5KP7B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with holo donor-acp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CurD
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Transferase
total genus 25
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp7B00
2JU2A 2M5RA 2KGEA 2AVAA 2K2QA 2L22A 3GZMA 4NEOA 2PNGA 1NQ4A 3EJDA 1HQBA 2GDXA 2CG5B 2FAEA 1T8KA 4MRTC 2DNWA 3EJBA 2FVFA 1VKUA 2JQ4A 1L0IA 2KGAA 2ROQA 2KG8A 2LPKA 2GDYA 2LL8A 2KR5A 4IZ6A 2KGDA 2KORA 4R0MA 2LTEA 3LMOA 2K92A 4PWVB 2GDWA 2QNWA 5EJDA 4H2WC 4H2XC 2X2BA 2VSQA 2JGPA 2KOQA 2XZ0D 5CZDB 2MD9A 5HV8A 2MVUA 1KLPA 2N5IA 5KP8B 2MR8A 2L9FA 3NY7B 5KP6B 2CGQA 2N6ZA 1L0HA 2KG6A 2KWLA 4DG9A 2FADA 2N5HA 4PXHB 1F80D 2AFDA 2FHSC 1AF8A 2AFEA 2K94A 2KGCA 2N6YA 5HVCA 2LIUA 1X3OA 3CE7A 1HY8A 2FVAA 2KG9A 2LIWA 2MY5A 4BPHA 2MR7A 5KP7B 1DV5A 2KW2A 2K93A 4H2YC 2XZ1C 2EHTA 4CA3A 2L4BA 3EJEA 2LMLA 2CQ8A 2L0QA 2KOPA 2FACA 1ACPA 2KOSA 4BPFA 1DNYA 4BPGA 2MF4A 2LOLA 3GZLA 2FQ1A 2KOOA 2K0XA 2CNRA 2FQ0A 2N98A 2FQ2A 2N50A 2AF8A 2EHSA 2K0YA 2LKIA 2MVVA 2JU1A 4HKGA 2FVEA 1OR5A 3RG2A
chains in the Genus database with same CATH superfamily
1GPJA 3H4EA 2JU2A 4U0BA 2KGEA 1NJIQ 2WPTA 1NQ4A 3EJDA 2GDXA 2CG5B 3LRYA 1EIAA 2FAEA 4PH0A 2FVFA 2GDYA 1YJWP 2QEXP 2KGDA 2E1MA 1K73Q 5BS2A 2M8PA 4PWVB 1VQ7P 2GDWA 3GKLC 1W2BO 3CCVP 2X2BA 2VSQA 2PEKA 2JGPA 2XZ0D 1AYIA 2Z46A 2N5IA 5KP8B 2MR8A 5KP6B 1GXGA 1L0HA 1QRJA 3WBHA 2KWLA 3CPWO 2FADA 1BXIA 3G28A 3G29A 4XFYA 2AFDA 3DPHA 3CCUP 2GZIA 2Z44A 1HY8A 4GR2A 1VQOP 2MR7A 2PEOA 2KW2A 3DS0A 2CWOA 3DS1A 4CA3A 2L4BA 2CQ8A 1ZMBA 3CXCO 2L0QA 2KOPA 4WYMA 1DNYA 3M1MA 2MF4A 2PEIA 2KOOA 3H47A 3P05A 1ZNVA 2MVVA 2JU1A 1YI2P 2M5RA 2L22A 3GZMA 3U43A 4NEOA 2PNGA 1IMQA 1M6EX 1K9MQ 1T8KA 2DNWA 2JQ4A 3MGEA 2KGAA 2KG8A 3DS2A 2LPKA 1FR2A 2LL8A 3CCMP 3GJNA 3RG6C 4COPA 3LMOA 1VQPP 1D1DA 1IUQA 5EJDA 2PY8A 2GZFA 3CCSP 1QVFO 2MD9A 3I56P 1K30A 1YJ9P 2MVUA 2N6ZA 3G26A 3DS5A 4UHPB 1EOQA 1M74A 4PXHB 3CCEP 1F80D 2K94A 2LIUA 3CE7A 2KG9A 2LIWA 2K5XA 5KP7B 1BAJA 3VRLC 1VQNP 5EW5E 4XRQA 2XZ1C 2EHTA 2LF4A 3EJEA 2LMLA 1MZ8A 1A8OA 3CD6P 2JYLA 4XFXA 2M8LA 3CC2P 2KOSA 2L6EA 2LOLA 3GZLA 2FQ1A 2CNRA 2N98A 2FQ2A 2N50A 2NO8A 2AF8A 4HKGA 2FVEA 5I4TG 3RG2A 4U0DA 4PH1A 2K2QA 1QVGO 1E6JP 1Z6MA 1RO0A 4M0IA 4XROA 3CC4P 4MRTC 3EJBA 3NTEA 2K0DX 1L0IA 1Q7YQ 1M1KQ 2ROQA 3CCJP 2GZJA 5F2KA 1YHQP 2VLPA 1YITP 3I55P 5HGNA 2KR5A 2GZGA 1EMVA 2OTLP 2KORA 2K92A 2PEQA 2GYKA 1S72P 4COCA 1K8AQ 4H2XC 4XFZA 4U0EA 5CZDB 5HV8A 2Z45A 2L9FA 3NY7B 1VHNA 3OW2O 4DG9A 1VQMP 1YIJP 3CCLP 1AF8A 2EIAA 1KD1Q 2KGCA 3CMAP 2FVAA 2MY5A 4GR6A 1RO2A 3H0DA 4IPYA 5HGMA 2XV6A 5BS1A 1VQ4P 1DV5A 3G1IA 2OTJP 2K93A 1Q86Q 2EFJA 1UJZA 1RNIA 4QKOA 5F2OA 3G21A 1VQ9P 3HYBA 2KODA 1M6NA 4U0CA 2M8NA 4BPGA 1M90Q 1Q81Q 2VLOA 3B5IA 2EHSA 2LKIA 2OARA 3Q20A 1VQ8P 3G6EP 1OR5A 2ERHA 1JJ2O 4U0AA 3HZQA 2AVAA 2JO0A 5JPAA 2EG5A 1HQBA 2PEMA 3CCQP 2JAZA 1VKUA 5DCKA 3CMEP 2GZEA 2JBGA 1UNKA 4IZ6A 1VQLP 1VQ6P 2PENA 2BUOA 3CCRP 2JB0A 4R0MA 2LTEA 3B4QA 2XXMA 7CEIA 2P9XA 1E0HA 2ONTA 2VLQA 2QNWA 4H2WC 3E2DA 2DGYA 1KQSO 2JYGA 2KOQA 2VLNA 4QNBA 1KLPA 3CC7P 2CGQA 2KG6A 1YJNP 1KC8Q 3G1GA 3DS3A 3DTJA 1Q82Q 2N5HA 1AUMA 2FHSC 5HGLA 2AFEA 2N6YA 5HVCA 1X3OA 4BPHA 3DS4A 5F2NA 3G71P 1GXHA 3G0VA 4H2YC 1CEIA 2BHVA 2XT1A 4U0FA 2FACA 2QA4P 1ACPA 1A43A 4F37A 3G4SP 5HGOA 4BPFA 1VQKP 2PEJA 1IMPA 2K0XA 2FQ0A 1N8RQ 2K0YA 1VQ5P
chains in the Genus database with same CATH topology
2JU2A 2M5RA 2KGEA 2AVAA 2K2QA 2L22A 3GZMA 4NEOA 2PNGA 1NQ4A 3EJDA 1HQBA 2GDXA 2CG5B 2FAEA 1T8KA 4MRTC 2DNWA 3EJBA 2FVFA 1VKUA 2JQ4A 1L0IA 2KGAA 2ROQA 2KG8A 2LPKA 2GDYA 2LL8A 2KR5A 4IZ6A 2KGDA 2KORA 4R0MA 2LTEA 3LMOA 2K92A 4PWVB 2GDWA 2QNWA 5EJDA 4H2WC 4H2XC 2X2BA 2VSQA 2JGPA 2KOQA 2XZ0D 5CZDB 2MD9A 5HV8A 2MVUA 1KLPA 2N5IA 5KP8B 2MR8A 2L9FA 3NY7B 5KP6B 2CGQA 2N6ZA 1L0HA 2KG6A 2KWLA 4DG9A 2FADA 2N5HA 4PXHB 1F80D 2AFDA 2FHSC 1AF8A 2AFEA 2K94A 2KGCA 2N6YA 5HVCA 2LIUA 1X3OA 3CE7A 1HY8A 2FVAA 2KG9A 2LIWA 2MY5A 4BPHA 2MR7A 5KP7B 1DV5A 2KW2A 2K93A 4H2YC 2XZ1C 2EHTA 4CA3A 2L4BA 3EJEA 2LMLA 2CQ8A 2L0QA 2KOPA 2FACA 1ACPA 2KOSA 4BPFA 1DNYA 4BPGA 2MF4A 2LOLA 3GZLA 2FQ1A 2KOOA 2K0XA 2CNRA 2FQ0A 2N98A 2FQ2A 2N50A 2AF8A 2EHSA 2K0YA 2LKIA 2MVVA 2JU1A 4HKGA 2FVEA 1OR5A 3RG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JU2 A;  2M5R A;  2KGE A;  2AVA A;  2K2Q A;  2L22 A;  3GZM A;  4NEO A;  2PNG A;  1NQ4 A;  3EJD A;  1HQB A;  2GDX A;  2CG5 B;  2FAE A;  1T8K A;  4MRT C;  2DNW A;  3EJB A;  2FVF A;  1VKU A;  2JQ4 A;  1L0I A;  2KGA A;  2ROQ A;  2KG8 A;  2LPK A;  2GDY A;  2LL8 A;  2KR5 A;  4IZ6 A;  2KGD A;  2KOR A;  4R0M A;  2LTE A;  3LMO A;  2K92 A;  4PWV B;  2GDW A;  2QNW A;  5EJD A;  4H2W C;  4H2X C;  2X2B A;  2VSQ A;  2JGP A;  2KOQ A;  2XZ0 D;  5CZD B;  2MD9 A;  5HV8 A;  2MVU A;  1KLP A;  2N5I A;  5KP8 B;  2MR8 A;  2L9F A;  3NY7 B;  5KP6 B;  2CGQ A;  2N6Z A;  1L0H A;  2KG6 A;  2KWL A;  4DG9 A;  2FAD A;  2N5H A;  4PXH B;  1F80 D;  2AFD A;  2FHS C;  1AF8 A;  2AFE A;  2K94 A;  2KGC A;  2N6Y A;  5HVC A;  2LIU A;  1X3O A;  3CE7 A;  1HY8 A;  2FVA A;  2KG9 A;  2LIW A;  2MY5 A;  4BPH A;  2MR7 A;  5KP7 B;  1DV5 A;  2KW2 A;  2K93 A;  4H2Y C;  2XZ1 C;  2EHT A;  4CA3 A;  2L4B A;  3EJE A;  2LML A;  2CQ8 A;  2L0Q A;  2KOP A;  2FAC A;  1ACP A;  2KOS A;  4BPF A;  1DNY A;  4BPG A;  2MF4 A;  2LOL A;  3GZL A;  2FQ1 A;  2KOO A;  2K0X A;  2CNR A;  2FQ0 A;  2N98 A;  2FQ2 A;  2N50 A;  2AF8 A;  2EHS A;  2K0Y A;  2LKI A;  2MVV A;  2JU1 A;  4HKG A;  2FVE A;  1OR5 A;  3RG2 A; 
#chains in the Genus database with same CATH topology
 1GPJ A;  3H4E A;  2JU2 A;  4U0B A;  2KGE A;  1NJI Q;  2WPT A;  1NQ4 A;  3EJD A;  2GDX A;  2CG5 B;  3LRY A;  1EIA A;  2FAE A;  4PH0 A;  2FVF A;  2GDY A;  1YJW P;  2QEX P;  2KGD A;  2E1M A;  1K73 Q;  5BS2 A;  2M8P A;  4PWV B;  1VQ7 P;  2GDW A;  3GKL C;  1W2B O;  3CCV P;  2X2B A;  2VSQ A;  2PEK A;  2JGP A;  2XZ0 D;  1AYI A;  2Z46 A;  2N5I A;  5KP8 B;  2MR8 A;  5KP6 B;  1GXG A;  1L0H A;  1QRJ A;  3WBH A;  2KWL A;  3CPW O;  2FAD A;  1BXI A;  3G28 A;  3G29 A;  4XFY A;  2AFD A;  3DPH A;  3CCU P;  2GZI A;  2Z44 A;  1HY8 A;  4GR2 A;  1VQO P;  2MR7 A;  2PEO A;  2KW2 A;  3DS0 A;  2CWO A;  3DS1 A;  4CA3 A;  2L4B A;  2CQ8 A;  1ZMB A;  3CXC O;  2L0Q A;  2KOP A;  4WYM A;  1DNY A;  3M1M A;  2MF4 A;  2PEI A;  2KOO A;  3H47 A;  3P05 A;  1ZNV A;  2MVV A;  2JU1 A;  1YI2 P;  2M5R A;  2L22 A;  3GZM A;  3U43 A;  4NEO A;  2PNG A;  1IMQ A;  1M6E X;  1K9M Q;  1T8K A;  2DNW A;  2JQ4 A;  3MGE A;  2KGA A;  2KG8 A;  3DS2 A;  2LPK A;  1FR2 A;  2LL8 A;  3CCM P;  3GJN A;  3RG6 C;  4COP A;  3LMO A;  1VQP P;  1D1D A;  1IUQ A;  5EJD A;  2PY8 A;  2GZF A;  3CCS P;  1QVF O;  2MD9 A;  3I56 P;  1K30 A;  1YJ9 P;  2MVU A;  2N6Z A;  3G26 A;  3DS5 A;  4UHP B;  1EOQ A;  1M74 A;  4PXH B;  3CCE P;  1F80 D;  2K94 A;  2LIU A;  3CE7 A;  2KG9 A;  2LIW A;  2K5X A;  5KP7 B;  1BAJ A;  3VRL C;  1VQN P;  5EW5 E;  4XRQ A;  2XZ1 C;  2EHT A;  2LF4 A;  3EJE A;  2LML A;  1MZ8 A;  1A8O A;  3CD6 P;  2JYL A;  4XFX A;  2M8L A;  3CC2 P;  2KOS A;  2L6E A;  2LOL A;  3GZL A;  2FQ1 A;  2CNR A;  2N98 A;  2FQ2 A;  2N50 A;  2NO8 A;  2AF8 A;  4HKG A;  2FVE A;  5I4T G;  3RG2 A;  4U0D A;  4PH1 A;  2K2Q A;  1QVG O;  1E6J P;  1Z6M A;  1RO0 A;  4M0I A;  4XRO A;  3CC4 P;  4MRT C;  3EJB A;  3NTE A;  2K0D X;  1L0I A;  1Q7Y Q;  1M1K Q;  2ROQ A;  3CCJ P;  2GZJ A;  5F2K A;  1YHQ P;  2VLP A;  1YIT P;  3I55 P;  5HGN A;  2KR5 A;  2GZG A;  1EMV A;  2OTL P;  2KOR A;  2K92 A;  2PEQ A;  2GYK A;  1S72 P;  4COC A;  1K8A Q;  4H2X C;  4XFZ A;  4U0E A;  5CZD B;  5HV8 A;  2Z45 A;  2L9F A;  3NY7 B;  1VHN A;  3OW2 O;  4DG9 A;  1VQM P;  1YIJ P;  3CCL P;  1AF8 A;  2EIA A;  1KD1 Q;  2KGC A;  3CMA P;  2FVA A;  2MY5 A;  4GR6 A;  1RO2 A;  3H0D A;  4IPY A;  5HGM A;  2XV6 A;  5BS1 A;  1VQ4 P;  1DV5 A;  3G1I A;  2OTJ P;  2K93 A;  1Q86 Q;  2EFJ A;  1UJZ A;  1RNI A;  4QKO A;  5F2O A;  3G21 A;  1VQ9 P;  3HYB A;  2KOD A;  1M6N A;  4U0C A;  2M8N A;  4BPG A;  1M90 Q;  1Q81 Q;  2VLO A;  3B5I A;  2EHS A;  2LKI A;  2OAR A;  3Q20 A;  1VQ8 P;  3G6E P;  1OR5 A;  2ERH A;  1JJ2 O;  4U0A A;  3HZQ A;  2AVA A;  2JO0 A;  5JPA A;  2EG5 A;  1HQB A;  2PEM A;  3CCQ P;  2JAZ A;  1VKU A;  5DCK A;  3CME P;  2GZE A;  2JBG A;  1UNK A;  4IZ6 A;  1VQL P;  1VQ6 P;  2PEN A;  2BUO A;  3CCR P;  2JB0 A;  4R0M A;  2LTE A;  3B4Q A;  2XXM A;  7CEI A;  2P9X A;  1E0H A;  2ONT A;  2VLQ A;  2QNW A;  4H2W C;  3E2D A;  2DGY A;  1KQS O;  2JYG A;  2KOQ A;  2VLN A;  4QNB A;  1KLP A;  3CC7 P;  2CGQ A;  2KG6 A;  1YJN P;  1KC8 Q;  3G1G A;  3DS3 A;  3DTJ A;  1Q82 Q;  2N5H A;  1AUM A;  2FHS C;  5HGL A;  2AFE A;  2N6Y A;  5HVC A;  1X3O A;  4BPH A;  3DS4 A;  5F2N A;  3G71 P;  1GXH A;  3G0V A;  4H2Y C;  1CEI A;  2BHV A;  2XT1 A;  4U0F A;  2FAC A;  2QA4 P;  1ACP A;  1A43 A;  4F37 A;  3G4S P;  5HGO A;  4BPF A;  1VQK P;  2PEJ A;  1IMP A;  2K0X A;  2FQ0 A;  1N8R Q;  2K0Y A;  1VQ5 P; 
#chains in the Genus database with same CATH homology
 2JU2 A;  2M5R A;  2KGE A;  2AVA A;  2K2Q A;  2L22 A;  3GZM A;  4NEO A;  2PNG A;  1NQ4 A;  3EJD A;  1HQB A;  2GDX A;  2CG5 B;  2FAE A;  1T8K A;  4MRT C;  2DNW A;  3EJB A;  2FVF A;  1VKU A;  2JQ4 A;  1L0I A;  2KGA A;  2ROQ A;  2KG8 A;  2LPK A;  2GDY A;  2LL8 A;  2KR5 A;  4IZ6 A;  2KGD A;  2KOR A;  4R0M A;  2LTE A;  3LMO A;  2K92 A;  4PWV B;  2GDW A;  2QNW A;  5EJD A;  4H2W C;  4H2X C;  2X2B A;  2VSQ A;  2JGP A;  2KOQ A;  2XZ0 D;  5CZD B;  2MD9 A;  5HV8 A;  2MVU A;  1KLP A;  2N5I A;  5KP8 B;  2MR8 A;  2L9F A;  3NY7 B;  5KP6 B;  2CGQ A;  2N6Z A;  1L0H A;  2KG6 A;  2KWL A;  4DG9 A;  2FAD A;  2N5H A;  4PXH B;  1F80 D;  2AFD A;  2FHS C;  1AF8 A;  2AFE A;  2K94 A;  2KGC A;  2N6Y A;  5HVC A;  2LIU A;  1X3O A;  3CE7 A;  1HY8 A;  2FVA A;  2KG9 A;  2LIW A;  2MY5 A;  4BPH A;  2MR7 A;  5KP7 B;  1DV5 A;  2KW2 A;  2K93 A;  4H2Y C;  2XZ1 C;  2EHT A;  4CA3 A;  2L4B A;  3EJE A;  2LML A;  2CQ8 A;  2L0Q A;  2KOP A;  2FAC A;  1ACP A;  2KOS A;  4BPF A;  1DNY A;  4BPG A;  2MF4 A;  2LOL A;  3GZL A;  2FQ1 A;  2KOO A;  2K0X A;  2CNR A;  2FQ0 A;  2N98 A;  2FQ2 A;  2N50 A;  2AF8 A;  2EHS A;  2K0Y A;  2LKI A;  2MVV A;  2JU1 A;  4HKG A;  2FVE A;  1OR5 A;  3RG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...