5KQ4A

Crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2 and synthetic cap analog
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
124
structure length
124
Chain Sequence
b'MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structural basis of mRNA-cap recognition by Dcp1-Dcp2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
molecule tags Hydrolase
total genus 32
structure length 124
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kq4A00
2ELAA 2Y8GA 3WA0A 4DX8A 2VRWB 4HB0B 1FHWA 2P8VA 2D9WA 2YSZA 1LB1A 2MWNB 4GMXB 3OANA 1RRPB 2EC1A 3D8EA 5LONB 1I7AA 2R09A 2UVMA 1EAZA 4F7UP 2RUKB 2P0FA 4DBBA 1FOEA 4HDOA 3TW1A 4F7HA 1NU2A 4KVGB 2YRYA 5D3XA 4ZRJA 1MK9B 5EFXA 3QBVB 1DDWA 1OQNA 3DXCA 1DBHA 1P5TA 3VIAA 1I2HA 2MKRA 1ZM0A 5FI1A 1XR0B 5J3YA 3M1IB 5CLQB 2DTCA 2YT0A 5KQ1A 2Y8FA 2YT1A 1P3RA 5HE1A 5JHGA 5D27A 2GCLA 3AJ4A 3U8ZA 1WVHA 3UZTA 1PLSA 3PVUA 1KI1B 5JLJB 1W1DA 1U5FA 1UNRA 4HAZB 2EMSA 1KZ7A 3PVLA 1ZSQA 1BWNA 2J0JA 4KHOA 4HAWB 4P7IA 2M38A 1SGHA 1ISNA 1V88A 1U5GA 1H4RA 2CY4A 2MFQA 4XWXA 3ODOA 4PQ0A 5CLLB 2N0YA 1XODA 2DN6A 1ZC3B 2COAA 4IFSA 4HHVA 2R0DA 1BAKA 4MT7A 2GJYA 1UPQA 3N7CA 5HE0A 2M14A 3SUZA 2LULA 4HATB 2DHKA 2HE7A 1M7EA 1AQCA 4HAUB 1FHOA 2LYDA 4IOYX 2K00A 4ZRKA 1J19A 2NZ8B 4HAYB 4EKUA 1MKEA 5DIFB 3X23A 3KY9A 2L2IA 2I1JA 1MK7B 1AWEA 1B55A 2J0KA 2LKOA 3AU4A 2CODA 5DH9B 4GZUA 1MPHA 2K2UA 4CHMA 2P0HA 2D9XA 3P7ZA 2DHIA 2D11A 2COFA 4EMOA 4HDQA 2UZRA 4DXAB 2QKMA 4KAXB 5LOPB 2CY5A 2DFKA 2YS5A 4HB4B 3G9WA 5D3WA 1E5WA 2E2XA 1FB8A 1MIXA 3PSCA 2ADZA 2KGXB 1U5EA 1NTYA 2H7DA 1BTKA 1FGZA 2RSGA 3KZ1A 2DHJA 3ULCA 3O96A 3F5RA 2VKIA 4YONA 2LOZA 5D3YA 2ELBA 2Z0PA 1OY2A 2I1KA 5KCVA 1NI2A 2LG1A 3DXDA 4GN1A 2ZPYA 2YVCA 5C79A 1EGXA 1GC7A 4WSFA 5HE2A 1IRSA 2XQNM 4H8SA 4WJ7A 5JHHA 4IAPA 3FM8C 2J0MA 4CHJA 3A8QA 3SNHA 4C0AA 5KQ4A 1MIZB 5GOWB 2KCJA 3NSUA 2MDXA 3KRWA 1XKEA 1WG7A 2D9ZA 1EF1A 4TYZA 2N23A 3QIJA 1U29A 3ML4A 4D0NB 2FJLA 1QQGA 4K81A 2W2WA 1OMWA 1RJ2A 4F7GA 3FEHA 4K2OA 1UNQA 3ODWA 3KSYA 1X11A 3ZVRA 3CIKA 2GS0A 2L1CA 3IVFA 1MAIA 2GCJA 5C16A 1V5UA 4EJNA 1K5DB 4GPTB 4YL8A 1TXDA 4B6HA 4WVFB 5J3QA 4NY0A 4K2PA 2RVBB 1V5MA 1U2BA 1X1FA 1DYNA 4KHAA 2IFSA 2UZSA 1UNPA 3DXEA 3PG7A 2RNRB 5FI0A 2RLOA 3TFMA 2OQBA 2VSZA 3HK0A 4L6EA 3TCAA 1FAOA 1FHXA 3PP2A 1U5DA 2CRFA 2QKLA 1ZVRA 3GYOA 4A6KA 5DHAB 3V5WA 5HE3A 1DDMA 2ROZB 1NTVA 4Y94A 3RCPA 5C5BB 3BINA 4HB3B 3BJIA 3PEGA 4MK0A 3SO6A 1W1HA 2D2QA 2J59M 4HAVB 4K17A 4GMVA 1Y5OA 2JP2A 4A6FB 2Q13A 1DROA 1PFJA 4BBKA 1H10A 1GC6A 1WJMA 2Y7BA 2IYBA 2KUPA 3VOQA 2DYNA 2H7EA 3PZDA 4HB2B 3FSSA 3SYXA 2AEHA 3D8FA 3KRXA 2G35A 1X86A 2X18A 5D3VA 2W2XC 4KHBB 1GG3A 3HQCA 3A8PA 4NSWA 1UPRA 2V76A 5DHFB 4Z2NA 2ROVA 3U7DA 5C5BA 2YS1A 2P0DA 1SHCA 1FGYA 3TO1A 2RGNB 1M7RA 1DDVA 2I5FA 2Z0QA 2K2JA 2PZ1A 2DKPA 1Z87A 1V5PA 4MY6A 4CYEA 3T06A 1K5GB 3ZDTA 3PVWA 4A6FA 2DLWA 2D9YA 2COCA 1BTNA 2AL6A 1P6SA 3A98B 2W2XD 1WGQA 1XX0A 2HTHB 1W1GA 3ODXA 1ZC4B 1XD4A 5DI9B 1V89A 4ZRIA 1LW3A 1WJ1A 2D4QA 2DX5A 1U27A 1V61A 1KZGA 5J3TA 2D10A 1PMSA 2DX1A 3LJUX 3MPXA 1EVHA 1TQZA 4A5KA 2EJ8A 2YF0A 3TVVA 3WYFB 3HW2B 3SV1A 1X05A 4HAXB 2CAYA 2LOXA 2OTXA 2DA0A 3MDBC 1UEFA 1WI1A 3F0WA 4PNKA 1J0WA 1WGUA 4TKNA 3QWMA 2EMTA 4Z2MB 1TJ6A 5C6RA 4GXBA 2D9VA 2I5CA 4A6HA 2BCJA 3GYPA 1Q67A 2Z0OA 2NMBA 2YS3A 3AU5A 1Y19B 3D8DA 1QC6A 1X1GA 5JP4A 4DX90 2DKQA 3ULBA 1N3HA 3CXBB 5L81A 1XCGA 2DYQA 3P6AA
chains in the Genus database with same CATH superfamily
2ELAA 2Y8GA 3WA0A 4DX8A 2VRWB 2FJUB 4HB0B 2KIGA 1FHWA 2P8VA 2D9WA 2YSZA 1LB1A 2MWNB 4GMXB 3OANA 1RRPB 2EC1A 3D8EA 5LONB 3DCXA 1I7AA 2R09A 4OSNA 2UVMA 1EAZA 4F7UP 2RUKB 2P0FA 4DBBA 5M4YB 1FOEA 4HDOA 3TW1A 4F7HA 1NU2A 4KVGB 2YRYA 5D3XA 4ZRJA 1MK9B 5EFXA 3QBVB 1DDWA 1OQNA 3DXCA 1DBHA 1P5TA 3VIAA 1I2HA 2MKRA 1ZM0A 5FI1A 3HIEA 1XR0B 5J3YA 3M1IB 5CLQB 2DTCA 2ZKMX 2YT0A 5KQ1A 2Y8FA 2YT1A 2RRFA 1P3RA 5HE1A 5JHGA 5D27A 2GCLA 3AJ4A 3U8ZA 2K49A 1WVHA 3UZTA 1PLSA 3PVUA 1KI1B 5JLJB 1W1DA 1U5FA 1UNRA 4HAZB 2EMSA 1KZ7A 4GNKB 3PVLA 2Z59A 1ZSQA 1BWNA 2J0JA 4KHOA 4HAWB 4P7IA 2M38A 1SGHA 1ISNA 1V88A 1U5GA 1H4RA 2CY4A 2MFQA 4XWXA 3ODOA 4PQ0A 2K8EA 5CLLB 2N0YA 1XODA 2DN6A 1ZC3B 2COAA 4IFSA 4HHVA 2R0DA 4CSQA 1BAKA 4MT7A 2GJYA 1UPQA 3N7CA 5HE0A 2M14A 3SUZA 2LULA 4HATB 5I2MA 2DHKA 2HE7A 1M7EA 1AQCA 4HAUB 1FHOA 2LYDA 4IOYX 2K00A 4ZRKA 1J19A 2NZ8B 4HAYB 4EKUA 1MKEA 5DIFB 3X23A 3KY9A 2L2IA 2I1JA 1MK7B 1AWEA 1B55A 2J0KA 2LKOA 2Z4DA 3AU4A 2CODA 5DH9B 4GZUA 1MPHA 2K2UA 4CHMA 3NWAA 2P0HA 2D9XA 3P7ZA 2DHIA 2D11A 2COFA 4EMOA 5I2SA 4HDQA 2UZRA 4DXAB 2QKMA 4KAXB 5LOPB 2CY5A 2DFKA 2YS5A 4HB4B 3G9WA 5D3WA 1E5WA 2E2XA 1FB8A 1MIXA 3PSCA 2ADZA 2KGXB 1U5EA 2KIEA 1NTYA 2H7DA 1BTKA 4QXAB 1FGZA 2RSGA 3KZ1A 2DHJA 1ZYIA 4D6WA 3ULCA 3O96A 3F5RA 2VKIA 4YONA 2LOZA 5D3YA 3NWDA 2ELBA 2Z0PA 1OY2A 2I1KA 5KCVA 1NI2A 2LG1A 3DXDA 4GN1A 2ZPYA 2YVCA 5C79A 1EGXA 1GC7A 3OHMB 4WSFA 5HE2A 2R2YA 1IRSA 2XQNM 4H8SA 4WJ7A 5JHHA 3FVCA 4IAPA 3FM8C 2J0MA 4CHJA 3A8QA 3SNHA 4C0AA 5KQ4A 1MIZB 5GOWB 2KCJA 3NSUA 2MDXA 3KRWA 1XKEA 1WG7A 2D9ZA 3HSAA 1EF1A 2NBVA 4TYZA 2N23A 3QIJA 1U29A 3ML4A 4D0NB 2FJLA 1QQGA 4K81A 2W2WA 1OMWA 1RJ2A 4F7GA 3FEHA 4K2OA 1UNQA 3ODWA 3KSYA 1X11A 3ZVRA 3CIKA 2GS0A 2L1CA 3IVFA 1MAIA 2GCJA 5C16A 1V5UA 4EJNA 1K5DB 4GPTB 4YL8A 1TXDA 4B6HA 4WVFB 5J3QA 4NY0A 4K2PA 2RVBB 1V5MA 1U2BA 1X1FA 1DYNA 4KHAA 2IFSA 2UZSA 1UNPA 3DXEA 3PG7A 2RNRB 5FI0A 2RLOA 3TFMA 2OQBA 2VSZA 3HK0A 4L6EA 3TCAA 2KUQA 1FAOA 1FHXA 2Z14A 3PP2A 4L1RA 1U5DA 2CRFA 2QKLA 1ZVRA 3GYOA 4A6KA 5DHAB 3V5WA 5HE3A 1DDMA 2ROZB 1NTVA 4Y94A 3RCPA 5C5BB 3BINA 4HB3B 3BJIA 3PEGA 4MK0A 3SO6A 1W1HA 2D2QA 2J59M 4GOUA 4HAVB 4K17A 4DIXA 4GMVA 1Y5OA 1T77A 2JP2A 4A6FB 2Q13A 1DROA 1PFJA 4BBKA 1H10A 1GC6A 1WJMA 2Y7BA 2IYBA 2KUPA 3VOQA 2DYNA 2H7EA 3PZDA 4HB2B 2Z13A 3FSSA 3SYXA 2AEHA 5LG4B 3D8FA 3KRXA 2G35A 1X86A 2X18A 5D3VA 2W2XC 4KHBB 1GG3A 3HQCA 3A8PA 4NSWA 1UPRA 2V76A 4QJ4B 5DHFB 4Z2NA 2ROVA 3U7DA 5C5BA 2YS1A 2P0DA 1SHCA 1FGYA 3TO1A 2RGNB 1M7RA 1DDVA 2I5FA 2Z0QA 2K2JA 2PZ1A 2DKPA 4HSIA 1Z87A 1V5PA 4MY6A 4CYEA 3T06A 1K5GB 3ZDTA 3PVWA 4A6FA 2DLWA 2GUMA 2D9YA 2COCA 1BTNA 2AL6A 1P6SA 3A98B 2W2XD 1WGQA 1XX0A 2HTHB 1W1GA 3ODXA 3U12A 1ZC4B 1XD4A 5DI9B 1V89A 4ZRIA 1LW3A 1WJ1A 2D4QA 2DX5A 4KHBA 4QJ5B 3NWFA 2YT2A 1U27A 1V61A 1MI1A 1KZGA 5J3TA 2D10A 1PMSA 2DX1A 3LJUX 3MPXA 1EVHA 1TQZA 4A5KA 2EJ8A 2YF0A 3B77A 3TVVA 3WYFB 3HW2B 3SV1A 2KR0A 3NW8A 1X05A 4HAXB 2CAYA 4QJ3B 2LOXA 2OTXA 2DA0A 4OT1A 3MDBC 1UEFA 1WI1A 3F0WA 4PNKA 1J0WA 1WGUA 4TKNA 3QWMA 2EMTA 4Z2MB 1TJ6A 3A58A 5C6RA 4GXBA 2D9VA 2I5CA 4A6HA 2BCJA 3GYPA 1Q67A 2Z0OA 2NMBA 2YS3A 3AU5A 1Y19B 3D8DA 1QC6A 1X1GA 5JP4A 4DX90 2DKQA 3ULBA 1N3HA 3CXBB 5L81A 1XCGA 2DYQA 5IRSA 3P6AA
chains in the Genus database with same CATH topology
2ELAA 2Y8GA 3WA0A 4DX8A 2VRWB 4HB0B 1FHWA 2P8VA 2D9WA 2YSZA 1LB1A 2MWNB 4GMXB 3OANA 1RRPB 2EC1A 3D8EA 5LONB 1I7AA 2R09A 2UVMA 1EAZA 4F7UP 2RUKB 2P0FA 4DBBA 1FOEA 4HDOA 3TW1A 4F7HA 1NU2A 4KVGB 2YRYA 5D3XA 4ZRJA 1MK9B 5EFXA 3QBVB 1DDWA 1OQNA 3DXCA 1DBHA 1P5TA 3VIAA 1I2HA 2MKRA 1ZM0A 5FI1A 1XR0B 5J3YA 3M1IB 5CLQB 2DTCA 2YT0A 5KQ1A 2Y8FA 2YT1A 1P3RA 5HE1A 5JHGA 5D27A 2GCLA 3AJ4A 3U8ZA 1WVHA 3UZTA 1PLSA 3PVUA 1KI1B 5JLJB 1W1DA 1U5FA 1UNRA 4HAZB 2EMSA 1KZ7A 3PVLA 1ZSQA 1BWNA 2J0JA 4KHOA 4HAWB 4P7IA 2M38A 1SGHA 1ISNA 1V88A 1U5GA 1H4RA 2CY4A 2MFQA 4XWXA 3ODOA 4PQ0A 5CLLB 2N0YA 1XODA 2DN6A 1ZC3B 2COAA 4IFSA 4HHVA 2R0DA 1BAKA 4MT7A 2GJYA 1UPQA 3N7CA 5HE0A 2M14A 3SUZA 2LULA 4HATB 2DHKA 2HE7A 1M7EA 1AQCA 4HAUB 1FHOA 2LYDA 4IOYX 2K00A 4ZRKA 1J19A 2NZ8B 4HAYB 4EKUA 1MKEA 5DIFB 3X23A 3KY9A 2L2IA 2I1JA 1MK7B 1AWEA 1B55A 2J0KA 2LKOA 3AU4A 2CODA 5DH9B 4GZUA 1MPHA 2K2UA 4CHMA 2P0HA 2D9XA 3P7ZA 2DHIA 2D11A 2COFA 4EMOA 4HDQA 2UZRA 4DXAB 2QKMA 4KAXB 5LOPB 2CY5A 2DFKA 2YS5A 4HB4B 3G9WA 5D3WA 1E5WA 2E2XA 1FB8A 1MIXA 3PSCA 2ADZA 2KGXB 1U5EA 1NTYA 2H7DA 1BTKA 1FGZA 2RSGA 3KZ1A 2DHJA 3ULCA 3O96A 3F5RA 2VKIA 4YONA 2LOZA 5D3YA 2ELBA 2Z0PA 1OY2A 2I1KA 5KCVA 1NI2A 2LG1A 3DXDA 4GN1A 2ZPYA 2YVCA 5C79A 1EGXA 1GC7A 4WSFA 5HE2A 1IRSA 2XQNM 4H8SA 4WJ7A 5JHHA 4IAPA 3FM8C 2J0MA 4CHJA 3A8QA 3SNHA 4C0AA 5KQ4A 1MIZB 5GOWB 2KCJA 3NSUA 2MDXA 3KRWA 1XKEA 1WG7A 2D9ZA 1EF1A 4TYZA 2N23A 3QIJA 1U29A 3ML4A 4D0NB 2FJLA 1QQGA 4K81A 2W2WA 1OMWA 1RJ2A 4F7GA 3FEHA 4K2OA 1UNQA 3ODWA 3KSYA 1X11A 3ZVRA 3CIKA 2GS0A 2L1CA 3IVFA 1MAIA 2GCJA 5C16A 1V5UA 4EJNA 1K5DB 4GPTB 4YL8A 1TXDA 4B6HA 4WVFB 5J3QA 4NY0A 4K2PA 2RVBB 1V5MA 1U2BA 1X1FA 1DYNA 4KHAA 2IFSA 2UZSA 1UNPA 3DXEA 3PG7A 2RNRB 5FI0A 2RLOA 3TFMA 2OQBA 2VSZA 3HK0A 4L6EA 3TCAA 1FAOA 1FHXA 3PP2A 1U5DA 2CRFA 2QKLA 1ZVRA 3GYOA 4A6KA 5DHAB 3V5WA 5HE3A 1DDMA 2ROZB 1NTVA 4Y94A 3RCPA 5C5BB 3BINA 4HB3B 3BJIA 3PEGA 4MK0A 3SO6A 1W1HA 2D2QA 2J59M 4HAVB 4K17A 4GMVA 1Y5OA 2JP2A 4A6FB 2Q13A 1DROA 1PFJA 4BBKA 1H10A 1GC6A 1WJMA 2Y7BA 2IYBA 2KUPA 3VOQA 2DYNA 2H7EA 3PZDA 4HB2B 3FSSA 3SYXA 2AEHA 3D8FA 3KRXA 2G35A 1X86A 2X18A 5D3VA 2W2XC 4KHBB 1GG3A 3HQCA 3A8PA 4NSWA 1UPRA 2V76A 5DHFB 4Z2NA 2ROVA 3U7DA 5C5BA 2YS1A 2P0DA 1SHCA 1FGYA 3TO1A 2RGNB 1M7RA 1DDVA 2I5FA 2Z0QA 2K2JA 2PZ1A 2DKPA 1Z87A 1V5PA 4MY6A 4CYEA 3T06A 1K5GB 3ZDTA 3PVWA 4A6FA 2DLWA 2D9YA 2COCA 1BTNA 2AL6A 1P6SA 3A98B 2W2XD 1WGQA 1XX0A 2HTHB 1W1GA 3ODXA 1ZC4B 1XD4A 5DI9B 1V89A 4ZRIA 1LW3A 1WJ1A 2D4QA 2DX5A 1U27A 1V61A 1KZGA 5J3TA 2D10A 1PMSA 2DX1A 3LJUX 3MPXA 1EVHA 1TQZA 4A5KA 2EJ8A 2YF0A 3TVVA 3WYFB 3HW2B 3SV1A 1X05A 4HAXB 2CAYA 2LOXA 2OTXA 2DA0A 3MDBC 1UEFA 1WI1A 3F0WA 4PNKA 1J0WA 1WGUA 4TKNA 3QWMA 2EMTA 4Z2MB 1TJ6A 5C6RA 4GXBA 2D9VA 2I5CA 4A6HA 2BCJA 3GYPA 1Q67A 2Z0OA 2NMBA 2YS3A 3AU5A 1Y19B 3D8DA 1QC6A 1X1GA 5JP4A 4DX90 2DKQA 3ULBA 1N3HA 3CXBB 5L81A 1XCGA 2DYQA 3P6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELA A;  2Y8G A;  3WA0 A;  4DX8 A;  2VRW B;  4HB0 B;  1FHW A;  2P8V A;  2D9W A;  2YSZ A;  1LB1 A;  2MWN B;  4GMX B;  3OAN A;  1RRP B;  2EC1 A;  3D8E A;  5LON B;  1I7A A;  2R09 A;  2UVM A;  1EAZ A;  4F7U P;  2RUK B;  2P0F A;  4DBB A;  1FOE A;  4HDO A;  3TW1 A;  4F7H A;  1NU2 A;  4KVG B;  2YRY A;  5D3X A;  4ZRJ A;  1MK9 B;  5EFX A;  3QBV B;  1DDW A;  1OQN A;  3DXC A;  1DBH A;  1P5T A;  3VIA A;  1I2H A;  2MKR A;  1ZM0 A;  5FI1 A;  1XR0 B;  5J3Y A;  3M1I B;  5CLQ B;  2DTC A;  2YT0 A;  5KQ1 A;  2Y8F A;  2YT1 A;  1P3R A;  5HE1 A;  5JHG A;  5D27 A;  2GCL A;  3AJ4 A;  3U8Z A;  1WVH A;  3UZT A;  1PLS A;  3PVU A;  1KI1 B;  5JLJ B;  1W1D A;  1U5F A;  1UNR A;  4HAZ B;  2EMS A;  1KZ7 A;  3PVL A;  1ZSQ A;  1BWN A;  2J0J A;  4KHO A;  4HAW B;  4P7I A;  2M38 A;  1SGH A;  1ISN A;  1V88 A;  1U5G A;  1H4R A;  2CY4 A;  2MFQ A;  4XWX A;  3ODO A;  4PQ0 A;  5CLL B;  2N0Y A;  1XOD A;  2DN6 A;  1ZC3 B;  2COA A;  4IFS A;  4HHV A;  2R0D A;  1BAK A;  4MT7 A;  2GJY A;  1UPQ A;  3N7C A;  5HE0 A;  2M14 A;  3SUZ A;  2LUL A;  4HAT B;  2DHK A;  2HE7 A;  1M7E A;  1AQC A;  4HAU B;  1FHO A;  2LYD A;  4IOY X;  2K00 A;  4ZRK A;  1J19 A;  2NZ8 B;  4HAY B;  4EKU A;  1MKE A;  5DIF B;  3X23 A;  3KY9 A;  2L2I A;  2I1J A;  1MK7 B;  1AWE A;  1B55 A;  2J0K A;  2LKO A;  3AU4 A;  2COD A;  5DH9 B;  4GZU A;  1MPH A;  2K2U A;  4CHM A;  2P0H A;  2D9X A;  3P7Z A;  2DHI A;  2D11 A;  2COF A;  4EMO A;  4HDQ A;  2UZR A;  4DXA B;  2QKM A;  4KAX B;  5LOP B;  2CY5 A;  2DFK A;  2YS5 A;  4HB4 B;  3G9W A;  5D3W A;  1E5W A;  2E2X A;  1FB8 A;  1MIX A;  3PSC A;  2ADZ A;  2KGX B;  1U5E A;  1NTY A;  2H7D A;  1BTK A;  1FGZ A;  2RSG A;  3KZ1 A;  2DHJ A;  3ULC A;  3O96 A;  3F5R A;  2VKI A;  4YON A;  2LOZ A;  5D3Y A;  2ELB A;  2Z0P A;  1OY2 A;  2I1K A;  5KCV A;  1NI2 A;  2LG1 A;  3DXD A;  4GN1 A;  2ZPY A;  2YVC A;  5C79 A;  1EGX A;  1GC7 A;  4WSF A;  5HE2 A;  1IRS A;  2XQN M;  4H8S A;  4WJ7 A;  5JHH A;  4IAP A;  3FM8 C;  2J0M A;  4CHJ A;  3A8Q A;  3SNH A;  4C0A A;  5KQ4 A;  1MIZ B;  5GOW B;  2KCJ A;  3NSU A;  2MDX A;  3KRW A;  1XKE A;  1WG7 A;  2D9Z A;  1EF1 A;  4TYZ A;  2N23 A;  3QIJ A;  1U29 A;  3ML4 A;  4D0N B;  2FJL A;  1QQG A;  4K81 A;  2W2W A;  1OMW A;  1RJ2 A;  4F7G A;  3FEH A;  4K2O A;  1UNQ A;  3ODW A;  3KSY A;  1X11 A;  3ZVR A;  3CIK A;  2GS0 A;  2L1C A;  3IVF A;  1MAI A;  2GCJ A;  5C16 A;  1V5U A;  4EJN A;  1K5D B;  4GPT B;  4YL8 A;  1TXD A;  4B6H A;  4WVF B;  5J3Q A;  4NY0 A;  4K2P A;  2RVB B;  1V5M A;  1U2B A;  1X1F A;  1DYN A;  4KHA A;  2IFS A;  2UZS A;  1UNP A;  3DXE A;  3PG7 A;  2RNR B;  5FI0 A;  2RLO A;  3TFM A;  2OQB A;  2VSZ A;  3HK0 A;  4L6E A;  3TCA A;  1FAO A;  1FHX A;  3PP2 A;  1U5D A;  2CRF A;  2QKL A;  1ZVR A;  3GYO A;  4A6K A;  5DHA B;  3V5W A;  5HE3 A;  1DDM A;  2ROZ B;  1NTV A;  4Y94 A;  3RCP A;  5C5B B;  3BIN A;  4HB3 B;  3BJI A;  3PEG A;  4MK0 A;  3SO6 A;  1W1H A;  2D2Q A;  2J59 M;  4HAV B;  4K17 A;  4GMV A;  1Y5O A;  2JP2 A;  4A6F B;  2Q13 A;  1DRO A;  1PFJ A;  4BBK A;  1H10 A;  1GC6 A;  1WJM A;  2Y7B A;  2IYB A;  2KUP A;  3VOQ A;  2DYN A;  2H7E A;  3PZD A;  4HB2 B;  3FSS A;  3SYX A;  2AEH A;  3D8F A;  3KRX A;  2G35 A;  1X86 A;  2X18 A;  5D3V A;  2W2X C;  4KHB B;  1GG3 A;  3HQC A;  3A8P A;  4NSW A;  1UPR A;  2V76 A;  5DHF B;  4Z2N A;  2ROV A;  3U7D A;  5C5B A;  2YS1 A;  2P0D A;  1SHC A;  1FGY A;  3TO1 A;  2RGN B;  1M7R A;  1DDV A;  2I5F A;  2Z0Q A;  2K2J A;  2PZ1 A;  2DKP A;  1Z87 A;  1V5P A;  4MY6 A;  4CYE A;  3T06 A;  1K5G B;  3ZDT A;  3PVW A;  4A6F A;  2DLW A;  2D9Y A;  2COC A;  1BTN A;  2AL6 A;  1P6S A;  3A98 B;  2W2X D;  1WGQ A;  1XX0 A;  2HTH B;  1W1G A;  3ODX A;  1ZC4 B;  1XD4 A;  5DI9 B;  1V89 A;  4ZRI A;  1LW3 A;  1WJ1 A;  2D4Q A;  2DX5 A;  1U27 A;  1V61 A;  1KZG A;  5J3T A;  2D10 A;  1PMS A;  2DX1 A;  3LJU X;  3MPX A;  1EVH A;  1TQZ A;  4A5K A;  2EJ8 A;  2YF0 A;  3TVV A;  3WYF B;  3HW2 B;  3SV1 A;  1X05 A;  4HAX B;  2CAY A;  2LOX A;  2OTX A;  2DA0 A;  3MDB C;  1UEF A;  1WI1 A;  3F0W A;  4PNK A;  1J0W A;  1WGU A;  4TKN A;  3QWM A;  2EMT A;  4Z2M B;  1TJ6 A;  5C6R A;  4GXB A;  2D9V A;  2I5C A;  4A6H A;  2BCJ A;  3GYP A;  1Q67 A;  2Z0O A;  2NMB A;  2YS3 A;  3AU5 A;  1Y19 B;  3D8D A;  1QC6 A;  1X1G A;  5JP4 A;  4DX9 0;  2DKQ A;  3ULB A;  1N3H A;  3CXB B;  5L81 A;  1XCG A;  2DYQ A;  3P6A A; 
#chains in the Genus database with same CATH topology
 2ELA A;  2Y8G A;  3WA0 A;  4DX8 A;  2VRW B;  2FJU B;  4HB0 B;  2KIG A;  1FHW A;  2P8V A;  2D9W A;  2YSZ A;  1LB1 A;  2MWN B;  4GMX B;  3OAN A;  1RRP B;  2EC1 A;  3D8E A;  5LON B;  3DCX A;  1I7A A;  2R09 A;  4OSN A;  2UVM A;  1EAZ A;  4F7U P;  2RUK B;  2P0F A;  4DBB A;  5M4Y B;  1FOE A;  4HDO A;  3TW1 A;  4F7H A;  1NU2 A;  4KVG B;  2YRY A;  5D3X A;  4ZRJ A;  1MK9 B;  5EFX A;  3QBV B;  1DDW A;  1OQN A;  3DXC A;  1DBH A;  1P5T A;  3VIA A;  1I2H A;  2MKR A;  1ZM0 A;  5FI1 A;  3HIE A;  1XR0 B;  5J3Y A;  3M1I B;  5CLQ B;  2DTC A;  2ZKM X;  2YT0 A;  5KQ1 A;  2Y8F A;  2YT1 A;  2RRF A;  1P3R A;  5HE1 A;  5JHG A;  5D27 A;  2GCL A;  3AJ4 A;  3U8Z A;  2K49 A;  1WVH A;  3UZT A;  1PLS A;  3PVU A;  1KI1 B;  5JLJ B;  1W1D A;  1U5F A;  1UNR A;  4HAZ B;  2EMS A;  1KZ7 A;  4GNK B;  3PVL A;  2Z59 A;  1ZSQ A;  1BWN A;  2J0J A;  4KHO A;  4HAW B;  4P7I A;  2M38 A;  1SGH A;  1ISN A;  1V88 A;  1U5G A;  1H4R A;  2CY4 A;  2MFQ A;  4XWX A;  3ODO A;  4PQ0 A;  2K8E A;  5CLL B;  2N0Y A;  1XOD A;  2DN6 A;  1ZC3 B;  2COA A;  4IFS A;  4HHV A;  2R0D A;  4CSQ A;  1BAK A;  4MT7 A;  2GJY A;  1UPQ A;  3N7C A;  5HE0 A;  2M14 A;  3SUZ A;  2LUL A;  4HAT B;  5I2M A;  2DHK A;  2HE7 A;  1M7E A;  1AQC A;  4HAU B;  1FHO A;  2LYD A;  4IOY X;  2K00 A;  4ZRK A;  1J19 A;  2NZ8 B;  4HAY B;  4EKU A;  1MKE A;  5DIF B;  3X23 A;  3KY9 A;  2L2I A;  2I1J A;  1MK7 B;  1AWE A;  1B55 A;  2J0K A;  2LKO A;  2Z4D A;  3AU4 A;  2COD A;  5DH9 B;  4GZU A;  1MPH A;  2K2U A;  4CHM A;  3NWA A;  2P0H A;  2D9X A;  3P7Z A;  2DHI A;  2D11 A;  2COF A;  4EMO A;  5I2S A;  4HDQ A;  2UZR A;  4DXA B;  2QKM A;  4KAX B;  5LOP B;  2CY5 A;  2DFK A;  2YS5 A;  4HB4 B;  3G9W A;  5D3W A;  1E5W A;  2E2X A;  1FB8 A;  1MIX A;  3PSC A;  2ADZ A;  2KGX B;  1U5E A;  2KIE A;  1NTY A;  2H7D A;  1BTK A;  4QXA B;  1FGZ A;  2RSG A;  3KZ1 A;  2DHJ A;  1ZYI A;  4D6W A;  3ULC A;  3O96 A;  3F5R A;  2VKI A;  4YON A;  2LOZ A;  5D3Y A;  3NWD A;  2ELB A;  2Z0P A;  1OY2 A;  2I1K A;  5KCV A;  1NI2 A;  2LG1 A;  3DXD A;  4GN1 A;  2ZPY A;  2YVC A;  5C79 A;  1EGX A;  1GC7 A;  3OHM B;  4WSF A;  5HE2 A;  2R2Y A;  1IRS A;  2XQN M;  4H8S A;  4WJ7 A;  5JHH A;  3FVC A;  4IAP A;  3FM8 C;  2J0M A;  4CHJ A;  3A8Q A;  3SNH A;  4C0A A;  5KQ4 A;  1MIZ B;  5GOW B;  2KCJ A;  3NSU A;  2MDX A;  3KRW A;  1XKE A;  1WG7 A;  2D9Z A;  3HSA A;  1EF1 A;  2NBV A;  4TYZ A;  2N23 A;  3QIJ A;  1U29 A;  3ML4 A;  4D0N B;  2FJL A;  1QQG A;  4K81 A;  2W2W A;  1OMW A;  1RJ2 A;  4F7G A;  3FEH A;  4K2O A;  1UNQ A;  3ODW A;  3KSY A;  1X11 A;  3ZVR A;  3CIK A;  2GS0 A;  2L1C A;  3IVF A;  1MAI A;  2GCJ A;  5C16 A;  1V5U A;  4EJN A;  1K5D B;  4GPT B;  4YL8 A;  1TXD A;  4B6H A;  4WVF B;  5J3Q A;  4NY0 A;  4K2P A;  2RVB B;  1V5M A;  1U2B A;  1X1F A;  1DYN A;  4KHA A;  2IFS A;  2UZS A;  1UNP A;  3DXE A;  3PG7 A;  2RNR B;  5FI0 A;  2RLO A;  3TFM A;  2OQB A;  2VSZ A;  3HK0 A;  4L6E A;  3TCA A;  2KUQ A;  1FAO A;  1FHX A;  2Z14 A;  3PP2 A;  4L1R A;  1U5D A;  2CRF A;  2QKL A;  1ZVR A;  3GYO A;  4A6K A;  5DHA B;  3V5W A;  5HE3 A;  1DDM A;  2ROZ B;  1NTV A;  4Y94 A;  3RCP A;  5C5B B;  3BIN A;  4HB3 B;  3BJI A;  3PEG A;  4MK0 A;  3SO6 A;  1W1H A;  2D2Q A;  2J59 M;  4GOU A;  4HAV B;  4K17 A;  4DIX A;  4GMV A;  1Y5O A;  1T77 A;  2JP2 A;  4A6F B;  2Q13 A;  1DRO A;  1PFJ A;  4BBK A;  1H10 A;  1GC6 A;  1WJM A;  2Y7B A;  2IYB A;  2KUP A;  3VOQ A;  2DYN A;  2H7E A;  3PZD A;  4HB2 B;  2Z13 A;  3FSS A;  3SYX A;  2AEH A;  5LG4 B;  3D8F A;  3KRX A;  2G35 A;  1X86 A;  2X18 A;  5D3V A;  2W2X C;  4KHB B;  1GG3 A;  3HQC A;  3A8P A;  4NSW A;  1UPR A;  2V76 A;  4QJ4 B;  5DHF B;  4Z2N A;  2ROV A;  3U7D A;  5C5B A;  2YS1 A;  2P0D A;  1SHC A;  1FGY A;  3TO1 A;  2RGN B;  1M7R A;  1DDV A;  2I5F A;  2Z0Q A;  2K2J A;  2PZ1 A;  2DKP A;  4HSI A;  1Z87 A;  1V5P A;  4MY6 A;  4CYE A;  3T06 A;  1K5G B;  3ZDT A;  3PVW A;  4A6F A;  2DLW A;  2GUM A;  2D9Y A;  2COC A;  1BTN A;  2AL6 A;  1P6S A;  3A98 B;  2W2X D;  1WGQ A;  1XX0 A;  2HTH B;  1W1G A;  3ODX A;  3U12 A;  1ZC4 B;  1XD4 A;  5DI9 B;  1V89 A;  4ZRI A;  1LW3 A;  1WJ1 A;  2D4Q A;  2DX5 A;  4KHB A;  4QJ5 B;  3NWF A;  2YT2 A;  1U27 A;  1V61 A;  1MI1 A;  1KZG A;  5J3T A;  2D10 A;  1PMS A;  2DX1 A;  3LJU X;  3MPX A;  1EVH A;  1TQZ A;  4A5K A;  2EJ8 A;  2YF0 A;  3B77 A;  3TVV A;  3WYF B;  3HW2 B;  3SV1 A;  2KR0 A;  3NW8 A;  1X05 A;  4HAX B;  2CAY A;  4QJ3 B;  2LOX A;  2OTX A;  2DA0 A;  4OT1 A;  3MDB C;  1UEF A;  1WI1 A;  3F0W A;  4PNK A;  1J0W A;  1WGU A;  4TKN A;  3QWM A;  2EMT A;  4Z2M B;  1TJ6 A;  3A58 A;  5C6R A;  4GXB A;  2D9V A;  2I5C A;  4A6H A;  2BCJ A;  3GYP A;  1Q67 A;  2Z0O A;  2NMB A;  2YS3 A;  3AU5 A;  1Y19 B;  3D8D A;  1QC6 A;  1X1G A;  5JP4 A;  4DX9 0;  2DKQ A;  3ULB A;  1N3H A;  3CXB B;  5L81 A;  1XCG A;  2DYQ A;  5IRS A;  3P6A A; 
#chains in the Genus database with same CATH homology
 2ELA A;  2Y8G A;  3WA0 A;  4DX8 A;  2VRW B;  4HB0 B;  1FHW A;  2P8V A;  2D9W A;  2YSZ A;  1LB1 A;  2MWN B;  4GMX B;  3OAN A;  1RRP B;  2EC1 A;  3D8E A;  5LON B;  1I7A A;  2R09 A;  2UVM A;  1EAZ A;  4F7U P;  2RUK B;  2P0F A;  4DBB A;  1FOE A;  4HDO A;  3TW1 A;  4F7H A;  1NU2 A;  4KVG B;  2YRY A;  5D3X A;  4ZRJ A;  1MK9 B;  5EFX A;  3QBV B;  1DDW A;  1OQN A;  3DXC A;  1DBH A;  1P5T A;  3VIA A;  1I2H A;  2MKR A;  1ZM0 A;  5FI1 A;  1XR0 B;  5J3Y A;  3M1I B;  5CLQ B;  2DTC A;  2YT0 A;  5KQ1 A;  2Y8F A;  2YT1 A;  1P3R A;  5HE1 A;  5JHG A;  5D27 A;  2GCL A;  3AJ4 A;  3U8Z A;  1WVH A;  3UZT A;  1PLS A;  3PVU A;  1KI1 B;  5JLJ B;  1W1D A;  1U5F A;  1UNR A;  4HAZ B;  2EMS A;  1KZ7 A;  3PVL A;  1ZSQ A;  1BWN A;  2J0J A;  4KHO A;  4HAW B;  4P7I A;  2M38 A;  1SGH A;  1ISN A;  1V88 A;  1U5G A;  1H4R A;  2CY4 A;  2MFQ A;  4XWX A;  3ODO A;  4PQ0 A;  5CLL B;  2N0Y A;  1XOD A;  2DN6 A;  1ZC3 B;  2COA A;  4IFS A;  4HHV A;  2R0D A;  1BAK A;  4MT7 A;  2GJY A;  1UPQ A;  3N7C A;  5HE0 A;  2M14 A;  3SUZ A;  2LUL A;  4HAT B;  2DHK A;  2HE7 A;  1M7E A;  1AQC A;  4HAU B;  1FHO A;  2LYD A;  4IOY X;  2K00 A;  4ZRK A;  1J19 A;  2NZ8 B;  4HAY B;  4EKU A;  1MKE A;  5DIF B;  3X23 A;  3KY9 A;  2L2I A;  2I1J A;  1MK7 B;  1AWE A;  1B55 A;  2J0K A;  2LKO A;  3AU4 A;  2COD A;  5DH9 B;  4GZU A;  1MPH A;  2K2U A;  4CHM A;  2P0H A;  2D9X A;  3P7Z A;  2DHI A;  2D11 A;  2COF A;  4EMO A;  4HDQ A;  2UZR A;  4DXA B;  2QKM A;  4KAX B;  5LOP B;  2CY5 A;  2DFK A;  2YS5 A;  4HB4 B;  3G9W A;  5D3W A;  1E5W A;  2E2X A;  1FB8 A;  1MIX A;  3PSC A;  2ADZ A;  2KGX B;  1U5E A;  1NTY A;  2H7D A;  1BTK A;  1FGZ A;  2RSG A;  3KZ1 A;  2DHJ A;  3ULC A;  3O96 A;  3F5R A;  2VKI A;  4YON A;  2LOZ A;  5D3Y A;  2ELB A;  2Z0P A;  1OY2 A;  2I1K A;  5KCV A;  1NI2 A;  2LG1 A;  3DXD A;  4GN1 A;  2ZPY A;  2YVC A;  5C79 A;  1EGX A;  1GC7 A;  4WSF A;  5HE2 A;  1IRS A;  2XQN M;  4H8S A;  4WJ7 A;  5JHH A;  4IAP A;  3FM8 C;  2J0M A;  4CHJ A;  3A8Q A;  3SNH A;  4C0A A;  5KQ4 A;  1MIZ B;  5GOW B;  2KCJ A;  3NSU A;  2MDX A;  3KRW A;  1XKE A;  1WG7 A;  2D9Z A;  1EF1 A;  4TYZ A;  2N23 A;  3QIJ A;  1U29 A;  3ML4 A;  4D0N B;  2FJL A;  1QQG A;  4K81 A;  2W2W A;  1OMW A;  1RJ2 A;  4F7G A;  3FEH A;  4K2O A;  1UNQ A;  3ODW A;  3KSY A;  1X11 A;  3ZVR A;  3CIK A;  2GS0 A;  2L1C A;  3IVF A;  1MAI A;  2GCJ A;  5C16 A;  1V5U A;  4EJN A;  1K5D B;  4GPT B;  4YL8 A;  1TXD A;  4B6H A;  4WVF B;  5J3Q A;  4NY0 A;  4K2P A;  2RVB B;  1V5M A;  1U2B A;  1X1F A;  1DYN A;  4KHA A;  2IFS A;  2UZS A;  1UNP A;  3DXE A;  3PG7 A;  2RNR B;  5FI0 A;  2RLO A;  3TFM A;  2OQB A;  2VSZ A;  3HK0 A;  4L6E A;  3TCA A;  1FAO A;  1FHX A;  3PP2 A;  1U5D A;  2CRF A;  2QKL A;  1ZVR A;  3GYO A;  4A6K A;  5DHA B;  3V5W A;  5HE3 A;  1DDM A;  2ROZ B;  1NTV A;  4Y94 A;  3RCP A;  5C5B B;  3BIN A;  4HB3 B;  3BJI A;  3PEG A;  4MK0 A;  3SO6 A;  1W1H A;  2D2Q A;  2J59 M;  4HAV B;  4K17 A;  4GMV A;  1Y5O A;  2JP2 A;  4A6F B;  2Q13 A;  1DRO A;  1PFJ A;  4BBK A;  1H10 A;  1GC6 A;  1WJM A;  2Y7B A;  2IYB A;  2KUP A;  3VOQ A;  2DYN A;  2H7E A;  3PZD A;  4HB2 B;  3FSS A;  3SYX A;  2AEH A;  3D8F A;  3KRX A;  2G35 A;  1X86 A;  2X18 A;  5D3V A;  2W2X C;  4KHB B;  1GG3 A;  3HQC A;  3A8P A;  4NSW A;  1UPR A;  2V76 A;  5DHF B;  4Z2N A;  2ROV A;  3U7D A;  5C5B A;  2YS1 A;  2P0D A;  1SHC A;  1FGY A;  3TO1 A;  2RGN B;  1M7R A;  1DDV A;  2I5F A;  2Z0Q A;  2K2J A;  2PZ1 A;  2DKP A;  1Z87 A;  1V5P A;  4MY6 A;  4CYE A;  3T06 A;  1K5G B;  3ZDT A;  3PVW A;  4A6F A;  2DLW A;  2D9Y A;  2COC A;  1BTN A;  2AL6 A;  1P6S A;  3A98 B;  2W2X D;  1WGQ A;  1XX0 A;  2HTH B;  1W1G A;  3ODX A;  1ZC4 B;  1XD4 A;  5DI9 B;  1V89 A;  4ZRI A;  1LW3 A;  1WJ1 A;  2D4Q A;  2DX5 A;  1U27 A;  1V61 A;  1KZG A;  5J3T A;  2D10 A;  1PMS A;  2DX1 A;  3LJU X;  3MPX A;  1EVH A;  1TQZ A;  4A5K A;  2EJ8 A;  2YF0 A;  3TVV A;  3WYF B;  3HW2 B;  3SV1 A;  1X05 A;  4HAX B;  2CAY A;  2LOX A;  2OTX A;  2DA0 A;  3MDB C;  1UEF A;  1WI1 A;  3F0W A;  4PNK A;  1J0W A;  1WGU A;  4TKN A;  3QWM A;  2EMT A;  4Z2M B;  1TJ6 A;  5C6R A;  4GXB A;  2D9V A;  2I5C A;  4A6H A;  2BCJ A;  3GYP A;  1Q67 A;  2Z0O A;  2NMB A;  2YS3 A;  3AU5 A;  1Y19 B;  3D8D A;  1QC6 A;  1X1G A;  5JP4 A;  4DX9 0;  2DKQ A;  3ULB A;  1N3H A;  3CXB B;  5L81 A;  1XCG A;  2DYQ A;  3P6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...