5KP7B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with holo donor-acp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Transferase
molecule keywords CurD
total genus 25
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp7B00
2KW2A 2N5HA 1NQ4A 5KP8B 4H2WC 2AVAA 2KGCA 2KG6A 2LKIA 4PWVB 2KG9A 2FVEA 1VKUA 2KWLA 2MVVA 4MRTC 2L9FA 2FADA 1OR5A 4R0MA 5CZDB 4H2YC 4IZ6A 2AFDA 2N6YA 4BPGA 2CQ8A 1AF8A 1X3OA 1ACPA 2GDYA 2FACA 1F80D 5EJDA 2AF8A 5HVCA 2GDWA 2LIWA 2KORA 2PNGA 2KOPA 2FAEA 2LOLA 2X2BA 1KLPA 2N50A 2N98A 2N5IA 2JGPA 2EHSA 1DNYA 2QNWA 2FVAA 2N6ZA 2CNRA 2K0XA 2GDXA 1HY8A 4DG9A 2K94A 2JU2A 3RG2A 3CE7A 2KOOA 2M5RA 3GZLA 3GZMA 2LTEA 2FQ2A 2KR5A 2LL8A 2LPKA 2MY5A 2XZ1C 4CA3A 2K2QA 2MD9A 2VSQA 5KP6B 2K0YA 3EJEA 2KGEA 5HV8A 2JU1A 2FVFA 2CG5B 2MVUA 4NEOA 2K93A 1L0IA 2LIUA 2KGAA 4PXHB 1DV5A 1L0HA 2FHSC 2MF4A 1HQBA 2FQ1A 3EJBA 2ROQA 2AFEA 2L22A 1T8KA 2MR8A 2KGDA 2MR7A 2K92A 4HKGA 4BPFA 2JQ4A 2KOSA 2KOQA 3NY7B 4BPHA 2LMLA 4H2XC 2CGQA 2EHTA 2L0QA 3LMOA 2L4BA 5KP7B 2XZ0D 2FQ0A 3EJDA 2KG8A 2DNWA
chains in the Genus database with same CATH superfamily
2N5HA 1NQ4A 1K30A 2KGCA 2LKIA 3CCSP 1VKUA 1OR5A 2N6YA 4BPGA 2CQ8A 3CCVP 3E2DA 2GZEA 2FACA 2PEOA 1F80D 3VRLC 2LIWA 1UNKA 2N5IA 2PENA 1NJIQ 1VQ6P 2CNRA 1HY8A 3WBHA 2K94A 2ONTA 2JU2A 3GJNA 3P05A 3CCUP 3GZMA 2LTEA 2FQ2A 3CXCO 4U0DA 3U43A 3DS3A 1Z6MA 2M8LA 1Q7YQ 1VQNP 2BUOA 2LPKA 5F2KA 2GYKA 1VQLP 2GZIA 3EJEA 2FVFA 2CG5B 4NEOA 1GXHA 2KGAA 1L0HA 3G0VA 1HQBA 1VQPP 2JYLA 3DS4A 2L22A 5EW5E 1UJZA 2P9XA 4BPHA 2KODA 4BPFA 1D1DA 3CCQP 3G29A 2K0DX 4IPYA 3MGEA 2L6EA 4H2XC 3OW2O 2L0QA 2GZGA 7CEIA 2FQ0A 1KD1Q 3EJDA 1N8RQ 4PH1A 1VQMP 1YJNP 5KP8B 4H2WC 1VQ4P 3DS2A 1RO2A 4PWVB 1YHQP 2EG5A 2KWLA 2MVVA 4GR6A 2FADA 2EFJA 4IZ6A 1K9MQ 2AFDA 2GDYA 4U0EA 2E1MA 3DS5A 5EJDA 3DPHA 2KORA 3G21A 2LOLA 2XXMA 1KLPA 3CC7P 2N50A 2JGPA 2EHSA 3G1IA 2GDXA 4XROA 1QVGO 5HGNA 1K8AQ 3GZLA 2QEXP 5DCKA 3HZQA 3CCRP 2KR5A 3CCJP 2XZ1C 3I56P 2K2QA 3CMEP 2MD9A 3CCEP 4U0CA 2VSQA 4UHPB 2PY8A 5KP6B 1AUMA 1KQSO 2KGEA 2Z45A 3B5IA 1BAJA 2JU1A 5HGOA 2K93A 1L0IA 4XFXA 5BS1A 2PEJA 2FQ1A 1EOQA 5BS2A 5I4TG 2K92A 4HKGA 3NY7B 2KOQA 1IMQA 5F2NA 2LMLA 4XRQA 2CGQA 1VQ9P 3GKLC 2VLPA 2L4BA 2EIAA 1GPJA 1YJ9P 1YI2P 1IMPA 1YIJP 1VQ7P 2DNWA 3CCMP 3CMAP 1IUQA 3NTEA 2JB0A 2ERHA 1RO0A 2VLOA 2AVAA 2M8PA 2KG9A 4U0AA 3G4SP 4MRTC 2L9FA 4R0MA 3H0DA 2PEIA 1AF8A 1X3OA 1ACPA 1Q82Q 2JAZA 2WPTA 4M0IA 2PNGA 1M1KQ 1S72P 1KC8Q 3CC4P 2FAEA 3DS0A 1Q81Q 3RG6C 3DS1A 5HGMA 2FVAA 3H4EA 2VLQA 2K0XA 3DTJA 3LRYA 2M8NA 4DG9A 3RG2A 4QKOA 2M5RA 2K5XA 2PEKA 2LL8A 4CA3A 5F2OA 3G28A 2K0YA 5HV8A 1M6NA 1GXGA 2LIUA 4U0BA 4PXHB 1VQ8P 1DV5A 2MF4A 2GZJA 2ROQA 2VLNA 2AFEA 1CEIA 4WYMA 1BXIA 2JQ4A 2KOSA 4XFZA 2EHTA 2OTLP 5HGLA 3LMOA 1Q86Q 3CD6P 1EIAA 5KP7B 2JYGA 1YJWP 2KG8A 1E6JP 1YITP 2KW2A 2PEQA 3G6EP 1M90Q 2KG6A 1MZ8A 2JO0A 3CC2P 2JBGA 2FVEA 5CZDB 4H2YC 3CPWO 1EMVA 3G1GA 3I55P 1K73Q 1VQ5P 2DGYA 4COPA 2AF8A 3G26A 5HVCA 2GDWA 1AYIA 2KOPA 2X2BA 2Z44A 2N98A 1ZMBA 1DNYA 2QNWA 2N6ZA 1M6EX 2PEMA 4XFYA 2BHVA 2LF4A 3CE7A 4COCA 2KOOA 4PH0A 1JJ2O 3Q20A 1VQOP 1VQKP 2XV6A 1E0HA 1A8OA 1QVFO 1A43A 3G71P 2GZFA 2MY5A 1RNIA 1ZNVA 1W2BO 4U0FA 1VHNA 3HYBA 4GR2A 2Z46A 2NO8A 3B4QA 2MVUA 3M1MA 3CCLP 2FHSC 2QA4P 2XT1A 2OARA 3EJBA 3H47A 1T8KA 2MR8A 2KGDA 2MR7A 1QRJA 4F37A 2CWOA 1FR2A 2XZ0D 1M74A 2OTJP 4QNBA 5JPAA
chains in the Genus database with same CATH topology
2KW2A 2N5HA 1NQ4A 5KP8B 4H2WC 2AVAA 2KGCA 2KG6A 2LKIA 4PWVB 2KG9A 2FVEA 1VKUA 2KWLA 2MVVA 4MRTC 2L9FA 2FADA 1OR5A 4R0MA 5CZDB 4H2YC 4IZ6A 2AFDA 2N6YA 4BPGA 2CQ8A 1AF8A 1X3OA 1ACPA 2GDYA 2FACA 1F80D 5EJDA 2AF8A 5HVCA 2GDWA 2LIWA 2KORA 2PNGA 2KOPA 2FAEA 2LOLA 2X2BA 1KLPA 2N50A 2N98A 2N5IA 2JGPA 2EHSA 1DNYA 2QNWA 2FVAA 2N6ZA 2CNRA 2K0XA 2GDXA 1HY8A 4DG9A 2K94A 2JU2A 3RG2A 3CE7A 2KOOA 2M5RA 3GZLA 3GZMA 2LTEA 2FQ2A 2KR5A 2LL8A 2LPKA 2MY5A 2XZ1C 4CA3A 2K2QA 2MD9A 2VSQA 5KP6B 2K0YA 3EJEA 2KGEA 5HV8A 2JU1A 2FVFA 2CG5B 2MVUA 4NEOA 2K93A 1L0IA 2LIUA 2KGAA 4PXHB 1DV5A 1L0HA 2FHSC 2MF4A 1HQBA 2FQ1A 3EJBA 2ROQA 2AFEA 2L22A 1T8KA 2MR8A 2KGDA 2MR7A 2K92A 4HKGA 4BPFA 2JQ4A 2KOSA 2KOQA 3NY7B 4BPHA 2LMLA 4H2XC 2CGQA 2EHTA 2L0QA 3LMOA 2L4BA 5KP7B 2XZ0D 2FQ0A 3EJDA 2KG8A 2DNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KW2 A;  2N5H A;  1NQ4 A;  5KP8 B;  4H2W C;  2AVA A;  2KGC A;  2KG6 A;  2LKI A;  4PWV B;  2KG9 A;  2FVE A;  1VKU A;  2KWL A;  2MVV A;  4MRT C;  2L9F A;  2FAD A;  1OR5 A;  4R0M A;  5CZD B;  4H2Y C;  4IZ6 A;  2AFD A;  2N6Y A;  4BPG A;  2CQ8 A;  1AF8 A;  1X3O A;  1ACP A;  2GDY A;  2FAC A;  1F80 D;  5EJD A;  2AF8 A;  5HVC A;  2GDW A;  2LIW A;  2KOR A;  2PNG A;  2KOP A;  2FAE A;  2LOL A;  2X2B A;  1KLP A;  2N50 A;  2N98 A;  2N5I A;  2JGP A;  2EHS A;  1DNY A;  2QNW A;  2FVA A;  2N6Z A;  2CNR A;  2K0X A;  2GDX A;  1HY8 A;  4DG9 A;  2K94 A;  2JU2 A;  3RG2 A;  3CE7 A;  2KOO A;  2M5R A;  3GZL A;  3GZM A;  2LTE A;  2FQ2 A;  2KR5 A;  2LL8 A;  2LPK A;  2MY5 A;  2XZ1 C;  4CA3 A;  2K2Q A;  2MD9 A;  2VSQ A;  5KP6 B;  2K0Y A;  3EJE A;  2KGE A;  5HV8 A;  2JU1 A;  2FVF A;  2CG5 B;  2MVU A;  4NEO A;  2K93 A;  1L0I A;  2LIU A;  2KGA A;  4PXH B;  1DV5 A;  1L0H A;  2FHS C;  2MF4 A;  1HQB A;  2FQ1 A;  3EJB A;  2ROQ A;  2AFE A;  2L22 A;  1T8K A;  2MR8 A;  2KGD A;  2MR7 A;  2K92 A;  4HKG A;  4BPF A;  2JQ4 A;  2KOS A;  2KOQ A;  3NY7 B;  4BPH A;  2LML A;  4H2X C;  2CGQ A;  2EHT A;  2L0Q A;  3LMO A;  2L4B A;  5KP7 B;  2XZ0 D;  2FQ0 A;  3EJD A;  2KG8 A;  2DNW A; 
#chains in the Genus database with same CATH topology
 2N5H A;  1NQ4 A;  1K30 A;  2KGC A;  2LKI A;  3CCS P;  1VKU A;  1OR5 A;  2N6Y A;  4BPG A;  2CQ8 A;  3CCV P;  3E2D A;  2GZE A;  2FAC A;  2PEO A;  1F80 D;  3VRL C;  2LIW A;  1UNK A;  2N5I A;  2PEN A;  1NJI Q;  1VQ6 P;  2CNR A;  1HY8 A;  3WBH A;  2K94 A;  2ONT A;  2JU2 A;  3GJN A;  3P05 A;  3CCU P;  3GZM A;  2LTE A;  2FQ2 A;  3CXC O;  4U0D A;  3U43 A;  3DS3 A;  1Z6M A;  2M8L A;  1Q7Y Q;  1VQN P;  2BUO A;  2LPK A;  5F2K A;  2GYK A;  1VQL P;  2GZI A;  3EJE A;  2FVF A;  2CG5 B;  4NEO A;  1GXH A;  2KGA A;  1L0H A;  3G0V A;  1HQB A;  1VQP P;  2JYL A;  3DS4 A;  2L22 A;  5EW5 E;  1UJZ A;  2P9X A;  4BPH A;  2KOD A;  4BPF A;  1D1D A;  3CCQ P;  3G29 A;  2K0D X;  4IPY A;  3MGE A;  2L6E A;  4H2X C;  3OW2 O;  2L0Q A;  2GZG A;  7CEI A;  2FQ0 A;  1KD1 Q;  3EJD A;  1N8R Q;  4PH1 A;  1VQM P;  1YJN P;  5KP8 B;  4H2W C;  1VQ4 P;  3DS2 A;  1RO2 A;  4PWV B;  1YHQ P;  2EG5 A;  2KWL A;  2MVV A;  4GR6 A;  2FAD A;  2EFJ A;  4IZ6 A;  1K9M Q;  2AFD A;  2GDY A;  4U0E A;  2E1M A;  3DS5 A;  5EJD A;  3DPH A;  2KOR A;  3G21 A;  2LOL A;  2XXM A;  1KLP A;  3CC7 P;  2N50 A;  2JGP A;  2EHS A;  3G1I A;  2GDX A;  4XRO A;  1QVG O;  5HGN A;  1K8A Q;  3GZL A;  2QEX P;  5DCK A;  3HZQ A;  3CCR P;  2KR5 A;  3CCJ P;  2XZ1 C;  3I56 P;  2K2Q A;  3CME P;  2MD9 A;  3CCE P;  4U0C A;  2VSQ A;  4UHP B;  2PY8 A;  5KP6 B;  1AUM A;  1KQS O;  2KGE A;  2Z45 A;  3B5I A;  1BAJ A;  2JU1 A;  5HGO A;  2K93 A;  1L0I A;  4XFX A;  5BS1 A;  2PEJ A;  2FQ1 A;  1EOQ A;  5BS2 A;  5I4T G;  2K92 A;  4HKG A;  3NY7 B;  2KOQ A;  1IMQ A;  5F2N A;  2LML A;  4XRQ A;  2CGQ A;  1VQ9 P;  3GKL C;  2VLP A;  2L4B A;  2EIA A;  1GPJ A;  1YJ9 P;  1YI2 P;  1IMP A;  1YIJ P;  1VQ7 P;  2DNW A;  3CCM P;  3CMA P;  1IUQ A;  3NTE A;  2JB0 A;  2ERH A;  1RO0 A;  2VLO A;  2AVA A;  2M8P A;  2KG9 A;  4U0A A;  3G4S P;  4MRT C;  2L9F A;  4R0M A;  3H0D A;  2PEI A;  1AF8 A;  1X3O A;  1ACP A;  1Q82 Q;  2JAZ A;  2WPT A;  4M0I A;  2PNG A;  1M1K Q;  1S72 P;  1KC8 Q;  3CC4 P;  2FAE A;  3DS0 A;  1Q81 Q;  3RG6 C;  3DS1 A;  5HGM A;  2FVA A;  3H4E A;  2VLQ A;  2K0X A;  3DTJ A;  3LRY A;  2M8N A;  4DG9 A;  3RG2 A;  4QKO A;  2M5R A;  2K5X A;  2PEK A;  2LL8 A;  4CA3 A;  5F2O A;  3G28 A;  2K0Y A;  5HV8 A;  1M6N A;  1GXG A;  2LIU A;  4U0B A;  4PXH B;  1VQ8 P;  1DV5 A;  2MF4 A;  2GZJ A;  2ROQ A;  2VLN A;  2AFE A;  1CEI A;  4WYM A;  1BXI A;  2JQ4 A;  2KOS A;  4XFZ A;  2EHT A;  2OTL P;  5HGL A;  3LMO A;  1Q86 Q;  3CD6 P;  1EIA A;  5KP7 B;  2JYG A;  1YJW P;  2KG8 A;  1E6J P;  1YIT P;  2KW2 A;  2PEQ A;  3G6E P;  1M90 Q;  2KG6 A;  1MZ8 A;  2JO0 A;  3CC2 P;  2JBG A;  2FVE A;  5CZD B;  4H2Y C;  3CPW O;  1EMV A;  3G1G A;  3I55 P;  1K73 Q;  1VQ5 P;  2DGY A;  4COP A;  2AF8 A;  3G26 A;  5HVC A;  2GDW A;  1AYI A;  2KOP A;  2X2B A;  2Z44 A;  2N98 A;  1ZMB A;  1DNY A;  2QNW A;  2N6Z A;  1M6E X;  2PEM A;  4XFY A;  2BHV A;  2LF4 A;  3CE7 A;  4COC A;  2KOO A;  4PH0 A;  1JJ2 O;  3Q20 A;  1VQO P;  1VQK P;  2XV6 A;  1E0H A;  1A8O A;  1QVF O;  1A43 A;  3G71 P;  2GZF A;  2MY5 A;  1RNI A;  1ZNV A;  1W2B O;  4U0F A;  1VHN A;  3HYB A;  4GR2 A;  2Z46 A;  2NO8 A;  3B4Q A;  2MVU A;  3M1M A;  3CCL P;  2FHS C;  2QA4 P;  2XT1 A;  2OAR A;  3EJB A;  3H47 A;  1T8K A;  2MR8 A;  2KGD A;  2MR7 A;  1QRJ A;  4F37 A;  2CWO A;  1FR2 A;  2XZ0 D;  1M74 A;  2OTJ P;  4QNB A;  5JPA A; 
#chains in the Genus database with same CATH homology
 2KW2 A;  2N5H A;  1NQ4 A;  5KP8 B;  4H2W C;  2AVA A;  2KGC A;  2KG6 A;  2LKI A;  4PWV B;  2KG9 A;  2FVE A;  1VKU A;  2KWL A;  2MVV A;  4MRT C;  2L9F A;  2FAD A;  1OR5 A;  4R0M A;  5CZD B;  4H2Y C;  4IZ6 A;  2AFD A;  2N6Y A;  4BPG A;  2CQ8 A;  1AF8 A;  1X3O A;  1ACP A;  2GDY A;  2FAC A;  1F80 D;  5EJD A;  2AF8 A;  5HVC A;  2GDW A;  2LIW A;  2KOR A;  2PNG A;  2KOP A;  2FAE A;  2LOL A;  2X2B A;  1KLP A;  2N50 A;  2N98 A;  2N5I A;  2JGP A;  2EHS A;  1DNY A;  2QNW A;  2FVA A;  2N6Z A;  2CNR A;  2K0X A;  2GDX A;  1HY8 A;  4DG9 A;  2K94 A;  2JU2 A;  3RG2 A;  3CE7 A;  2KOO A;  2M5R A;  3GZL A;  3GZM A;  2LTE A;  2FQ2 A;  2KR5 A;  2LL8 A;  2LPK A;  2MY5 A;  2XZ1 C;  4CA3 A;  2K2Q A;  2MD9 A;  2VSQ A;  5KP6 B;  2K0Y A;  3EJE A;  2KGE A;  5HV8 A;  2JU1 A;  2FVF A;  2CG5 B;  2MVU A;  4NEO A;  2K93 A;  1L0I A;  2LIU A;  2KGA A;  4PXH B;  1DV5 A;  1L0H A;  2FHS C;  2MF4 A;  1HQB A;  2FQ1 A;  3EJB A;  2ROQ A;  2AFE A;  2L22 A;  1T8K A;  2MR8 A;  2KGD A;  2MR7 A;  2K92 A;  4HKG A;  4BPF A;  2JQ4 A;  2KOS A;  2KOQ A;  3NY7 B;  4BPH A;  2LML A;  4H2X C;  2CGQ A;  2EHT A;  2L0Q A;  3LMO A;  2L4B A;  5KP7 B;  2XZ0 D;  2FQ0 A;  3EJD A;  2KG8 A;  2DNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...