5KQ4A

Crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2 and synthetic cap analog
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
124
structure length
124
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA-decapping enzyme subunit 1
publication title Structural basis of mRNA-cap recognition by Dcp1-Dcp2.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
molecule tags Hydrolase
total genus 32
structure length 124
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kq4A00
1XX0A 2NZ8B 4K17A 2ELBA 2CY4A 1X05A 2RGNB 1H4RA 2ZPYA 2D9VA 2YT0A 4GZUA 4IAPA 1QC6A 2YVCA 4L6EA 2EC1A 4Z2MB 1P5TA 3TCAA 1OY2A 3QBVB 1UNPA 2DYQA 2J59M 3KRXA 4IOYX 3SNHA 1X11A 3VIAA 2J0MA 1DYNA 4EJNA 2DX5A 2H7DA 5DHAB 2FJLA 2P0FA 1GC6A 4DBBA 2P8VA 1EF1A 3HW2B 3QIJA 2XQNM 3ULBA 2MFQA 5D3YA 1DROA 2CRFA 1PLSA 2AL6A 5J3YA 2YSZA 2MWNB 2KGXB 3ZDTA 1J19A 1WI1A 1OQNA 3KZ1A 1GG3A 4EKUA 4KHOA 3VOQA 1ZC4B 2ADZA 1N3HA 4P7IA 4GPTB 3D8DA 2RUKB 2CY5A 2Z0QA 3F5RA 5KCVA 2P0HA 4HAUB 2Z0OA 4A6FB 3DXCA 2HTHB 4DX8A 5C5BB 3TW1A 4WSFA 4HHVA 4B6HA 4HB0B 2GCLA 2RNRB 4KHBB 1NI2A 2G35A 2YRYA 3DXDA 1XKEA 1U5FA 1BWNA 4TKNA 2MDXA 1UPQA 2KUPA 2EMTA 3AJ4A 2GCJA 2DHJA 4ZRJA 2D4QA 1ZVRA 1FHXA 5JLJB 3GYOA 4WJ7A 4CHJA 5L81A 1U5GA 4ZRIA 5EFXA 2K00A 4Y94A 1P6SA 2Y7BA 4MT7A 2D10A 3DXEA 3N7CA 1KI1B 1WJMA 4HAYB 3V5WA 2LYDA 4KVGB 1WGUA 2D11A 1RRPB 2UZSA 2COCA 3TVVA 5D3VA 1UNRA 2IYBA 2UVMA 2UZRA 2I1JA 1UPRA 2DKQA 1AQCA 5HE2A 1J0WA 3IVFA 3HQCA 3A98B 3AU4A 3MPXA 2QKMA 2R0DA 5GOWB 4PNKA 1UEFA 3PVWA 2Y8FA 1WGQA 1KZGA 2LULA 1NU2A 3U8ZA 5HE0A 2CAYA 2DHIA 2LOZA 3KRWA 1AWEA 1MIZB 3D8FA 2I5FA 3ML4A 1V61A 1SGHA 1KZ7A 4CHMA 2P0DA 5LOPB 2YT1A 4HB3B 1MIXA 3PG7A 1LW3A 1U27A 4GN1A 5J3TA 1X1FA 2D9WA 5HE1A 3A8PA 5CLQB 2GS0A 5DIFB 3MDBC 2YS3A 1M7RA 3SUZA 1DBHA 1FGZA 1W1HA 4GMXB 1XR0B 3BINA 1MPHA 1U5EA 1WJ1A 1IRSA 1FHOA 3KSYA 1OMWA 3ODXA 1V5MA 3T06A 4IFSA 1E5WA 2Y8GA 4YL8A 2CODA 5JHGA 5JP4A 2OTXA 3ULCA 2EJ8A 5C6RA 2EMSA 1WVHA 4MK0A 4A5KA 1Y19B 4A6HA 1ZM0A 1K5GB 4HDOA 3HK0A 3FSSA 2W2XD 3ZVRA 4EMOA 2HE7A 2LOXA 1RJ2A 1BTKA 4ZRKA 1MK7B 1Q67A 1W1GA 2YS1A 2NMBA 2VSZA 2DX1A 5C16A 3M1IB 3WYFB 1Z87A 2J0KA 4K2PA 2W2XC 2GJYA 2KCJA 2N23A 1V88A 2I5CA 3U7DA 4H8SA 1H10A 1QQGA 2BCJA 2DKPA 2E2XA 3ODOA 3OANA 1B55A 4DXAB 2DTCA 1V89A 3AU5A 2Z0PA 1MKEA 1X86A 5LONB 1U5DA 3F0WA 2D9YA 1DDWA 1FAOA 1U2BA 2V76A 3CXBB 3LJUX 1FHWA 2W2WA 3P7ZA 1TQZA 1Y5OA 2AEHA 1GC7A 3CIKA 3X23A 3SV1A 4NY0A 5JHHA 4NSWA 3BJIA 2PZ1A 5D3WA 1P3RA 2VKIA 4HAWB 4TYZA 3PSCA 5DI9B 4A6KA 5FI1A 1BTNA 1V5UA 4HDQA 4CYEA 1PMSA 1FOEA 1DDMA 4HAXB 2QKLA 3GYPA 4K81A 3P6AA 2ROVA 3G9WA 4WVFB 4HATB 1NTYA 3UZTA 3NSUA 1PFJA 2ROZB 2COAA 1WG7A 5FI0A 2COFA 4HB2B 5C79A 3PVUA 4F7UP 1XD4A 1XCGA 4K2OA 1EGXA 4D0NB 2MKRA 1X1GA 3ODWA 2LG1A 2J0JA 3FEHA 1K5DB 5D27A 4HAZB 4BBKA 1MAIA 4F7HA 2YF0A 4GMVA 3KY9A 1I7AA 2IFSA 5CLLB 1FGYA 2OQBA 3D8EA 4F7GA 1TJ6A 3QWMA 4GXBA 2D9XA 4C0AA 3TO1A 5DH9B 3TFMA 1ZC3B 2D2QA 4DX90 2ELAA 4PQ0A 3O96A 5J3QA 1SHCA 1LB1A 2K2UA 3PVLA 2X18A 2RVBB 2K2JA 2D9ZA 2M38A 3A8QA 2I1KA 3PZDA 2RLOA 2VRWB 2DFKA 2L1CA 2DYNA 2N0YA 1XODA 2R09A 5DHFB 1M7EA 5HE3A 5D3XA 1V5PA 3PP2A 1U29A 1DDVA 3SYXA 2LKOA 1EAZA 2YS5A 2DA0A 1UNQA 1BAKA 3WA0A 5KQ4A 1I2HA 2RSGA 2DLWA 5KQ1A 1TXDA 4A6FA 4HB4B 2L2IA 2Q13A 3RCPA 1ZSQA 2DN6A 3FM8C 3SO6A 2JP2A 2H7EA 5C5BA 1FB8A 2DHKA 4HAVB 4MY6A 1MK9B 2M14A 4KHAA 4XWXA 4KAXB 1W1DA 4Z2NA 1ISNA 4YONA 3PEGA 1EVHA 1NTVA
chains in the Genus database with same CATH superfamily
1XX0A 2NZ8B 4K17A 2ELBA 2CY4A 1X05A 2RGNB 1H4RA 2ZPYA 4QXAB 2D9VA 2YT0A 4GZUA 4IAPA 1QC6A 2YVCA 4L6EA 2EC1A 4Z2MB 1P5TA 3TCAA 1OY2A 3QBVB 1UNPA 2DYQA 2K8EA 2J59M 3KRXA 4IOYX 3SNHA 3NW8A 1X11A 3VIAA 2J0MA 1DYNA 4EJNA 2DX5A 2H7DA 5DHAB 2FJLA 2P0FA 1GC6A 5LG4B 4DBBA 2P8VA 1EF1A 3HW2B 3QIJA 2XQNM 3ULBA 2Z59A 2MFQA 5D3YA 1DROA 2CRFA 1PLSA 2AL6A 5J3YA 2YSZA 2MWNB 2KGXB 3ZDTA 1J19A 1WI1A 1OQNA 3KZ1A 1GG3A 4EKUA 4KHOA 3VOQA 1ZC4B 2ADZA 1N3HA 4P7IA 4GPTB 3D8DA 2RUKB 2CY5A 2Z0QA 3F5RA 5KCVA 2P0HA 4HAUB 2Z0OA 4A6FB 3DXCA 2HTHB 4DX8A 3U12A 5C5BB 3TW1A 2GUMA 4WSFA 4HHVA 4B6HA 4OSNA 4HB0B 2GCLA 2RNRB 4KHBB 1NI2A 2G35A 2YRYA 2KUQA 3DXDA 1XKEA 1U5FA 1BWNA 4TKNA 2MDXA 3OHMB 1UPQA 5I2MA 5IRSA 2KUPA 2EMTA 3AJ4A 2GCJA 2DHJA 4ZRJA 2D4QA 1ZVRA 1FHXA 3B77A 5JLJB 3GYOA 4WJ7A 4CHJA 5L81A 1U5GA 4ZRIA 5EFXA 2K00A 4Y94A 1P6SA 2Y7BA 4MT7A 1MI1A 2D10A 3DXEA 3N7CA 1KI1B 1WJMA 4HAYB 3V5WA 2LYDA 4KVGB 2FJUB 4DIXA 1WGUA 2D11A 1RRPB 2UZSA 1T77A 4GNKB 2COCA 3TVVA 5D3VA 5M4YB 1UNRA 2IYBA 2UVMA 2KIGA 2I1JA 2UZRA 1UPRA 2DKQA 1AQCA 5HE2A 1J0WA 3IVFA 3HQCA 3DCXA 3A98B 3AU4A 3MPXA 2R0DA 2QKMA 5GOWB 2NBVA 1UEFA 4PNKA 5I2SA 3PVWA 2Y8FA 1WGQA 1KZGA 2LULA 1NU2A 3U8ZA 5HE0A 2CAYA 2DHIA 2LOZA 3KRWA 1AWEA 1MIZB 3D8FA 2I5FA 3ML4A 1V61A 1SGHA 1KZ7A 4OT1A 4CHMA 2P0DA 5LOPB 2YT1A 4HB3B 1MIXA 2YT2A 3PG7A 1LW3A 1U27A 4D6WA 4GN1A 3NWFA 5J3TA 1X1FA 2D9WA 5HE1A 3A8PA 5CLQB 2GS0A 5DIFB 3MDBC 2YS3A 1M7RA 3SUZA 1DBHA 1FGZA 1W1HA 4GMXB 1XR0B 3BINA 1MPHA 1U5EA 1WJ1A 1IRSA 1FHOA 3KSYA 1OMWA 3ODXA 1V5MA 4L1RA 3T06A 4IFSA 1E5WA 2Y8GA 4YL8A 2CODA 5JHGA 5JP4A 2OTXA 3ULCA 2EJ8A 5C6RA 2EMSA 1WVHA 4MK0A 4QJ4B 4A5KA 1Y19B 4A6HA 1ZM0A 1K5GB 2KR0A 4HDOA 3HK0A 3FSSA 2W2XD 3ZVRA 4EMOA 2HE7A 2LOXA 1RJ2A 1BTKA 4ZRKA 1MK7B 1Q67A 1W1GA 2YS1A 2R2YA 2NMBA 2VSZA 2DX1A 5C16A 3M1IB 3WYFB 1Z87A 2J0KA 4K2PA 2W2XC 2GJYA 2KCJA 2N23A 1V88A 2I5CA 3U7DA 4H8SA 1ZYIA 1H10A 1QQGA 2BCJA 2DKPA 2E2XA 3ODOA 3OANA 1B55A 4DXAB 2DTCA 2RRFA 1V89A 3AU5A 2Z0PA 1MKEA 1X86A 5LONB 1U5DA 3F0WA 2D9YA 1DDWA 1FAOA 1U2BA 2V76A 3CXBB 3LJUX 1FHWA 2W2WA 3P7ZA 1TQZA 1Y5OA 2AEHA 3HSAA 1GC7A 3CIKA 3X23A 3SV1A 4NY0A 5JHHA 4NSWA 3BJIA 2PZ1A 3HIEA 4HSIA 5D3WA 1P3RA 2VKIA 4QJ5B 4HAWB 4TYZA 3PSCA 5DI9B 4A6KA 5FI1A 1BTNA 1V5UA 4HDQA 4CYEA 1PMSA 1FOEA 1DDMA 4HAXB 2QKLA 3GYPA 4K81A 3P6AA 2ROVA 2Z13A 3G9WA 4WVFB 4HATB 1NTYA 2K49A 4GOUA 3UZTA 3NSUA 1PFJA 2ROZB 2COAA 1WG7A 5FI0A 2COFA 4HB2B 5C79A 3PVUA 4F7UP 1XD4A 1XCGA 4K2OA 1EGXA 4D0NB 2MKRA 1X1GA 3ODWA 2LG1A 2J0JA 3FEHA 1K5DB 5D27A 4HAZB 4BBKA 1MAIA 4F7HA 2YF0A 4GMVA 3KY9A 1I7AA 2IFSA 5CLLB 1FGYA 2OQBA 3D8EA 4F7GA 1TJ6A 3QWMA 4GXBA 3NWDA 2D9XA 4C0AA 3TO1A 5DH9B 3TFMA 2KIEA 1ZC3B 2D2QA 4DX90 4CSQA 2ELAA 4PQ0A 3O96A 5J3QA 1SHCA 1LB1A 2K2UA 3PVLA 2X18A 2RVBB 2K2JA 2D9ZA 2M38A 3A8QA 4QJ3B 2I1KA 3PZDA 2RLOA 2VRWB 2DFKA 2L1CA 2DYNA 2N0YA 1XODA 2R09A 5DHFB 2Z14A 1M7EA 5HE3A 3A58A 5D3XA 3NWAA 1V5PA 2ZKMX 3PP2A 1U29A 1DDVA 3SYXA 2LKOA 1EAZA 2YS5A 2DA0A 1UNQA 1BAKA 3WA0A 5KQ4A 1I2HA 2RSGA 2DLWA 5KQ1A 1TXDA 4A6FA 4HB4B 2L2IA 2Q13A 3RCPA 1ZSQA 2DN6A 3FM8C 3SO6A 2JP2A 2H7EA 5C5BA 1FB8A 2DHKA 4HAVB 4MY6A 1MK9B 2M14A 4KHBA 4KHAA 4XWXA 4KAXB 1W1DA 2Z4DA 4Z2NA 3FVCA 1ISNA 4YONA 3PEGA 1EVHA 1NTVA
chains in the Genus database with same CATH topology
1XX0A 2NZ8B 4K17A 2ELBA 2CY4A 1X05A 2RGNB 1H4RA 2ZPYA 2D9VA 2YT0A 4GZUA 4IAPA 1QC6A 2YVCA 4L6EA 2EC1A 4Z2MB 1P5TA 3TCAA 1OY2A 3QBVB 1UNPA 2DYQA 2J59M 3KRXA 4IOYX 3SNHA 1X11A 3VIAA 2J0MA 1DYNA 4EJNA 2DX5A 2H7DA 5DHAB 2FJLA 2P0FA 1GC6A 4DBBA 2P8VA 1EF1A 3HW2B 3QIJA 2XQNM 3ULBA 2MFQA 5D3YA 1DROA 2CRFA 1PLSA 2AL6A 5J3YA 2YSZA 2MWNB 2KGXB 3ZDTA 1J19A 1WI1A 1OQNA 3KZ1A 1GG3A 4EKUA 4KHOA 3VOQA 1ZC4B 2ADZA 1N3HA 4P7IA 4GPTB 3D8DA 2RUKB 2CY5A 2Z0QA 3F5RA 5KCVA 2P0HA 4HAUB 2Z0OA 4A6FB 3DXCA 2HTHB 4DX8A 5C5BB 3TW1A 4WSFA 4HHVA 4B6HA 4HB0B 2GCLA 2RNRB 4KHBB 1NI2A 2G35A 2YRYA 3DXDA 1XKEA 1U5FA 1BWNA 4TKNA 2MDXA 1UPQA 2KUPA 2EMTA 3AJ4A 2GCJA 2DHJA 4ZRJA 2D4QA 1ZVRA 1FHXA 5JLJB 3GYOA 4WJ7A 4CHJA 5L81A 1U5GA 4ZRIA 5EFXA 2K00A 4Y94A 1P6SA 2Y7BA 4MT7A 2D10A 3DXEA 3N7CA 1KI1B 1WJMA 4HAYB 3V5WA 2LYDA 4KVGB 1WGUA 2D11A 1RRPB 2UZSA 2COCA 3TVVA 5D3VA 1UNRA 2IYBA 2UVMA 2UZRA 2I1JA 1UPRA 2DKQA 1AQCA 5HE2A 1J0WA 3IVFA 3HQCA 3A98B 3AU4A 3MPXA 2QKMA 2R0DA 5GOWB 4PNKA 1UEFA 3PVWA 2Y8FA 1WGQA 1KZGA 2LULA 1NU2A 3U8ZA 5HE0A 2CAYA 2DHIA 2LOZA 3KRWA 1AWEA 1MIZB 3D8FA 2I5FA 3ML4A 1V61A 1SGHA 1KZ7A 4CHMA 2P0DA 5LOPB 2YT1A 4HB3B 1MIXA 3PG7A 1LW3A 1U27A 4GN1A 5J3TA 1X1FA 2D9WA 5HE1A 3A8PA 5CLQB 2GS0A 5DIFB 3MDBC 2YS3A 1M7RA 3SUZA 1DBHA 1FGZA 1W1HA 4GMXB 1XR0B 3BINA 1MPHA 1U5EA 1WJ1A 1IRSA 1FHOA 3KSYA 1OMWA 3ODXA 1V5MA 3T06A 4IFSA 1E5WA 2Y8GA 4YL8A 2CODA 5JHGA 5JP4A 2OTXA 3ULCA 2EJ8A 5C6RA 2EMSA 1WVHA 4MK0A 4A5KA 1Y19B 4A6HA 1ZM0A 1K5GB 4HDOA 3HK0A 3FSSA 2W2XD 3ZVRA 4EMOA 2HE7A 2LOXA 1RJ2A 1BTKA 4ZRKA 1MK7B 1Q67A 1W1GA 2YS1A 2NMBA 2VSZA 2DX1A 5C16A 3M1IB 3WYFB 1Z87A 2J0KA 4K2PA 2W2XC 2GJYA 2KCJA 2N23A 1V88A 2I5CA 3U7DA 4H8SA 1H10A 1QQGA 2BCJA 2DKPA 2E2XA 3ODOA 3OANA 1B55A 4DXAB 2DTCA 1V89A 3AU5A 2Z0PA 1MKEA 1X86A 5LONB 1U5DA 3F0WA 2D9YA 1DDWA 1FAOA 1U2BA 2V76A 3CXBB 3LJUX 1FHWA 2W2WA 3P7ZA 1TQZA 1Y5OA 2AEHA 1GC7A 3CIKA 3X23A 3SV1A 4NY0A 5JHHA 4NSWA 3BJIA 2PZ1A 5D3WA 1P3RA 2VKIA 4HAWB 4TYZA 3PSCA 5DI9B 4A6KA 5FI1A 1BTNA 1V5UA 4HDQA 4CYEA 1PMSA 1FOEA 1DDMA 4HAXB 2QKLA 3GYPA 4K81A 3P6AA 2ROVA 3G9WA 4WVFB 4HATB 1NTYA 3UZTA 3NSUA 1PFJA 2ROZB 2COAA 1WG7A 5FI0A 2COFA 4HB2B 5C79A 3PVUA 4F7UP 1XD4A 1XCGA 4K2OA 1EGXA 4D0NB 2MKRA 1X1GA 3ODWA 2LG1A 2J0JA 3FEHA 1K5DB 5D27A 4HAZB 4BBKA 1MAIA 4F7HA 2YF0A 4GMVA 3KY9A 1I7AA 2IFSA 5CLLB 1FGYA 2OQBA 3D8EA 4F7GA 1TJ6A 3QWMA 4GXBA 2D9XA 4C0AA 3TO1A 5DH9B 3TFMA 1ZC3B 2D2QA 4DX90 2ELAA 4PQ0A 3O96A 5J3QA 1SHCA 1LB1A 2K2UA 3PVLA 2X18A 2RVBB 2K2JA 2D9ZA 2M38A 3A8QA 2I1KA 3PZDA 2RLOA 2VRWB 2DFKA 2L1CA 2DYNA 2N0YA 1XODA 2R09A 5DHFB 1M7EA 5HE3A 5D3XA 1V5PA 3PP2A 1U29A 1DDVA 3SYXA 2LKOA 1EAZA 2YS5A 2DA0A 1UNQA 1BAKA 3WA0A 5KQ4A 1I2HA 2RSGA 2DLWA 5KQ1A 1TXDA 4A6FA 4HB4B 2L2IA 2Q13A 3RCPA 1ZSQA 2DN6A 3FM8C 3SO6A 2JP2A 2H7EA 5C5BA 1FB8A 2DHKA 4HAVB 4MY6A 1MK9B 2M14A 4KHAA 4XWXA 4KAXB 1W1DA 4Z2NA 1ISNA 4YONA 3PEGA 1EVHA 1NTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XX0 A;  2NZ8 B;  4K17 A;  2ELB A;  2CY4 A;  1X05 A;  2RGN B;  1H4R A;  2ZPY A;  2D9V A;  2YT0 A;  4GZU A;  4IAP A;  1QC6 A;  2YVC A;  4L6E A;  2EC1 A;  4Z2M B;  1P5T A;  3TCA A;  1OY2 A;  3QBV B;  1UNP A;  2DYQ A;  2J59 M;  3KRX A;  4IOY X;  3SNH A;  1X11 A;  3VIA A;  2J0M A;  1DYN A;  4EJN A;  2DX5 A;  2H7D A;  5DHA B;  2FJL A;  2P0F A;  1GC6 A;  4DBB A;  2P8V A;  1EF1 A;  3HW2 B;  3QIJ A;  2XQN M;  3ULB A;  2MFQ A;  5D3Y A;  1DRO A;  2CRF A;  1PLS A;  2AL6 A;  5J3Y A;  2YSZ A;  2MWN B;  2KGX B;  3ZDT A;  1J19 A;  1WI1 A;  1OQN A;  3KZ1 A;  1GG3 A;  4EKU A;  4KHO A;  3VOQ A;  1ZC4 B;  2ADZ A;  1N3H A;  4P7I A;  4GPT B;  3D8D A;  2RUK B;  2CY5 A;  2Z0Q A;  3F5R A;  5KCV A;  2P0H A;  4HAU B;  2Z0O A;  4A6F B;  3DXC A;  2HTH B;  4DX8 A;  5C5B B;  3TW1 A;  4WSF A;  4HHV A;  4B6H A;  4HB0 B;  2GCL A;  2RNR B;  4KHB B;  1NI2 A;  2G35 A;  2YRY A;  3DXD A;  1XKE A;  1U5F A;  1BWN A;  4TKN A;  2MDX A;  1UPQ A;  2KUP A;  2EMT A;  3AJ4 A;  2GCJ A;  2DHJ A;  4ZRJ A;  2D4Q A;  1ZVR A;  1FHX A;  5JLJ B;  3GYO A;  4WJ7 A;  4CHJ A;  5L81 A;  1U5G A;  4ZRI A;  5EFX A;  2K00 A;  4Y94 A;  1P6S A;  2Y7B A;  4MT7 A;  2D10 A;  3DXE A;  3N7C A;  1KI1 B;  1WJM A;  4HAY B;  3V5W A;  2LYD A;  4KVG B;  1WGU A;  2D11 A;  1RRP B;  2UZS A;  2COC A;  3TVV A;  5D3V A;  1UNR A;  2IYB A;  2UVM A;  2UZR A;  2I1J A;  1UPR A;  2DKQ A;  1AQC A;  5HE2 A;  1J0W A;  3IVF A;  3HQC A;  3A98 B;  3AU4 A;  3MPX A;  2QKM A;  2R0D A;  5GOW B;  4PNK A;  1UEF A;  3PVW A;  2Y8F A;  1WGQ A;  1KZG A;  2LUL A;  1NU2 A;  3U8Z A;  5HE0 A;  2CAY A;  2DHI A;  2LOZ A;  3KRW A;  1AWE A;  1MIZ B;  3D8F A;  2I5F A;  3ML4 A;  1V61 A;  1SGH A;  1KZ7 A;  4CHM A;  2P0D A;  5LOP B;  2YT1 A;  4HB3 B;  1MIX A;  3PG7 A;  1LW3 A;  1U27 A;  4GN1 A;  5J3T A;  1X1F A;  2D9W A;  5HE1 A;  3A8P A;  5CLQ B;  2GS0 A;  5DIF B;  3MDB C;  2YS3 A;  1M7R A;  3SUZ A;  1DBH A;  1FGZ A;  1W1H A;  4GMX B;  1XR0 B;  3BIN A;  1MPH A;  1U5E A;  1WJ1 A;  1IRS A;  1FHO A;  3KSY A;  1OMW A;  3ODX A;  1V5M A;  3T06 A;  4IFS A;  1E5W A;  2Y8G A;  4YL8 A;  2COD A;  5JHG A;  5JP4 A;  2OTX A;  3ULC A;  2EJ8 A;  5C6R A;  2EMS A;  1WVH A;  4MK0 A;  4A5K A;  1Y19 B;  4A6H A;  1ZM0 A;  1K5G B;  4HDO A;  3HK0 A;  3FSS A;  2W2X D;  3ZVR A;  4EMO A;  2HE7 A;  2LOX A;  1RJ2 A;  1BTK A;  4ZRK A;  1MK7 B;  1Q67 A;  1W1G A;  2YS1 A;  2NMB A;  2VSZ A;  2DX1 A;  5C16 A;  3M1I B;  3WYF B;  1Z87 A;  2J0K A;  4K2P A;  2W2X C;  2GJY A;  2KCJ A;  2N23 A;  1V88 A;  2I5C A;  3U7D A;  4H8S A;  1H10 A;  1QQG A;  2BCJ A;  2DKP A;  2E2X A;  3ODO A;  3OAN A;  1B55 A;  4DXA B;  2DTC A;  1V89 A;  3AU5 A;  2Z0P A;  1MKE A;  1X86 A;  5LON B;  1U5D A;  3F0W A;  2D9Y A;  1DDW A;  1FAO A;  1U2B A;  2V76 A;  3CXB B;  3LJU X;  1FHW A;  2W2W A;  3P7Z A;  1TQZ A;  1Y5O A;  2AEH A;  1GC7 A;  3CIK A;  3X23 A;  3SV1 A;  4NY0 A;  5JHH A;  4NSW A;  3BJI A;  2PZ1 A;  5D3W A;  1P3R A;  2VKI A;  4HAW B;  4TYZ A;  3PSC A;  5DI9 B;  4A6K A;  5FI1 A;  1BTN A;  1V5U A;  4HDQ A;  4CYE A;  1PMS A;  1FOE A;  1DDM A;  4HAX B;  2QKL A;  3GYP A;  4K81 A;  3P6A A;  2ROV A;  3G9W A;  4WVF B;  4HAT B;  1NTY A;  3UZT A;  3NSU A;  1PFJ A;  2ROZ B;  2COA A;  1WG7 A;  5FI0 A;  2COF A;  4HB2 B;  5C79 A;  3PVU A;  4F7U P;  1XD4 A;  1XCG A;  4K2O A;  1EGX A;  4D0N B;  2MKR A;  1X1G A;  3ODW A;  2LG1 A;  2J0J A;  3FEH A;  1K5D B;  5D27 A;  4HAZ B;  4BBK A;  1MAI A;  4F7H A;  2YF0 A;  4GMV A;  3KY9 A;  1I7A A;  2IFS A;  5CLL B;  1FGY A;  2OQB A;  3D8E A;  4F7G A;  1TJ6 A;  3QWM A;  4GXB A;  2D9X A;  4C0A A;  3TO1 A;  5DH9 B;  3TFM A;  1ZC3 B;  2D2Q A;  4DX9 0;  2ELA A;  4PQ0 A;  3O96 A;  5J3Q A;  1SHC A;  1LB1 A;  2K2U A;  3PVL A;  2X18 A;  2RVB B;  2K2J A;  2D9Z A;  2M38 A;  3A8Q A;  2I1K A;  3PZD A;  2RLO A;  2VRW B;  2DFK A;  2L1C A;  2DYN A;  2N0Y A;  1XOD A;  2R09 A;  5DHF B;  1M7E A;  5HE3 A;  5D3X A;  1V5P A;  3PP2 A;  1U29 A;  1DDV A;  3SYX A;  2LKO A;  1EAZ A;  2YS5 A;  2DA0 A;  1UNQ A;  1BAK A;  3WA0 A;  5KQ4 A;  1I2H A;  2RSG A;  2DLW A;  5KQ1 A;  1TXD A;  4A6F A;  4HB4 B;  2L2I A;  2Q13 A;  3RCP A;  1ZSQ A;  2DN6 A;  3FM8 C;  3SO6 A;  2JP2 A;  2H7E A;  5C5B A;  1FB8 A;  2DHK A;  4HAV B;  4MY6 A;  1MK9 B;  2M14 A;  4KHA A;  4XWX A;  4KAX B;  1W1D A;  4Z2N A;  1ISN A;  4YON A;  3PEG A;  1EVH A;  1NTV A; 
#chains in the Genus database with same CATH topology
 1XX0 A;  2NZ8 B;  4K17 A;  2ELB A;  2CY4 A;  1X05 A;  2RGN B;  1H4R A;  2ZPY A;  4QXA B;  2D9V A;  2YT0 A;  4GZU A;  4IAP A;  1QC6 A;  2YVC A;  4L6E A;  2EC1 A;  4Z2M B;  1P5T A;  3TCA A;  1OY2 A;  3QBV B;  1UNP A;  2DYQ A;  2K8E A;  2J59 M;  3KRX A;  4IOY X;  3SNH A;  3NW8 A;  1X11 A;  3VIA A;  2J0M A;  1DYN A;  4EJN A;  2DX5 A;  2H7D A;  5DHA B;  2FJL A;  2P0F A;  1GC6 A;  5LG4 B;  4DBB A;  2P8V A;  1EF1 A;  3HW2 B;  3QIJ A;  2XQN M;  3ULB A;  2Z59 A;  2MFQ A;  5D3Y A;  1DRO A;  2CRF A;  1PLS A;  2AL6 A;  5J3Y A;  2YSZ A;  2MWN B;  2KGX B;  3ZDT A;  1J19 A;  1WI1 A;  1OQN A;  3KZ1 A;  1GG3 A;  4EKU A;  4KHO A;  3VOQ A;  1ZC4 B;  2ADZ A;  1N3H A;  4P7I A;  4GPT B;  3D8D A;  2RUK B;  2CY5 A;  2Z0Q A;  3F5R A;  5KCV A;  2P0H A;  4HAU B;  2Z0O A;  4A6F B;  3DXC A;  2HTH B;  4DX8 A;  3U12 A;  5C5B B;  3TW1 A;  2GUM A;  4WSF A;  4HHV A;  4B6H A;  4OSN A;  4HB0 B;  2GCL A;  2RNR B;  4KHB B;  1NI2 A;  2G35 A;  2YRY A;  2KUQ A;  3DXD A;  1XKE A;  1U5F A;  1BWN A;  4TKN A;  2MDX A;  3OHM B;  1UPQ A;  5I2M A;  5IRS A;  2KUP A;  2EMT A;  3AJ4 A;  2GCJ A;  2DHJ A;  4ZRJ A;  2D4Q A;  1ZVR A;  1FHX A;  3B77 A;  5JLJ B;  3GYO A;  4WJ7 A;  4CHJ A;  5L81 A;  1U5G A;  4ZRI A;  5EFX A;  2K00 A;  4Y94 A;  1P6S A;  2Y7B A;  4MT7 A;  1MI1 A;  2D10 A;  3DXE A;  3N7C A;  1KI1 B;  1WJM A;  4HAY B;  3V5W A;  2LYD A;  4KVG B;  2FJU B;  4DIX A;  1WGU A;  2D11 A;  1RRP B;  2UZS A;  1T77 A;  4GNK B;  2COC A;  3TVV A;  5D3V A;  5M4Y B;  1UNR A;  2IYB A;  2UVM A;  2KIG A;  2I1J A;  2UZR A;  1UPR A;  2DKQ A;  1AQC A;  5HE2 A;  1J0W A;  3IVF A;  3HQC A;  3DCX A;  3A98 B;  3AU4 A;  3MPX A;  2R0D A;  2QKM A;  5GOW B;  2NBV A;  1UEF A;  4PNK A;  5I2S A;  3PVW A;  2Y8F A;  1WGQ A;  1KZG A;  2LUL A;  1NU2 A;  3U8Z A;  5HE0 A;  2CAY A;  2DHI A;  2LOZ A;  3KRW A;  1AWE A;  1MIZ B;  3D8F A;  2I5F A;  3ML4 A;  1V61 A;  1SGH A;  1KZ7 A;  4OT1 A;  4CHM A;  2P0D A;  5LOP B;  2YT1 A;  4HB3 B;  1MIX A;  2YT2 A;  3PG7 A;  1LW3 A;  1U27 A;  4D6W A;  4GN1 A;  3NWF A;  5J3T A;  1X1F A;  2D9W A;  5HE1 A;  3A8P A;  5CLQ B;  2GS0 A;  5DIF B;  3MDB C;  2YS3 A;  1M7R A;  3SUZ A;  1DBH A;  1FGZ A;  1W1H A;  4GMX B;  1XR0 B;  3BIN A;  1MPH A;  1U5E A;  1WJ1 A;  1IRS A;  1FHO A;  3KSY A;  1OMW A;  3ODX A;  1V5M A;  4L1R A;  3T06 A;  4IFS A;  1E5W A;  2Y8G A;  4YL8 A;  2COD A;  5JHG A;  5JP4 A;  2OTX A;  3ULC A;  2EJ8 A;  5C6R A;  2EMS A;  1WVH A;  4MK0 A;  4QJ4 B;  4A5K A;  1Y19 B;  4A6H A;  1ZM0 A;  1K5G B;  2KR0 A;  4HDO A;  3HK0 A;  3FSS A;  2W2X D;  3ZVR A;  4EMO A;  2HE7 A;  2LOX A;  1RJ2 A;  1BTK A;  4ZRK A;  1MK7 B;  1Q67 A;  1W1G A;  2YS1 A;  2R2Y A;  2NMB A;  2VSZ A;  2DX1 A;  5C16 A;  3M1I B;  3WYF B;  1Z87 A;  2J0K A;  4K2P A;  2W2X C;  2GJY A;  2KCJ A;  2N23 A;  1V88 A;  2I5C A;  3U7D A;  4H8S A;  1ZYI A;  1H10 A;  1QQG A;  2BCJ A;  2DKP A;  2E2X A;  3ODO A;  3OAN A;  1B55 A;  4DXA B;  2DTC A;  2RRF A;  1V89 A;  3AU5 A;  2Z0P A;  1MKE A;  1X86 A;  5LON B;  1U5D A;  3F0W A;  2D9Y A;  1DDW A;  1FAO A;  1U2B A;  2V76 A;  3CXB B;  3LJU X;  1FHW A;  2W2W A;  3P7Z A;  1TQZ A;  1Y5O A;  2AEH A;  3HSA A;  1GC7 A;  3CIK A;  3X23 A;  3SV1 A;  4NY0 A;  5JHH A;  4NSW A;  3BJI A;  2PZ1 A;  3HIE A;  4HSI A;  5D3W A;  1P3R A;  2VKI A;  4QJ5 B;  4HAW B;  4TYZ A;  3PSC A;  5DI9 B;  4A6K A;  5FI1 A;  1BTN A;  1V5U A;  4HDQ A;  4CYE A;  1PMS A;  1FOE A;  1DDM A;  4HAX B;  2QKL A;  3GYP A;  4K81 A;  3P6A A;  2ROV A;  2Z13 A;  3G9W A;  4WVF B;  4HAT B;  1NTY A;  2K49 A;  4GOU A;  3UZT A;  3NSU A;  1PFJ A;  2ROZ B;  2COA A;  1WG7 A;  5FI0 A;  2COF A;  4HB2 B;  5C79 A;  3PVU A;  4F7U P;  1XD4 A;  1XCG A;  4K2O A;  1EGX A;  4D0N B;  2MKR A;  1X1G A;  3ODW A;  2LG1 A;  2J0J A;  3FEH A;  1K5D B;  5D27 A;  4HAZ B;  4BBK A;  1MAI A;  4F7H A;  2YF0 A;  4GMV A;  3KY9 A;  1I7A A;  2IFS A;  5CLL B;  1FGY A;  2OQB A;  3D8E A;  4F7G A;  1TJ6 A;  3QWM A;  4GXB A;  3NWD A;  2D9X A;  4C0A A;  3TO1 A;  5DH9 B;  3TFM A;  2KIE A;  1ZC3 B;  2D2Q A;  4DX9 0;  4CSQ A;  2ELA A;  4PQ0 A;  3O96 A;  5J3Q A;  1SHC A;  1LB1 A;  2K2U A;  3PVL A;  2X18 A;  2RVB B;  2K2J A;  2D9Z A;  2M38 A;  3A8Q A;  4QJ3 B;  2I1K A;  3PZD A;  2RLO A;  2VRW B;  2DFK A;  2L1C A;  2DYN A;  2N0Y A;  1XOD A;  2R09 A;  5DHF B;  2Z14 A;  1M7E A;  5HE3 A;  3A58 A;  5D3X A;  3NWA A;  1V5P A;  2ZKM X;  3PP2 A;  1U29 A;  1DDV A;  3SYX A;  2LKO A;  1EAZ A;  2YS5 A;  2DA0 A;  1UNQ A;  1BAK A;  3WA0 A;  5KQ4 A;  1I2H A;  2RSG A;  2DLW A;  5KQ1 A;  1TXD A;  4A6F A;  4HB4 B;  2L2I A;  2Q13 A;  3RCP A;  1ZSQ A;  2DN6 A;  3FM8 C;  3SO6 A;  2JP2 A;  2H7E A;  5C5B A;  1FB8 A;  2DHK A;  4HAV B;  4MY6 A;  1MK9 B;  2M14 A;  4KHB A;  4KHA A;  4XWX A;  4KAX B;  1W1D A;  2Z4D A;  4Z2N A;  3FVC A;  1ISN A;  4YON A;  3PEG A;  1EVH A;  1NTV A; 
#chains in the Genus database with same CATH homology
 1XX0 A;  2NZ8 B;  4K17 A;  2ELB A;  2CY4 A;  1X05 A;  2RGN B;  1H4R A;  2ZPY A;  2D9V A;  2YT0 A;  4GZU A;  4IAP A;  1QC6 A;  2YVC A;  4L6E A;  2EC1 A;  4Z2M B;  1P5T A;  3TCA A;  1OY2 A;  3QBV B;  1UNP A;  2DYQ A;  2J59 M;  3KRX A;  4IOY X;  3SNH A;  1X11 A;  3VIA A;  2J0M A;  1DYN A;  4EJN A;  2DX5 A;  2H7D A;  5DHA B;  2FJL A;  2P0F A;  1GC6 A;  4DBB A;  2P8V A;  1EF1 A;  3HW2 B;  3QIJ A;  2XQN M;  3ULB A;  2MFQ A;  5D3Y A;  1DRO A;  2CRF A;  1PLS A;  2AL6 A;  5J3Y A;  2YSZ A;  2MWN B;  2KGX B;  3ZDT A;  1J19 A;  1WI1 A;  1OQN A;  3KZ1 A;  1GG3 A;  4EKU A;  4KHO A;  3VOQ A;  1ZC4 B;  2ADZ A;  1N3H A;  4P7I A;  4GPT B;  3D8D A;  2RUK B;  2CY5 A;  2Z0Q A;  3F5R A;  5KCV A;  2P0H A;  4HAU B;  2Z0O A;  4A6F B;  3DXC A;  2HTH B;  4DX8 A;  5C5B B;  3TW1 A;  4WSF A;  4HHV A;  4B6H A;  4HB0 B;  2GCL A;  2RNR B;  4KHB B;  1NI2 A;  2G35 A;  2YRY A;  3DXD A;  1XKE A;  1U5F A;  1BWN A;  4TKN A;  2MDX A;  1UPQ A;  2KUP A;  2EMT A;  3AJ4 A;  2GCJ A;  2DHJ A;  4ZRJ A;  2D4Q A;  1ZVR A;  1FHX A;  5JLJ B;  3GYO A;  4WJ7 A;  4CHJ A;  5L81 A;  1U5G A;  4ZRI A;  5EFX A;  2K00 A;  4Y94 A;  1P6S A;  2Y7B A;  4MT7 A;  2D10 A;  3DXE A;  3N7C A;  1KI1 B;  1WJM A;  4HAY B;  3V5W A;  2LYD A;  4KVG B;  1WGU A;  2D11 A;  1RRP B;  2UZS A;  2COC A;  3TVV A;  5D3V A;  1UNR A;  2IYB A;  2UVM A;  2UZR A;  2I1J A;  1UPR A;  2DKQ A;  1AQC A;  5HE2 A;  1J0W A;  3IVF A;  3HQC A;  3A98 B;  3AU4 A;  3MPX A;  2QKM A;  2R0D A;  5GOW B;  4PNK A;  1UEF A;  3PVW A;  2Y8F A;  1WGQ A;  1KZG A;  2LUL A;  1NU2 A;  3U8Z A;  5HE0 A;  2CAY A;  2DHI A;  2LOZ A;  3KRW A;  1AWE A;  1MIZ B;  3D8F A;  2I5F A;  3ML4 A;  1V61 A;  1SGH A;  1KZ7 A;  4CHM A;  2P0D A;  5LOP B;  2YT1 A;  4HB3 B;  1MIX A;  3PG7 A;  1LW3 A;  1U27 A;  4GN1 A;  5J3T A;  1X1F A;  2D9W A;  5HE1 A;  3A8P A;  5CLQ B;  2GS0 A;  5DIF B;  3MDB C;  2YS3 A;  1M7R A;  3SUZ A;  1DBH A;  1FGZ A;  1W1H A;  4GMX B;  1XR0 B;  3BIN A;  1MPH A;  1U5E A;  1WJ1 A;  1IRS A;  1FHO A;  3KSY A;  1OMW A;  3ODX A;  1V5M A;  3T06 A;  4IFS A;  1E5W A;  2Y8G A;  4YL8 A;  2COD A;  5JHG A;  5JP4 A;  2OTX A;  3ULC A;  2EJ8 A;  5C6R A;  2EMS A;  1WVH A;  4MK0 A;  4A5K A;  1Y19 B;  4A6H A;  1ZM0 A;  1K5G B;  4HDO A;  3HK0 A;  3FSS A;  2W2X D;  3ZVR A;  4EMO A;  2HE7 A;  2LOX A;  1RJ2 A;  1BTK A;  4ZRK A;  1MK7 B;  1Q67 A;  1W1G A;  2YS1 A;  2NMB A;  2VSZ A;  2DX1 A;  5C16 A;  3M1I B;  3WYF B;  1Z87 A;  2J0K A;  4K2P A;  2W2X C;  2GJY A;  2KCJ A;  2N23 A;  1V88 A;  2I5C A;  3U7D A;  4H8S A;  1H10 A;  1QQG A;  2BCJ A;  2DKP A;  2E2X A;  3ODO A;  3OAN A;  1B55 A;  4DXA B;  2DTC A;  1V89 A;  3AU5 A;  2Z0P A;  1MKE A;  1X86 A;  5LON B;  1U5D A;  3F0W A;  2D9Y A;  1DDW A;  1FAO A;  1U2B A;  2V76 A;  3CXB B;  3LJU X;  1FHW A;  2W2W A;  3P7Z A;  1TQZ A;  1Y5O A;  2AEH A;  1GC7 A;  3CIK A;  3X23 A;  3SV1 A;  4NY0 A;  5JHH A;  4NSW A;  3BJI A;  2PZ1 A;  5D3W A;  1P3R A;  2VKI A;  4HAW B;  4TYZ A;  3PSC A;  5DI9 B;  4A6K A;  5FI1 A;  1BTN A;  1V5U A;  4HDQ A;  4CYE A;  1PMS A;  1FOE A;  1DDM A;  4HAX B;  2QKL A;  3GYP A;  4K81 A;  3P6A A;  2ROV A;  3G9W A;  4WVF B;  4HAT B;  1NTY A;  3UZT A;  3NSU A;  1PFJ A;  2ROZ B;  2COA A;  1WG7 A;  5FI0 A;  2COF A;  4HB2 B;  5C79 A;  3PVU A;  4F7U P;  1XD4 A;  1XCG A;  4K2O A;  1EGX A;  4D0N B;  2MKR A;  1X1G A;  3ODW A;  2LG1 A;  2J0J A;  3FEH A;  1K5D B;  5D27 A;  4HAZ B;  4BBK A;  1MAI A;  4F7H A;  2YF0 A;  4GMV A;  3KY9 A;  1I7A A;  2IFS A;  5CLL B;  1FGY A;  2OQB A;  3D8E A;  4F7G A;  1TJ6 A;  3QWM A;  4GXB A;  2D9X A;  4C0A A;  3TO1 A;  5DH9 B;  3TFM A;  1ZC3 B;  2D2Q A;  4DX9 0;  2ELA A;  4PQ0 A;  3O96 A;  5J3Q A;  1SHC A;  1LB1 A;  2K2U A;  3PVL A;  2X18 A;  2RVB B;  2K2J A;  2D9Z A;  2M38 A;  3A8Q A;  2I1K A;  3PZD A;  2RLO A;  2VRW B;  2DFK A;  2L1C A;  2DYN A;  2N0Y A;  1XOD A;  2R09 A;  5DHF B;  1M7E A;  5HE3 A;  5D3X A;  1V5P A;  3PP2 A;  1U29 A;  1DDV A;  3SYX A;  2LKO A;  1EAZ A;  2YS5 A;  2DA0 A;  1UNQ A;  1BAK A;  3WA0 A;  5KQ4 A;  1I2H A;  2RSG A;  2DLW A;  5KQ1 A;  1TXD A;  4A6F A;  4HB4 B;  2L2I A;  2Q13 A;  3RCP A;  1ZSQ A;  2DN6 A;  3FM8 C;  3SO6 A;  2JP2 A;  2H7E A;  5C5B A;  1FB8 A;  2DHK A;  4HAV B;  4MY6 A;  1MK9 B;  2M14 A;  4KHA A;  4XWX A;  4KAX B;  1W1D A;  4Z2N A;  1ISN A;  4YON A;  3PEG A;  1EVH A;  1NTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...