5KP7B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with holo donor-acp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Transferase
molecule keywords CurD
total genus 25
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp7B00
2K92A 3RG2A 2AFDA 2MD9A 2MY5A 3CE7A 2FADA 1L0IA 2GDWA 4DG9A 2K0XA 2N6YA 2EHSA 2LL8A 2KG6A 2LPKA 2JGPA 2MF4A 2FACA 2N50A 2L9FA 2PNGA 1KLPA 5EJDA 4MRTC 2LTEA 2L22A 4R0MA 3GZLA 4H2WC 4BPGA 2DNWA 2GDXA 2CNRA 2KR5A 4PXHB 1NQ4A 2CGQA 2FQ2A 2LKIA 1VKUA 5KP7B 2JQ4A 4IZ6A 1AF8A 2KGCA 4H2XC 2XZ0D 2L4BA 1OR5A 1X3OA 2KOQA 2MR8A 2AFEA 2MVUA 2JU1A 2KOOA 2ROQA 2L0QA 2M5RA 2X2BA 2FHSC 3NY7B 1F80D 2N6ZA 1HQBA 2K94A 3EJEA 2VSQA 2LIWA 3EJDA 2LOLA 2LMLA 5HVCA 3LMOA 4PWVB 2K93A 2GDYA 3GZMA 5KP6B 1L0HA 1DNYA 2KG8A 2KOSA 2FVFA 2LIUA 1DV5A 1HY8A 4BPFA 2KW2A 2N5IA 1ACPA 2FQ0A 2K0YA 5CZDB 2N5HA 3EJBA 2KORA 5KP8B 2AVAA 2AF8A 4HKGA 2KGEA 2JU2A 4NEOA 2K2QA 2KOPA 4BPHA 2FAEA 2CQ8A 2FVAA 2KGDA 2XZ1C 2QNWA 2KGAA 2MR7A 2FQ1A 4CA3A 2CG5B 1T8KA 4H2YC 2MVVA 2N98A 5HV8A 2FVEA 2KG9A 2KWLA 2EHTA
chains in the Genus database with same CATH superfamily
1D1DA 2K92A 1K73Q 2XT1A 3CE7A 2GDWA 1K8AQ 2KG6A 3CCUP 3CCQP 2LPKA 2ONTA 1S72P 2L9FA 1AYIA 3CD6P 3H0DA 2L22A 3DPHA 4H2WC 1UJZA 2Z44A 2LKIA 4XROA 1VKUA 5F2NA 3I55P 1GXGA 2JB0A 2GZFA 1ZNVA 2KOQA 2MR8A 2AFEA 2ERHA 2KOOA 2L0QA 1VQKP 2FHSC 3NY7B 1E0HA 2VSQA 3G6EP 3G21A 4XRQA 2LMLA 3LMOA 3U43A 3CC4P 2GDYA 1KC8Q 3MGEA 2FVFA 4PH1A 1DV5A 2WPTA 1HY8A 5HGMA 3M1MA 4U0DA 5CZDB 4XFZA 3EJBA 5KP8B 1IMQA 3CXCO 2GZJA 3GJNA 2CQ8A 5BS2A 1IUQA 1YJ9P 2XZ1C 2QNWA 4U0EA 3CCMP 3DS2A 1Q86Q 5HV8A 4U0CA 3CCRP 1RO2A 1MZ8A 1ZMBA 2MD9A 1VQ9P 1EOQA 1VQPP 2GYKA 1VQ7P 4UHPB 2JGPA 2MF4A 3B4QA 3DTJA 2XXMA 2PNGA 2LTEA 1VQNP 3GKLC 3GZLA 3OW2O 1RO0A 3E2DA 1M6NA 1VQ6P 4PXHB 1NQ4A 2L6EA 2CGQA 2FQ2A 1AF8A 1IMPA 3CC2P 3LRYA 1OR5A 3H47A 1YJNP 1KQSO 2MVUA 2ROQA 1VQ8P 3G26A 1AUMA 2PEKA 2M5RA 2X2BA 2VLNA 3G29A 5BS1A 2LIWA 1K30A 3CMEP 2K93A 1DNYA 1L0HA 2QA4P 2KG8A 2KOSA 1Q81Q 2VLQA 2XV6A 2N5IA 2KODA 2PEJA 2K0YA 5HGLA 2N5HA 1QVFO 4HKGA 2JU2A 4NEOA 2K2QA 2KOPA 2FVAA 3G1IA 1VQ4P 2Z45A 4QKOA 2MR7A 1RNIA 3DS4A 4CA3A 1VQ5P 1T8KA 4H2YC 2MVVA 2N98A 4COPA 2KWLA 2MY5A 2OTJP 2FADA 2M8LA 1YHQP 1L0IA 2K0XA 2N6YA 1M90Q 1JJ2O 5DCKA 3CCSP 2FACA 4PH0A 2NO8A 4U0BA 3DS0A 1KLPA 3NTEA 5EJDA 7CEIA 2K5XA 2K0DX 4MRTC 3HZQA 4BPGA 2DNWA 3G28A 3G71P 3CMAP 3I56P 2KR5A 5HGOA 2OARA 2JQ4A 1YJWP 2EIAA 1GPJA 2KGCA 3WBHA 4H2XC 2XZ0D 2PEMA 2EFJA 1YI2P 4M0IA 1BAJA 2PENA 2GZEA 1NJIQ 1F80D 4GR6A 2K94A 2JYLA 3EJEA 3Q20A 3G0VA 1EIAA 4COCA 2PEOA 2LOLA 4XFXA 2M8NA 1Q82Q 3GZMA 2GZGA 2QEXP 3G4SP 3DS1A 5JPAA 1ACPA 2KW2A 3DS5A 1VQLP 2BUOA 2FQ0A 2P9XA 2KORA 2AVAA 4U0FA 4QNBA 2AF8A 2KGEA 3CCVP 4BPHA 2FAEA 3H4EA 2KGDA 2JO0A 2KGAA 2FQ1A 3B5IA 4IPYA 1A43A 5F2OA 2OTLP 1YIJP 1QVGO 1UNKA 1EMVA 3DS3A 3RG2A 3P05A 2AFDA 5F2KA 2EG5A 2VLOA 4GR2A 4DG9A 1K9MQ 2EHSA 2LL8A 1Z6MA 3CC7P 2N50A 1A8OA 2E1MA 3VRLC 3CPWO 4R0MA 1CEIA 2GDXA 2CNRA 2LF4A 3CCEP 1YITP 5KP7B 4IZ6A 1GXHA 1M1KQ 1VQMP 2L4BA 2VLPA 1X3OA 3HYBA 1N8RQ 2JU1A 2PEQA 4F37A 4XFYA 2DGYA 3CCJP 1E6JP 1VQOP 2PEIA 1M6EX 2N6ZA 1HQBA 2CWOA 2BHVA 2PY8A 3EJDA 5HVCA 2Z46A 4WYMA 4PWVB 5KP6B 5I4TG 2GZIA 1Q7YQ 1BXIA 1KD1Q 2JYGA 2LIUA 1M74A 4BPFA 5HGNA 3CCLP 2M8PA 2JBGA 3RG6C 4U0AA 1VHNA 5EW5E 1FR2A 1QRJA 2CG5B 2JAZA 3G1GA 2FVEA 2KG9A 1W2BO 2EHTA
chains in the Genus database with same CATH topology
2K92A 3RG2A 2AFDA 2MD9A 2MY5A 3CE7A 2FADA 1L0IA 2GDWA 4DG9A 2K0XA 2N6YA 2EHSA 2LL8A 2KG6A 2LPKA 2JGPA 2MF4A 2FACA 2N50A 2L9FA 2PNGA 1KLPA 5EJDA 4MRTC 2LTEA 2L22A 4R0MA 3GZLA 4H2WC 4BPGA 2DNWA 2GDXA 2CNRA 2KR5A 4PXHB 1NQ4A 2CGQA 2FQ2A 2LKIA 1VKUA 5KP7B 2JQ4A 4IZ6A 1AF8A 2KGCA 4H2XC 2XZ0D 2L4BA 1OR5A 1X3OA 2KOQA 2MR8A 2AFEA 2MVUA 2JU1A 2KOOA 2ROQA 2L0QA 2M5RA 2X2BA 2FHSC 3NY7B 1F80D 2N6ZA 1HQBA 2K94A 3EJEA 2VSQA 2LIWA 3EJDA 2LOLA 2LMLA 5HVCA 3LMOA 4PWVB 2K93A 2GDYA 3GZMA 5KP6B 1L0HA 1DNYA 2KG8A 2KOSA 2FVFA 2LIUA 1DV5A 1HY8A 4BPFA 2KW2A 2N5IA 1ACPA 2FQ0A 2K0YA 5CZDB 2N5HA 3EJBA 2KORA 5KP8B 2AVAA 2AF8A 4HKGA 2KGEA 2JU2A 4NEOA 2K2QA 2KOPA 4BPHA 2FAEA 2CQ8A 2FVAA 2KGDA 2XZ1C 2QNWA 2KGAA 2MR7A 2FQ1A 4CA3A 2CG5B 1T8KA 4H2YC 2MVVA 2N98A 5HV8A 2FVEA 2KG9A 2KWLA 2EHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K92 A;  3RG2 A;  2AFD A;  2MD9 A;  2MY5 A;  3CE7 A;  2FAD A;  1L0I A;  2GDW A;  4DG9 A;  2K0X A;  2N6Y A;  2EHS A;  2LL8 A;  2KG6 A;  2LPK A;  2JGP A;  2MF4 A;  2FAC A;  2N50 A;  2L9F A;  2PNG A;  1KLP A;  5EJD A;  4MRT C;  2LTE A;  2L22 A;  4R0M A;  3GZL A;  4H2W C;  4BPG A;  2DNW A;  2GDX A;  2CNR A;  2KR5 A;  4PXH B;  1NQ4 A;  2CGQ A;  2FQ2 A;  2LKI A;  1VKU A;  5KP7 B;  2JQ4 A;  4IZ6 A;  1AF8 A;  2KGC A;  4H2X C;  2XZ0 D;  2L4B A;  1OR5 A;  1X3O A;  2KOQ A;  2MR8 A;  2AFE A;  2MVU A;  2JU1 A;  2KOO A;  2ROQ A;  2L0Q A;  2M5R A;  2X2B A;  2FHS C;  3NY7 B;  1F80 D;  2N6Z A;  1HQB A;  2K94 A;  3EJE A;  2VSQ A;  2LIW A;  3EJD A;  2LOL A;  2LML A;  5HVC A;  3LMO A;  4PWV B;  2K93 A;  2GDY A;  3GZM A;  5KP6 B;  1L0H A;  1DNY A;  2KG8 A;  2KOS A;  2FVF A;  2LIU A;  1DV5 A;  1HY8 A;  4BPF A;  2KW2 A;  2N5I A;  1ACP A;  2FQ0 A;  2K0Y A;  5CZD B;  2N5H A;  3EJB A;  2KOR A;  5KP8 B;  2AVA A;  2AF8 A;  4HKG A;  2KGE A;  2JU2 A;  4NEO A;  2K2Q A;  2KOP A;  4BPH A;  2FAE A;  2CQ8 A;  2FVA A;  2KGD A;  2XZ1 C;  2QNW A;  2KGA A;  2MR7 A;  2FQ1 A;  4CA3 A;  2CG5 B;  1T8K A;  4H2Y C;  2MVV A;  2N98 A;  5HV8 A;  2FVE A;  2KG9 A;  2KWL A;  2EHT A; 
#chains in the Genus database with same CATH topology
 1D1D A;  2K92 A;  1K73 Q;  2XT1 A;  3CE7 A;  2GDW A;  1K8A Q;  2KG6 A;  3CCU P;  3CCQ P;  2LPK A;  2ONT A;  1S72 P;  2L9F A;  1AYI A;  3CD6 P;  3H0D A;  2L22 A;  3DPH A;  4H2W C;  1UJZ A;  2Z44 A;  2LKI A;  4XRO A;  1VKU A;  5F2N A;  3I55 P;  1GXG A;  2JB0 A;  2GZF A;  1ZNV A;  2KOQ A;  2MR8 A;  2AFE A;  2ERH A;  2KOO A;  2L0Q A;  1VQK P;  2FHS C;  3NY7 B;  1E0H A;  2VSQ A;  3G6E P;  3G21 A;  4XRQ A;  2LML A;  3LMO A;  3U43 A;  3CC4 P;  2GDY A;  1KC8 Q;  3MGE A;  2FVF A;  4PH1 A;  1DV5 A;  2WPT A;  1HY8 A;  5HGM A;  3M1M A;  4U0D A;  5CZD B;  4XFZ A;  3EJB A;  5KP8 B;  1IMQ A;  3CXC O;  2GZJ A;  3GJN A;  2CQ8 A;  5BS2 A;  1IUQ A;  1YJ9 P;  2XZ1 C;  2QNW A;  4U0E A;  3CCM P;  3DS2 A;  1Q86 Q;  5HV8 A;  4U0C A;  3CCR P;  1RO2 A;  1MZ8 A;  1ZMB A;  2MD9 A;  1VQ9 P;  1EOQ A;  1VQP P;  2GYK A;  1VQ7 P;  4UHP B;  2JGP A;  2MF4 A;  3B4Q A;  3DTJ A;  2XXM A;  2PNG A;  2LTE A;  1VQN P;  3GKL C;  3GZL A;  3OW2 O;  1RO0 A;  3E2D A;  1M6N A;  1VQ6 P;  4PXH B;  1NQ4 A;  2L6E A;  2CGQ A;  2FQ2 A;  1AF8 A;  1IMP A;  3CC2 P;  3LRY A;  1OR5 A;  3H47 A;  1YJN P;  1KQS O;  2MVU A;  2ROQ A;  1VQ8 P;  3G26 A;  1AUM A;  2PEK A;  2M5R A;  2X2B A;  2VLN A;  3G29 A;  5BS1 A;  2LIW A;  1K30 A;  3CME P;  2K93 A;  1DNY A;  1L0H A;  2QA4 P;  2KG8 A;  2KOS A;  1Q81 Q;  2VLQ A;  2XV6 A;  2N5I A;  2KOD A;  2PEJ A;  2K0Y A;  5HGL A;  2N5H A;  1QVF O;  4HKG A;  2JU2 A;  4NEO A;  2K2Q A;  2KOP A;  2FVA A;  3G1I A;  1VQ4 P;  2Z45 A;  4QKO A;  2MR7 A;  1RNI A;  3DS4 A;  4CA3 A;  1VQ5 P;  1T8K A;  4H2Y C;  2MVV A;  2N98 A;  4COP A;  2KWL A;  2MY5 A;  2OTJ P;  2FAD A;  2M8L A;  1YHQ P;  1L0I A;  2K0X A;  2N6Y A;  1M90 Q;  1JJ2 O;  5DCK A;  3CCS P;  2FAC A;  4PH0 A;  2NO8 A;  4U0B A;  3DS0 A;  1KLP A;  3NTE A;  5EJD A;  7CEI A;  2K5X A;  2K0D X;  4MRT C;  3HZQ A;  4BPG A;  2DNW A;  3G28 A;  3G71 P;  3CMA P;  3I56 P;  2KR5 A;  5HGO A;  2OAR A;  2JQ4 A;  1YJW P;  2EIA A;  1GPJ A;  2KGC A;  3WBH A;  4H2X C;  2XZ0 D;  2PEM A;  2EFJ A;  1YI2 P;  4M0I A;  1BAJ A;  2PEN A;  2GZE A;  1NJI Q;  1F80 D;  4GR6 A;  2K94 A;  2JYL A;  3EJE A;  3Q20 A;  3G0V A;  1EIA A;  4COC A;  2PEO A;  2LOL A;  4XFX A;  2M8N A;  1Q82 Q;  3GZM A;  2GZG A;  2QEX P;  3G4S P;  3DS1 A;  5JPA A;  1ACP A;  2KW2 A;  3DS5 A;  1VQL P;  2BUO A;  2FQ0 A;  2P9X A;  2KOR A;  2AVA A;  4U0F A;  4QNB A;  2AF8 A;  2KGE A;  3CCV P;  4BPH A;  2FAE A;  3H4E A;  2KGD A;  2JO0 A;  2KGA A;  2FQ1 A;  3B5I A;  4IPY A;  1A43 A;  5F2O A;  2OTL P;  1YIJ P;  1QVG O;  1UNK A;  1EMV A;  3DS3 A;  3RG2 A;  3P05 A;  2AFD A;  5F2K A;  2EG5 A;  2VLO A;  4GR2 A;  4DG9 A;  1K9M Q;  2EHS A;  2LL8 A;  1Z6M A;  3CC7 P;  2N50 A;  1A8O A;  2E1M A;  3VRL C;  3CPW O;  4R0M A;  1CEI A;  2GDX A;  2CNR A;  2LF4 A;  3CCE P;  1YIT P;  5KP7 B;  4IZ6 A;  1GXH A;  1M1K Q;  1VQM P;  2L4B A;  2VLP A;  1X3O A;  3HYB A;  1N8R Q;  2JU1 A;  2PEQ A;  4F37 A;  4XFY A;  2DGY A;  3CCJ P;  1E6J P;  1VQO P;  2PEI A;  1M6E X;  2N6Z A;  1HQB A;  2CWO A;  2BHV A;  2PY8 A;  3EJD A;  5HVC A;  2Z46 A;  4WYM A;  4PWV B;  5KP6 B;  5I4T G;  2GZI A;  1Q7Y Q;  1BXI A;  1KD1 Q;  2JYG A;  2LIU A;  1M74 A;  4BPF A;  5HGN A;  3CCL P;  2M8P A;  2JBG A;  3RG6 C;  4U0A A;  1VHN A;  5EW5 E;  1FR2 A;  1QRJ A;  2CG5 B;  2JAZ A;  3G1G A;  2FVE A;  2KG9 A;  1W2B O;  2EHT A; 
#chains in the Genus database with same CATH homology
 2K92 A;  3RG2 A;  2AFD A;  2MD9 A;  2MY5 A;  3CE7 A;  2FAD A;  1L0I A;  2GDW A;  4DG9 A;  2K0X A;  2N6Y A;  2EHS A;  2LL8 A;  2KG6 A;  2LPK A;  2JGP A;  2MF4 A;  2FAC A;  2N50 A;  2L9F A;  2PNG A;  1KLP A;  5EJD A;  4MRT C;  2LTE A;  2L22 A;  4R0M A;  3GZL A;  4H2W C;  4BPG A;  2DNW A;  2GDX A;  2CNR A;  2KR5 A;  4PXH B;  1NQ4 A;  2CGQ A;  2FQ2 A;  2LKI A;  1VKU A;  5KP7 B;  2JQ4 A;  4IZ6 A;  1AF8 A;  2KGC A;  4H2X C;  2XZ0 D;  2L4B A;  1OR5 A;  1X3O A;  2KOQ A;  2MR8 A;  2AFE A;  2MVU A;  2JU1 A;  2KOO A;  2ROQ A;  2L0Q A;  2M5R A;  2X2B A;  2FHS C;  3NY7 B;  1F80 D;  2N6Z A;  1HQB A;  2K94 A;  3EJE A;  2VSQ A;  2LIW A;  3EJD A;  2LOL A;  2LML A;  5HVC A;  3LMO A;  4PWV B;  2K93 A;  2GDY A;  3GZM A;  5KP6 B;  1L0H A;  1DNY A;  2KG8 A;  2KOS A;  2FVF A;  2LIU A;  1DV5 A;  1HY8 A;  4BPF A;  2KW2 A;  2N5I A;  1ACP A;  2FQ0 A;  2K0Y A;  5CZD B;  2N5H A;  3EJB A;  2KOR A;  5KP8 B;  2AVA A;  2AF8 A;  4HKG A;  2KGE A;  2JU2 A;  4NEO A;  2K2Q A;  2KOP A;  4BPH A;  2FAE A;  2CQ8 A;  2FVA A;  2KGD A;  2XZ1 C;  2QNW A;  2KGA A;  2MR7 A;  2FQ1 A;  4CA3 A;  2CG5 B;  1T8K A;  4H2Y C;  2MVV A;  2N98 A;  5HV8 A;  2FVE A;  2KG9 A;  2KWL A;  2EHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...