5KQ4A

Crystal structure of s. pombe dcp1/dcp2 in complex with h. sapiens pnrc2 and synthetic cap analog
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
124
structure length
124
Chain Sequence
MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of mRNA-cap recognition by Dcp1-Dcp2.
pubmed doi rcsb
molecule keywords mRNA-decapping enzyme subunit 1
molecule tags Hydrolase
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
total genus 32
structure length 124
sequence length 124
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06058 DCP1 Dcp1-like decapping family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 5kq4A00
5CLQB 2YS1A 2VSZA 5C5BB 3QIJA 1X05A 3OANA 1XCGA 4F7UP 1B55A 3U7DA 1J0WA 3HK0A 5JLJB 5KQ1A 1DROA 1V88A 3ODXA 3KZ1A 3HW2B 4TKNA 1ZSQA 2I5FA 5DHFB 4HAUB 1ZC4B 2IYBA 4BBKA 1RJ2A 3D8DA 1FHWA 1WJMA 5D3YA 1KZ7A 2CY5A 2D9ZA 3GYPA 3ML4A 3V5WA 2XQNM 1WI1A 4A5KA 1EVHA 2RVBB 5CLLB 4NY0A 2N23A 3RCPA 1UNQA 3CXBB 1V61A 1LW3A 4GMXB 1BTKA 2RSGA 1TQZA 2L1CA 3N7CA 4HAVB 3ODWA 5EFXA 3SO6A 3SV1A 2DA0A 3TFMA 1NU2A 5FI0A 4P7IA 1U2BA 3AJ4A 2BCJA 4EJNA 2E2XA 2EC1A 1WVHA 1I7AA 2J0KA 1BTNA 2ELAA 1Z87A 2KCJA 2Y8FA 2EMTA 4D0NB 3UZTA 3TW1A 1NTYA 1P5TA 1RRPB 1GC6A 1U27A 4WVFB 1KI1B 1X86A 2DHJA 2QKMA 2OTXA 1V5MA 4K2OA 3U8ZA 2LOXA 2DFKA 4F7GA 3PZDA 2HE7A 2YS3A 4DX8A 1U5EA 1UNPA 3PVUA 1U5FA 5DIFB 4DX90 2M14A 3BINA 1XX0A 1K5DB 4CHJA 3AU4A 3P7ZA 3SYXA 1FB8A 2JP2A 1FGYA 4KHOA 1SHCA 2MFQA 3SNHA 3BJIA 3M1IB 1EF1A 2DN6A 4IOYX 2GCJA 3MDBC 1ZM0A 4GMVA 1MAIA 2L2IA 4F7HA 4HAZB 4Z2MB 1N3HA 4XWXA 4CHMA 1MPHA 2FJLA 2LULA 4A6FB 1X1GA 4HAYB 1X1FA 5J3QA 3PVWA 4Z2NA 2ROZB 2DYQA 1NI2A 1K5GB 3DXCA 4HDQA 3KRWA 5KCVA 4DXAB 3FM8C 4TYZA 2UVMA 4HAWB 1GC7A 1P3RA 2ELBA 2YSZA 2PZ1A 1ZVRA 2AL6A 2DKPA 1P6SA 3TVVA 2DKQA 2P0DA 3A8QA 1UPRA 1M7EA 2AEHA 3CIKA 1LB1A 5LOPB 5DH9B 4PQ0A 3D8EA 4KHBB 5DI9B 5FI1A 2RLOA 3KRXA 3KSYA 4GXBA 2CY4A 1DDVA 3DXEA 5LONB 5D27A 3G9WA 3PEGA 3PG7A 4KVGB 5C5BA 2YT1A 4HATB 2K2UA 1MIXA 1GG3A 2MKRA 2LOZA 1OMWA 4YL8A 1WGUA 4GN1A 3T06A 4KHAA 3ULBA 1NTVA 2NMBA 2LKOA 4HHVA 1FAOA 4NSWA 2N0YA 2Z0PA 2VRWB 4HB0B 2DHIA 3IVFA 2YVCA 2RGNB 1V5UA 2ADZA 2EMSA 3X23A 3QWMA 3GYOA 3VOQA 4A6KA 4HAXB 1DYNA 1AWEA 1OQNA 1MK9B 2COFA 1OY2A 5HE3A 1FHOA 3MPXA 2IFSA 4Y94A 3VIAA 1X11A 4HB4B 4A6HA 5JHHA 3FSSA 4B6HA 5JHGA 2COCA 4KAXB 4GPTB 3SUZA 2ZPYA 2R09A 2YT0A 3HQCA 2DHKA 1W1GA 1WGQA 2M38A 4CYEA 4WJ7A 2Y7BA 1IRSA 2KUPA 2G35A 1U5GA 5L81A 1PMSA 5HE0A 1PFJA 4ZRJA 2I1KA 2CRFA 4EKUA 2RUKB 2DX5A 2GS0A 2Y8GA 1H4RA 4IFSA 2J0JA 5J3TA 4GZUA 1ISNA 4MK0A 2K00A 3TO1A 1ZC3B 1E5WA 2GJYA 2P0HA 2RNRB 2OQBA 3PP2A 1BAKA 2DYNA 3LJUX 1SGHA 1KZGA 4HB2B 2W2WA 1MKEA 1M7RA 2R0DA 5DHAB 2D11A 2K2JA 2YF0A 2P0FA 3KY9A 1MIZB 4PNKA 3D8FA 4EMOA 2D9YA 2EJ8A 2Q13A 2VKIA 4MY6A 1XKEA 2LG1A 3FEHA 1WG7A 1DDMA 5KQ4A 3TCAA 5J3YA 2X18A 3ODOA 2D9XA 2DX1A 1FGZA 1FOEA 2MDXA 4A6FA 5C79A 5C6RA 1AQCA 2KGXB 1XR0B 5C16A 5D3XA 3DXDA 1Q67A 1BWNA 1FHXA 2W2XC 2W2XD 2LYDA 2ROVA 1QC6A 2GCLA 3QBVB 3PSCA 1MK7B 4HB3B 4K2PA 5JP4A 2J59M 2NZ8B 1J19A 1I2HA 3F5RA 4IAPA 2CODA 1UPQA 2UZSA 2D2QA 3AU5A 2Z0QA 4L6EA 2UZRA 3A98B 2MWNB 4YONA 1DDWA 2DLWA 2HTHB 5HE1A 1WJ1A 4HDOA 2YRYA 2J0MA 2Z0OA 3ZVRA 4H8SA 2D4QA 1Y19B 3F0WA 2COAA 2QKLA 2V76A 4MT7A 2D9WA 1XODA 2I5CA 2D9VA 5GOWB 1U5DA 1UEFA 4ZRIA 1W1DA 2H7DA 1Y5OA 4K17A 5HE2A 3ULCA 1UNRA 1V5PA 3PVLA 1DBHA 1PLSA 3P6AA 1EGXA 1TJ6A 1XD4A 2YS5A 4K81A 1H10A 3A8PA 5D3WA 3NSUA 1QQGA 4C0AA 3O96A 1V89A 5D3VA 4ZRKA 2H7EA 2DTCA 1W1HA 3ZDTA 3WYFB 2I1JA 3WA0A 2P8VA 4DBBA 2CAYA 2D10A 1TXDA 1U29A 1EAZA 4WSFA
chains in the Genus database with same CATH superfamily
5CLQB 2YS1A 2VSZA 5C5BB 3QIJA 1X05A 3OANA 1XCGA 4F7UP 1B55A 3U7DA 1J0WA 3HK0A 3NWFA 5JLJB 5KQ1A 1DROA 1V88A 3ODXA 3KZ1A 3HW2B 4TKNA 1ZSQA 2I5FA 2KUQA 4OSNA 5DHFB 4HAUB 1ZC4B 3A58A 2IYBA 4BBKA 1RJ2A 3D8DA 1FHWA 1WJMA 5D3YA 1KZ7A 2CY5A 2D9ZA 2Z14A 3GYPA 3ML4A 3V5WA 2XQNM 1WI1A 4A5KA 1EVHA 2RVBB 5CLLB 4NY0A 2K49A 2N23A 3RCPA 1UNQA 3CXBB 1V61A 1LW3A 4GMXB 1BTKA 2RSGA 2Z13A 1TQZA 2L1CA 3N7CA 4HAVB 3ODWA 5EFXA 3SO6A 3SV1A 2DA0A 3TFMA 1NU2A 5FI0A 4P7IA 1U2BA 3AJ4A 2Z59A 2BCJA 4EJNA 2E2XA 2EC1A 1WVHA 1I7AA 2J0KA 2KIGA 1BTNA 2ELAA 1Z87A 2KCJA 2Y8FA 2EMTA 4D0NB 4QJ3B 3UZTA 5LG4B 3TW1A 1NTYA 1P5TA 1RRPB 1U27A 1GC6A 4WVFB 1KI1B 1X86A 2DHJA 2QKMA 2OTXA 1T77A 1V5MA 4K2OA 3U8ZA 2LOXA 2DFKA 4F7GA 3PZDA 4GOUA 2HE7A 2YS3A 4DX8A 1U5EA 1UNPA 3PVUA 1U5FA 5DIFB 4DX90 2M14A 2RRFA 3BINA 1XX0A 1K5DB 4CHJA 3AU4A 3P7ZA 3SYXA 1FB8A 2JP2A 1FGYA 4KHOA 2GUMA 1SHCA 2MFQA 3SNHA 3BJIA 3M1IB 1EF1A 2DN6A 3NWAA 4IOYX 2GCJA 3MDBC 1ZM0A 3NW8A 1MAIA 4GMVA 2L2IA 4F7HA 4HAZB 2K8EA 4Z2MB 1N3HA 4XWXA 4CHMA 1MPHA 2FJLA 2LULA 4A6FB 1X1GA 4HAYB 1X1FA 2YT2A 5J3QA 3PVWA 4Z2NA 2ROZB 2DYQA 1NI2A 1K5GB 3DXCA 4HDQA 3KRWA 5KCVA 4DXAB 3FM8C 4TYZA 2UVMA 4HAWB 1GC7A 1P3RA 2ELBA 2YSZA 2PZ1A 1ZVRA 2AL6A 2DKPA 1P6SA 3TVVA 2DKQA 2P0DA 3A8QA 1UPRA 1M7EA 2AEHA 2R2YA 3CIKA 1LB1A 5LOPB 5DH9B 4PQ0A 3D8EA 5M4YB 4KHBB 5DI9B 5FI1A 2RLOA 3KRXA 3KSYA 4GXBA 2CY4A 1DDVA 3DXEA 5LONB 5D27A 3G9WA 2Z4DA 3PEGA 3PG7A 4KVGB 4OT1A 5C5BA 2YT1A 4HATB 2K2UA 1MIXA 1GG3A 2MKRA 5IRSA 2LOZA 1OMWA 4YL8A 1WGUA 4GN1A 3DCXA 3T06A 4QXAB 4KHAA 3ULBA 1NTVA 2NMBA 2LKOA 4HHVA 1FAOA 4NSWA 4QJ4B 2N0YA 2Z0PA 2VRWB 4HB0B 2DHIA 3IVFA 2YVCA 2RGNB 1V5UA 2ADZA 3NWDA 2EMSA 3X23A 3QWMA 3GYOA 3VOQA 4A6KA 4HAXB 2ZKMX 1DYNA 2NBVA 1AWEA 1OQNA 1MK9B 2COFA 1OY2A 5HE3A 1FHOA 3MPXA 2IFSA 4Y94A 3VIAA 1X11A 4HB4B 4A6HA 5JHHA 3FSSA 4B6HA 5JHGA 2COCA 4KAXB 4GPTB 3SUZA 2ZPYA 2R09A 2YT0A 3HQCA 2DHKA 1W1GA 3OHMB 1WGQA 4QJ5B 2M38A 4CYEA 4WJ7A 2Y7BA 1IRSA 2KUPA 2G35A 2FJUB 1U5GA 5L81A 1PMSA 1MI1A 5HE0A 1PFJA 4ZRJA 2I1KA 5I2MA 2CRFA 4EKUA 2RUKB 3HSAA 2DX5A 2GS0A 3U12A 5I2SA 2Y8GA 1H4RA 4IFSA 2J0JA 5J3TA 4GZUA 1ISNA 4MK0A 2KIEA 2K00A 3TO1A 1ZC3B 1E5WA 2GJYA 2P0HA 2RNRB 2OQBA 3PP2A 1BAKA 2DYNA 3LJUX 4L1RA 1SGHA 1KZGA 1ZYIA 4HB2B 2W2WA 4D6WA 1MKEA 1M7RA 2R0DA 5DHAB 2D11A 2K2JA 2YF0A 2P0FA 3KY9A 1MIZB 4PNKA 3D8FA 4EMOA 2D9YA 3B77A 2EJ8A 2Q13A 2VKIA 4MY6A 1XKEA 2LG1A 3FEHA 1WG7A 1DDMA 5KQ4A 3TCAA 5J3YA 2X18A 3ODOA 2D9XA 2DX1A 1FGZA 1FOEA 2MDXA 4A6FA 5C79A 5C6RA 1AQCA 2KGXB 1XR0B 5C16A 5D3XA 3DXDA 1Q67A 1BWNA 1FHXA 2W2XC 2W2XD 2LYDA 2ROVA 1QC6A 2GCLA 2KR0A 3QBVB 3PSCA 1MK7B 4DIXA 4HB3B 4K2PA 4GNKB 5JP4A 2J59M 2NZ8B 1J19A 1I2HA 3F5RA 4IAPA 2CODA 1UPQA 3FVCA 4CSQA 2UZSA 2D2QA 3AU5A 2Z0QA 4L6EA 2UZRA 3A98B 2MWNB 4YONA 1DDWA 2DLWA 2HTHB 4KHBA 5HE1A 1WJ1A 4HDOA 2YRYA 2J0MA 2Z0OA 3ZVRA 4H8SA 2D4QA 3HIEA 1Y19B 3F0WA 2COAA 2QKLA 2V76A 4MT7A 2D9WA 4HSIA 1XODA 2I5CA 2D9VA 5GOWB 1U5DA 1UEFA 4ZRIA 1W1DA 2H7DA 1Y5OA 4K17A 5HE2A 3ULCA 1UNRA 1V5PA 3PVLA 1DBHA 1PLSA 3P6AA 1EGXA 1TJ6A 1XD4A 2YS5A 4K81A 1H10A 3A8PA 5D3WA 3NSUA 1QQGA 4C0AA 3O96A 1V89A 5D3VA 4ZRKA 2H7EA 2DTCA 1W1HA 3ZDTA 3WYFB 2I1JA 3WA0A 2P8VA 4DBBA 2CAYA 2D10A 1TXDA 1U29A 1EAZA 4WSFA
chains in the Genus database with same CATH topology
5CLQB 2YS1A 2VSZA 5C5BB 3QIJA 1X05A 3OANA 1XCGA 4F7UP 1B55A 3U7DA 1J0WA 3HK0A 5JLJB 5KQ1A 1DROA 1V88A 3ODXA 3KZ1A 3HW2B 4TKNA 1ZSQA 2I5FA 5DHFB 4HAUB 1ZC4B 2IYBA 4BBKA 1RJ2A 3D8DA 1FHWA 1WJMA 5D3YA 1KZ7A 2CY5A 2D9ZA 3GYPA 3ML4A 3V5WA 2XQNM 1WI1A 4A5KA 1EVHA 2RVBB 5CLLB 4NY0A 2N23A 3RCPA 1UNQA 3CXBB 1V61A 1LW3A 4GMXB 1BTKA 2RSGA 1TQZA 2L1CA 3N7CA 4HAVB 3ODWA 5EFXA 3SO6A 3SV1A 2DA0A 3TFMA 1NU2A 5FI0A 4P7IA 1U2BA 3AJ4A 2BCJA 4EJNA 2E2XA 2EC1A 1WVHA 1I7AA 2J0KA 1BTNA 2ELAA 1Z87A 2KCJA 2Y8FA 2EMTA 4D0NB 3UZTA 3TW1A 1NTYA 1P5TA 1RRPB 1GC6A 1U27A 4WVFB 1KI1B 1X86A 2DHJA 2QKMA 2OTXA 1V5MA 4K2OA 3U8ZA 2LOXA 2DFKA 4F7GA 3PZDA 2HE7A 2YS3A 4DX8A 1U5EA 1UNPA 3PVUA 1U5FA 5DIFB 4DX90 2M14A 3BINA 1XX0A 1K5DB 4CHJA 3AU4A 3P7ZA 3SYXA 1FB8A 2JP2A 1FGYA 4KHOA 1SHCA 2MFQA 3SNHA 3BJIA 3M1IB 1EF1A 2DN6A 4IOYX 2GCJA 3MDBC 1ZM0A 4GMVA 1MAIA 2L2IA 4F7HA 4HAZB 4Z2MB 1N3HA 4XWXA 4CHMA 1MPHA 2FJLA 2LULA 4A6FB 1X1GA 4HAYB 1X1FA 5J3QA 3PVWA 4Z2NA 2ROZB 2DYQA 1NI2A 1K5GB 3DXCA 4HDQA 3KRWA 5KCVA 4DXAB 3FM8C 4TYZA 2UVMA 4HAWB 1GC7A 1P3RA 2ELBA 2YSZA 2PZ1A 1ZVRA 2AL6A 2DKPA 1P6SA 3TVVA 2DKQA 2P0DA 3A8QA 1UPRA 1M7EA 2AEHA 3CIKA 1LB1A 5LOPB 5DH9B 4PQ0A 3D8EA 4KHBB 5DI9B 5FI1A 2RLOA 3KRXA 3KSYA 4GXBA 2CY4A 1DDVA 3DXEA 5LONB 5D27A 3G9WA 3PEGA 3PG7A 4KVGB 5C5BA 2YT1A 4HATB 2K2UA 1MIXA 1GG3A 2MKRA 2LOZA 1OMWA 4YL8A 1WGUA 4GN1A 3T06A 4KHAA 3ULBA 1NTVA 2NMBA 2LKOA 4HHVA 1FAOA 4NSWA 2N0YA 2Z0PA 2VRWB 4HB0B 2DHIA 3IVFA 2YVCA 2RGNB 1V5UA 2ADZA 2EMSA 3X23A 3QWMA 3GYOA 3VOQA 4A6KA 4HAXB 1DYNA 1AWEA 1OQNA 1MK9B 2COFA 1OY2A 5HE3A 1FHOA 3MPXA 2IFSA 4Y94A 3VIAA 1X11A 4HB4B 4A6HA 5JHHA 3FSSA 4B6HA 5JHGA 2COCA 4KAXB 4GPTB 3SUZA 2ZPYA 2R09A 2YT0A 3HQCA 2DHKA 1W1GA 1WGQA 2M38A 4CYEA 4WJ7A 2Y7BA 1IRSA 2KUPA 2G35A 1U5GA 5L81A 1PMSA 5HE0A 1PFJA 4ZRJA 2I1KA 2CRFA 4EKUA 2RUKB 2DX5A 2GS0A 2Y8GA 1H4RA 4IFSA 2J0JA 5J3TA 4GZUA 1ISNA 4MK0A 2K00A 3TO1A 1ZC3B 1E5WA 2GJYA 2P0HA 2RNRB 2OQBA 3PP2A 1BAKA 2DYNA 3LJUX 1SGHA 1KZGA 4HB2B 2W2WA 1MKEA 1M7RA 2R0DA 5DHAB 2D11A 2K2JA 2YF0A 2P0FA 3KY9A 1MIZB 4PNKA 3D8FA 4EMOA 2D9YA 2EJ8A 2Q13A 2VKIA 4MY6A 1XKEA 2LG1A 3FEHA 1WG7A 1DDMA 5KQ4A 3TCAA 5J3YA 2X18A 3ODOA 2D9XA 2DX1A 1FGZA 1FOEA 2MDXA 4A6FA 5C79A 5C6RA 1AQCA 2KGXB 1XR0B 5C16A 5D3XA 3DXDA 1Q67A 1BWNA 1FHXA 2W2XC 2W2XD 2LYDA 2ROVA 1QC6A 2GCLA 3QBVB 3PSCA 1MK7B 4HB3B 4K2PA 5JP4A 2J59M 2NZ8B 1J19A 1I2HA 3F5RA 4IAPA 2CODA 1UPQA 2UZSA 2D2QA 3AU5A 2Z0QA 4L6EA 2UZRA 3A98B 2MWNB 4YONA 1DDWA 2DLWA 2HTHB 5HE1A 1WJ1A 4HDOA 2YRYA 2J0MA 2Z0OA 3ZVRA 4H8SA 2D4QA 1Y19B 3F0WA 2COAA 2QKLA 2V76A 4MT7A 2D9WA 1XODA 2I5CA 2D9VA 5GOWB 1U5DA 1UEFA 4ZRIA 1W1DA 2H7DA 1Y5OA 4K17A 5HE2A 3ULCA 1UNRA 1V5PA 3PVLA 1DBHA 1PLSA 3P6AA 1EGXA 1TJ6A 1XD4A 2YS5A 4K81A 1H10A 3A8PA 5D3WA 3NSUA 1QQGA 4C0AA 3O96A 1V89A 5D3VA 4ZRKA 2H7EA 2DTCA 1W1HA 3ZDTA 3WYFB 2I1JA 3WA0A 2P8VA 4DBBA 2CAYA 2D10A 1TXDA 1U29A 1EAZA 4WSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLQ B;  2YS1 A;  2VSZ A;  5C5B B;  3QIJ A;  1X05 A;  3OAN A;  1XCG A;  4F7U P;  1B55 A;  3U7D A;  1J0W A;  3HK0 A;  5JLJ B;  5KQ1 A;  1DRO A;  1V88 A;  3ODX A;  3KZ1 A;  3HW2 B;  4TKN A;  1ZSQ A;  2I5F A;  5DHF B;  4HAU B;  1ZC4 B;  2IYB A;  4BBK A;  1RJ2 A;  3D8D A;  1FHW A;  1WJM A;  5D3Y A;  1KZ7 A;  2CY5 A;  2D9Z A;  3GYP A;  3ML4 A;  3V5W A;  2XQN M;  1WI1 A;  4A5K A;  1EVH A;  2RVB B;  5CLL B;  4NY0 A;  2N23 A;  3RCP A;  1UNQ A;  3CXB B;  1V61 A;  1LW3 A;  4GMX B;  1BTK A;  2RSG A;  1TQZ A;  2L1C A;  3N7C A;  4HAV B;  3ODW A;  5EFX A;  3SO6 A;  3SV1 A;  2DA0 A;  3TFM A;  1NU2 A;  5FI0 A;  4P7I A;  1U2B A;  3AJ4 A;  2BCJ A;  4EJN A;  2E2X A;  2EC1 A;  1WVH A;  1I7A A;  2J0K A;  1BTN A;  2ELA A;  1Z87 A;  2KCJ A;  2Y8F A;  2EMT A;  4D0N B;  3UZT A;  3TW1 A;  1NTY A;  1P5T A;  1RRP B;  1GC6 A;  1U27 A;  4WVF B;  1KI1 B;  1X86 A;  2DHJ A;  2QKM A;  2OTX A;  1V5M A;  4K2O A;  3U8Z A;  2LOX A;  2DFK A;  4F7G A;  3PZD A;  2HE7 A;  2YS3 A;  4DX8 A;  1U5E A;  1UNP A;  3PVU A;  1U5F A;  5DIF B;  4DX9 0;  2M14 A;  3BIN A;  1XX0 A;  1K5D B;  4CHJ A;  3AU4 A;  3P7Z A;  3SYX A;  1FB8 A;  2JP2 A;  1FGY A;  4KHO A;  1SHC A;  2MFQ A;  3SNH A;  3BJI A;  3M1I B;  1EF1 A;  2DN6 A;  4IOY X;  2GCJ A;  3MDB C;  1ZM0 A;  4GMV A;  1MAI A;  2L2I A;  4F7H A;  4HAZ B;  4Z2M B;  1N3H A;  4XWX A;  4CHM A;  1MPH A;  2FJL A;  2LUL A;  4A6F B;  1X1G A;  4HAY B;  1X1F A;  5J3Q A;  3PVW A;  4Z2N A;  2ROZ B;  2DYQ A;  1NI2 A;  1K5G B;  3DXC A;  4HDQ A;  3KRW A;  5KCV A;  4DXA B;  3FM8 C;  4TYZ A;  2UVM A;  4HAW B;  1GC7 A;  1P3R A;  2ELB A;  2YSZ A;  2PZ1 A;  1ZVR A;  2AL6 A;  2DKP A;  1P6S A;  3TVV A;  2DKQ A;  2P0D A;  3A8Q A;  1UPR A;  1M7E A;  2AEH A;  3CIK A;  1LB1 A;  5LOP B;  5DH9 B;  4PQ0 A;  3D8E A;  4KHB B;  5DI9 B;  5FI1 A;  2RLO A;  3KRX A;  3KSY A;  4GXB A;  2CY4 A;  1DDV A;  3DXE A;  5LON B;  5D27 A;  3G9W A;  3PEG A;  3PG7 A;  4KVG B;  5C5B A;  2YT1 A;  4HAT B;  2K2U A;  1MIX A;  1GG3 A;  2MKR A;  2LOZ A;  1OMW A;  4YL8 A;  1WGU A;  4GN1 A;  3T06 A;  4KHA A;  3ULB A;  1NTV A;  2NMB A;  2LKO A;  4HHV A;  1FAO A;  4NSW A;  2N0Y A;  2Z0P A;  2VRW B;  4HB0 B;  2DHI A;  3IVF A;  2YVC A;  2RGN B;  1V5U A;  2ADZ A;  2EMS A;  3X23 A;  3QWM A;  3GYO A;  3VOQ A;  4A6K A;  4HAX B;  1DYN A;  1AWE A;  1OQN A;  1MK9 B;  2COF A;  1OY2 A;  5HE3 A;  1FHO A;  3MPX A;  2IFS A;  4Y94 A;  3VIA A;  1X11 A;  4HB4 B;  4A6H A;  5JHH A;  3FSS A;  4B6H A;  5JHG A;  2COC A;  4KAX B;  4GPT B;  3SUZ A;  2ZPY A;  2R09 A;  2YT0 A;  3HQC A;  2DHK A;  1W1G A;  1WGQ A;  2M38 A;  4CYE A;  4WJ7 A;  2Y7B A;  1IRS A;  2KUP A;  2G35 A;  1U5G A;  5L81 A;  1PMS A;  5HE0 A;  1PFJ A;  4ZRJ A;  2I1K A;  2CRF A;  4EKU A;  2RUK B;  2DX5 A;  2GS0 A;  2Y8G A;  1H4R A;  4IFS A;  2J0J A;  5J3T A;  4GZU A;  1ISN A;  4MK0 A;  2K00 A;  3TO1 A;  1ZC3 B;  1E5W A;  2GJY A;  2P0H A;  2RNR B;  2OQB A;  3PP2 A;  1BAK A;  2DYN A;  3LJU X;  1SGH A;  1KZG A;  4HB2 B;  2W2W A;  1MKE A;  1M7R A;  2R0D A;  5DHA B;  2D11 A;  2K2J A;  2YF0 A;  2P0F A;  3KY9 A;  1MIZ B;  4PNK A;  3D8F A;  4EMO A;  2D9Y A;  2EJ8 A;  2Q13 A;  2VKI A;  4MY6 A;  1XKE A;  2LG1 A;  3FEH A;  1WG7 A;  1DDM A;  5KQ4 A;  3TCA A;  5J3Y A;  2X18 A;  3ODO A;  2D9X A;  2DX1 A;  1FGZ A;  1FOE A;  2MDX A;  4A6F A;  5C79 A;  5C6R A;  1AQC A;  2KGX B;  1XR0 B;  5C16 A;  5D3X A;  3DXD A;  1Q67 A;  1BWN A;  1FHX A;  2W2X C;  2W2X D;  2LYD A;  2ROV A;  1QC6 A;  2GCL A;  3QBV B;  3PSC A;  1MK7 B;  4HB3 B;  4K2P A;  5JP4 A;  2J59 M;  2NZ8 B;  1J19 A;  1I2H A;  3F5R A;  4IAP A;  2COD A;  1UPQ A;  2UZS A;  2D2Q A;  3AU5 A;  2Z0Q A;  4L6E A;  2UZR A;  3A98 B;  2MWN B;  4YON A;  1DDW A;  2DLW A;  2HTH B;  5HE1 A;  1WJ1 A;  4HDO A;  2YRY A;  2J0M A;  2Z0O A;  3ZVR A;  4H8S A;  2D4Q A;  1Y19 B;  3F0W A;  2COA A;  2QKL A;  2V76 A;  4MT7 A;  2D9W A;  1XOD A;  2I5C A;  2D9V A;  5GOW B;  1U5D A;  1UEF A;  4ZRI A;  1W1D A;  2H7D A;  1Y5O A;  4K17 A;  5HE2 A;  3ULC A;  1UNR A;  1V5P A;  3PVL A;  1DBH A;  1PLS A;  3P6A A;  1EGX A;  1TJ6 A;  1XD4 A;  2YS5 A;  4K81 A;  1H10 A;  3A8P A;  5D3W A;  3NSU A;  1QQG A;  4C0A A;  3O96 A;  1V89 A;  5D3V A;  4ZRK A;  2H7E A;  2DTC A;  1W1H A;  3ZDT A;  3WYF B;  2I1J A;  3WA0 A;  2P8V A;  4DBB A;  2CAY A;  2D10 A;  1TXD A;  1U29 A;  1EAZ A;  4WSF A; 
#chains in the Genus database with same CATH topology
 5CLQ B;  2YS1 A;  2VSZ A;  5C5B B;  3QIJ A;  1X05 A;  3OAN A;  1XCG A;  4F7U P;  1B55 A;  3U7D A;  1J0W A;  3HK0 A;  3NWF A;  5JLJ B;  5KQ1 A;  1DRO A;  1V88 A;  3ODX A;  3KZ1 A;  3HW2 B;  4TKN A;  1ZSQ A;  2I5F A;  2KUQ A;  4OSN A;  5DHF B;  4HAU B;  1ZC4 B;  3A58 A;  2IYB A;  4BBK A;  1RJ2 A;  3D8D A;  1FHW A;  1WJM A;  5D3Y A;  1KZ7 A;  2CY5 A;  2D9Z A;  2Z14 A;  3GYP A;  3ML4 A;  3V5W A;  2XQN M;  1WI1 A;  4A5K A;  1EVH A;  2RVB B;  5CLL B;  4NY0 A;  2K49 A;  2N23 A;  3RCP A;  1UNQ A;  3CXB B;  1V61 A;  1LW3 A;  4GMX B;  1BTK A;  2RSG A;  2Z13 A;  1TQZ A;  2L1C A;  3N7C A;  4HAV B;  3ODW A;  5EFX A;  3SO6 A;  3SV1 A;  2DA0 A;  3TFM A;  1NU2 A;  5FI0 A;  4P7I A;  1U2B A;  3AJ4 A;  2Z59 A;  2BCJ A;  4EJN A;  2E2X A;  2EC1 A;  1WVH A;  1I7A A;  2J0K A;  2KIG A;  1BTN A;  2ELA A;  1Z87 A;  2KCJ A;  2Y8F A;  2EMT A;  4D0N B;  4QJ3 B;  3UZT A;  5LG4 B;  3TW1 A;  1NTY A;  1P5T A;  1RRP B;  1U27 A;  1GC6 A;  4WVF B;  1KI1 B;  1X86 A;  2DHJ A;  2QKM A;  2OTX A;  1T77 A;  1V5M A;  4K2O A;  3U8Z A;  2LOX A;  2DFK A;  4F7G A;  3PZD A;  4GOU A;  2HE7 A;  2YS3 A;  4DX8 A;  1U5E A;  1UNP A;  3PVU A;  1U5F A;  5DIF B;  4DX9 0;  2M14 A;  2RRF A;  3BIN A;  1XX0 A;  1K5D B;  4CHJ A;  3AU4 A;  3P7Z A;  3SYX A;  1FB8 A;  2JP2 A;  1FGY A;  4KHO A;  2GUM A;  1SHC A;  2MFQ A;  3SNH A;  3BJI A;  3M1I B;  1EF1 A;  2DN6 A;  3NWA A;  4IOY X;  2GCJ A;  3MDB C;  1ZM0 A;  3NW8 A;  1MAI A;  4GMV A;  2L2I A;  4F7H A;  4HAZ B;  2K8E A;  4Z2M B;  1N3H A;  4XWX A;  4CHM A;  1MPH A;  2FJL A;  2LUL A;  4A6F B;  1X1G A;  4HAY B;  1X1F A;  2YT2 A;  5J3Q A;  3PVW A;  4Z2N A;  2ROZ B;  2DYQ A;  1NI2 A;  1K5G B;  3DXC A;  4HDQ A;  3KRW A;  5KCV A;  4DXA B;  3FM8 C;  4TYZ A;  2UVM A;  4HAW B;  1GC7 A;  1P3R A;  2ELB A;  2YSZ A;  2PZ1 A;  1ZVR A;  2AL6 A;  2DKP A;  1P6S A;  3TVV A;  2DKQ A;  2P0D A;  3A8Q A;  1UPR A;  1M7E A;  2AEH A;  2R2Y A;  3CIK A;  1LB1 A;  5LOP B;  5DH9 B;  4PQ0 A;  3D8E A;  5M4Y B;  4KHB B;  5DI9 B;  5FI1 A;  2RLO A;  3KRX A;  3KSY A;  4GXB A;  2CY4 A;  1DDV A;  3DXE A;  5LON B;  5D27 A;  3G9W A;  2Z4D A;  3PEG A;  3PG7 A;  4KVG B;  4OT1 A;  5C5B A;  2YT1 A;  4HAT B;  2K2U A;  1MIX A;  1GG3 A;  2MKR A;  5IRS A;  2LOZ A;  1OMW A;  4YL8 A;  1WGU A;  4GN1 A;  3DCX A;  3T06 A;  4QXA B;  4KHA A;  3ULB A;  1NTV A;  2NMB A;  2LKO A;  4HHV A;  1FAO A;  4NSW A;  4QJ4 B;  2N0Y A;  2Z0P A;  2VRW B;  4HB0 B;  2DHI A;  3IVF A;  2YVC A;  2RGN B;  1V5U A;  2ADZ A;  3NWD A;  2EMS A;  3X23 A;  3QWM A;  3GYO A;  3VOQ A;  4A6K A;  4HAX B;  2ZKM X;  1DYN A;  2NBV A;  1AWE A;  1OQN A;  1MK9 B;  2COF A;  1OY2 A;  5HE3 A;  1FHO A;  3MPX A;  2IFS A;  4Y94 A;  3VIA A;  1X11 A;  4HB4 B;  4A6H A;  5JHH A;  3FSS A;  4B6H A;  5JHG A;  2COC A;  4KAX B;  4GPT B;  3SUZ A;  2ZPY A;  2R09 A;  2YT0 A;  3HQC A;  2DHK A;  1W1G A;  3OHM B;  1WGQ A;  4QJ5 B;  2M38 A;  4CYE A;  4WJ7 A;  2Y7B A;  1IRS A;  2KUP A;  2G35 A;  2FJU B;  1U5G A;  5L81 A;  1PMS A;  1MI1 A;  5HE0 A;  1PFJ A;  4ZRJ A;  2I1K A;  5I2M A;  2CRF A;  4EKU A;  2RUK B;  3HSA A;  2DX5 A;  2GS0 A;  3U12 A;  5I2S A;  2Y8G A;  1H4R A;  4IFS A;  2J0J A;  5J3T A;  4GZU A;  1ISN A;  4MK0 A;  2KIE A;  2K00 A;  3TO1 A;  1ZC3 B;  1E5W A;  2GJY A;  2P0H A;  2RNR B;  2OQB A;  3PP2 A;  1BAK A;  2DYN A;  3LJU X;  4L1R A;  1SGH A;  1KZG A;  1ZYI A;  4HB2 B;  2W2W A;  4D6W A;  1MKE A;  1M7R A;  2R0D A;  5DHA B;  2D11 A;  2K2J A;  2YF0 A;  2P0F A;  3KY9 A;  1MIZ B;  4PNK A;  3D8F A;  4EMO A;  2D9Y A;  3B77 A;  2EJ8 A;  2Q13 A;  2VKI A;  4MY6 A;  1XKE A;  2LG1 A;  3FEH A;  1WG7 A;  1DDM A;  5KQ4 A;  3TCA A;  5J3Y A;  2X18 A;  3ODO A;  2D9X A;  2DX1 A;  1FGZ A;  1FOE A;  2MDX A;  4A6F A;  5C79 A;  5C6R A;  1AQC A;  2KGX B;  1XR0 B;  5C16 A;  5D3X A;  3DXD A;  1Q67 A;  1BWN A;  1FHX A;  2W2X C;  2W2X D;  2LYD A;  2ROV A;  1QC6 A;  2GCL A;  2KR0 A;  3QBV B;  3PSC A;  1MK7 B;  4DIX A;  4HB3 B;  4K2P A;  4GNK B;  5JP4 A;  2J59 M;  2NZ8 B;  1J19 A;  1I2H A;  3F5R A;  4IAP A;  2COD A;  1UPQ A;  3FVC A;  4CSQ A;  2UZS A;  2D2Q A;  3AU5 A;  2Z0Q A;  4L6E A;  2UZR A;  3A98 B;  2MWN B;  4YON A;  1DDW A;  2DLW A;  2HTH B;  4KHB A;  5HE1 A;  1WJ1 A;  4HDO A;  2YRY A;  2J0M A;  2Z0O A;  3ZVR A;  4H8S A;  2D4Q A;  3HIE A;  1Y19 B;  3F0W A;  2COA A;  2QKL A;  2V76 A;  4MT7 A;  2D9W A;  4HSI A;  1XOD A;  2I5C A;  2D9V A;  5GOW B;  1U5D A;  1UEF A;  4ZRI A;  1W1D A;  2H7D A;  1Y5O A;  4K17 A;  5HE2 A;  3ULC A;  1UNR A;  1V5P A;  3PVL A;  1DBH A;  1PLS A;  3P6A A;  1EGX A;  1TJ6 A;  1XD4 A;  2YS5 A;  4K81 A;  1H10 A;  3A8P A;  5D3W A;  3NSU A;  1QQG A;  4C0A A;  3O96 A;  1V89 A;  5D3V A;  4ZRK A;  2H7E A;  2DTC A;  1W1H A;  3ZDT A;  3WYF B;  2I1J A;  3WA0 A;  2P8V A;  4DBB A;  2CAY A;  2D10 A;  1TXD A;  1U29 A;  1EAZ A;  4WSF A; 
#chains in the Genus database with same CATH homology
 5CLQ B;  2YS1 A;  2VSZ A;  5C5B B;  3QIJ A;  1X05 A;  3OAN A;  1XCG A;  4F7U P;  1B55 A;  3U7D A;  1J0W A;  3HK0 A;  5JLJ B;  5KQ1 A;  1DRO A;  1V88 A;  3ODX A;  3KZ1 A;  3HW2 B;  4TKN A;  1ZSQ A;  2I5F A;  5DHF B;  4HAU B;  1ZC4 B;  2IYB A;  4BBK A;  1RJ2 A;  3D8D A;  1FHW A;  1WJM A;  5D3Y A;  1KZ7 A;  2CY5 A;  2D9Z A;  3GYP A;  3ML4 A;  3V5W A;  2XQN M;  1WI1 A;  4A5K A;  1EVH A;  2RVB B;  5CLL B;  4NY0 A;  2N23 A;  3RCP A;  1UNQ A;  3CXB B;  1V61 A;  1LW3 A;  4GMX B;  1BTK A;  2RSG A;  1TQZ A;  2L1C A;  3N7C A;  4HAV B;  3ODW A;  5EFX A;  3SO6 A;  3SV1 A;  2DA0 A;  3TFM A;  1NU2 A;  5FI0 A;  4P7I A;  1U2B A;  3AJ4 A;  2BCJ A;  4EJN A;  2E2X A;  2EC1 A;  1WVH A;  1I7A A;  2J0K A;  1BTN A;  2ELA A;  1Z87 A;  2KCJ A;  2Y8F A;  2EMT A;  4D0N B;  3UZT A;  3TW1 A;  1NTY A;  1P5T A;  1RRP B;  1GC6 A;  1U27 A;  4WVF B;  1KI1 B;  1X86 A;  2DHJ A;  2QKM A;  2OTX A;  1V5M A;  4K2O A;  3U8Z A;  2LOX A;  2DFK A;  4F7G A;  3PZD A;  2HE7 A;  2YS3 A;  4DX8 A;  1U5E A;  1UNP A;  3PVU A;  1U5F A;  5DIF B;  4DX9 0;  2M14 A;  3BIN A;  1XX0 A;  1K5D B;  4CHJ A;  3AU4 A;  3P7Z A;  3SYX A;  1FB8 A;  2JP2 A;  1FGY A;  4KHO A;  1SHC A;  2MFQ A;  3SNH A;  3BJI A;  3M1I B;  1EF1 A;  2DN6 A;  4IOY X;  2GCJ A;  3MDB C;  1ZM0 A;  4GMV A;  1MAI A;  2L2I A;  4F7H A;  4HAZ B;  4Z2M B;  1N3H A;  4XWX A;  4CHM A;  1MPH A;  2FJL A;  2LUL A;  4A6F B;  1X1G A;  4HAY B;  1X1F A;  5J3Q A;  3PVW A;  4Z2N A;  2ROZ B;  2DYQ A;  1NI2 A;  1K5G B;  3DXC A;  4HDQ A;  3KRW A;  5KCV A;  4DXA B;  3FM8 C;  4TYZ A;  2UVM A;  4HAW B;  1GC7 A;  1P3R A;  2ELB A;  2YSZ A;  2PZ1 A;  1ZVR A;  2AL6 A;  2DKP A;  1P6S A;  3TVV A;  2DKQ A;  2P0D A;  3A8Q A;  1UPR A;  1M7E A;  2AEH A;  3CIK A;  1LB1 A;  5LOP B;  5DH9 B;  4PQ0 A;  3D8E A;  4KHB B;  5DI9 B;  5FI1 A;  2RLO A;  3KRX A;  3KSY A;  4GXB A;  2CY4 A;  1DDV A;  3DXE A;  5LON B;  5D27 A;  3G9W A;  3PEG A;  3PG7 A;  4KVG B;  5C5B A;  2YT1 A;  4HAT B;  2K2U A;  1MIX A;  1GG3 A;  2MKR A;  2LOZ A;  1OMW A;  4YL8 A;  1WGU A;  4GN1 A;  3T06 A;  4KHA A;  3ULB A;  1NTV A;  2NMB A;  2LKO A;  4HHV A;  1FAO A;  4NSW A;  2N0Y A;  2Z0P A;  2VRW B;  4HB0 B;  2DHI A;  3IVF A;  2YVC A;  2RGN B;  1V5U A;  2ADZ A;  2EMS A;  3X23 A;  3QWM A;  3GYO A;  3VOQ A;  4A6K A;  4HAX B;  1DYN A;  1AWE A;  1OQN A;  1MK9 B;  2COF A;  1OY2 A;  5HE3 A;  1FHO A;  3MPX A;  2IFS A;  4Y94 A;  3VIA A;  1X11 A;  4HB4 B;  4A6H A;  5JHH A;  3FSS A;  4B6H A;  5JHG A;  2COC A;  4KAX B;  4GPT B;  3SUZ A;  2ZPY A;  2R09 A;  2YT0 A;  3HQC A;  2DHK A;  1W1G A;  1WGQ A;  2M38 A;  4CYE A;  4WJ7 A;  2Y7B A;  1IRS A;  2KUP A;  2G35 A;  1U5G A;  5L81 A;  1PMS A;  5HE0 A;  1PFJ A;  4ZRJ A;  2I1K A;  2CRF A;  4EKU A;  2RUK B;  2DX5 A;  2GS0 A;  2Y8G A;  1H4R A;  4IFS A;  2J0J A;  5J3T A;  4GZU A;  1ISN A;  4MK0 A;  2K00 A;  3TO1 A;  1ZC3 B;  1E5W A;  2GJY A;  2P0H A;  2RNR B;  2OQB A;  3PP2 A;  1BAK A;  2DYN A;  3LJU X;  1SGH A;  1KZG A;  4HB2 B;  2W2W A;  1MKE A;  1M7R A;  2R0D A;  5DHA B;  2D11 A;  2K2J A;  2YF0 A;  2P0F A;  3KY9 A;  1MIZ B;  4PNK A;  3D8F A;  4EMO A;  2D9Y A;  2EJ8 A;  2Q13 A;  2VKI A;  4MY6 A;  1XKE A;  2LG1 A;  3FEH A;  1WG7 A;  1DDM A;  5KQ4 A;  3TCA A;  5J3Y A;  2X18 A;  3ODO A;  2D9X A;  2DX1 A;  1FGZ A;  1FOE A;  2MDX A;  4A6F A;  5C79 A;  5C6R A;  1AQC A;  2KGX B;  1XR0 B;  5C16 A;  5D3X A;  3DXD A;  1Q67 A;  1BWN A;  1FHX A;  2W2X C;  2W2X D;  2LYD A;  2ROV A;  1QC6 A;  2GCL A;  3QBV B;  3PSC A;  1MK7 B;  4HB3 B;  4K2P A;  5JP4 A;  2J59 M;  2NZ8 B;  1J19 A;  1I2H A;  3F5R A;  4IAP A;  2COD A;  1UPQ A;  2UZS A;  2D2Q A;  3AU5 A;  2Z0Q A;  4L6E A;  2UZR A;  3A98 B;  2MWN B;  4YON A;  1DDW A;  2DLW A;  2HTH B;  5HE1 A;  1WJ1 A;  4HDO A;  2YRY A;  2J0M A;  2Z0O A;  3ZVR A;  4H8S A;  2D4Q A;  1Y19 B;  3F0W A;  2COA A;  2QKL A;  2V76 A;  4MT7 A;  2D9W A;  1XOD A;  2I5C A;  2D9V A;  5GOW B;  1U5D A;  1UEF A;  4ZRI A;  1W1D A;  2H7D A;  1Y5O A;  4K17 A;  5HE2 A;  3ULC A;  1UNR A;  1V5P A;  3PVL A;  1DBH A;  1PLS A;  3P6A A;  1EGX A;  1TJ6 A;  1XD4 A;  2YS5 A;  4K81 A;  1H10 A;  3A8P A;  5D3W A;  3NSU A;  1QQG A;  4C0A A;  3O96 A;  1V89 A;  5D3V A;  4ZRK A;  2H7E A;  2DTC A;  1W1H A;  3ZDT A;  3WYF B;  2I1J A;  3WA0 A;  2P8V A;  4DBB A;  2CAY A;  2D10 A;  1TXD A;  1U29 A;  1EAZ A;  4WSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...