2E2VA 4LYLB 3MPHA 3EBTA 1B20A 2MF7A 4HOHA 1DMQA 3D79A 3RDEA 3X41A 3H51A 1RNBA 5TGNA 2P0XA 1Q864 1VZZA 1LQGC 1Q42A 3AMOB 5JPPA 4NREA 3OWUA 4AKYA 3G8ZA 4HM2B 1NNVA 1OHOA 1ROAA 4XDVA 1BUJA 1YIJ3 2HMOB 4MMXB 4N6TA 3EN8A 4K1UA 3BU4A 3KN4A 5IERA 3GZYB 1K41A 1G02A 2BNGA 3X3XA 2KF4A 3LT8A 1UCJA 1K9M4 2P09A 2E2UA 1WMPA 3NV0B 1MWTA 1RCLA 1FUTA 1WMOA 4FCJA 3DUKA 3L0RA 1TRQA 4N6UA 1IQ8A 3AHSA 4PEJA 4XBYA 1AR0A 1DVCA 3FKAA 1JV2B 1O7NB 1ZS7A 1CH0A 1M1XB 3DGNA 2LQVA 3NM7A 1QMAA 1KC84 3NXJA 3HK4A 1LXEA 2KF6A 3CNXA 6GSPA 5KP4A 4EXRA 1YVSA 3FZWA 5GSPA 2OTL3 1RGAA 3MSOA 1G0TA 1OHPA 1RRLA 4O2HA 3S29A 1W4NA 1T2HA 2W03A 3OV4A 4HKVB 3RGAA 1YJN3 4EW5A 4NHFA 2GSPA 2GXFA 2W56B 2IA7A 1MGWA 1DMMA 3X3ZA 4FCMA 1GY5A 4R1KA 5ELUA 3HIIA 1JJ22 4J8TA 2YFJB 1W01A 1A2PA 3G713 1BU4A 1D6ZA 3BB9A 4HM0B 1Q40A 1L5GB 5G2GA 3H3HA 1YJW3 1B2XA 3QK9A 4L8PA 2BMOB 3DH2A 3EB8A 2CFGA 1SARA 2JQ5A 2F98A 4QWTA 1Q7HA 1M9GA 1O7PB 4WFOA 1I70A 7GSPA 1BSDA 4XBTA 5M1AA 4CCVA 1MGRA 3PS8A 3HOHA 2XRXB 1NJI4 1O7GB 3LYGA 3GAXA 1RN7A 1AV4A 1GD3A 1C7HA 1FZUA 2PNCA 3JUQA 2O3OA 1KSIA 4J5GA 4STDA 1PYLA 4NPBA 5EQLA 2BU4A 3CPOA 3K9MC 1RKYA 1T2IA 1RDSA 5LC6A 1LVNA 1AY7A 1T3BA 3SOYA 3LTAA 1EQKA 2OOVC 1ULIB 1RJOA 2CG0A 3LTBA 3UL5A 1Q814 3AGOA 3MYTA 1IVUA 4RNZA 4EC6A 1I2FA 1IDPA 3I0YA 3NBBA 3EE1A 1ISKA 1TFKA 1W5ZA 2Y73A 2CC3A 3CCL3 2CIUA 3CU3A 3OWSA 4FMCA 4ILFA 4MJDA 1VQK3 1A90A 3NHXA 3QRDA 4DKIA 2W56A 3FSDA 5DRVA 2P38A 2XEPA 3JVCA 9RNTA 4CJNA 3G16A 2SARA 1VQM3 1UW1A 1BSAA 1IVWA 3BLZA 3DY5A 1DE3A 1J2BA 2XFSA 4FMBA 1IQYA 3UB1A 1I3FA 1ZX2A 3JUMA 3VGNA 1D6UA 1DETA 2K3DA 3IPTA 2WGOA 1BRKA 1HYFA 1JB2A 2AAEA 2CH9A 1FGMA 2XR8B 1PU4A 1M1K4 1YVBI 3EHCA 3JUOA 1WNHA 3D3LA 3GZRA 4FR9A 5IG3A 1JKGB 1UUVB 5G1KA 1BNRA 3CME3 1WTHA 2CWTA 1VQ43 1LOVA 3BNEA 5AIIA 3CCS3 1BRGA 3Q1CA 1D6YA 5M19A 2C10A 2O9UX 1IV9A 1N5HA 2CX0A 3PGBA 2L4VA 1IQXA 1IVXA 1MWUA 1X1XA 2QA43 1VQL3 2H0HA 1VQ93 3Q2PA 1YNVX 2RFRA 2UUGC 3DXOA 1QAKA 3N9HA 2QGUA 4JF8A 1BAOA 1E3VA 4R9LA 5EVHA 1BSCA 1JBSA 1VQO3 3NQZA 3KSED 7RNTA 1EA2A 1IK3A 1EG9B 3X3YA 2OWPA 3PZWA 2L1SA 2IUKA 3NM2A 1QAFA 4LMIA 4FMAA 5IF6A 1HKXA 4KFDA 5STDA 3B8LA 3K63A 1WQLB 1N5PA 3CCM3 1FGQA 1BNGA 1SPUA 1GY6A 3NV0A 3V92A 3WR2A 3DM8A 5RNTA 2CFDA 1NB3I 1OHSA 3ZG0A 3CCE3 2F56A 3F7XA 1ROVA 2W2CA 1BOXA 1CYVA 3AGNA 3F9SA 4U13A 3WODG 1F8NA 3EX9A 3T8UA 1B2UA 3OWYA 2CW9A 1JB5A 3NBRA 1RN4A 5IW9A 3WOFB 2Z77A 4O3VA 2CG1A 3K5TA 1GMQA 3CCQ3 1W7CA 3D4AA 2MC8A 5BU4A 4J5KA 3B7CA 4ORLA 2JDIH 3PCRA 2WO0A 2I9WA 4XDWA 3LXUX 4K90B 4HM5B 3SOAA 1GD4A 1RGKA 1N9JA 3GZXB 3A5EA 3BNBA 3SXXA 3UNLA 1U8CB 1US1A 2OOVA 3WMDA 3CCU3 3OW22 1O7WB 3Q3FA 3FG3A 1SIIA 4XB5A 3UL6A 1W02A 4WWUC 2HMLB 3IMAB 1BNEA 1RGEA 1STFI 3MWZA 4WYKA 1E3RA 5AEUB 1W2ZA 1UGIA 3AHWA 2CK3H 2D42A 1IU7A 1RSNA 4L8OA 3EQQB 1NU3A 4RBNA 1FGOA 2BMQB 1BNJA 1SQWA 1X1YA 1X1UA 3Q90A 3S27A 3T0UA 2Z6BA 1OF5A 4G1MB 4GHOA 5AYSC 1M904 1PY3A 2Y74A 5HOHA 4WYKB 2Z76A 1EEJA 1RN1A 4HAAA 1B3SA 1LOWA 2A15A 1CQSA 1W6CA 2C11A 2K0MA 2XH9A 3E99A 1RNTA 4X2HA 4RZMA 5CXOA 3SYUA 4EBGA 1OF5B 1JBTA 2YX9A 1OH0A 2ZDJA 1NB5I 3KZTA 1UGHI 2INXA 1RGFA 3IJEB 4FCZA 3B4PA 4HZ9B 1W6YA 1CYUA 3KE7A 3F8HA 1TU5A 1RMSA 4EYCA 3WHOA 1GY7A 4HM6B 1OACA 1R4YA 5IEPA 3ROBA 1EKMA 1N8R4 5DREA 3ECFA 4HM7B 2C4BA 1TIJA 1OPYA 3K0ZA 3NX0A 1ZO2A 4HBRA 3D5GA 2WGQA 3BNDA 1V74A 1C54A 1VQN3 3CC23 3LTCA 4KFFA 1HZ1A 4MMYB 1RGGA 5IEOA 1NWWA 3CMA3 1R4CA 1Q9EA 1QALA 2GEYA 1V58A 1Y4KA 2ZHXB 3F7SA 3TDGA 1BNIA 4R80A 4KT3B 2KCDA 3N8BA 1SJWA 3BIRA 3LT9A 2GEXA 3MG3A 2XFTA 3LTDA 4HZBB 2QIYA 1STDA 4IPBA 3WA3A 5AIGA 4N6MA 1JKGA 1LQMB 3LMLA 3CXC2 3X42A 3CNMA 3HZPA 3SX1A 1NO3A 2QEX3 3X40A 4K61A 4X2OA 1MNLA 2HOHA 1OGXA 1UI8A 2W0QA 1GMPA 1VQ83 5KP1A 1RRHA 1X1WA 4CDLA 1LNIA 2YFIB 1B27A 1JZDA 1E97A 1QVG2 3KIIA 2BO9B 3CC43 4N6NB 1PFPA 2RNTA 4IT7A 1WMNA 5A0OB 1B2MA 3LOYA 2FNQA 1I8VA 2KXGA 4BTXA 3GSPA 1BRHA 1TRPA 1JB4A 2WOHA 2OQEA 4XM4A 8RNTA 1LNHA 1V57A 1YIT3 1QJGA 2OTJ3 1I0VA 1YGEA 2XF3A 4HJLB 2FGTA 4N6OB 3VF1A 3CD63 8CHOA 2BHMA 3CCR3 3DZLA 1A2VA 5IG4A 2IMJA 1TUHA 5D82A 4EV5A 1GOYA 4HM1B 1B21A 1RGCA 1BANA 5EEOA 1W00A 1I3IA 3EJVA 1I2GA 1DMNA 4GL6A 1KD14 3HI7A 3OXAA 1EUIC 4MMZB 2ML5A 2XSOB 4K1VA 3S5CA 3CC73 3SEDA 4XBXA 1A2KA 4BL3A 1GOUA 1S5AA 2HMMB 3ZG5A 3JUPA 3FH1A 4LSOA 2KF3A 3V99A 2Q07A 1RGLA 2R41A 3F8XA 1JN5B 3NQYA 2P05A 1KQS2 3FF2A 1SIHA 4I4KA 2K54A 1TJDA 5CLKA 5BVBA 2CFKA 2WOFA 5JPUA 1BRSA 4RNYA 3VSYA 2XGLA 5I97A 2XSHB 3MHEA 4O02B 1JN5A 5JBSA 4IIAA 1AQZA 3K7CA 4LGQA 3NBJA 1K734 1OCVA 1UCKA 1RGHA 2LYXA 5D81A 5BIRA 1BSBA 3EC9A 1VQQA 1K28A 4N6V0 4I5QA 3U1WA 3LH4A 1FYSA 4R4KA 2UGIA 4CPKA 2PZVA 2IYJA 1UDII 3ER7A 3M8CA 2GU1A 3FG1A 1UCLA 2BT3A 3CPW2 4JRFA 3URPA 2B24B 4ZM8A 5CF1A 1FUSA 3JUNA 5IG0A 3U97A 2KF5A 3G0KA 2HMJB 2KAAA 3GZBA 2IUJA 1N9EA 1GYBA 1AVKA 3OX9A 2KRTA 2W04A 2CFWA 4LEHA 4MEIA 2YFLB 1O7HB 1T5YA 1ULJB 5AYRB 1DYUA 1KWIA
chains in the Genus database with same CATH topology
1HU9A 1FGRA 2CWUA 2OCTA 3S28A 2HMNB 4OK0A 5FW5A 4OUQA 4R9KA 3S67A 2RCDA 1IVVA 1W6GA 1Q40B 4KFEA 3F40A 3FGYA 3WOEB 4Q53A 3MG1A 3CCV3 3FLJA 4HM8B 1AVLA 1N8QA 2CFLA 3EF8A 1S723 3MG2A 5BXQA 3GWRA 3NUVA 3I553 3CCJ3 1TFOA 2W9PA 1TP6A 5ELJA 3HX8A 3SVAA 4HM4B 1BUQA 1LOXA 1CEWI 3PYJA 4WHAA 5FGOA 3RGRA 1OGZA 3D9RA 1VQ73 5CK6A 1UUWB 2CHCA 5HGRA 2HMKB 4BTYA 3FF0A 1A67A 4TX4A 4EV2A 5IENA 1ASKA 4N3VA 1IT7A 1U5OA 2BMRB 2OQEC 4GB5A 3LZAA 2FXTA 2GBXB 2SBLA 3FCSB 3WA2X 3ALAA 2F86B 2RSXA 4WP5A 1YHQ3 3MKIA 4AEQA 4HM3B 3EBYA 4LZIA 5KP3A 4L7KA 3DGOA 4HYZA 3KFQC 1Z1SA 1OUNA 3WDGB 2B1XB 1VQ53 7STDA 2M7OA 3PXMA 4O8SA 3G4S3 3J7Yd 2W6JH 6STDA 3I563 1Q7Y4 3DGMA 2F99A 1FGTA 1YJ93 5AIHA 5AEWB 3BNCA 4H3UA 1GS3A 2GBWB 4FMDA 1JRQA 3PCSA 3UJMA 1O7MB 2D1WA 4AKZA 3G6E3 1NDOB 1G96A 3F14A 1DVDA 3A76A 1QVF2 2E2TA 4OVMA 3V98A 3STDA 2P0MA 2W9QA 2ML6A 4N6LA 1W2B2 3DGLA 3SLUA 4J9AA 3DMCA 3T8NA 5AIFA 4BTWA 2Z7AA 2STDA 4HVNA 3O8YA 1FA3A 3KKGA 1IV7A 4H61A 4KVHA 5CF2A 3N54B 1IT8A 1Q824 3FG4A 2CKFB 1YI23 3EN1B 2V1LA 5LC7A 2ZL8A 5IG5A 1MOLA 3KSPA 1VQP3 1K8A4 2RGQA 3HIGA 3AMOA 4KZ1A 1JNQA 2R4IA 5D83A 5AI1A 2XGNA 2CWVA 1UI7A 2UX0A 1VQ63 3GRDA 3B4OA 2GU3A 2E2VA 3MPHA 3EBTA 2MF7A 1DMQA 3RDEA 3X41A 3H51A 5TGNA 2P0XA 1Q864 1VZZA 1Q42A 3AMOB 5JPPA 4NREA 3OWUA 4AKYA 3G8ZA 4HM2B 1OHOA 4XDVA 1ROAA 1YIJ3 2HMOB 4MMXB 4N6TA 3EN8A 4K1UA 3KN4A 5IERA 3GZYB 1K41A 2BNGA 3X3XA 3LT8A 1K9M4 2P09A 2E2UA 1WMPA 3NV0B 1WMOA 4FCJA 3DUKA 3L0RA 4N6UA 4PEJA 1IQ8A 4XBYA 1AR0A 1DVCA 3FKAA 1JV2B 1O7NB 3DGNA 1M1XB 2LQVA 3NM7A 1QMAA 1KC84 3NXJA 3HK4A 1LXEA 3CNXA 5KP4A 4EXRA 3FZWA 2OTL3 3MSOA 1OHPA 1RRLA 4O2HA 3S29A 1W4NA 2W03A 3OV4A 4HKVB 3RGAA 1YJN3 4NHFA 2GXFA 2W56B 2IA7A 1DMMA 3X3ZA 4FCMA 1GY5A 4R1KA 5ELUA 3HIIA 1JJ22 4J8TA 2YFJB 1W01A 3G713 1D6ZA 3BB9A 4HM0B 1Q40A 1L5GB 5G2GA 3H3HA 1YJW3 3QK9A 4L8PA 2BMOB 3EB8A 2CFGA 2JQ5A 2F98A 4QWTA 1M9GA 1O7PB 4WFOA 4XBTA 4CCVA 3PS8A 2XRXB 1NJI4 1O7GB 3LYGA 3GAXA 1RN7A 1AV4A 1GD3A 1C7HA 2PNCA 3JUQA 2O3OA 1KSIA 4STDA 5EQLA 3K9MC 3CPOA 1RKYA 5LC6A 1LVNA 3SOYA 3LTAA 1EQKA 2OOVC 1ULIB 1RJOA 2CG0A 3LTBA 3UL5A 1Q814 3MYTA 1IVUA 4RNZA 4EC6A 1IDPA 3I0YA 3NBBA 1ISKA 3EE1A 1TFKA 1W5ZA 2Y73A 2CC3A 3CCL3 2CIUA 3CU3A 3OWSA 4FMCA 1VQK3 4MJDA 1A90A 3NHXA 3QRDA 2W56A 3FSDA 5DRVA 2P38A 2XEPA 3JVCA 3G16A 1VQM3 1UW1A 1IVWA 3BLZA 3DY5A 1J2BA 2XFSA 4FMBA 1IQYA 3UB1A 1ZX2A 3JUMA 3VGNA 1D6UA 3IPTA 2WGOA 1JB2A 2CH9A 2XR8B 1FGMA 1PU4A 1M1K4 1YVBI 3EHCA 3JUOA 1WNHA 3D3LA 3GZRA 4FR9A 5IG3A 1JKGB 1UUVB 3CME3 1WTHA 2CWTA 1VQ43 5AIIA 3BNEA 3CCS3 3Q1CA 1D6YA 2C10A 2O9UX 1IV9A 1N5HA 3PGBA 2L4VA 1IQXA 1IVXA 2QA43 1VQL3 1VQ93 3Q2PA 2RFRA 3DXOA 1QAKA 3N9HA 2QGUA 4JF8A 1E3VA 4R9LA 5EVHA 1VQO3 3NQZA 3KSED 1EA2A 1IK3A 1EG9B 3X3YA 2OWPA 3PZWA 2IUKA 3NM2A 1QAFA 4LMIA 4FMAA 5IF6A 1HKXA 4KFDA 5STDA 3B8LA 3K63A 1WQLB 1N5PA 3CCM3 1FGQA 1SPUA 3V92A 1GY6A 3NV0A 3DM8A 1NB3I 2CFDA 1OHSA 3CCE3 3F7XA 1ROVA 2W2CA 1CYVA 3F9SA 3WODG 4U13A 1F8NA 3EX9A 3T8UA 3OWYA 2CW9A 1JB5A 3NBRA 5IW9A 3WOFB 2Z77A 4O3VA 2CG1A 3K5TA 3CCQ3 1W7CA 2MC8A 3B7CA 4ORLA 2JDIH 3PCRA 2WO0A 2I9WA 4XDWA 3LXUX 4K90B 4HM5B 3SOAA 1GD4A 1FUWA 1N9JA 3GZXB 3BNBA 3SXXA 3UNLA 1U8CB 1US1A 2OOVA 3WMDA 3CCU3 3OW22 1O7WB 3FG3A 1SIIA 4XB5A 3UL6A 1W02A 4WWUC 2HMLB 3IMAB 1STFI 3MWZA 4WYKA 1E3RA 5AEUB 1W2ZA 2CK3H 2D42A 1IU7A 4L8OA 3EQQB 1NU3A 4RBNA 1FGOA 2BMQB 1SQWA 3S27A 3T0UA 3Q90A 2Z6BA 1OF5A 4G1MB 5AYSC 1M904 2Y74A 4WYKB 2Z76A 2A15A 1CQSA 1W6CA 2C11A 2K0MA 2XH9A 3E99A 4X2HA 5CXOA 4RZMA 4EBGA 1OF5B 2YX9A 1OH0A 2ZDJA 1NB5I 3KZTA 2INXA 3IJEB 4FCZA 3B4PA 4HZ9B 1W6YA 1CYUA 3KE7A 3F8HA 1TU5A 4EYCA 1GY7A 4HM6B 1OACA 5IEPA 1N8R4 3ROBA 1EKMA 5DREA 3ECFA 4HM7B 1TIJA 1OPYA 3K0ZA 3NX0A 1ZO2A 4HBRA 2WGQA 3BNDA 1V74A 1VQN3 3CC23 3LTCA 4KFFA 5IEOA 4MMYB 1NWWA 3CMA3 1R4CA 1QALA 2GEYA 3F7SA 1Y4KA 3TDGA 4R80A 2KCDA 3N8BA 1SJWA 3LT9A 2GEXA 3MG3A 2XFTA 3LTDA 4HZBB 2QIYA 1STDA 4IPBA 3WA3A 5AIGA 4N6MA 1JKGA 3LMLA 3CXC2 3X42A 3CNMA 3HZPA 3SX1A 1NO3A 2QEX3 3X40A 4K61A 4X2OA 1MNLA 1OGXA 1UI8A 2W0QA 1VQ83 5KP1A 1RRHA 4CDLA 2YFIB 1E97A 1QVG2 3KIIA 2BO9B 3CC43 4N6NB 1PFPA 4IT7A 1WMNA 5A0OB 3LOYA 2FNQA 2KXGA 4BTXA 2WOHA 1JB4A 2OQEA 4XM4A 1LNHA 1YIT3 1QJGA 2OTJ3 2XF3A 1YGEA 4HJLB 2FGTA 4N6OB 3VF1A 3CD63 8CHOA 2BHMA 3CCR3 3DZLA 1A2VA 5IG4A 2IMJA 1TUHA 5D82A 4EV5A 4HM1B 5EEOA 1W00A 3EJVA 1DMNA 4GL6A 1KD14 3HI7A 3OXAA 4MMZB 2ML5A 2XSOB 4K1VA 3S5CA 3CC73 3SEDA 4XBXA 1A2KA 1S5AA 2HMMB 3JUPA 3FH1A 4LSOA 3V99A 2Q07A 3F8XA 1JN5B 3NQYA 2P05A 1KQS2 3FF2A 1SIHA 4I4KA 2K54A 5CLKA 5BVBA 2CFKA 2WOFA 5JPUA 4RNYA 3VSYA 2XGLA 5I97A 2XSHB 3MHEA 4O02B 1JN5A 5JBSA 4IIAA 3K7CA 4LGQA 1K734 3NBJA 1OCVA 2LYXA 5D81A 3EC9A 1K28A 4N6V0 3U1WA 3LH4A 4R4KA 2PZVA 3ER7A 3M8CA 2GU1A 3FG1A 2BT3A 3CPW2 4JRFA 2B24B 4ZM8A 5CF1A 3JUNA 5IG0A 3U97A 3G0KA 3GZBA 2HMJB 2IUJA 1N9EA 1GYBA 1AVKA 3OX9A 2KRTA 2W04A 2CFWA 4LEHA 4MEIA 2YFLB 1O7HB 1T5YA 1ULJB 5AYRB 1DYUA 1KWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKG B;  1UUV B;  5JPP A;  2HMN B;  3OWU A;  3G8Z A;  4HM2 B;  5AII A;  5FW5 A;  1OHO A;  4OUQ A;  1NWW A;  2RCD A;  4R9K A;  4XDV A;  5IEO A;  1Q40 B;  2GEY A;  3F7S A;  2HMO B;  3F40 A;  3FGY A;  4Q53 A;  3EN8 A;  4K1U A;  3MG1 A;  5IER A;  1SJW A;  3GZY B;  1K41 A;  2BNG A;  2GEX A;  2RFR A;  3DXO A;  3MG3 A;  4HZB B;  3FLJ A;  4HM8 B;  2QIY A;  2QGU A;  1STD A;  3EF8 A;  1E3V A;  3MG2 A;  4R9L A;  1JKG A;  5AIG A;  5EVH A;  4WYK B;  3GWR A;  3NUV A;  3NV0 B;  5BXQ A;  3CNM A;  3HZP A;  4FCJ A;  1TP6 A;  3DUK A;  3HX8 A;  1EA2 A;  4PEJ A;  4HM4 B;  4X2O A;  1AR0 A;  1EG9 B;  4XBY A;  2OWP A;  1BUQ A;  1OGX A;  3FKA A;  5KP1 A;  1O7N B;  3NM2 A;  3RGR A;  4CDL A;  2YFI B;  1QMA A;  1E97 A;  1OGZ A;  1HKX A;  3D9R A;  3NXJ A;  3HK4 A;  4LMI A;  3B8L A;  3CNX A;  5STD A;  5CK6 A;  1UUW B;  1WQL B;  2CHC A;  5HGR A;  2HMK B;  3FZW A;  5KP4 A;  3MSO A;  3FF0 A;  1OHP A;  5IF6 A;  1GY6 A;  3NV0 A;  5IEN A;  1ASK A;  3DM8 A;  4N3V A;  1U5O A;  2BMR B;  1OHS A;  3OV4 A;  4HKV B;  1JB4 A;  3RGA A;  4GB5 A;  3F7X A;  2GXF A;  4XM4 A;  3LZA A;  2W2C A;  3F9S A;  2GBX B;  1QJG A;  1DMM A;  4U13 A;  4FCM A;  2F86 B;  1GY5 A;  4HJL B;  4R1K A;  3EX9 A;  3MKI A;  4WP5 A;  3T8U A;  4J8T A;  3OWY A;  2YFJ B;  1JB5 A;  3EBY A;  3NBR A;  1W01 A;  4HM3 B;  4L7K A;  5KP3 A;  2Z77 A;  8CHO A;  1Z1S A;  3BB9 A;  4HM0 B;  1OUN A;  1Q40 A;  2B1X B;  2IMJ A;  3DZL A;  3H3H A;  1TUH A;  5D82 A;  5G2G A;  7STD A;  5IG4 A;  4L8P A;  2BMO B;  4HM1 B;  3B7C A;  6STD A;  1W00 A;  4ORL A;  3EJV A;  4XDW A;  2JQ5 A;  2I9W A;  1DMN A;  2F98 A;  4HM5 B;  3SOA A;  1O7P B;  2F99 A;  3GZX B;  3OXA A;  4XBT A;  2XSO B;  4K1V A;  3S5C A;  5AIH A;  3UNL A;  3SED A;  1O7W B;  3WMD A;  4XBX A;  4H3U A;  4XB5 A;  1GS3 A;  2GBW B;  1W02 A;  4WWU C;  5AEW B;  3UJM A;  1A2K A;  1O7M B;  2XRX B;  2HML B;  1S5A A;  1NDO B;  1O7G B;  2HMM B;  3LYG A;  3JUP A;  3F14 A;  4WYK A;  1E3R A;  1C7H A;  3FH1 A;  3JUQ A;  4STD A;  3A76 A;  5AEU B;  3F8X A;  1JN5 B;  3CPO A;  4L8O A;  3EQQ B;  1NU3 A;  3FF2 A;  4OVM A;  4I4K A;  3STD A;  2K54 A;  2BMQ B;  5CLK A;  5BVB A;  3Q90 A;  3SOY A;  1OF5 A;  1ULI B;  4J9A A;  3DMC A;  3VSY A;  5JPU A;  3T8N A;  5AIF A;  3MYT A;  1IDP A;  2Z7A A;  2XSH B;  3I0Y A;  3MHE A;  1JN5 A;  2STD A;  2Z76 A;  3K7C A;  4HVN A;  4IIA A;  3CU3 A;  4LGQ A;  1OCV A;  3OWS A;  2A15 A;  1CQS A;  4MJD A;  1ISK A;  3KKG A;  4KVH A;  3NHX A;  5D81 A;  3E99 A;  3EC9 A;  4X2H A;  5DRV A;  3FSD A;  4RZM A;  5CXO A;  5CF2 A;  1OF5 B;  1OH0 A;  3KZT A;  2INX A;  2CKF B;  2PZV A;  3EN1 B;  3B4P A;  3ER7 A;  3G16 A;  1W6Y A;  3M8C A;  3KE7 A;  3F8H A;  4HZ9 B;  5IG5 A;  3KSP A;  3BLZ A;  1GY7 A;  4HM6 B;  2RGQ A;  5IEP A;  2B24 B;  3ROB A;  5CF1 A;  2R4I A;  5D83 A;  3JUN A;  1ZX2 A;  5IG0 A;  3JUM A;  3G0K A;  3GZB A;  2HMJ B;  5AI1 A;  3ECF A;  3IPT A;  5DRE A;  2UX0 A;  3VGN A;  3GRD A;  3B4O A;  1GYB A;  3OX9 A;  1JB2 A;  2XR8 B;  4HM7 B;  3EBT A;  4LEH A;  3EHC A;  3JUO A;  2YFL B;  1DMQ A;  1O7H B;  3GZR A;  1OPY A;  1ULJ B;  3H51 A;  1ZO2 A;  3K0Z A;  5TGN A;  1VZZ A;  5IG3 A;  1Q42 A; 
#chains in the Genus database with same CATH topology
 1UCI A;  1HU9 A;  3ZFZ A;  1FGR A;  2CWU A;  1ZGX A;  2OCT A;  3S28 A;  2HMN B;  2F4Y A;  4OK0 A;  5FW5 A;  2AAD A;  4OUQ A;  4R9K A;  3S67 A;  2RCD A;  1IVV A;  1RLS A;  2J8X B;  1W6G A;  1Q40 B;  4KFE A;  3F40 A;  3FGY A;  1BGS A;  4Q53 A;  3WOE B;  3MG1 A;  3CCV 3;  3FLJ A;  4HM8 B;  4BU4 A;  1AVL A;  1GSP A;  1N8Q A;  2CFL A;  3EF8 A;  3MG2 A;  5BXQ A;  2H0I A;  1S72 3;  3GWR A;  1I2E A;  3NUV A;  3I55 3;  3CCJ 3;  2F5M A;  1TFO A;  1BSE A;  2W9P A;  1TP6 A;  1BRN L;  5ELJ A;  3HX8 A;  3SVA A;  4HM4 B;  1JZO A;  1BUQ A;  1LOX A;  1CEW I;  3PYJ A;  4WHA A;  5FGO A;  1BIR A;  4BL2 A;  3DGY A;  2F5W A;  3RGR A;  1BRI A;  1OGZ A;  3D9R A;  1VQ7 3;  5CK6 A;  1UUW B;  2CHC A;  5HGR A;  2HMK B;  2ZA4 A;  4BTY A;  1JBR A;  3FF0 A;  1MWR A;  1A67 A;  4TX4 A;  4EV2 A;  5IEN A;  1ASK A;  4N3V A;  1IT7 A;  1BNS A;  1U5O A;  2BMR B;  2OQE C;  1BRJ A;  4GB5 A;  1IYY A;  1BVI A;  3LZA A;  1B2Z A;  2FXT A;  2GBX B;  2RBI A;  2SBL A;  3FCS B;  3WA2 X;  3ALA A;  2F86 B;  2RSX A;  4WP5 A;  4BIR A;  1YHQ 3;  3MKI A;  4AEQ A;  4HM3 B;  1RHL A;  3EBY A;  1UUG B;  4LZI A;  5KP3 A;  4L7K A;  3DGO A;  4HYZ A;  3KFQ C;  1Z1S A;  1OUN A;  3WDG B;  2B1X B;  1LOY A;  1VQ5 3;  1RTU A;  4GSP A;  1B2S A;  2M7O A;  3PXM A;  4O8S A;  4RNT A;  1I0X A;  2BIR A;  7STD A;  3G4S 3;  3J7Y d;  1YGW A;  5M18 A;  2W6J H;  6STD A;  3I56 3;  1Q7Y 4;  3DGM A;  2F99 A;  1FGT A;  1YJ9 3;  5AIH A;  1LRA A;  3BNC A;  3D5I A;  4H3U A;  1GS3 A;  2GBW B;  4FMD A;  5AEW B;  1JRQ A;  3PCS A;  3UJM A;  1O7M B;  2D1W A;  4AKZ A;  3G6E 3;  1NDO B;  1G96 A;  3F14 A;  3RNT A;  1DVD A;  3A76 A;  1QVF 2;  6RNT A;  2E2T A;  1BNF A;  4OVM A;  3V98 A;  3STD A;  2H0G A;  2P0M A;  2W9Q A;  2ML6 A;  4N6L A;  1W2B 2;  3DGL A;  3SLU A;  4J9A A;  1TTO A;  3DMC A;  1FW7 A;  3T8N A;  5AIF A;  4BTW A;  2Z7A A;  2CX1 A;  2STD A;  4HVN A;  1GMR A;  3O8Y A;  5G1L A;  1FA3 A;  1FUW A;  3KKG A;  1IV7 A;  4H61 A;  4KVH A;  5CF2 A;  3N54 B;  2IY2 A;  1IT8 A;  1Q82 4;  3FG4 A;  2CKF B;  1YI2 3;  3EN1 B;  2V1L A;  5LC7 A;  1MWS A;  2ZL8 A;  3KCH A;  5IG5 A;  1MOL A;  3KSP A;  1VQP 3;  1K8A 4;  1GOV A;  2RGQ A;  3HIG A;  3AMO A;  4KZ1 A;  1JNQ A;  2R4I A;  5D83 A;  5AI1 A;  2XGN A;  2CWV A;  1UI7 A;  2UX0 A;  1VQ6 3;  1RCK A;  3GRD A;  3B4O A;  2GU3 A;  2E2V A;  4LYL B;  3MPH A;  3EBT A;  1B20 A;  2MF7 A;  4HOH A;  1DMQ A;  3D79 A;  3RDE A;  3X41 A;  3H51 A;  1RNB A;  5TGN A;  2P0X A;  1Q86 4;  1VZZ A;  1LQG C;  1Q42 A;  3AMO B;  5JPP A;  4NRE A;  3OWU A;  4AKY A;  3G8Z A;  4HM2 B;  1NNV A;  1OHO A;  1ROA A;  4XDV A;  1BUJ A;  1YIJ 3;  2HMO B;  4MMX B;  4N6T A;  3EN8 A;  4K1U A;  3BU4 A;  3KN4 A;  5IER A;  3GZY B;  1K41 A;  1G02 A;  2BNG A;  3X3X A;  2KF4 A;  3LT8 A;  1UCJ A;  1K9M 4;  2P09 A;  2E2U A;  1WMP A;  3NV0 B;  1MWT A;  1RCL A;  1FUT A;  1WMO A;  4FCJ A;  3DUK A;  3L0R A;  1TRQ A;  4N6U A;  1IQ8 A;  3AHS A;  4PEJ A;  4XBY A;  1AR0 A;  1DVC A;  3FKA A;  1JV2 B;  1O7N B;  1ZS7 A;  1CH0 A;  1M1X B;  3DGN A;  2LQV A;  3NM7 A;  1QMA A;  1KC8 4;  3NXJ A;  3HK4 A;  1LXE A;  2KF6 A;  3CNX A;  6GSP A;  5KP4 A;  4EXR A;  1YVS A;  3FZW A;  5GSP A;  2OTL 3;  1RGA A;  3MSO A;  1G0T A;  1OHP A;  1RRL A;  4O2H A;  3S29 A;  1W4N A;  1T2H A;  2W03 A;  3OV4 A;  4HKV B;  3RGA A;  1YJN 3;  4EW5 A;  4NHF A;  2GSP A;  2GXF A;  2W56 B;  2IA7 A;  1MGW A;  1DMM A;  3X3Z A;  4FCM A;  1GY5 A;  4R1K A;  5ELU A;  3HII A;  1JJ2 2;  4J8T A;  2YFJ B;  1W01 A;  1A2P A;  3G71 3;  1BU4 A;  1D6Z A;  3BB9 A;  4HM0 B;  1Q40 A;  1L5G B;  5G2G A;  3H3H A;  1YJW 3;  1B2X A;  3QK9 A;  4L8P A;  2BMO B;  3DH2 A;  3EB8 A;  2CFG A;  1SAR A;  2JQ5 A;  2F98 A;  4QWT A;  1Q7H A;  1M9G A;  1O7P B;  4WFO A;  1I70 A;  7GSP A;  1BSD A;  4XBT A;  5M1A A;  4CCV A;  1MGR A;  3PS8 A;  3HOH A;  2XRX B;  1NJI 4;  1O7G B;  3LYG A;  3GAX A;  1RN7 A;  1AV4 A;  1GD3 A;  1C7H A;  1FZU A;  2PNC A;  3JUQ A;  2O3O A;  1KSI A;  4J5G A;  4STD A;  1PYL A;  4NPB A;  5EQL A;  2BU4 A;  3CPO A;  3K9M C;  1RKY A;  1T2I A;  1RDS A;  5LC6 A;  1LVN A;  1AY7 A;  1T3B A;  3SOY A;  3LTA A;  1EQK A;  2OOV C;  1ULI B;  1RJO A;  2CG0 A;  3LTB A;  3UL5 A;  1Q81 4;  3AGO A;  3MYT A;  1IVU A;  4RNZ A;  4EC6 A;  1I2F A;  1IDP A;  3I0Y A;  3NBB A;  3EE1 A;  1ISK A;  1TFK A;  1W5Z A;  2Y73 A;  2CC3 A;  3CCL 3;  2CIU A;  3CU3 A;  3OWS A;  4FMC A;  4ILF A;  4MJD A;  1VQK 3;  1A90 A;  3NHX A;  3QRD A;  4DKI A;  2W56 A;  3FSD A;  5DRV A;  2P38 A;  2XEP A;  3JVC A;  9RNT A;  4CJN A;  3G16 A;  2SAR A;  1VQM 3;  1UW1 A;  1BSA A;  1IVW A;  3BLZ A;  3DY5 A;  1DE3 A;  1J2B A;  2XFS A;  4FMB A;  1IQY A;  3UB1 A;  1I3F A;  1ZX2 A;  3JUM A;  3VGN A;  1D6U A;  1DET A;  2K3D A;  3IPT A;  2WGO A;  1BRK A;  1HYF A;  1JB2 A;  2AAE A;  2CH9 A;  1FGM A;  2XR8 B;  1PU4 A;  1M1K 4;  1YVB I;  3EHC A;  3JUO A;  1WNH A;  3D3L A;  3GZR A;  4FR9 A;  5IG3 A;  1JKG B;  1UUV B;  5G1K A;  1BNR A;  3CME 3;  1WTH A;  2CWT A;  1VQ4 3;  1LOV A;  3BNE A;  5AII A;  3CCS 3;  1BRG A;  3Q1C A;  1D6Y A;  5M19 A;  2C10 A;  2O9U X;  1IV9 A;  1N5H A;  2CX0 A;  3PGB A;  2L4V A;  1IQX A;  1IVX A;  1MWU A;  1X1X A;  2QA4 3;  1VQL 3;  2H0H A;  1VQ9 3;  3Q2P A;  1YNV X;  2RFR A;  2UUG C;  3DXO A;  1QAK A;  3N9H A;  2QGU A;  4JF8 A;  1BAO A;  1E3V A;  4R9L A;  5EVH A;  1BSC A;  1JBS A;  1VQO 3;  3NQZ A;  3KSE D;  7RNT A;  1EA2 A;  1IK3 A;  1EG9 B;  3X3Y A;  2OWP A;  3PZW A;  2L1S A;  2IUK A;  3NM2 A;  1QAF A;  4LMI A;  4FMA A;  5IF6 A;  1HKX A;  4KFD A;  5STD A;  3B8L A;  3K63 A;  1WQL B;  1N5P A;  3CCM 3;  1FGQ A;  1BNG A;  1SPU A;  1GY6 A;  3NV0 A;  3V92 A;  3WR2 A;  3DM8 A;  5RNT A;  2CFD A;  1NB3 I;  1OHS A;  3ZG0 A;  3CCE 3;  2F56 A;  3F7X A;  1ROV A;  2W2C A;  1BOX A;  1CYV A;  3AGN A;  3F9S A;  4U13 A;  3WOD G;  1F8N A;  3EX9 A;  3T8U A;  1B2U A;  3OWY A;  2CW9 A;  1JB5 A;  3NBR A;  1RN4 A;  5IW9 A;  3WOF B;  2Z77 A;  4O3V A;  2CG1 A;  3K5T A;  1GMQ A;  3CCQ 3;  1W7C A;  3D4A A;  2MC8 A;  5BU4 A;  4J5K A;  3B7C A;  4ORL A;  2JDI H;  3PCR A;  2WO0 A;  2I9W A;  4XDW A;  3LXU X;  4K90 B;  4HM5 B;  3SOA A;  1GD4 A;  1RGK A;  1N9J A;  3GZX B;  3A5E A;  3BNB A;  3SXX A;  3UNL A;  1U8C B;  1US1 A;  2OOV A;  3WMD A;  3CCU 3;  3OW2 2;  1O7W B;  3Q3F A;  3FG3 A;  1SII A;  4XB5 A;  3UL6 A;  1W02 A;  4WWU C;  2HML B;  3IMA B;  1BNE A;  1RGE A;  1STF I;  3MWZ A;  4WYK A;  1E3R A;  5AEU B;  1W2Z A;  1UGI A;  3AHW A;  2CK3 H;  2D42 A;  1IU7 A;  1RSN A;  4L8O A;  3EQQ B;  1NU3 A;  4RBN A;  1FGO A;  2BMQ B;  1BNJ A;  1SQW A;  1X1Y A;  1X1U A;  3Q90 A;  3S27 A;  3T0U A;  2Z6B A;  1OF5 A;  4G1M B;  4GHO A;  5AYS C;  1M90 4;  1PY3 A;  2Y74 A;  5HOH A;  4WYK B;  2Z76 A;  1EEJ A;  1RN1 A;  4HAA A;  1B3S A;  1LOW A;  2A15 A;  1CQS A;  1W6C A;  2C11 A;  2K0M A;  2XH9 A;  3E99 A;  1RNT A;  4X2H A;  4RZM A;  5CXO A;  3SYU A;  4EBG A;  1OF5 B;  1JBT A;  2YX9 A;  1OH0 A;  2ZDJ A;  1NB5 I;  3KZT A;  1UGH I;  2INX A;  1RGF A;  3IJE B;  4FCZ A;  3B4P A;  4HZ9 B;  1W6Y A;  1CYU A;  3KE7 A;  3F8H A;  1TU5 A;  1RMS A;  4EYC A;  3WHO A;  1GY7 A;  4HM6 B;  1OAC A;  1R4Y A;  5IEP A;  3ROB A;  1EKM A;  1N8R 4;  5DRE A;  3ECF A;  4HM7 B;  2C4B A;  1TIJ A;  1OPY A;  3K0Z A;  3NX0 A;  1ZO2 A;  4HBR A;  3D5G A;  2WGQ A;  3BND A;  1V74 A;  1C54 A;  1VQN 3;  3CC2 3;  3LTC A;  4KFF A;  1HZ1 A;  4MMY B;  1RGG A;  5IEO A;  1NWW A;  3CMA 3;  1R4C A;  1Q9E A;  1QAL A;  2GEY A;  1V58 A;  1Y4K A;  2ZHX B;  3F7S A;  3TDG A;  1BNI A;  4R80 A;  4KT3 B;  2KCD A;  3N8B A;  1SJW A;  3BIR A;  3LT9 A;  2GEX A;  3MG3 A;  2XFT A;  3LTD A;  4HZB B;  2QIY A;  1STD A;  4IPB A;  3WA3 A;  5AIG A;  4N6M A;  1JKG A;  1LQM B;  3LML A;  3CXC 2;  3X42 A;  3CNM A;  3HZP A;  3SX1 A;  1NO3 A;  2QEX 3;  3X40 A;  4K61 A;  4X2O A;  1MNL A;  2HOH A;  1OGX A;  1UI8 A;  2W0Q A;  1GMP A;  1VQ8 3;  5KP1 A;  1RRH A;  1X1W A;  4CDL A;  1LNI A;  2YFI B;  1B27 A;  1JZD A;  1E97 A;  1QVG 2;  3KII A;  2BO9 B;  3CC4 3;  4N6N B;  1PFP A;  2RNT A;  4IT7 A;  1WMN A;  5A0O B;  1B2M A;  3LOY A;  2FNQ A;  1I8V A;  2KXG A;  4BTX A;  3GSP A;  1BRH A;  1TRP A;  1JB4 A;  2WOH A;  2OQE A;  4XM4 A;  8RNT A;  1LNH A;  1V57 A;  1YIT 3;  1QJG A;  2OTJ 3;  1I0V A;  1YGE A;  2XF3 A;  4HJL B;  2FGT A;  4N6O B;  3VF1 A;  3CD6 3;  8CHO A;  2BHM A;  3CCR 3;  3DZL A;  1A2V A;  5IG4 A;  2IMJ A;  1TUH A;  5D82 A;  4EV5 A;  1GOY A;  4HM1 B;  1B21 A;  1RGC A;  1BAN A;  5EEO A;  1W00 A;  1I3I A;  3EJV A;  1I2G A;  1DMN A;  4GL6 A;  1KD1 4;  3HI7 A;  3OXA A;  1EUI C;  4MMZ B;  2ML5 A;  2XSO B;  4K1V A;  3S5C A;  3CC7 3;  3SED A;  4XBX A;  1A2K A;  4BL3 A;  1GOU A;  1S5A A;  2HMM B;  3ZG5 A;  3JUP A;  3FH1 A;  4LSO A;  2KF3 A;  3V99 A;  2Q07 A;  1RGL A;  2R41 A;  3F8X A;  1JN5 B;  3NQY A;  2P05 A;  1KQS 2;  3FF2 A;  1SIH A;  4I4K A;  2K54 A;  1TJD A;  5CLK A;  5BVB A;  2CFK A;  2WOF A;  5JPU A;  1BRS A;  4RNY A;  3VSY A;  2XGL A;  5I97 A;  2XSH B;  3MHE A;  4O02 B;  1JN5 A;  5JBS A;  4IIA A;  1AQZ A;  3K7C A;  4LGQ A;  3NBJ A;  1K73 4;  1OCV A;  1UCK A;  1RGH A;  2LYX A;  5D81 A;  5BIR A;  1BSB A;  3EC9 A;  1VQQ A;  1K28 A;  4N6V 0;  4I5Q A;  3U1W A;  3LH4 A;  1FYS A;  4R4K A;  2UGI A;  4CPK A;  2PZV A;  2IYJ A;  1UDI I;  3ER7 A;  3M8C A;  2GU1 A;  3FG1 A;  1UCL A;  2BT3 A;  3CPW 2;  4JRF A;  3URP A;  2B24 B;  4ZM8 A;  5CF1 A;  1FUS A;  3JUN A;  5IG0 A;  3U97 A;  2KF5 A;  3G0K A;  2HMJ B;  2KAA A;  3GZB A;  2IUJ A;  1N9E A;  1GYB A;  1AVK A;  3OX9 A;  2KRT A;  2W04 A;  2CFW A;  4LEH A;  4MEI A;  2YFL B;  1O7H B;  1T5Y A;  1ULJ B;  5AYR B;  1DYU A;  1KWI A; 
#chains in the Genus database with same CATH homology
 1HU9 A;  1FGR A;  2CWU A;  2OCT A;  3S28 A;  2HMN B;  4OK0 A;  5FW5 A;  4OUQ A;  4R9K A;  3S67 A;  2RCD A;  1IVV A;  1W6G A;  1Q40 B;  4KFE A;  3F40 A;  3FGY A;  3WOE B;  4Q53 A;  3MG1 A;  3CCV 3;  3FLJ A;  4HM8 B;  1AVL A;  1N8Q A;  2CFL A;  3EF8 A;  1S72 3;  3MG2 A;  5BXQ A;  3GWR A;  3NUV A;  3I55 3;  3CCJ 3;  1TFO A;  2W9P A;  1TP6 A;  5ELJ A;  3HX8 A;  3SVA A;  4HM4 B;  1BUQ A;  1LOX A;  1CEW I;  3PYJ A;  4WHA A;  5FGO A;  3RGR A;  1OGZ A;  3D9R A;  1VQ7 3;  5CK6 A;  1UUW B;  2CHC A;  5HGR A;  2HMK B;  4BTY A;  3FF0 A;  1A67 A;  4TX4 A;  4EV2 A;  5IEN A;  1ASK A;  4N3V A;  1IT7 A;  1U5O A;  2BMR B;  2OQE C;  4GB5 A;  3LZA A;  2FXT A;  2GBX B;  2SBL A;  3FCS B;  3WA2 X;  3ALA A;  2F86 B;  2RSX A;  4WP5 A;  1YHQ 3;  3MKI A;  4AEQ A;  4HM3 B;  3EBY A;  4LZI A;  5KP3 A;  4L7K A;  3DGO A;  4HYZ A;  3KFQ C;  1Z1S A;  1OUN A;  3WDG B;  2B1X B;  1VQ5 3;  7STD A;  2M7O A;  3PXM A;  4O8S A;  3G4S 3;  3J7Y d;  2W6J H;  6STD A;  3I56 3;  1Q7Y 4;  3DGM A;  2F99 A;  1FGT A;  1YJ9 3;  5AIH A;  5AEW B;  3BNC A;  4H3U A;  1GS3 A;  2GBW B;  4FMD A;  1JRQ A;  3PCS A;  3UJM A;  1O7M B;  2D1W A;  4AKZ A;  3G6E 3;  1NDO B;  1G96 A;  3F14 A;  1DVD A;  3A76 A;  1QVF 2;  2E2T A;  4OVM A;  3V98 A;  3STD A;  2P0M A;  2W9Q A;  2ML6 A;  4N6L A;  1W2B 2;  3DGL A;  3SLU A;  4J9A A;  3DMC A;  3T8N A;  5AIF A;  4BTW A;  2Z7A A;  2STD A;  4HVN A;  3O8Y A;  1FA3 A;  3KKG A;  1IV7 A;  4H61 A;  4KVH A;  5CF2 A;  3N54 B;  1IT8 A;  1Q82 4;  3FG4 A;  2CKF B;  1YI2 3;  3EN1 B;  2V1L A;  5LC7 A;  2ZL8 A;  5IG5 A;  1MOL A;  3KSP A;  1VQP 3;  1K8A 4;  2RGQ A;  3HIG A;  3AMO A;  4KZ1 A;  1JNQ A;  2R4I A;  5D83 A;  5AI1 A;  2XGN A;  2CWV A;  1UI7 A;  2UX0 A;  1VQ6 3;  3GRD A;  3B4O A;  2GU3 A;  2E2V A;  3MPH A;  3EBT A;  2MF7 A;  1DMQ A;  3RDE A;  3X41 A;  3H51 A;  5TGN A;  2P0X A;  1Q86 4;  1VZZ A;  1Q42 A;  3AMO B;  5JPP A;  4NRE A;  3OWU A;  4AKY A;  3G8Z A;  4HM2 B;  1OHO A;  4XDV A;  1ROA A;  1YIJ 3;  2HMO B;  4MMX B;  4N6T A;  3EN8 A;  4K1U A;  3KN4 A;  5IER A;  3GZY B;  1K41 A;  2BNG A;  3X3X A;  3LT8 A;  1K9M 4;  2P09 A;  2E2U A;  1WMP A;  3NV0 B;  1WMO A;  4FCJ A;  3DUK A;  3L0R A;  4N6U A;  4PEJ A;  1IQ8 A;  4XBY A;  1AR0 A;  1DVC A;  3FKA A;  1JV2 B;  1O7N B;  3DGN A;  1M1X B;  2LQV A;  3NM7 A;  1QMA A;  1KC8 4;  3NXJ A;  3HK4 A;  1LXE A;  3CNX A;  5KP4 A;  4EXR A;  3FZW A;  2OTL 3;  3MSO A;  1OHP A;  1RRL A;  4O2H A;  3S29 A;  1W4N A;  2W03 A;  3OV4 A;  4HKV B;  3RGA A;  1YJN 3;  4NHF A;  2GXF A;  2W56 B;  2IA7 A;  1DMM A;  3X3Z A;  4FCM A;  1GY5 A;  4R1K A;  5ELU A;  3HII A;  1JJ2 2;  4J8T A;  2YFJ B;  1W01 A;  3G71 3;  1D6Z A;  3BB9 A;  4HM0 B;  1Q40 A;  1L5G B;  5G2G A;  3H3H A;  1YJW 3;  3QK9 A;  4L8P A;  2BMO B;  3EB8 A;  2CFG A;  2JQ5 A;  2F98 A;  4QWT A;  1M9G A;  1O7P B;  4WFO A;  4XBT A;  4CCV A;  3PS8 A;  2XRX B;  1NJI 4;  1O7G B;  3LYG A;  3GAX A;  1RN7 A;  1AV4 A;  1GD3 A;  1C7H A;  2PNC A;  3JUQ A;  2O3O A;  1KSI A;  4STD A;  5EQL A;  3K9M C;  3CPO A;  1RKY A;  5LC6 A;  1LVN A;  3SOY A;  3LTA A;  1EQK A;  2OOV C;  1ULI B;  1RJO A;  2CG0 A;  3LTB A;  3UL5 A;  1Q81 4;  3MYT A;  1IVU A;  4RNZ A;  4EC6 A;  1IDP A;  3I0Y A;  3NBB A;  1ISK A;  3EE1 A;  1TFK A;  1W5Z A;  2Y73 A;  2CC3 A;  3CCL 3;  2CIU A;  3CU3 A;  3OWS A;  4FMC A;  1VQK 3;  4MJD A;  1A90 A;  3NHX A;  3QRD A;  2W56 A;  3FSD A;  5DRV A;  2P38 A;  2XEP A;  3JVC A;  3G16 A;  1VQM 3;  1UW1 A;  1IVW A;  3BLZ A;  3DY5 A;  1J2B A;  2XFS A;  4FMB A;  1IQY A;  3UB1 A;  1ZX2 A;  3JUM A;  3VGN A;  1D6U A;  3IPT A;  2WGO A;  1JB2 A;  2CH9 A;  2XR8 B;  1FGM A;  1PU4 A;  1M1K 4;  1YVB I;  3EHC A;  3JUO A;  1WNH A;  3D3L A;  3GZR A;  4FR9 A;  5IG3 A;  1JKG B;  1UUV B;  3CME 3;  1WTH A;  2CWT A;  1VQ4 3;  5AII A;  3BNE A;  3CCS 3;  3Q1C A;  1D6Y A;  2C10 A;  2O9U X;  1IV9 A;  1N5H A;  3PGB A;  2L4V A;  1IQX A;  1IVX A;  2QA4 3;  1VQL 3;  1VQ9 3;  3Q2P A;  2RFR A;  3DXO A;  1QAK A;  3N9H A;  2QGU A;  4JF8 A;  1E3V A;  4R9L A;  5EVH A;  1VQO 3;  3NQZ A;  3KSE D;  1EA2 A;  1IK3 A;  1EG9 B;  3X3Y A;  2OWP A;  3PZW A;  2IUK A;  3NM2 A;  1QAF A;  4LMI A;  4FMA A;  5IF6 A;  1HKX A;  4KFD A;  5STD A;  3B8L A;  3K63 A;  1WQL B;  1N5P A;  3CCM 3;  1FGQ A;  1SPU A;  3V92 A;  1GY6 A;  3NV0 A;  3DM8 A;  1NB3 I;  2CFD A;  1OHS A;  3CCE 3;  3F7X A;  1ROV A;  2W2C A;  1CYV A;  3F9S A;  3WOD G;  4U13 A;  1F8N A;  3EX9 A;  3T8U A;  3OWY A;  2CW9 A;  1JB5 A;  3NBR A;  5IW9 A;  3WOF B;  2Z77 A;  4O3V A;  2CG1 A;  3K5T A;  3CCQ 3;  1W7C A;  2MC8 A;  3B7C A;  4ORL A;  2JDI H;  3PCR A;  2WO0 A;  2I9W A;  4XDW A;  3LXU X;  4K90 B;  4HM5 B;  3SOA A;  1GD4 A;  1FUW A;  1N9J A;  3GZX B;  3BNB A;  3SXX A;  3UNL A;  1U8C B;  1US1 A;  2OOV A;  3WMD A;  3CCU 3;  3OW2 2;  1O7W B;  3FG3 A;  1SII A;  4XB5 A;  3UL6 A;  1W02 A;  4WWU C;  2HML B;  3IMA B;  1STF I;  3MWZ A;  4WYK A;  1E3R A;  5AEU B;  1W2Z A;  2CK3 H;  2D42 A;  1IU7 A;  4L8O A;  3EQQ B;  1NU3 A;  4RBN A;  1FGO A;  2BMQ B;  1SQW A;  3S27 A;  3T0U A;  3Q90 A;  2Z6B A;  1OF5 A;  4G1M B;  5AYS C;  1M90 4;  2Y74 A;  4WYK B;  2Z76 A;  2A15 A;  1CQS A;  1W6C A;  2C11 A;  2K0M A;  2XH9 A;  3E99 A;  4X2H A;  5CXO A;  4RZM A;  4EBG A;  1OF5 B;  2YX9 A;  1OH0 A;  2ZDJ A;  1NB5 I;  3KZT A;  2INX A;  3IJE B;  4FCZ A;  3B4P A;  4HZ9 B;  1W6Y A;  1CYU A;  3KE7 A;  3F8H A;  1TU5 A;  4EYC A;  1GY7 A;  4HM6 B;  1OAC A;  5IEP A;  1N8R 4;  3ROB A;  1EKM A;  5DRE A;  3ECF A;  4HM7 B;  1TIJ A;  1OPY A;  3K0Z A;  3NX0 A;  1ZO2 A;  4HBR A;  2WGQ A;  3BND A;  1V74 A;  1VQN 3;  3CC2 3;  3LTC A;  4KFF A;  5IEO A;  4MMY B;  1NWW A;  3CMA 3;  1R4C A;  1QAL A;  2GEY A;  3F7S A;  1Y4K A;  3TDG A;  4R80 A;  2KCD A;  3N8B A;  1SJW A;  3LT9 A;  2GEX A;  3MG3 A;  2XFT A;  3LTD A;  4HZB B;  2QIY A;  1STD A;  4IPB A;  3WA3 A;  5AIG A;  4N6M A;  1JKG A;  3LML A;  3CXC 2;  3X42 A;  3CNM A;  3HZP A;  3SX1 A;  1NO3 A;  2QEX 3;  3X40 A;  4K61 A;  4X2O A;  1MNL A;  1OGX A;  1UI8 A;  2W0Q A;  1VQ8 3;  5KP1 A;  1RRH A;  4CDL A;  2YFI B;  1E97 A;  1QVG 2;  3KII A;  2BO9 B;  3CC4 3;  4N6N B;  1PFP A;  4IT7 A;  1WMN A;  5A0O B;  3LOY A;  2FNQ A;  2KXG A;  4BTX A;  2WOH A;  1JB4 A;  2OQE A;  4XM4 A;  1LNH A;  1YIT 3;  1QJG A;  2OTJ 3;  2XF3 A;  1YGE A;  4HJL B;  2FGT A;  4N6O B;  3VF1 A;  3CD6 3;  8CHO A;  2BHM A;  3CCR 3;  3DZL A;  1A2V A;  5IG4 A;  2IMJ A;  1TUH A;  5D82 A;  4EV5 A;  4HM1 B;  5EEO A;  1W00 A;  3EJV A;  1DMN A;  4GL6 A;  1KD1 4;  3HI7 A;  3OXA A;  4MMZ B;  2ML5 A;  2XSO B;  4K1V A;  3S5C A;  3CC7 3;  3SED A;  4XBX A;  1A2K A;  1S5A A;  2HMM B;  3JUP A;  3FH1 A;  4LSO A;  3V99 A;  2Q07 A;  3F8X A;  1JN5 B;  3NQY A;  2P05 A;  1KQS 2;  3FF2 A;  1SIH A;  4I4K A;  2K54 A;  5CLK A;  5BVB A;  2CFK A;  2WOF A;  5JPU A;  4RNY A;  3VSY A;  2XGL A;  5I97 A;  2XSH B;  3MHE A;  4O02 B;  1JN5 A;  5JBS A;  4IIA A;  3K7C A;  4LGQ A;  1K73 4;  3NBJ A;  1OCV A;  2LYX A;  5D81 A;  3EC9 A;  1K28 A;  4N6V 0;  3U1W A;  3LH4 A;  4R4K A;  2PZV A;  3ER7 A;  3M8C A;  2GU1 A;  3FG1 A;  2BT3 A;  3CPW 2;  4JRF A;  2B24 B;  4ZM8 A;  5CF1 A;  3JUN A;  5IG0 A;  3U97 A;  3G0K A;  3GZB A;  2HMJ B;  2IUJ A;  1N9E A;  1GYB A;  1AVK A;  3OX9 A;  2KRT A;  2W04 A;  2CFW A;  4LEH A;  4MEI A;  2YFL B;  1O7H B;  1T5Y A;  1ULJ B;  5AYR B;  1DYU A;  1KWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...