5KP7B

Crystal structure of the curacin biosynthetic pathway hmg synthase in complex with holo donor-acp
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
79
structure length
79
Chain Sequence
b'MSKEQVLKIIKKYTREIAPELEDSPLEPTDSLKKLGIDSVNRAEIIMMVMEDLSLNIPRIELAGAKNIGELADLFAAKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CurD
publication title Anatomy of the beta-branching enzyme of polyketide biosynthesis and its interaction with an acyl-ACP substrate.
pubmed doi rcsb
source organism Moorea producens 3l
molecule tags Transferase
total genus 25
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2016-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00550 PP-binding Phosphopantetheine attachment site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.10 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A ACP-like 5kp7B00
2AFDA 2JGPA 1AF8A 1L0IA 1HQBA 2K2QA 2FQ0A 5KP7B 2JU2A 2JU1A 4PXHB 2LL8A 2MR7A 2N6ZA 2N50A 1T8KA 2FVEA 2LTEA 4H2YC 4H2WC 1VKUA 5KP6B 2MF4A 2ROQA 3NY7B 2MY5A 2XZ1C 2MD9A 3EJEA 2KGEA 2XZ0D 1DNYA 2LPKA 2MVVA 1ACPA 2KW2A 2KOPA 4CA3A 4HKGA 3LMOA 1F80D 2N98A 1HY8A 2KG8A 2KOOA 2KGCA 2KG6A 2GDXA 2L22A 2CNRA 4H2XC 2K93A 1NQ4A 2QNWA 5HVCA 2AF8A 2AVAA 2KWLA 2PNGA 2KR5A 2FACA 2VSQA 2N6YA 2FADA 2KGAA 3RG2A 3GZMA 4PWVB 2CG5B 2GDYA 3CE7A 4BPFA 2K0YA 2K92A 2KOSA 2L0QA 1OR5A 2FQ1A 4BPHA 2LIUA 2EHTA 4NEOA 2KGDA 1DV5A 2M5RA 2LIWA 2LOLA 5KP8B 2FVAA 2L9FA 4R0MA 2MVUA 2AFEA 5CZDB 2LKIA 2KG9A 2X2BA 5HV8A 3EJBA 4IZ6A 2JQ4A 2K94A 2LMLA 4DG9A 2MR8A 2N5IA 3EJDA 2EHSA 2L4BA 1X3OA 2CGQA 2FHSC 3GZLA 4BPGA 2N5HA 4MRTC 2DNWA 2FAEA 1KLPA 2FVFA 2GDWA 2K0XA 2KOQA 5EJDA 2CQ8A 2KORA 2FQ2A 1L0HA
chains in the Genus database with same CATH superfamily
2AFDA 2JGPA 1HQBA 4XFZA 4PH1A 1VQ6P 1Q7YQ 5I4TG 2ONTA 2M8LA 2N50A 1YJNP 1BXIA 3NY7B 2M8NA 2MD9A 3EJEA 3DS5A 2ERHA 2KW2A 1IUQA 1VQNP 2KG8A 3NTEA 2E1MA 1K8AQ 2PEKA 2QNWA 2AF8A 3H0DA 3CD6P 2KR5A 2FADA 2QA4P 2K0DX 1S72P 3I56P 2PY8A 1GPJA 1K73Q 3M1MA 3G29A 2GZGA 1W2BO 3I55P 2LIWA 2Z45A 2LOLA 3OW2O 4XROA 2FVAA 3CCUP 2NO8A 2MVUA 2AFEA 1VQ9P 2KG9A 2X2BA 3HZQA 1MZ8A 2N5IA 1CEIA 2XT1A 4MRTC 1KLPA 2FVFA 3G6EP 1GXGA 2CQ8A 1L0HA 2K2QA 2KODA 5KP7B 3CCRP 1IMPA 1VQLP 2JU1A 4COPA 2MR7A 4H2WC 3G71P 3CCVP 1VKUA 5KP6B 2MF4A 2ROQA 2VLQA 5HGOA 3CMAP 1VQKP 1ZNVA 4QKOA 1N8RQ 2KGEA 2XZ0D 1DNYA 1EIAA 1Z6MA 2MVVA 3DS3A 1VQ7P 1ACPA 3P05A 1E0HA 1YIJP 4GR2A 3Q20A 5F2KA 3LMOA 2BUOA 5HGMA 3H4EA 1RO0A 2KG6A 1M74A 2GDXA 1VQ8P 4COCA 1BAJA 2K93A 2AVAA 1YJ9P 5BS1A 2FACA 2VSQA 2KGAA 4PH0A 3GZMA 3CC7P 1VQ5P 1EOQA 3CE7A 3H47A 1KC8Q 4U0AA 4U0CA 3CCSP 2L0QA 1OR5A 3RG6C 3CC2P 2P9XA 3VRLC 2KGDA 2M5RA 2VLOA 5KP8B 2PEJA 2L9FA 4R0MA 1YITP 1VQOP 2PEQA 3G4SP 3EJBA 2JQ4A 2LMLA 4DG9A 1RNIA 2MR8A 1EMVA 1FR2A 2OARA 2FAEA 3G0VA 3G28A 1VQMP 2GDWA 2K0XA 2GZEA 1Q81Q 2JAZA 4GR6A 2FQ0A 3DS1A 1VHNA 5HGNA 4XFYA 4PXHB 1ZMBA 1E6JP 1T8KA 2FVEA 1JJ2O 1M6NA 2VLNA 2XZ1C 5DCKA 3G1GA 3WBHA 1IMQA 2KOPA 1YI2P 1K9MQ 2Z44A 3CMEP 4HKGA 1F80D 1A43A 3GJNA 2KOOA 2K5XA 2L22A 4H2XC 1NQ4A 1RO2A 5BS2A 4QNBA 4PWVB 2JYGA 3CXCO 2CG5B 2JB0A 3G26A 2L6EA 3DS0A 4BPFA 1A8OA 3CCLP 1YHQP 5EW5E 2K0YA 2KOSA 2FQ1A 2GYKA 4NEOA 3E2DA 3G21A 3DS2A 3B5IA 1GXHA 2GZJA 2XXMA 2LKIA 1KQSO 1AYIA 4IZ6A 2M8PA 1Q82Q 3EJDA 2EHSA 2GZFA 2CGQA 4F37A 2JYLA 5HGLA 2N5HA 5F2OA 2DGYA 5F2NA 2KOQA 5EJDA 2PEOA 4U0BA 2FQ2A 1AF8A 1L0IA 3G1IA 2QEXP 2XV6A 1UJZA 2JU2A 2LL8A 2N6ZA 3DS4A 2LTEA 4H2YC 1QVGO 2MY5A 3CPWO 4U0DA 2OTLP 2JBGA 1AUMA 2LPKA 4CA3A 1QVFO 3LRYA 3B4QA 1D1DA 2N98A 1HY8A 4UHPB 3U43A 2CWOA 2WPTA 2KGCA 5JPAA 2CNRA 3CCQP 1UNKA 3CCJP 2OTJP 3GKLC 4U0FA 5HVCA 2KWLA 2GZIA 2PNGA 3CC4P 2VLPA 2N6YA 3RG2A 3MGEA 2GDYA 1VQPP 3DTJA 1VQ4P 1M90Q 2LF4A 3CCMP 7CEIA 1M1KQ 2K92A 4IPYA 3DPHA 4BPHA 2LIUA 2EHTA 2BHVA 1Q86Q 1DV5A 4XRQA 2EG5A 3HYBA 2PEIA 1QRJA 1YJWP 1K30A 4M0IA 4U0EA 4XFXA 5CZDB 2PEMA 3CCEP 2Z46A 1KD1Q 5HV8A 2K94A 2L4BA 1X3OA 2FHSC 3GZLA 1M6EX 4BPGA 2PENA 2EIAA 2DNWA 2EFJA 1NJIQ 4WYMA 2KORA 2JO0A
chains in the Genus database with same CATH topology
2AFDA 2JGPA 1AF8A 1L0IA 1HQBA 2K2QA 2FQ0A 5KP7B 2JU2A 2JU1A 4PXHB 2LL8A 2MR7A 2N6ZA 2N50A 1T8KA 2FVEA 2LTEA 4H2YC 4H2WC 1VKUA 5KP6B 2MF4A 2ROQA 3NY7B 2MY5A 2XZ1C 2MD9A 3EJEA 2KGEA 2XZ0D 1DNYA 2LPKA 2MVVA 1ACPA 2KW2A 2KOPA 4CA3A 4HKGA 3LMOA 1F80D 2N98A 1HY8A 2KG8A 2KOOA 2KGCA 2KG6A 2GDXA 2L22A 2CNRA 4H2XC 2K93A 1NQ4A 2QNWA 5HVCA 2AF8A 2AVAA 2KWLA 2PNGA 2KR5A 2FACA 2VSQA 2N6YA 2FADA 2KGAA 3RG2A 3GZMA 4PWVB 2CG5B 2GDYA 3CE7A 4BPFA 2K0YA 2K92A 2KOSA 2L0QA 1OR5A 2FQ1A 4BPHA 2LIUA 2EHTA 4NEOA 2KGDA 1DV5A 2M5RA 2LIWA 2LOLA 5KP8B 2FVAA 2L9FA 4R0MA 2MVUA 2AFEA 5CZDB 2LKIA 2KG9A 2X2BA 5HV8A 3EJBA 4IZ6A 2JQ4A 2K94A 2LMLA 4DG9A 2MR8A 2N5IA 3EJDA 2EHSA 2L4BA 1X3OA 2CGQA 2FHSC 3GZLA 4BPGA 2N5HA 4MRTC 2DNWA 2FAEA 1KLPA 2FVFA 2GDWA 2K0XA 2KOQA 5EJDA 2CQ8A 2KORA 2FQ2A 1L0HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFD A;  2JGP A;  1AF8 A;  1L0I A;  1HQB A;  2K2Q A;  2FQ0 A;  5KP7 B;  2JU2 A;  2JU1 A;  4PXH B;  2LL8 A;  2MR7 A;  2N6Z A;  2N50 A;  1T8K A;  2FVE A;  2LTE A;  4H2Y C;  4H2W C;  1VKU A;  5KP6 B;  2MF4 A;  2ROQ A;  3NY7 B;  2MY5 A;  2XZ1 C;  2MD9 A;  3EJE A;  2KGE A;  2XZ0 D;  1DNY A;  2LPK A;  2MVV A;  1ACP A;  2KW2 A;  2KOP A;  4CA3 A;  4HKG A;  3LMO A;  1F80 D;  2N98 A;  1HY8 A;  2KG8 A;  2KOO A;  2KGC A;  2KG6 A;  2GDX A;  2L22 A;  2CNR A;  4H2X C;  2K93 A;  1NQ4 A;  2QNW A;  5HVC A;  2AF8 A;  2AVA A;  2KWL A;  2PNG A;  2KR5 A;  2FAC A;  2VSQ A;  2N6Y A;  2FAD A;  2KGA A;  3RG2 A;  3GZM A;  4PWV B;  2CG5 B;  2GDY A;  3CE7 A;  4BPF A;  2K0Y A;  2K92 A;  2KOS A;  2L0Q A;  1OR5 A;  2FQ1 A;  4BPH A;  2LIU A;  2EHT A;  4NEO A;  2KGD A;  1DV5 A;  2M5R A;  2LIW A;  2LOL A;  5KP8 B;  2FVA A;  2L9F A;  4R0M A;  2MVU A;  2AFE A;  5CZD B;  2LKI A;  2KG9 A;  2X2B A;  5HV8 A;  3EJB A;  4IZ6 A;  2JQ4 A;  2K94 A;  2LML A;  4DG9 A;  2MR8 A;  2N5I A;  3EJD A;  2EHS A;  2L4B A;  1X3O A;  2CGQ A;  2FHS C;  3GZL A;  4BPG A;  2N5H A;  4MRT C;  2DNW A;  2FAE A;  1KLP A;  2FVF A;  2GDW A;  2K0X A;  2KOQ A;  5EJD A;  2CQ8 A;  2KOR A;  2FQ2 A;  1L0H A; 
#chains in the Genus database with same CATH topology
 2AFD A;  2JGP A;  1HQB A;  4XFZ A;  4PH1 A;  1VQ6 P;  1Q7Y Q;  5I4T G;  2ONT A;  2M8L A;  2N50 A;  1YJN P;  1BXI A;  3NY7 B;  2M8N A;  2MD9 A;  3EJE A;  3DS5 A;  2ERH A;  2KW2 A;  1IUQ A;  1VQN P;  2KG8 A;  3NTE A;  2E1M A;  1K8A Q;  2PEK A;  2QNW A;  2AF8 A;  3H0D A;  3CD6 P;  2KR5 A;  2FAD A;  2QA4 P;  2K0D X;  1S72 P;  3I56 P;  2PY8 A;  1GPJ A;  1K73 Q;  3M1M A;  3G29 A;  2GZG A;  1W2B O;  3I55 P;  2LIW A;  2Z45 A;  2LOL A;  3OW2 O;  4XRO A;  2FVA A;  3CCU P;  2NO8 A;  2MVU A;  2AFE A;  1VQ9 P;  2KG9 A;  2X2B A;  3HZQ A;  1MZ8 A;  2N5I A;  1CEI A;  2XT1 A;  4MRT C;  1KLP A;  2FVF A;  3G6E P;  1GXG A;  2CQ8 A;  1L0H A;  2K2Q A;  2KOD A;  5KP7 B;  3CCR P;  1IMP A;  1VQL P;  2JU1 A;  4COP A;  2MR7 A;  4H2W C;  3G71 P;  3CCV P;  1VKU A;  5KP6 B;  2MF4 A;  2ROQ A;  2VLQ A;  5HGO A;  3CMA P;  1VQK P;  1ZNV A;  4QKO A;  1N8R Q;  2KGE A;  2XZ0 D;  1DNY A;  1EIA A;  1Z6M A;  2MVV A;  3DS3 A;  1VQ7 P;  1ACP A;  3P05 A;  1E0H A;  1YIJ P;  4GR2 A;  3Q20 A;  5F2K A;  3LMO A;  2BUO A;  5HGM A;  3H4E A;  1RO0 A;  2KG6 A;  1M74 A;  2GDX A;  1VQ8 P;  4COC A;  1BAJ A;  2K93 A;  2AVA A;  1YJ9 P;  5BS1 A;  2FAC A;  2VSQ A;  2KGA A;  4PH0 A;  3GZM A;  3CC7 P;  1VQ5 P;  1EOQ A;  3CE7 A;  3H47 A;  1KC8 Q;  4U0A A;  4U0C A;  3CCS P;  2L0Q A;  1OR5 A;  3RG6 C;  3CC2 P;  2P9X A;  3VRL C;  2KGD A;  2M5R A;  2VLO A;  5KP8 B;  2PEJ A;  2L9F A;  4R0M A;  1YIT P;  1VQO P;  2PEQ A;  3G4S P;  3EJB A;  2JQ4 A;  2LML A;  4DG9 A;  1RNI A;  2MR8 A;  1EMV A;  1FR2 A;  2OAR A;  2FAE A;  3G0V A;  3G28 A;  1VQM P;  2GDW A;  2K0X A;  2GZE A;  1Q81 Q;  2JAZ A;  4GR6 A;  2FQ0 A;  3DS1 A;  1VHN A;  5HGN A;  4XFY A;  4PXH B;  1ZMB A;  1E6J P;  1T8K A;  2FVE A;  1JJ2 O;  1M6N A;  2VLN A;  2XZ1 C;  5DCK A;  3G1G A;  3WBH A;  1IMQ A;  2KOP A;  1YI2 P;  1K9M Q;  2Z44 A;  3CME P;  4HKG A;  1F80 D;  1A43 A;  3GJN A;  2KOO A;  2K5X A;  2L22 A;  4H2X C;  1NQ4 A;  1RO2 A;  5BS2 A;  4QNB A;  4PWV B;  2JYG A;  3CXC O;  2CG5 B;  2JB0 A;  3G26 A;  2L6E A;  3DS0 A;  4BPF A;  1A8O A;  3CCL P;  1YHQ P;  5EW5 E;  2K0Y A;  2KOS A;  2FQ1 A;  2GYK A;  4NEO A;  3E2D A;  3G21 A;  3DS2 A;  3B5I A;  1GXH A;  2GZJ A;  2XXM A;  2LKI A;  1KQS O;  1AYI A;  4IZ6 A;  2M8P A;  1Q82 Q;  3EJD A;  2EHS A;  2GZF A;  2CGQ A;  4F37 A;  2JYL A;  5HGL A;  2N5H A;  5F2O A;  2DGY A;  5F2N A;  2KOQ A;  5EJD A;  2PEO A;  4U0B A;  2FQ2 A;  1AF8 A;  1L0I A;  3G1I A;  2QEX P;  2XV6 A;  1UJZ A;  2JU2 A;  2LL8 A;  2N6Z A;  3DS4 A;  2LTE A;  4H2Y C;  1QVG O;  2MY5 A;  3CPW O;  4U0D A;  2OTL P;  2JBG A;  1AUM A;  2LPK A;  4CA3 A;  1QVF O;  3LRY A;  3B4Q A;  1D1D A;  2N98 A;  1HY8 A;  4UHP B;  3U43 A;  2CWO A;  2WPT A;  2KGC A;  5JPA A;  2CNR A;  3CCQ P;  1UNK A;  3CCJ P;  2OTJ P;  3GKL C;  4U0F A;  5HVC A;  2KWL A;  2GZI A;  2PNG A;  3CC4 P;  2VLP A;  2N6Y A;  3RG2 A;  3MGE A;  2GDY A;  1VQP P;  3DTJ A;  1VQ4 P;  1M90 Q;  2LF4 A;  3CCM P;  7CEI A;  1M1K Q;  2K92 A;  4IPY A;  3DPH A;  4BPH A;  2LIU A;  2EHT A;  2BHV A;  1Q86 Q;  1DV5 A;  4XRQ A;  2EG5 A;  3HYB A;  2PEI A;  1QRJ A;  1YJW P;  1K30 A;  4M0I A;  4U0E A;  4XFX A;  5CZD B;  2PEM A;  3CCE P;  2Z46 A;  1KD1 Q;  5HV8 A;  2K94 A;  2L4B A;  1X3O A;  2FHS C;  3GZL A;  1M6E X;  4BPG A;  2PEN A;  2EIA A;  2DNW A;  2EFJ A;  1NJI Q;  4WYM A;  2KOR A;  2JO0 A; 
#chains in the Genus database with same CATH homology
 2AFD A;  2JGP A;  1AF8 A;  1L0I A;  1HQB A;  2K2Q A;  2FQ0 A;  5KP7 B;  2JU2 A;  2JU1 A;  4PXH B;  2LL8 A;  2MR7 A;  2N6Z A;  2N50 A;  1T8K A;  2FVE A;  2LTE A;  4H2Y C;  4H2W C;  1VKU A;  5KP6 B;  2MF4 A;  2ROQ A;  3NY7 B;  2MY5 A;  2XZ1 C;  2MD9 A;  3EJE A;  2KGE A;  2XZ0 D;  1DNY A;  2LPK A;  2MVV A;  1ACP A;  2KW2 A;  2KOP A;  4CA3 A;  4HKG A;  3LMO A;  1F80 D;  2N98 A;  1HY8 A;  2KG8 A;  2KOO A;  2KGC A;  2KG6 A;  2GDX A;  2L22 A;  2CNR A;  4H2X C;  2K93 A;  1NQ4 A;  2QNW A;  5HVC A;  2AF8 A;  2AVA A;  2KWL A;  2PNG A;  2KR5 A;  2FAC A;  2VSQ A;  2N6Y A;  2FAD A;  2KGA A;  3RG2 A;  3GZM A;  4PWV B;  2CG5 B;  2GDY A;  3CE7 A;  4BPF A;  2K0Y A;  2K92 A;  2KOS A;  2L0Q A;  1OR5 A;  2FQ1 A;  4BPH A;  2LIU A;  2EHT A;  4NEO A;  2KGD A;  1DV5 A;  2M5R A;  2LIW A;  2LOL A;  5KP8 B;  2FVA A;  2L9F A;  4R0M A;  2MVU A;  2AFE A;  5CZD B;  2LKI A;  2KG9 A;  2X2B A;  5HV8 A;  3EJB A;  4IZ6 A;  2JQ4 A;  2K94 A;  2LML A;  4DG9 A;  2MR8 A;  2N5I A;  3EJD A;  2EHS A;  2L4B A;  1X3O A;  2CGQ A;  2FHS C;  3GZL A;  4BPG A;  2N5H A;  4MRT C;  2DNW A;  2FAE A;  1KLP A;  2FVF A;  2GDW A;  2K0X A;  2KOQ A;  5EJD A;  2CQ8 A;  2KOR A;  2FQ2 A;  1L0H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...