5KQGA

Co-crystal structure of lmw-ptp in complex with 2-(benzothiazol-2-ylamino)-2-oxo-1-phenylethanesulfonic acid
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
154
structure length
154
Chain Sequence
ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of low molecular weight protein tyrosine phosphatase by an induced-fit mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
total genus 66
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2016-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kqgA00
4Q6BA 1PNRA 1JBEA 2FN8A 2IPNA 3M6MD 3JS5A 1Y1LA 4RK0A 4MR7B 2L17A 3QX9A 2IKSA 1ZESA 4ETIA 4KVFA 9ABPA 2FKAA 3HVRA 2GI4A 4G0PA 1JFTA 4RK1A 5D2CA 1Z2EA 3E3MA 3N53A 5BQ3A 3LKBA 2PLNA 5DLEA 1ZVVA 1QMPA 1QNLA 2L19A 4ZYLA 5FWYA 4DQDA 3RQIA 1NXPA 3IP5A 4ZMSA 5FWXB 5IUNC 2IPAB 1BVHA 3LUGA 4OBBA 1BA2A 2FQYA 1KGSA 3CTPA 3F6PA 4RK4A 5C5CA 1GCAA 1EWKA 3H5LA 2JB9A 3GL9A 3C3KA 3OQNA 3O1JC 1E6KA 1D5WA 1AB5A 4MR8A 3T95A 3R0JA 1JF8A 2PAFA 4G0YA 3FMVA 4E7PA 2VK2A 2KYRA 8ABPA 1ABFA 3E61A 2CHFA 4RWEA 4RY0A 1RPJA 3LMKA 3UKJA 5BR1A 2FLWA 1T34A 2NUBA 4PICA 1APBA 4MR9A 3O21A 4ETMA 5DCLA 1B00A 5JS2A 1KMIY 2V0NA 1M2EA 3M9WA 4Z0NA 3RVMA 5GOTA 3Q7SA 4H3KB 2WY2D 1YIOA 2XDYA 1BDHA 3LOPA 1ZH2A 4MS4A 1JL3A 3DBIA 3MYYA 5C5EA 1DP4A 2JCGA 1C4WA 1XHEA 3LUFA 1YS6A 1A04A 1W9HA 3RVRA 1RXIA 3DGFC 4KZKA 2H0AA 5TQJA 5TE9A 1ZGZA 1ZDMA 3K4HA 4RK7A 2JBAA 2FEWB 4MQFA 3FFTA 3RVLA 3TO5A 3GA5A 4GPAA 5TPZD 1JWLA 4PE5B 4RK5A 1LBHA 4F8JA 4YCSA 4Z4HA 4HNRA 3EAFA 1E6LA 5JS1A 3SAJA 2MSLA 3KCNA 4MR8B 3KLOA 2PL9A 3SG0A 3CG0A 4MYRA 1YK0A 5CNJA 3I5AA 4LX8A 1ZITA 2E4YA 3MMNA 1TMYA 3I09A 2IOYA 4YGXB 1E2BA 1QPZA 4WT7A 4KNYA 1NTRA 1H9CA 4G0OA 3OLYA 1Z12A 5KWSA 3N75A 1DBPA 4Y9TA 1QKKA 5IC5A 1DC7A 4RXMA 4W5RA 3IDOA 4N76A 2QXYA 2DRIA 4UHJA 3H1EA 5T3YA 3DGEC 4N0QA 1JFSA 3KSMA 4W5NA 4RV5A 3GT7A 1DCKA 4EYQA 2CD7A 3MM4A 4YR7A 3D02A 5HM6A 1F51E 4Q7EA 4XAQA 5IULC 4EY3A 2IYNA 3MQ4A 1Z18A 4WUTA 3C97A 3LUKA 4O5AA 3MIZA 4F3TA 1ZN2A 3GV0A 5DGCA 3CS3A 3C3WA 3UK0A 4D6XA 3H5IA 3KTOA 3ILHA 4UHKA 1YMUA 2AYXA 3ILYA 3HUUA 3EGCA 2Q5CA 2QV0A 1M5UA 3CU5A 2PUGA 4E7OA 1USKA 1ABEA 2M98A 4G0ZA 3BILA 3GBPA 3I45A 1USIA 4HNSA 4EUKA 4F12A 4TLLB 3QEMA 4RK6A 3HEBA 3GRCA 4IMIB 3OO0A 3KYIB 2A9OA 1TLFA 2QZJA 3KHTA 1NY5A 1YMVA 1Z13A 3LUJA 4JB2A 3HJFA 2R47A 1NXSA 2WWVD 4MR7A 2PE5A 1PHRA 2L18A 3HUTA 4MS1A 4EVQA 1UDRA 3HDVA 4B09A 3OMXA 4Z9AA 4FB4A 3C6QA 3H5OA 2E4ZA 3KJXA 2JBAB 2NZUG 4RXUA 1CHNA 4LE0A 3W9SA 1DRJA 1TVMA 4IMJB 4MLDA 1I3CA 4MQEB 1ZHHA 4RU1A 3EDCA 3G85A 1FQWA 1DJMA 1NXWA 4G0QA 2RGYA 1LJLA 2AYZA 4RSMA 5JNSA 2FN9A 3SY8A 4HNQA 4XARA 3O74A 4MS3A 4LRQA 2E4UA 2FW0A 4L85A 5JNRA 4NCBA 1RNLA 3VNAA 2R25B 1JFVA 4S04A 4XLTA 1U8TA 2PL1A 4FE7A 5HQJA 4EYKA 3CKMA 4RDCA 5KC8A 1JYEA 5F64A 5I4CA 2MYTA 4EYGA 3FDFA 2PMCA 3I42A 4KV7A 2YHBA 3CFYA 3CZCA 2FXIA 3H6GA 4EYOA 1M5TA 2R48A 2P9HA 4RKRA 4KFCA 4Z99A 1QO0D 5FWXA 3A3KA 2HQBA 4MRMA 3LUHA 3OQMA 3RVNA 4MS4B 3OLZA 3Q7RA 4KQ9A 3T6KA 4ZJPA 2WRZA 4DADA 1BAPA 3HDGA 1Z26A 3A0UA 1IIBA 5GQSA 3DLHA 5IEJA 3L49A 4DN6A 1L5YA 3RVQA 2YHAA 1FFGA 1HEYA 1K66A 2LUOA 2MYUA 4MLCA 6CHYA 4EVRA 4RY8A 4OLAA 3GBVA 3KS9A 4L4UA 1VLZA 5IUKC 3RH0A 3O1IC 5B3JA 2OQRA 1GUBA 1LBIA 4D6YA 1P6QA 3P9YA 5KQLA 1YTUA 4F06A 4TMYA 3HO1A 4XFKA 1P8AA 3DLBA 1AB6A 3H6HA 1MIHA 2JVJA 2R4QA 5KQGA 3N6VA 3QEMB 2WJWA 4OLBA 1JHZA 1XHFA 5EWMB 1U0SY 3EULA 4JASB 2HQOA 1JDPA 5ED4A 4YWHA 1MVOA 4CBVA 1MB3A 2QU7A 5JNWA 2LIVA 3TX6A 1DCMA 2FQWA 1JX6A 2O20A 1OXBB 2MSWA 3GWGA 3Q9SA 3QEKA 1W25A 2HQRA 5IX8A 5KQPA 1C0EA 1F4VA 3OLVA 3O2JA 4H60A 3F6CA 1PEAA 2MSKA 4Z4IA 3QELB 4WXEA 3O75A 3H1FA 3BRQA 3N0RA 3N0WA 4LE1A 1P2FA 1QQAA 1U2PA 3FFWA 2F8SA 4IGAA 3CNBA 1WETA 1KRWA 1QP0A 3HZHA 3OM1A 4NQRA 4F11A 2W42A 2NT4A 1CEYA 3BREA 3EQZA 4ZPJA 1EAYA 5TQ0A 1DRKA 5HKOA 1GCGA 3N0XA 3KLNA 1D1QA 5B3JC 2MYPA 3IPCA 3OLWA 3QLVA 3F7NA 4KQCA 4RY9A 5ABPA 1JLKA 1FFWA 4NV3A 1EHCA 3SQNA 4ZMRA 1Z2DA 4KMRA 4MQEA 4RZSA 5EWJA 4JA2A 3QLVC 4KK4A 3OM0A 1NXOA 1ISSA 1DC8A 4EGSA 3BBLA 1PEYA 3NNNA 2VUHB 3RVSA 1QO0A 3CZ5A 5BRAA 5IUJC 2ZAYA 4MGEA 1FFSA 1PUXA 2RJNA 1A0OA 2VUIB 4ETNA 3VNBA 1ISRA 1JDNA 2PKXA 3MA0A 4W5QA 1CYEA 3MF4A 1S8NA 2P4UA 5DTEA 1RZRA 1VPWA 5HSGA 1SXIA 4MR9B 2A9QA 3CLKA 3UUGA 5DKFA 4MQFB 1QQBA 2WJAA 4Z4CA 3O1HB 1RZRD 4O1HA 3NNSA 1URPA 3FGZA 4KRFA 4YS6A 5BRJA 4RS3A 1DBQA 2H3HA 3QLUC 4PEVA 3LUCA 5JNTA 2FSPA 4QYMA 2BGGA 4XXHA 2M1ZA 3BRSA 3DZDA 4OG2A 2QVCA 2JRLA 2CHEA 4M88A 5IBQA 3H5WA 3KG2A 3EODA 3T38A 7ABPA 3JPYA 2VYCA 1Z15A 2F8TA 1DG9A 2JVIA 3H5VA 4PYRA 5CHYA 3S99A 3IPAA 3KKEA 4QYWA 1NXXA 2FMHA 3M9XA 4MS3B 3IP6A 5CNIA 4ML3A 5KI6A 2FEKA 1E6MA 3B2NA 4N0PA 3NNDA 3NHZA 2PJUA 3CG4A 3EJWA 3N8IA 3NHMA 3HM9A 1MAVA 1NXTA 3OLXA 4Z4EA 5TQ0B 3CRNA 2FLKA 1BDIA 3A0RB 1OXKB 4IRXA 4JB0A 4MAAA 3ROFA 4XASA 1VRVA 4YRZA 2JK1A 3KYJB 5E3JA 2B4AA 3H1GA 4MS1B 4N03A 3URMA 1K68A 2RJOA 2JVKA 3CHYA 1DBWA 3HCWA 4QPJC 2QW1A 1D1PA 4NICA 1U04A 1GUDA 2CWDA 3ROTA 1JH9A 2HJ9A 1YVUA 3TD9A 1L5ZA 2HPHA 1EWVA 4Z4GA 4IF4A 1R8JA 5TPWA 4PZ0A 4N47A 2FVYA 1SD5A 3RVOA 1J56A 4YV7A 2FMFA 1PNTA 4KPYA 3JVIA 3LFTA 1Z17A 3QELA 4JP1A 2LP4Y 2FEPA 1ZH4A 2LBPA 4NCAA 3QLTA 5FWYB 4N41A 2A9RA 2FMKA 4MRMB 3D8UA 2PUEA 4D74A 3NBMA 2FQXA 5FBKA 4YO7A 2ZWMA 2PUBA 3TMYA 2PUDA 4G97A 4H3HB 2IPMA 2X7XA 4QICA 4RKQA 2GBPA 1YS7A 2PUCA 5IEBA 2RDMA 5CNKA 5JNUA 3IP7A 2NT3A 5T7BA 5PNTA 3LTEA 1QP7A 4LDZA 3H75A 1ZY2A 4O1IA 2WMYA 4KK3A 3Q41A 3FFXA 3RVJA 2QSJA 1RXEA 2N9UA 1DCFA 2IPLA 2NZVG 2PUAA 4YP9A 2LPMA 4Q6WA 3IP9A 3LUDA 4LDAA 3C3MA 3TB6A 3A10A 1YK1A 3JY6A 3LKVA 4P1ZA 5CNMA 3T8YA 3JTEA 5JNVA 1KRXA 4KREA 3Q7TA 1FSPA 1A2OA 1LJUA 4WZZA 3RVKA 3HS3A 4Z4FA 3QLUA 2HSGA 2TMYA 1U2QA 4G86A 3LUAA 3K9CA 5EWLA 4FE4A 2I6FA 4MPTA 1DZ3A 3EQ2A 2E4WA 3F73A 4TN5A 3L6UA 2MYNA 5FBHA 4GNRA 5TPZA 4WWHA 5TQ2B 2QVGA 2QR3A 1MB0A 1SRRA 2L2QA 3HSYA 5KC9A 1EWTA 2ID7A 3GYBA 4EVSA 2ID9A 1JYFA 4RXTA 3HK2A 4W5TA 2E4XA 1D2AA 2E4VA 1NATA 3HV2A 3O2QB 2WB4A 5TQ2A 1M2FA 1TM2A 4JOQA 4WXMA 3SNKA 3Q15C 4LE2A 1ZGGA 2A9PA 1Z16A 4TLMB 5EWJB 3O2SB 4OTZA 4IILA 5EWLB 1Z25A 1VKRA 4HYEA 2J48A 1XWWA 2B1JA 5TPWB 1QP4A 1TJYA 4Z9BA 6ABPA 1P6UA 2GX6A 3H5TA 3RVPA 4S05A 4P98A 3QX8A 2PUFA 1ZAYA 3JVDA 4LZLA 4G0XA 3QK7A 1D4ZA 1BDJA 4JAVC 5EWMA 3G1WA 1SXHA 3SM9A 2FMIA 4W5OA 1GLGA 2FTKE 2OENG 1EFAA 3OO1A 4G0MA 1USGA 3HXMA 2GWRA 4YLEA 1SXGA 3JPWA 3OQOA 4OATA 5KQMA 2IDMA 1NXVA 1LK0A 3OMWA 2GKGA
chains in the Genus database with same CATH superfamily
4MVJG 4QQFA 2BI8A 2Q3DA 2I80A 1Y9EA 4ODIA 2GN6A 3AC0A 1HBJA 4KIFA 1EGVB 2CVPA 4ZAYA 3NH6A 4IG9A 2HCTA 5IVIA 3EMBA 1JQ3A 1MC5A 4KWHA 4CV1A 9ABPA 5HZGA 5KNLA 1XVUA 2HD4A 2YVAA 3EXHB 3EXIA 4G0PA 3DAFA 4PZLA 1NVVR 4WN3A 4ZZ2A 5TIIA 3AK4A 5DNWA 3TIFA 1DQYA 3Q3JB 4YP0A 1AY0A 4KSBA 2DTEA 2K2WA 2E48A 2ZAGA 1II8B 1RJEA 1R4ZA 2C2KA 4MSUA 4JGIA 4WY5A 1JI0A 5J5VA 4CMHA 4E4YA 1X7WA 5FWXB 4PIMA 5IUNC 1UEJA 4REMA 2IKQA 3RADC 2YWDA 3IIIA 3QTBA 4OBBA 4CLRA 2W8ZA 3E1GA 3BSYA 5JDIA 4JOBA 4QLBA 2ZZNA 4MW2A 3SC6A 3CTPA 1T1GA 2C29D 4ZU1X 4B5KA 1MDBA 4UOEA 2QMUA 3FLBA 3G2KA 2B3DA 2PEZA 4ZQFA 4P82A 4NC9A 3O1JC 3OQNA 1D5WA 2X3FA 1GDHA 1GIAA 5JI3E 3G3EA 3RAPR 1MH9A 3A4IA 4Y6QA 4B80A 1SBZA 2PAFA 5KOYA 2BMAA 3IBTA 2RHTA 1EJ2A 1WMSA 4KVZA 5KKCA 2J9RA 4JI7B 1EH5A 2E7ZA 1P5HA 3GP3A 5BR1A 4G2TA 5FEMA 3O93A 4PICA 5FFMA 2POQX 4LZNA 3Q8LA 1SQ5A 2UUAB 2VHZA 3GLHE 4ETMA 1JDSA 3NKFA 3THYA 4PIVA 5BWOA 3ELWA 3P97A 3VYWA 1JYSA 4GS5A 3U3XA 3DSRA 1HQYE 1T35A 3C7DB 1TQ2A 4GZLA 3DTVD 3FYCA 2O05A 4J0JA 4OEHA 3VR5D 2JAUA 4XWWA 3AU8A 3MYYA 1GN9A 3FF4A 5FUBA 4LISA 3S2FA 3H42B 1VYTA 2CGEA 2R79A 2QN9A 4REOA 3W4JA 1ZZGA 3U7FB 1RXIA 3IQXA 4KU4A 2DT5A 3DGFC 5CB6A 2ZYWX 3WYEA 3L41A 2I6SA 3PRHA 3OJCA 1X7YA 4JB3A 4YCAA 2F64A 5TNXA 4Z5XA 5A0VA 3OCXA 1A69A 3ND6A 3LT4A 4HLNA 3IUYA 1VYUA 2H4JA 2R44A 3CZPA 4DR5B 1OZ0A 3BF8A 1UBRS 3UHAA 5AUQA 3GA5A 4DIBA 3TECE 3KFXA 2JDID 3KAQA 3WRXA 4NBVA 1SBHA 2O2SA 3HJTA 3ZQKA 2IYOA 3BT7A 1ND5A 5ALMA 3VBCA 1CUVA 4BLQA 3W8DA 3PEUA 3DZHA 4NESA 1OT3A 2I3AA 1FMTA 3IPRA 5KSOA 4X60A 3FA2A 4KB5A 1TZMA 4EKIA 1A5BB 1A95A 4LX8A 1VFNA 4YQYA 2DBQA 3E1SA 4DPLA 3DDZX 2RHJA 3IBSA 4H2DA 4HAWA 4OGWA 1E2BA 3A2MA 4H0CA 1V9SA 1H9CA 1R4MB 1TRKA 2GAFA 1IXYA 1YDEA 3RS8A 2R1UA 1QGAA 1LLFA 5A4MS 4N40A 4ARIA 3L8CA 3I9MA 2OTCA 1L7XA 4ZHQB 4RMNA 3WLNA 3PLRA 3MQ2A 3C6ZA 5CX4A 4D92A 1EK1A 1OBHA 1XJQA 2IV3A 3RUAA 5EXXA 3GT7A 4U00A 2J3HA 5HM6A 4MUIA 2AQIA 5DBEX 3IBGA 1Q3HA 4JBNA 1OLOA 1Z18A 2X22A 3R3HA 5AIAA 3A27A 3RYFA 2O8BA 5ALSA 1U0TA 4EFNA 1TTQB 4YH1A 1Z36A 1ZOSA 2DOKA 4RJKA 1JLRA 3HSSA 3FTQA 3F96A 4TWBA 5IANA 3MWDA 3T4EA 4UHKA 5KTMA 2JJ2A 4YEDA 2M6LA 1GL3A 2AK3A 4F2HA 1L9XA 1UOQA 2ZBGA 4PZAA 2NM0A 2VRCD 1WV0A 4MMZB 2WE8A 1L5HA 5EPUA 1K75A 5EE1A 4P3OA 4WA7A 1MJGM 1RBMA 1NUAA 1XJ0A 2D7CA 3SSNA 3AHEA 5IVKA 2O3UA 4CIWA 5BN4B 4Y30A 3FWPA 2G07A 4K9LA 1UBGA 2OXEA 3GGGA 4Y2SA 4DPMA 4BO8A 5ITZB 3OM9A 3OWOA 2XUAA 4FX2A 3VXKA 1CD5A 4NENA 3I9V6 4E5KA 5LQJA 1DAOA 1WMEA 4CEIB 3I9FA 4ZTUB 4RLQA 3L7NA 5AI9A 5HDQA 2PMWB 4GC9A 4RPCA 4DG5A 1O97D 3ZWMA 3B7WA 1V5IA 1RWXA 3VR3D 3I58A 4ZREA 3QENA 4HLDA 4UAUA 2ZWOA 4D80A 4KUGA 2RIRA 3LRXA 3HYLA 1R16A 3MCAA 2FETA 1XEXA 2Q0QA 4PGGA 2JFFA 1LRJA 4G9EA 5AM1A 4MEBA 2ZTHA 5DMHA 5BUQA 3DMPA 4NAHA 2R11A 1A1SA 1EUDB 2QN6A 4X1YA 4WQMA 1QIHA 1U63A 2XYHA 1I7LA 1RPAA 4RSMA 3UB2A 4Z86A 3L05A 5IXYA 3NTVA 2FKNA 3TIIA 3JV7A 1WW2A 2C3YA 3R9KA 2DFDA 4PQRA 3MCUA 4G1BA 1W47A 1OAOA 3HY4A 5H8WA 3ZV7A 1Y37A 3NHBA 5AWFC 2BGJA 3DE4X 5HKBA 4S04A 4XLTA 3ZNPA 1ZOIA 3TNLA 4B85A 3ND9A 5HQJA 2IEAA 4FFDA 5DNCA 2QBYA 2ZS7A 1K4KA 1LTQA 1YOVA 1YQEA 4IHJA 4KO4S 4HQLA 3A1VA 4OU5A 1UXOA 4W6QA 3W9UA 3SI7A 1D3AA 3JRXA 3OI7A 1E6EA 1OZGA 4UPEA 2JLRA 3FGPA 4RMIA 4RF5A 4LXXA 3OLCX 3VYVA 4ZV4A 3BXZA 2C78A 5BQOA 5M34A 2JD2A 4LY0A 3SCZA 5KDOA 1IEVA 4Z99A 1QR2A 4F4DA 4QGGA 2XGGA 4KNVA 4BRZA 4MI1A 4YJKA 4MV9A 2RGRA 4QFCA 1A7JA 1F1BA 5DM1A 4DARA 5C1IA 2W83A 3OZUA 4P7BA 4QUIA 4MS4B 4O2AB 4ZVUA 1BFKA 1IU9A 2ZWPA 3BTSA 3H1AA 3Q7RA 4LHSA 4MWBA 1N78A 1X8LA 4YRAA 3NASA 1JI3A 3H2JA 4UMVA 1HG0A 4WLVA 4D41A 3VUEA 2VQFB 2GZRA 3LRPA 1M6HA 4NRDA 2IS2A 1U1DA 4OU4A 1WDLA 2QD4A 3ZG6A 4E22A 5LD2C 4RAQA 3TXXA 5J4KA 3I62A 4LYDA 5FJIA 1LZKA 2RGAA 4EA9A 4HI0E 3WL7A 1XF9A 1I7SB 2P90A 3FBTA 4NCXA 4ZCMA 1P4GA 3LNTA 1ZICA 3N0TA 1CUYA 3COYA 2CB9A 3L9WA 4OOEA 4TMYA 5B1EA 2DBYA 3HYCA 3UGJA 3PNMA 2YVUA 3ZHQA 2CYBA 1UFVA 3ESBA 1Y1SA 1NVEA 1R0XA 2GCPA 2YDXA 4BPBA 1FJGB 4WD3A 4UVDA 3BIOA 1M0TA 1XZLA 3AILA 3CO5A 3VJKA 1ZU4A 4YWHA 4LRWA 5TMDA 5H02A 4KFSA 3BGIA 1DBVO 3DQQA 1MO3A 2CZGA 4CPDA 1K5GA 4R8LA 2IFTA 3QE9Y 2X4LA 4CL2A 4HDOB 1XPUA 2XA9A 2EL9A 2H2HA 5KQPA 3Q9SA 1WDWB 2FV8A 1FL9A 2C03A 3C7TA 4PXAA 4D8TA 4YMSA 1Z33A 5BV8A 7ADHA 3F6YA 3GEHA 4D3XA 3AESA 2HSZA 2XUFA 5G1PA 1TVEA 1ZGCA 2IS6A 3BRQA 2J6HA 2XGSA 1Q6YA 2JLQA 1FFCA 3GNLA 1EFKA 1PNQA 3U3OA 3LQ2A 5JJ5A 1X7YB 4J4HA 3OM1A 2X0NA 3REOA 1BVUA 4AUMA 4JV5B 4WZBE 3WSWA 2GTPA 1U0HC 3BREA 4NMHA 2NAPA 2J5RA 3RABA 2ZUVA 3KSBC 1YONA 1Z06A 2EJUA 2HA6A 4MVXA 2NPFA 1EXWA 5HKOA 2AE1A 4IOJA 4NI5A 1R0RE 1RKVA 1UFKA 2WD8A 2AFIB 1GU1A 4PZYA 1ZJJA 3OEED 3TW8A 1E79D 3EWIA 1Z34A 2OEPA 1RE1A 2XLCA 3JQRA 4RABA 3SQNA 4B2LA 1A5TA 4EF6A 2FN7A 3ONWA 4KIJA 5EUBA 1O5TA 1E1CB 3GRUA 2IIQA 1YU6A 1WHTB 2H7XA 5C51B 3PQCA 1ISSA 2YY6A 2FW7A 3FG9A 3CWQA 4ZRNA 4L0CA 1SJ9A 3MFQA 5K2OA 4NYMQ 2AFRA 1WD7A 2QS9A 3KBBA 1ESMA 4BLSA 5JY6A 5F2KA 5LPNA 1J8FA 1BHJA 4DNPA 5K0CA 4JC8A 1ISRA 4TYMA 3U3RA 1IVNA 2PZMA 3EGOA 4O29A 3UF0A 4DV2B 1UBCA 3A3YA 4MUXA 1L7DA 1WB4A 5BW4A 2XWJI 2PU5A 5AW7A 3CLKA 3K5PA 4IHJB 2Q27A 4F04A 4RETA 1GP2A 4EG7A 2ET6A 2WYHA 1YHZA 2FPIA 2I1QA 5EY5B 5KB3A 3BMXA 4IJMA 2PS1A 2QRJA 3BHJA 1GUZA 3E5NA 2ACKA 4WLEA 5GJVC 1QLJA 2J5XA 2W5UA 3U0BA 2ZZMA 4KRFA 3O4JA 4QFMA 1WE2A 4GXQA 3Q12A 2EQ5A 1QTQA 2QVCA 4GIBA 1ZI8A 3QFSA 3W2HA 2ZIEA 1P9NA 4HV4A 4E15A 3EODA 3KKZA 1XDGA 5KVCA 4CQJA 5AKYA 2FRXA 4L95C 4G8DA 4GWLA 1X3SA 2EBWA 3I8SA 2PNFA 1WVMA 1ZD5A 2JIDA 4DKJA 1ZJ4A 5AKZA 3UAVA 4BEJA 2PJUA 4JJ7A 4B3XA 1W5BA 2V7VA 3OOWA 5EIAA 1GPKA 3Q98A 3V34A 2FFJA 4A0RA 4F9TA 4EJFA 2G83A 2EU8A 4FFOA 4QLAA 5CYOA 2FE4A 2WLTA 4XWKA 3DCIA 1R8SA 2XCRB 1Z6TA 1NYLA 3A31A 3VR3A 1GGVA 1QYDA 4KUHA 3DYIA 3H11A 4QGBA 1TZKA 3ZWNA 1XZIA 5H4HA 3U60B 1ZIPA 1THMA 1W0JA 1Y48E 3K1AA 2XWQA 2Z1MA 1WW8A 4BX2A 4MW9A 2BFDB 4PN3A 5JSFA 2HA7A 4TKUB 4U5QA 3U7HB 2WSSD 5ETJA 1N3YA 3OZEA 3Q5DA 1OU0A 2Q5HA 4EKEA 4ZK2A 4FR2A 5DCYA 1YS9A 3TD2A 2NZJA 2BT4A 2EWMA 1B74A 2A9RA 1UDBA 3EVZA 1GA4A 2I71A 3PJDA 1PU2A 2HF7A 4KODA 3WTBA 1P4AA 2OA0A 2I03A 1U8YA 3BH6A 1IWPB 2QQEA 4YRTA 1Q16A 3GT3A 3ZKAA 1HR0B 2ZWMA 3HTXA 5ESXA 2VPZA 3AVXA 1OBFO 4K5QA 2IPMA 4LUCA 4N8DA 4Q3KA 4LW8A 4RHCA 1CQZA 4KFUA 3WNCA 2E5FA 2EJTA 4HDCA 2WSLA 2CC2A 1CRWG 2R5WA 2YXEA 3HDHA 4WCFC 2JDIA 4TKLA 4YUWA 1U7PA 3NHFA 4LMPA 2X3UA 1DJLA 3DEHA 4HSGA 1Q0UA 4RA6B 1J8YF 3MJ4A 3NIFB 1ZY2A 1UPAA 1O95A 1ZNYA 2AZ4A 2X5NA 4ZVSA 4F6LA 4WBNB 1D0IA 1OGJA 1H1LB 2G4LA 2Q6VA 5MFPA 2D7JA 3NALA 3SJ7A 3PKIA 2V7XA 1JG4A 4G25A 3T0GA 1TZ2A 3CE9A 4MAFA 4ZQGA 2NZVG 3GRYA 3O8BA 4D44A 4RKWA 2ZG6A 4A0QA 2WJJA 4LWOA 3ZU3A 1GAQA 4DWOA 3OZIA 3MT8A 4EB6B 1P80A 4JJAA 1N0IA 3G68A 3A14A 5K8LA 3R3VA 1A2OA 4GRDA 4J76A 1MJFA 1B6SA 2RAUA 4IZ6A 2CL7X 5IABA 1TYAE 2DB3A 2FFAA 2GZSA 5T3UA 1ODTC 1L5LA 3EQ2A 3R3WA 1NJ6A 1SOVA 3REQB 2VSYA 1X8KA 1Z3IX 3N8KA 1M3SA 3BWCA 5IRCD 1FUYB 1XTBA 4JWKA 1Y5MA 3ABRB 5DRTA 2QLJA 3G7UA 5CCXA 2QV7A 2I87A 2CXHA 1G1AA 3EY9A 5C53B 2ZI4A 5F7JA 3MOIA 3KKNA 3RBXA 4P80A 5KMGB 4OXYA 1M2FA 1V96A 4GOXA 5AOVA 3SNKA 2JFHA 1T6BY 4OHUA 3DHYA 2AC2A 5J2UF 4YPVA 3SGLA 4IILA 4QC2A 5JIBA 3UHJA 5LU9A 5FUWA 3ZBTA 2B1JA 1IEXA 3R7FA 4Z9BA 1FNBA 4DMHA 2HH9A 3MXTA 3G82C 4GOJA 2C2GA 2PUFA 2N3ZA 1PT9A 1A3CA 3PHLA 3WMXA 4C2AA 2E3JA 1JR3D 3AY3A 3K0EA 2YJGA 3MUFA 3R6WA 3JVUA 1E3LA 1GLGA 4I1OA 1O7JA 1Z83A 2EV9A 3CQ9A 1N5OX 3G02A 3A32A 4YRLA 3RIXA 3GJ5A 4I0WB 1HA3A 4JMPA 3AEYA 1SM4A 3AF1A 1KJQA 1N2BA 2GKGA 2FN8A 2W43A 4Q37A 3AFIA 2JIBA 2WM2A 4JIMA 2FPPA 4ARCA 4NBWA 4L51A 2WYWA 5T8KA 3UAYA 4ETIA 4HNAA 1A9XA 1U1FA 1U8EA 3EZXA 2KBFA 4EHFA 4E1AA 1AK2A 4MW7A 2VJMA 1L7OA 2Q3EA 2PX5A 3KPWA 3E9CA 1ZCFA 1XYVA 5ENZA 1XT6A 2QGZA 2LE0A 1EVLA 2ZJYA 4WNCA 2JS7A 4RL4A 3HP4A 1JDBC 3LZCA 1ONOA 5EJ7A 5K45A 3R3XA 5B2FA 4GLLA 3EISA 4HQNA 1QFZA 1XZNA 2EWVA 1OWLA 1Y4UA 1XRNA 3ZS8A 2GSDA 3HBLA 2YFYA 4QJ5A 4Z2AA 3O8DA 1H42A 4JELA 5FPTA 1CUCA 1PSWA 1FLAA 2EX4A 2PJRA 1RHKA 2PPLA 1L3CA 3EFBA 3RTGA 3AJEA 3B1KA 3P94A 4ZALA 5F9FA 4JBGA 3TX2A 3UKJA 4RIGA 2BP7A 4OQFA 1GXSB 2I2XB 3HVIA 3CVVA 3ESDA 1C0IA 1VPEA 2H31A 4CMEC 1DFIA 3WFZA 1P7ZA 2AFHE 1H2EA 4FJ0A 5F2EA 1JTEA 3HSKA 2GO1A 3DZKA 2UYYA 4N0MA 4Z0NA 3BD6A 3CW8X 3AHGA 3KCQA 3VJMA 3GXBA 2XF2A 4EW2A 3LCJA 2WY2D 2A3NA 2PTHA 2QX6A 2A94A 3CKLA 4NY1A 5DWDA 4YRBA 4IYJA 5ADVA 1AUPA 1XHLA 3CPSA 2JIQA 3NT4A 4H4EA 4NP6A 5GONA 4BAUA 4JXXA 3WC4A 4B17A 2GUWA 4LY6A 3GG2A 4OHCA 2PXCA 3UHPA 1Y3HA 3GEIA 1TKBA 3M2PA 4LRUA 4WOPA 2W2NA 2GPNA 1F17A 1P75A 1P4JA 4N3GA 5DBHX 2CK3D 3G9TA 3ZC3A 4ALKA 2GJKA 1FP2A 3EDQA 4D2IA 4M22A 2IW3A 3I6MA 2BFBA 2FEXA 4Q3OA 1U02A 2PWZA 4HGRA 4QLOA 3ZJ5A 1PGNA 1U6IA 3ZR4B 2O8EA 1JQDA 3K09A 2Y6VA 1J20A 3MTIA 3SQLA 1MAHA 3BE8A 2FEWB 4CG3A 5ARBA 3AF2A 4MVJP 1IVYA 1CVRA 1YO6A 5EQTA 2G71A 3LLUA 3KQUA 2FEMA 3U5ZB 4B4WA 5E38A 1O6GA 3IV7A 3DF7A 3OIVA 2GEKA 3QYPA 4KI7A 4YUZA 1QX3A 1KI7A 3VKFA 3R9WA 5B7PA 4Q7QA 3I5UA 4PLGA 4TTRA 5DLDA 5EXTA 3SG0A 4AJHA 1Z45A 3KQYA 4YAGA 4ZJZA 5JWRA 1K5PA 1RM4A 2QP4A 4YIHA 1XVVA 4B5LA 1CDZA 3C4JA 4A3SA 1EYZA 3PUJA 3QJGA 4D56A 4E94A 2E4YA 3L7OA 3IR6A 3O1LA 1XMQB 2CXPA 3OF2A 2ZBRA 2IHZA 4AZSA 2RAVA 5IW8A 5AKGA 4IY1A 3RSLA 4DBLC 5E7MA 4I50B 3UJDA 3RF6A 3AOEA 3WHKA 2ZKLA 3N75A 3LZDA 3LXXA 3R24A 3PX7A 1A4RA 1TW2A 2ODNA 2ZIZA 1T4GA 4YXWA 3ROZA 3I1YA 3IDOA 1AU9A 4X6YA 3UEOA 3GQVA 3ZDCA 1FFHA 2VRWA 4XIYA 7MHTA 5I4IA 3H1EA 2Y27A 3ACDA 3JU3A 3WRVA 2Q6KA 3ER6A 3BGSA 4C07A 1N0HA 2Y0DA 4IHJF 5AOAA 5LXTB 1F51E 1OX4B 1WDKA 4FUTA 4PV7A 4F4UA 3TR0A 1Z4LA 2OWEA 1WKVA 3I05A 2EP5A 4YCJA 4I8DA 4JGGA 4N65A 2IQIA 1I01A 3G8DA 1NPDA 3GFGA 1KFKB 3PRJA 1B6GA 1A7KA 4D0LB 5I7OA 1RVV1 2WWTA 1TF2A 4Y6OA 3ILYA 5ECGC 3JQGB 4PO1A 4Q19A 1S4QA 2NW6A 1YRYE 3R5FA 2YRXA 4Y2HA 4FPXA 2YZMA 1ABEA 1AD2A 4R2XA 3QMVA 1SD2A 4N4AA 1Z2CA 2ATEA 2A57A 2X13A 4URVR 4IS3A 1K4YA 2ODQA 3OX1A 4RIFA 3M5WA 4HXFB 1KKLA 2YJTD 1VE9A 1ZGHA 3C8UA 3KC2A 1ZOLA 5DULA 4I7EA 4TWAA 1TK3A 3DMHA 3HJFA 4KKXB 1KQ3A 5ES4B 1QB7A 4Q15A 3WJAA 1NXSA 1GZVA 2ZI7A 4L9RA 3RVDA 5JALA 1P5RA 1XCLA 1ES9A 2GN0A 3FBWA 4DEYA 1M1XB 3BB3A 4HXGA 4MVJA 1NUQA 3HDVA 5LM3A 5AI8A 3QXSA 4JBWA 1YZFA 4X3OA 2CFCA 5B3AA 3ZLTA 3BFXA 1XTKA 3VAZA 3IJ5A 5GINE 2IGBA 1GD1O 1ZUWA 1CQXA 4I5GA 4QRHA 2XYRA 3LVBA 2Y0PA 1F3LA 3ABQB 1DXHA 2ZR0A 2COKA 3NEPX 4FQ7A 4L7QA 5LZ9A 1KBOA 3SFTA 2JIZA 2B5OA 2PXHA 4EMTA 2EEPA 2OSVA 1NXWA 2DHEA 3JWEA 5TRTA 1MQ8B 4MRSA 1C8LA 4WESB 4BMCA 4XWGA 4ER0A 5LQNA 5LWHA 2QUKA 1YACA 2FX5A 5E6SB 3R20A 2NMVA 2GN8A 1XROA 4HNQA 1RMYA 1I9CA 2VBGA 4O4IF 3OOJA 4XFDA 3NOXA 2FWIA 2HK9A 1P9LA 4DAEA 4KQ6A 3SSMA 2HRZA 4L85A 1YR7A 2O3JA 1A2QA 3Q85A 3LDAA 4LXUA 4MGYR 5TXGA 3R7BA 2WD9A 5CTAA 1JU4A 1NFRA 4XSGA 1Y5IA 3OFJA 1TMOA 4P2BA 3LF2A 3LQRA 4O59O 3LTNC 2C7VA 1FUUA 5FBZA 4PLWA 4R71A 5ICCA 2ZGVA 3O4HA 1FVHA 1YR1A 4A82A 5AHXA 1C30B 5DWVA 1O95C 1L1RA 1ORDA 4D9MA 2JIRA 1M5TA 3WQBA 1W29A 1QO0D 3V8VA 5TVGA 3EXHC 5CT8A 2ZE5A 4A9AA 4F5DA 1U7XA 2DHCA 4KDEA 4MRMA 1NW5A 2HI0A 5KHAA 2FN4A 1WKBA 4AP6A 4YYEA 4BMYA 4BUCA 3BL5A 1IPEA 1BAPA 1DADA 4BZZA 1PNVA 3PFWO 5GQSA 3DLHA 3HH8A 1UXHA 3FHCB 3NCTA 2Q0HA 4YJFA 1FFGA 3R0ZA 3GVXA 3KXLA 4K2AA 2A4MA 4WJLA 4RY8A 1KU6A 1W44A 2GESA 3EF0A 3PCTA 1FVFA 2CLDX 3K94A 2DHRA 1UJ2A 3MYRA 1IEQA 5TGDA 2E37A 2Q4TA 2VDJA 3OCZA 1DT5A 2EGUA 2P7IA 2QR2A 2NLOA 3BJIC 4HR7A 4P31A 2IYEA 3QUBA 4EIWA 1H9BA 4Z7QB 2HU5A 2XMSA 3EMVA 5EMKA 3L8DA 1YHNA 3QPCA 1QHSA 3G23A 2GNPA 4KO3S 5CXUA 3QEMB 4NPAA 3WKAA 3S1AB 4Y9UA 1QU2A 5ARCA 3FXAA 1DVRA 2M6SA 5D7NA 1CZNA 4LOLA 3ZIUA 4UMEA 5K8CA 1JLHA 1Y3DE 1Z4QA 1MCZA 2D7DA 1J25A 2W37A 1ZNXA 1XDWA 1OXBB 3F90A 2LKDA 3I0MA 3ONEA 3OZVA 4B4OA 4MYCA 3HJUA 2HPAA 4LQLA 2PK3A 2H59A 3QPUA 5H3LA 4DSNA 5I7FA 1A2KC 1QIKA 4NMWA 5IK2A 1W34A 4PVDA 4C7OA 1G8YA 5AVZA 1YDHA 3BHIA 1VI2A 5BMVA 1R10A 4J8PA 3LWNA 5MHTA 5ILGA 4DLXA 5A4FS 5AFSA 1WETA 4Y8VA 1SCUB 4QYXA 4I1SA 4NQRA 4MXDA 3IVXA 4GPD1 1GKKA 4BTVA 4E5YA 5IFKA 1M2WA 2WKSA 3PGMA 1EP3B 4URXR 4OMUA 2PLRA 3A6ZA 1SU7A 2I76A 3DD5A 4LF6B 4NHOA 3OTQA 1MTZA 3HYSA 3M5DA 3RTEA 1PQUA 4UQPA 3HMKA 5KKNB 1C3OB 3KAJA 1YRHA 5BV2P 2BYTA 2O19A 3FBGA 2NAFA 1B2RA 4WPGA 1XL0A 3JQFA 3NKLA 1A8SA 1NOKA 1C0LA 1CZLA 1EFPA 1KDPA 1T6YA 4MHOA 4QDKA 5EI5A 3U48A 3BBLA 3THXB 2VA9A 3G7NA 1QWOA 4DSAA 3DBRA 2OOKA 4AP5A 3W5UA 5I3CA 5F73A 5BMVF 2YBEA 2DQKA 2ZULA 5B1SA 4URHA 1O58A 5KYUA 1RZRA 4JYPA 3R74A 5KPJA 3DLIA 3T9CA 5LQDA 4YCLA 1H2WA 5U4XA 3PUXA 3TIXB 2JAHA 1IY0A 1PV1A 2HEIA 5C7LO 4OP2A 5JEEA 2NSDA 1CLEA 1WQ1R 1NC3A 3BICA 4B6QA 1R74A 2ZRDA 2DHDA 3EF1A 2JBHA 3OLQA 4LJ5A 4UVHA 4HS9A 4AJEA 1DRUA 2ECPA 1ABBA 5U9CA 1VBFA 1WXIA 2BAGA 2N42A 5DNDA 5JNTA 3IP1A 3E27A 2OFPA 4G81A 1IK6A 1DDOA 3UT5B 4QNMA 1E6WA 1ZSNA 2FVXA 2YNMC 2ZE8A 4QU5A 1GVNB 4JOSA 3F0TA 4R1SA 1PUJA 3ZOKA 2I33A 3AG6A 1KZGB 1KVRA 4B31A 1ZIXA 1JKJA 1HXHA 4X3CA 3GRPA 3GHYA 4NATA 3RCBA 2Q6IA 3T1OA 1PG5A 4GBGA 5CNIA 3WDSA 2ORIA 4OXXA 3WMWA 1D8AA 1NUHA 2F59A 3IUSA 4V3CA 2XSZD 1ECLA 1FRNA 2Z2IA 2ZTSA 3DM5A 3IOBA 2QJOA 3IVGA 3H7AA 5K8VA 2EZ8A 1TQ6A 1GPAA 1HYQA 3C0KA 4ZT2A 4C88A 5L3QB 2VHTA 4PNZA 1X70A 4LOJA 4Q03A 4QO7A 4BJ3A 1QM5A 3DMTA 2XQJA 5HMMA 4KXNA 2RJOA 2VDNB 5CVTA 1XL1A 1SBNE 2H1OA 1P3JA 3K20A 3CF4G 5KBYA 4TMWA 3TLJA 3EDYA 3FMGA 3O4GA 1LI5A 4U7HA 3SHWA 2HPHA 1X1SA 1X80A 4BFVA 4ND6A 4L75A 1DWUA 2KW5A 2PSHA 4GI5A 5ALXA 4C4AA 3QBJA 1T9AA 1K8ZB 3Q6IA 2UZAA 4ZIRA 3UBMA 1SIWA 4QDOA 3MUNA 3NEAA 2J6CA 1E89A 4ZOAA 3L1KA 5AESA 4JHXA 2H2FA 3Q72A 2LP4Y 4JVNA 3T0IA 4TUYF 1OA1A 1J49A 3AF6A 1K4MA 3L77A 2R60A 3HY3A 2R7LA 4CF5A 1NBMD 4YY3B 4MRMB 1OU4A 1XVIA 3WICA 3JQ9C 4LXIA 2FPUA 4ZYWA 2HQ1A 1DARA 2VPXA 4LI3X 1T5SA 1JUDA 1Q0SA 5LBIA 3S2IA 3SPXA 3ZHVA 3WGIA 2PUDA 1E2NA 2Q62A 1W75A 3GD5A 3ZDFA 4F4HA 5KJ6A 4OQNA 5E2BA 1IZ8A 1XWIA 1FDUA 4YASA 3FETA 3OBIA 3PGXA 4EFKA 1XKQA 1UMCB 1K5HA 2MOKA 4QG7A 4EJSB 1G21E 4LDZA 1DU4A 2PUTA 4O2LA 2PA3A 4W5HA 3AVQA 2M32A 1TIBA 3BCSA 1E9EA 3QU5A 3QFFA 4HX5A 3ZK9A 1V4VA 1Y9AA 2WF5A 3QWFA 5M7EA 5AVWA 1FYDA 1M54A 2ZUWA 1QYXA 3VOSA 2I9PA 3BCHA 4Q6WA 1UAGA 4GUAA 3GVHA 4Q39A 2QMEA 3CO0S 1X8XA 1DMSA 1X86B 2H00A 3KQLA 4FSDA 3OE5A 2ZPTX 2JKZA 3BF7A 3BK7A 4WBSA 5EJIA 2P1DA 2WINI 4L27A 5J5CA 3HS3A 3V33A 3HFSA 2G4CA 3ZY3A 2WUGA 3PDHA 4E46A 2AI2A 4D0RA 5FTKA 4D8XA 2XOXA 3CLTC 1E77A 2XMPA 2B4RO 1SCBA 5TQ2B 2YJ4A 2P9BA 1F2TB 1SRRA 2L2QA 3IOYA 2AMFA 4JSYA 1SXQA 1L7BA 2H06A 1S2IA 4WK0B 5LQMA 1KPHA 3HA3A 5K3EA 4MUNA 2ID9A 3WMGA 1JYFA 2Y1OA 1GGKA 1M1YB 2BF4A 1XKLA 3H2SA 4X61A 3UQZA 1RRPA 1NATA 3QH4A 3AEKA 3TMAA 5JCPA 3RYHB 5I4BA 1E62A 2ZCVA 2AI3A 1UOPA 1HYBA 1X13A 2QLTA 4OTZA 1KSHA 4NFYA 4PVCA 1VKRA 1U5BA 3KU1A 4B32A 5FD8A 3CURA 4Q4LA 5TPWB 3O7MA 3UK6A 1TJYA 2CBZA 4G65A 2IU6A 1Q83A 3KLPX 5DCWA 3W2EA 5I47A 2XVAA 4Q1DA 3IJEB 4JAVC 1D0SA 2P6PA 3LLCA 3K31A 5LVAA 2QM3A 1O3YA 4JWTA 1RQ7A 4NCJA 3QPAA 2Y6UA 4L3WA 2FRVA 4RA6A 3I37X 4IDHA 2GYYA 2FPOA 4HMQA 4FZ3A 1UMKA 4AKGA 1QH1A 5DW3A 3H19A 1Y4DE 4RLFA 3QX9A 4ZFNA 3QZUA 3EVFA 2OORA 4H7FA 4KVFA 4DJ5X 1HQKA 1KP9A 1OREA 1E58A 3CLSD 3DEKA 4GLFA 1J7KA 2EW8A 1F12A 3V1NA 2BR4A 2RC5A 2CXSA 4GQIA 3BGDA 3FW1A 1XBTA 2FZWA 2X5XA 1UC9A 4KYIB 3AHFA 2ZB4A 2FCRA 1PDVA 1T8TA 3DV9A 4PW0A 1BZYA 2UZ0A 3M6AA 2NTJA 3RQIA 4ZOQI 1U2EA 1PL6A 4RFSB 1BVHA 3RYIA 2CWWA 5C5DA 2AW3A 2IWHA 4WIAA 5IAKA 1UBSB 3C7AA 3H5LA 4Q47A 5C1OA 5K6AC 5JWOA 4J16A 3CF0A 4WRRA 3AUYA 121PA 4CV0A 4BO6A 5LQRA 3R9XA 2PGNA 5IBPA 3QNUA 4LY9A 1C9JA 4E11A 1IHDA 5K0JA 2KM1A 2VUSA 1FK8A 4HDNA 1MOQA 2WQ7A 2QL6A 1XNJA 2YWHA 5EMMA 2B0JA 1LW7A 1PBNA 3I4FA 1BTOA 4ALNA 4M49A 4RL6A 3C3YA 5K0LA 4BNNA 2PGAA 4JFRA 1UXIA 3EGIA 3P2KA 2XCLA 3RVMA 1PBTA 1QE3A 3SF8A 3SOPA 4A8TA 1Y1QA 3PHCA 3GCXA 2PY6A 1Y8AA 4L3OA 2J9ZB 3L0BA 2EKDA 4KVGA 3ZJYA 3AI2A 5E6SA 1XLTA 1SUCA 4GAEA 5C5EA 2IYWA 3GJ3A 1OAOC 5HS6A 1VLLA 2AN3A 1KS9A 1ORHA 1GPMA 1J8MF 4UNRA 1H0SA 4FTWA 1KK2A 2XCOA 3UC9A 5KWIA 3FUWA 2R7MA 3FVRA 2EKQA 4RTNA 4M1MA 5TE9A 1EAMA 4KE9A 1ISMA 1C4XA 3KUDA 1P9WA 1Q1NA 3W6ZA 4RPIA 3V1TC 2UVPB 3UQYS 1H3FA 4HLUA 3WK5A 1X39A 2OCIA 4IO0A 3SJBA 1WZEA 1V1RB 2FWAA 1RAHA 3DMGA 5FP0A 3KEFA 1I4LD 1OILA 3RHZA 4MQFA 4OI4A 3GXOA 3TO5A 3I92A 1N92A 4XVQA 1Y63A 3BM5A 3WLLA 4EHIA 1SQSA 1KIMA 3JQBC 5KYXA 3TDKA 3EUFA 4P3KA 1G8MA 3VVBA 1UZLA 1NTOA 3GO4A 4EH1A 2MSLA 3H1TA 1DV1A 1KEEB 1W5AA 1Y8CA 4WK6A 5KSZA 1JSLA 1NSTA 4WJZA 4HDSA 2H48A 2O8DB 1J7JA 2F62A 4L8YA 1I0IA 4DIFA 2PH1A 4KN8A 3JAMA 4RTKA 3N05A 2GJ8A 1JAHA 1ZQ9A 3HFGA 3SKXA 4HWGA 2B2XA 5JUWA 2XOKA 1O4VA 4IW3B 1J6UA 1IBRA 3UJ3X 2XRZA 1Z12A 5KWSA 3EA0A 1QYRA 2P6MA 5AI5A 3G0OA 3AF0A 3L5OA 4KN9S 2YINC 1U98A 3N2GB 4UFPA 4D02A 5T3YA 2FEOA 4EJ0A 2V6MA 3WLOA 5JPCA 2OHIA 3ZVRA 3R9IA 4R6WA 4U3JA 3U3MA 1JZTA 1ZAKA 3RDPA 1YXMA 3B70A 3B5EA 2R6HA 1RHMA 4GKBA 2CHVA 5IAJA 5J4HA 5KQRA 1M1NB 1I14A 1P7VA 2LD4A 4I1YA 2N1MA 4MCHA 4BGVA 1KHTA 5J47A 2W58A 2AF3C 1TF7A 3CS3A 1CULC 1L5MA 2X0FA 2OHOA 4KITB 5CA1B 1W8IA 3L0IB 3VOTA 1NRXA 2ONJA 4KN5A 2B9EA 2QV0A 4I4IA 5EXPA 2IYYA 3AQ4A 5B7QA 3TBKA 3RWMB 2XUJA 4CCWA 1E2FA 5CJ2A 3AIKA 4DWVA 3BILA 3D6FA 4A8JA 5IKXA 1Q84A 3STXA 2QGFA 3OAAA 4JENA 3WK9A 1ADGA 2X1HA 4RK6A 1TUIA 4PSAA 2XB4A 3KYIB 1PFKA 3H0CA 1TYCA 1UF9A 1P1KA 1KP2A 1K0UA 2GM9A 2WWVD 3CUKA 5DPMA 1P5FA 3KUCA 4JT8A 5LOVA 5TARA 5FTJA 3EGVA 3WFJA 4A8PA 2A0XA 2CUKA 2A35A 1C7IA 2X23A 3OZTA 1XSEA 3SIRA 1Z7EA 1PR4A 3GLFB 1XAIA 1HDGO 3A70A 2E4ZA 4QQ8A 5KKAA 4AJ2A 4BX8A 5TMPA 1PGOA 2IDKA 2JBAB 4LG1A 5GJCA 3MMZA 3AGQA 2VPWA 4OL0A 2VUUA 4ZV9A 3SYNA 1SCQA 4QEKA 3T0FA 3TZCA 2REXB 4HYQA 3KOWA 2VHVA 2CNWA 3LBNA 5F3RA 2XUQA 4AF6A 1TECE 4JBHA 4KRXA 2Y4NA 5C52B 3FROA 4CI9A 4Y0NA 1YFJA 2DE0X 4R7GA 1JB9A 4JP5A 3MPOA 7YASA 1I7PA 2DQZA 2V8OA 5LN1A 3HR7A 4XSHA 5P8WA 2QRQA 4ZJYA 3KZKA 1OHHA 2DSNA 2XV1A 1FYWA 3MJHA 3TUIC 1B1AA 2AG8A 1E2GA 2ZRCA 5AP9A 2BBSA 1QJ4A 3FRJA 1RNLA 4FKZA 4H1UA 5LU8A 3CSDA 4M1TA 3OTHA 2JCSA 1NSFA 2W6IA 2OHJA 3I2JA 1UKZA 1JFFB 1RMQA 1Y42X 2PBZA 3ABOB 4KTTE 5DYIA 1TJ4A 4FQ8A 3OCVA 3ZHUA 1NNUA 3ORFA 2REQA 3E8SA 1BO6A 4IZOA 1W36C 4IIXA 2CLCX 3IAHA 3ZK8A 2C8KA 1GQRA 1NAIA 4QTUB 5EP4A 5T8KC 4NPCA 1QDLB 3ITKA 1Z6ZA 2N0SA 3MVEA 2QD2A 2QNIA 2GZHA 5I9BA 1T29A 3T06B 1HM5A 2YN2A 1Y6ZA 2SHKA 2YVQA 3G2LA 1QHHA 5EHXA 1CK4A 5KHLB 1VPDA 1SVSA 1JHDA 3CUSA 4Q01A 4WAUA 3ANLA 1JNXX 4NJMB 4BYMA 4G5GA 1GZ3A 2HGZA 2WRZA 3VTAA 3CC8A 4C2BA 2G3YA 1G8FA 5HTOA 3AVUA 1IIBA 5J2UA 5IEJA 1KY5A 1NVMB 3K8ZA 4WMLA 4LV6A 4R5HA 3W1VA 4DILA 5JT1A 5LXTA 2ESRA 4MLCA 1J9GA 4D81A 4EVRA 3HYRA 2PYZA 2LNDA 4YDRA 3SC3A 3Q8MA 2HGSA 3QVLA 2MCFA 1G3QA 4MV5A 3A3NA 3TUJC 5GAJA 2MR5A 1NJGA 5LMUB 1VPTA 3AKDA 2W4IA 1AKMA 2W48A 3ZXYA 5C8ZA 2O2HA 1EM6A 1SUWA 4JT9A 4R3NA 4AZ0B 2K7FA 4QU8A 2QG6A 3KEQA 3DV2A 3HNOA 2G9ZA 1AB6A 3K9LA 3SIPA 3A6GA 1WRBA 5CBPB 3Q8KA 4HPXB 2A84A 5FLXA 1ZR2A 3SXPA 2HLDD 4G1CA 2O06A 1XDSA 3FCSB 1R8QA 3ONDA 1O97C 3Q5EA 1L5HB 1NG1A 4EZBA 2J4FA 4G1FA 3IKTA 2A78A 5CU7A 3DMNA 2O3SA 1II8A 3ZCQA 4DJJA 3IAFA 1P2TA 4IUCS 2ZJ2A 4DCUA 2XMDA 4YB8A 1ZP6A 1Q3KA 1NQ5A 3CY6A 2FGJA 3F6CA 1ESNA 1T9BA 2VCHA 1HX7A 4YGYA 1IY8A 3D4PA 1ITZA 2GN2A 3IX7A 3RYFB 3QYFA 2I8CA 2W2XA 1MOSA 3EGEA 5F52A 3FCEA 1ZNQO 4NYJR 5ENVA 4UE6A 1YJQA 3CGWA 4IIUA 5H68A 1B0AA 4I5FA 3IALA 4ZPJA 2NUTA 1AQYA 3JQQA 2D3WA 3N7AA 2MHCA 2VJYA 2GH1A 1YZKA 4EI7A 2I7XA 2J0UA 2DC1A 1D1QA 2QTWB 4Q4HA 3CEHA 5TB5A 2VCEA 1TEZA 3F7NA 4UNSA 1ESZA 5LIRA 4P34A 3ORYA 1DKUA 1XMJA 3P52A 4TT3D 3FUCA 2WIGA 2GPTA 3BFPA 4OHWA 2JIPA 5KZMB 5EJ2A 1UT8A 2DM6A 1JECA 4W1PA 4XPIB 3VGJA 2F3SA 2WTXA 1XRPA 3K8QA 4UBLA 3R5TA 5REQB 5TX7A 3PXGA 4JLNA 1P31A 4I50A 2BZ1A 2PBRA 3RTBA 2O8VA 3FPJA 4UVIA 1W7AA 2C4TA 3RUPA 2NP7A 3NHSA 4P2GA 4L73A 2Q1YA 3VNBA 4JZYA 2K4MA 4L4XA 4A8HA 1AOXA 4CM4B 4RM3A 3D6AA 5IYZA 4W5QA 5F21A 3ROMA 5C5IA 4QFDA 4PTYA 5JVDF 5TGTA 1S1MA 2XAUA 4PSUA 1UQRA 3STUA 2IZ6A 4TWJA 4JP2A 3VTZA 5T5QA 3ORRA 4PLCA 2H9AA 3HPRA 4DV4B 4ZYZA 2GYUA 3SDBA 5LYJF 3UH0A 3TTWA 2AC7A 4L50A 5AW5A 1JV2B 3GJSA 1V5WA 5EESA 1WLYA 4A0GA 2C4KA 1GQ2A 1F60A 1OAKA 1WEKA 2HB6A 2FOLA 2X0JA 3QPBA 4Y3UA 4DNFA 3IOCA 4QYMA 1DGQA 2VDKB 2GD1O 5K05A 2MMGA 2AZXA 4HO1X 4AMGA 3H2YA 1I33A 3K0FA 4GICA 4L5CA 4G01B 2VP4A 4UAJA 5A9RA 5HZKA 5MN5A 2F8TA 3T7JA 1U9JA 4WI1A 1Q17A 3IPAA 3DMFA 5KHOC 1PN3A 1ZJ5A 3CE6A 4JR1A 3TTTA 3IP6A 4X1IB 3S4YA 2V03A 2FEKA 1S8OA 1B8PA 1BKSB 1C7QA 3QU9A 4WCFA 1RHUA 5A02A 2DQYA 1G0NA 3KFVA 2O0MA 1VBKA 2W2KB 4E5DA 4KSCA 1V1MA 1BA3A 4WASA 3T9EA 2P4HX 4QUDA 4HJXA 1TB4A 4XUEA 4CMIA 1KO5A 1V7QA 2H0RA 2YHIA 3E8XA 4S1OA 3TBFA 3FYSA 4FCVA 3D6VA 4UOZA 3AHIA 5HIJA 1M83A 1GUDA 4FNAA 3VOBA 3N6XA 5BSWA 2A5GA 5E7QA 1EWVA 1ZKDA 4Y7DA 4F4JA 1X7XA 4GKJB 3B3QA 4WXYB 3LG2A 1WVIA 2ZAIA 2FMFA 1EU1A 1MEOA 1PNTA 1NJ2A 1YZGA 3QFRA 4L5YA 3W0LB 1JT2A 3ZW7A 4CLRB 2YOFA 3LFTA 3T4UA 1DAGA 4ZCIA 4AP9A 1P1CA 1ZH4A 1M1ZA 4HGPA 2AQ8A 4FHCA 1I3OA 4U9UA 5KMGA 4N41A 1BJKA 2HTEA 4LVUA 2CMHA 5AR1A 3RUCA 1JKXA 3M33A 2ZB3A 1YUNA 2ZREA 4BQSA 3N58A 3HP7A 4F46A 4H27A 1P3DA 3DONA 4D9FA 1I7QB 1YBFA 3HADA 5CVEA 2XY4A 1DJNA 4MIYA 4RIEA 4H3VA 3DWFA 5GWXA 2ZOSA 3LI2A 4J4BA 5FHRA 4BFUA 3RRZA 3NX4A 4RKQA 1M66A 3EYAA 4RBNA 5MFZA 3DTTA 2CMDA 2V98A 1QIGA 4EBFA 2O7NA 2FPIB 4D57A 5JNUA 1KH3A 2NT3A 1OH7A 3RFCA 5A0TA 1ICEA 1DX4A 1Z5UA 1C3XA 3WZLA 3C1OA 2AB0A 2PRSA 4BX0A 5IH7A 3S68A 3FFXA 4K9DA 4HFMA 4N8EA 1QMGA 3LY5A 2VWHA 2IPLA 4F6CA 1ACLA 1OROA 1PDWA 3B7GA 3KHKA 4UU1A 3QXHA 1VI5A 2HUNA 1DAFA 3N07A 2Y9MB 4L8WB 5BT8A 1YE3A 4EA7A 3NVAA 3ELUA 5EQJB 1HE8B 2CV1A 1OH5A 2XMQA 3VDMA 5BYBA 3V80A 4KREA 4TPKA 3W5DA 1P3Y1 4WZZA 3G5UA 4P4SA 2TMYA 2WWYA 3C4VA 5AJTA 3A05A 3WLFA 3ZBQA 2PH7A 3KJNA 1RQRA 4GPBA 2E4WA 3EHDA 3EQ8A 2ZTUA 3AUSA 3C1UA 4NJEA 5FBHA 1JBKA 4WWHA 1PKXA 1NZDA 2JRCA 1M74A 2P9ZA 1W4ZA 4OI2A 2DH6A 4P4TA 4A0SA 4NBKA 5I9LA 2BD0A 2RGNC 3UMBA 1G3UA 3MLAA 1N33B 5DNEA 1OYVA 3U7EB 2EARA 2NWQA 3DKPA 2ALJA 3EW7A 3A26A 5L40A 3W5CA 3S2GA 1YMQA 4EUNA 3HV2A 1B23P 4PR0A 5TQ2A 1KZYC 2HFJA 3K5IA 1SZCA 2GVNA 3AT1A 3L8ZA 1L3BA 1EFDN 1PR9A 2Y05A 3ACBA 2O7RA 3BDVA 3BXXA 3GDWA 4LE2A 4M8IA 5A3VA 2XTAA 1E8DA 3NU1A 4MO2A 4QDJA 2Q5LA 5D3KA 5G53C 1KDVA 2P9JA 4EUSA 2I9KA 5C31A 2Q3BA 2FMUA 3BB4A 4I1IA 1K6EA 1TL7C 4CHGA 1TX4B 2FLVA 3E1KA 4HNAB 1HDRA 3GUHA 3HGTA 4C6HA 2PR7A 3HB5X 2PZGA 3OT5A 3QPWA 1OA0A 4LZAA 3QK7A 1PE0A 4A03A 4BFZA 2PWBA 1ESDA 3VUFA 2WTUA 2HNAA 2C4NA 3BQ9A 2J3EA 3OQOA 3WNZA 2O14A 1R9JA 1CR0A 1QKJA 2BTQA 2PO7A 2FUG6 1TLTA 4QYIB 4XX0A 5JV5A 1PFUA 4DCMA 5ER9A 4O1MA 1K9SA 4YONB 3ECCA 3DE6X 1NSYA 1XTSA 2V3VA 2CVFA 1DTWA 2QPAA 2FP4B 1X1EA 1NAHA 2X41A 2AUTA 1N8SA 1TYDE 2VNIA 3NS7A 4JP3A 4R83A 4HZUB 1M8GA 2RKBA 2BGLA 3CGGA 3M6LA 5IYZF 2PLNA 3ZLBA 2F9LA 2AMVA 3IDFA 1VJCA 2BGKA 5B2EA 1HORA 3UB4A 3W5HA 5DXFA 1K3UB 1PF7E 1ZBDA 3GMSA 1AS2A 2HNKA 5INTA 2QDXA 1PGPA 4L4ZA 2BGRA 3E22B 3FVTA 4G4IA 1RLIA 4ISCA 1J39A 3RSOA 4CTNA 3I2GA 1KGSA 4LYHA 1CUHA 1LLCA 2AS0A 1EDEA 3F6PA 3KSAC 3UCXA 3IB6A 4TVKA 3FJOA 3C3KA 2EBHX 1X74A 2B6NA 4UE2A 1M7GA 1JGTA 4JX9A 4FJ2A 3O83A 5FOVA 3DULA 4RD4A 3DZCA 4HLQB 4L8GA 4MKGA 5FI3A 3PEEA 1NJ5A 4RY0A 2Q7DA 3KEMA 2XBUA 4CQLB 1E20A 4JU8A 4QJIA 4RMHA 3OQBA 3O92A 1QS0A 3JARA 1T0HB 3ACCA 3WHLA 4TTQA 1D6JA 1JVNA 2J1LA 4I6EA 1B00A 1UPTA 2UUBB 2VHXA 4RNCA 2XE7A 3FUTA 2I6XA 1U7TA 4ICIA 4RKYA 1U3UA 2WSYB 3A9VA 4H1VA 3DH0A 5L6LB 4EB0A 2XDYA 2G7ZA 2P77A 2R85A 3LOPA 4CG2A 2V0CA 3H87A 5CYGA 2PMEA 1GTG1 2QN3A 2Z8YM 2BFEA 4B4DA 3HL0A 5F9MA 3LUFA 1S4MA 2XUIA 4JP8A 4E2FA 4JI8B 3C2QA 2PKQP 5KYYB 2IEIA 4PY2A 3LC1O 4DBVO 4LDJA 4OGKA 3UJCA 2QYOA 4N6OA 3CCFA 8ATCA 2V7GA 5FPKA 1FF9A 4ZZ1A 3W6PA 2E5LB 2C3OA 1EVIA 5JROA 2O8FA 1FMCA 1LZLA 3D31A 4DLAA 3LVFO 2FK7A 4UEQA 4RVUA 1JDZA 4HT3B 1G21A 2O9JA 1Y82A 2ZCUA 5HFJA 3RODA 4AK9A 3UAZA 3FI9A 4AS1A 1F8XA 5DHUA 2CV0A 4GP9A 2O5VA 4XTCS 4PE5B 2O7QA 3PVZA 3Q6NA 3ASVA 4OSPA 4MHTA 3PLAE 3S2SA 4KXWA 4ER5A 4IKPA 2B4QA 1WZNA 4F91B 1BMTA 2RI1A 4WEOA 2BHLA 3WRYA 2ATVA 2A7QA 3PYMA 1FMFA 4QZVA 4PR3A 4F7DA 2X4DA 3HNRA 4KXLA 1P77A 3MNFA 3VNVA 4WT7A 3CJQA 3NIBA 1DE0A 1NTRA 2P75A 1Z0SA 3EXEA 3IUJA 4OHRA 1YJXA 3RIHA 5BORA 4JUFA 1KWKA 4W63A 1HKUA 2BMDA 4RXMA 1AQLA 4ZK6A 1PDOA 1A9PA 1T10A 5K3AA 2C7RA 2NVOA 2QXYA 5DYYA 4YP6A 1KAHA 4BVBA 3AHDA 3JR3A 1DCKA 3I6QA 3IC5A 3PPYA 1K2WA 2JLSA 2WG1A 3BGOS 3NDIA 2NV6A 3U9TA 4ENSA 3GJTA 1CR4A 1NV8A 1ZK3A 3VPFA 3NHJA 1GSOA 1QONA 2QQ0A 4G36A 5GPBA 1FFYA 1EK6A 2VA8A 2WB2A 3ISJA 3LUKA 3UTCA 2VLIA 3UK0A 4TN1A 4B76A 4BP3A 4PLTA 1EIWA 2DUUA 3L0ZA 5FCDA 3U39A 1U7HA 3EGCA 3EW9A 4EVIA 4FI3F 4LF7B 1IHYA 1QZUA 3RS0A 1YQXA 3FPHA 3T1NA 4NZNA 1YB1A 3BH0A 2CJXA 4HNSA 1Q74A 3A9TA 4PFKA 4EUKA 1M2VA 4BQIA 4YROA 2HFKA 1W88B 4NE2A 5CK4A 3RLFA 1OZFA 2AIRA 3FPEA 4NBLA 5JVDB 3LUJA 1W0JD 3EVAA 4TV8B 1CRZA 4DEXA 1K2VN 2O5EA 2QLMA 2AR7A 3HDYA 1EHIA 4GI7A 1A5SB 2VF2A 2ZUSA 4DMKA 3VC7A 3ED1A 1MXHA 1PHRA 5KCZA 3HUTA 1FJHA 3WL5A 1XXHE 2VSNA 2JHFA 3SR3A 3TEFA 1FSFA 3ANNA 5DHAA 2ATXA 4Q1CA 1IZ0A 2OORC 2YYAA 3UOGA 1OZAA 2C2ZA 1X1RA 1QNFA 3KHSA 1O94D 2G08A 3MMSA 4QBHA 1YRLA 2SECE 1WF3A 1I3CA 4HVAA 1YFZA 4QEZA 3JYHA 4K2HA 4X95A 1V7PC 2NV0A 3DFZA 4IDDA 2BY4A 4FMPA 1BDIA 2GCIA 4EG0A 1HK7A 4EI9A 2OV4A 4FT2A 5C1DA 5COQA 5AUNB 3TUZC 3NHPA 1C41A 2OBBA 4K9KA 4YBZA 3SY8A 4HPJB 4WFJA 1VHDA 5B4VA 4LSWA 2CLLB 2DFLA 2VF5X 2VH2A 1R6AA 2GFHA 4FBLA 4XH9B 5I51A 1HDXA 4LY3A 1O94A 2VNAA 1NVXQ 1MABA 1IE3A 1UADA 1B93A 4TLAA 1UJCA 5K0TA 1T25A 5F64A 4UDNA 4REQA 2F7SA 5ENDA 3KJGA 3MELA 3HCPA 2DPLA 4ROTA 1NW3A 4HUQA 2BFNA 5EYPB 3OE7D 2P9CA 1O87A 2NUAB 1E4OA 4KFCA 2P4SA 1NDQA 4CM5A 5LXTF 4RCZA 4C7OB 2OKCA 3MFYA 3WLRA 1WL8A 5EJAA 3N2ZB 2OSBA 2B4TO 4ZO4A 4ZOLF 1CIJA 2JA2A 2WJGA 3LX8A 2NTYC 4AU1A 5A5FA 4G8BA 3RVNA 5JBIA 2F4VB 1F2DA 1HE3A 1TUGA 2IYQA 2O0KA 3OLZA 4DC1A 1XRSB 5I8ZA 3L7IA 3PQEA 4LKOA 3LJKA 3L49A 2HU8A 3OX2A 4UXJA 4OHKA 4XEUA 1UUFA 3S1AA 1FCJA 1SQGA 4NZMA 3LP6A 1IQ0A 1U0NA 5EHIA 1GTVA 1Q3TA 2H1WA 2NO9A 1RAFA 4LCBA 1H93A 4F3KA 5DM60 1VLZA 4IQGA 3ZD7A 1E4YA 2HEGA 1ZRMA 4GOMD 1OXMA 5DHRA 5IARA 3K70B 4HB2A 3M3DA 4ZTZB 2V7BA 1A8PA 4JLBA 1ZIYA 5D85A 1AQIA 2V9PA 2GRUA 1UEXC 3WK7A 4IWYA 1E0KA 1P8AA 2IYUA 3I23A 1JPJA 3SHFA 4J0EA 3N6VA 1GA1A 2QTZA 2WJWA 3CLVA 1V11B 4IIHA 4GX1A 4OK6A 2H9IA 5EWMB 5BRNA 1Z47A 3ZGNA 1CRLA 3GRAA 3HP1A 3MG9A 4Z49A 2I99A 1W0KA 4XWYA 5HUQA 3X1WA 3DAYA 1Y6QA 2FQWA 4UC0A 2VDRB 1DSSG 3GWGA 2XCTB 1A4UA 2VJPA 4GUDA 4QL3A 4J1TA 2O57A 1QUFA 2AQHA 3QE2A 5JH7B 5CD1A 2EYUA 3JQEA 3DOEA 2HA4A 5LDHA 2O8CB 1UBOS 3K1TA 1RSZA 3UGKA 4LC1A 2EJCA 5TS2A 1P1RA 3FNRA 5BN5A 3N0WA 4CFYA 4CGYA 1P2FA 5JSHA 4FCWA 3U62A 1D2NA 2F8MA 2G7MC 3KT3A 4HFRA 3P2IA 4MZXA 1LX6A 5HM8A 4I1PA 1NASA 2C0CA 3KJQA 1FDOA 2VZ8A 3IE0A 3A3OA 2PYIA 2IA5A 3MUEA 2YZNA 9GPBA 3DM9B 4FJ1A 3VU0A 4BO1A 1CT9A 1GCGA 2VTEA 4I9UA 5DX8A 1XQYA 4J2HA 4J29A 3SP1A 1YWGO 2YYYA 4YJ2B 5LWQA 1E66A 1OOEA 2X1LA 3K2BA 3RJTA 1EHCA 4K9SA 3DUFA 3WWCA 2W2KA 3TSOA 1OLUB 1SHUX 4LXGA 4Z0TA 1S1CA 1UODA 3PR3A 2XZTA 4S0ZA 1T24A 4D8UA 3EYWA 3FMFA 1DDIA 2W70A 4B3TB 1PUXA 4IX9A 4TZTA 1KXZA 3CYFA 4HWRA 2AKEA 3SYMA 1YBMA 1TOAA 3MN1A 4HVTA 1RCTE 3PXCX 1J1IA 4KTVE 4KBGA 1CUIA 1WMDA 4DG8A 5KNDA 3KKPA 3F5FA 4S1TA 4FOSA 1G2IA 5K8TA 2CLFB 2XZDA 3OJFA 1AVTA 3L07A 3ZLUA 4GMDA 4URFA 3ETGA 4DDTA 4V0NA 3NGMA 4I66A 5JD5A 1DINA 1UDXA 1Y6JA 2HMAA 3NAZA 4QQKA 3ZU5A 2WM8A 1A5AB 3NM4A 3T7EA 1F8UA 1OIWA 4OL9A 2VO1A 3WGVA 4IHQA 3K9FC 2I7TA 6PFKA 2AHOA 2HKIA 3WIVA 3BRSA 4ZO9A 4FHZA 4PSDA 4TYWA 1WB5A 4L7VA 4R1NA 3H5WA 5BVHA 2Z2ZA 4EPVA 1J8QA 2DUJA 3QV2A 2D2IA 2PVCA 2BFEB 1GPWB 2WUDA 1KZ1A 3ODGA 3DBRB 5HCNA 4DANA 3DHWC 1BG6A 3K4PA 4Q4JB 4CLOB 3SQXA 1IBLB 2O3QA 3EVGA 4PINA 1VKNA 3QHPA 1R00A 2ISSD 3K1ZA 1FRZA 3O6VA 4XCVA 4BN4A 4F1WA 2C1EA 1O57A 3HBAA 1CQIA 3IPYA 3HXLA 3DHEA 2KLHA 3ETEA 1ORWA 4YRFA 4CKCB 1WLSA 4WKNA 4C0WA 3LXMA 2K6GA 4I55A 1XPRA 1N2CA 4QOHA 1N7GA 5IHXA 3L40A 4FIZA 1KMNA 1S7GA 3AB3A 3OPYI 4DC9A 5IWCA 3NM5A 3AKZA 2X8WA 2QW1A 1Q91A 3E5MA 1U04A 5AXDA 1PFWA 2CNWD 5HHTA 2HJ9A 1NBIA 1B2LA 2XPCA 3Q88A 3TGPA 1YCDA 1N2JA 2CL5A 3GR6A 3FZQA 1NUUA 2C4UA 1ZN8A 1NJ1A 1R8JA 2NXEA 1DRWA 3VV3A 4TTAA 1N77A 1CETA 2JZOA 4CKCA 4FS8A 4KDCA 3QI2A 2G28A 4KPYA 2BE9A 4JBLA 2JJYA 1JE0A 4FYKA 4UPVA 5H0IA 4PFSA 5KJEA 3ZE1B 1O5IA 3OY7A 4JLJA 1J8DA 1WULS 2VRCA 5TT0A 3T3PB 1CUDA 1BFUA 5AW4A 5CIQA 4AQYB 3C8DA 2OD7A 4DXHA 1QE5A 2BGWA 1AHIA 3QYAA 5HIMA 1HQCA 1UK8A 4Y2XA 1Q1AA 4H3HB 1GA6A 1HL3A 1YDMA 1UC5B 1XB2A 3MERA 4N3NA 5AOCA 4A6EA 3ZV6A 3U4GA 1N25A 4ZKDA 4D8WA 2V5UA 3D9QX 5CNKA 2F6RA 1CY4A 4A2PA 1AIPA 1IXSB 4UBNA 5PNTA 1L5SA 5ALPA 1X9HA 4HDAA 4M1ZA 4PX5A 5G2OA 1R66A 3R3YA 5D6OA 3GC6A 1YZTA 3VKGA 4X1IA 3RJZA 2VDUE 4ZT3A 5CB4F 3H65A 5JMWA 1CDEA 3C5CA 3LV8A 3VNSA 2VF4X 2XEDA 1N5MA 5LZ5A 5JO0A 4MPRA 1T8PA 3G13A 4BJHB 1O96A 4ZYTA 1BXKA 1DCFA 2JGMA 3JZMA 3FJYA 2VPPA 4GOOD 4M76B 4MRVA 2ERCA 2PRJA 3D1JA 1OZHA 3LUDA 3FGNA 3RO7A 1FP4B 1TDJA 2K5UA 1OGIA 2X2OA 1XK6A 3DO8A 1W4AA 2UDPA 5JNVA 2C3PA 3F1LA 4BOYA 3ZDAA 1AH2A 1TPYA 2H1VA 4A5OA 3DYVA 3GPLA 4K88A 4C0AC 1I5RA 3OKFA 1BSVA 1TIKA 3PZRA 5LNK1 4IIFA 1WCV1 3BFJA 1RFLA 2NOAA 3CRVA 2J9YB 2RGNA 3JX9A 2J5KA 4O08A 1JH8A 3AWDA 4FYWA 1ETUA 1NUSA 3KDPA 1L8QA 4M0MA 5CLGA 2WVGA 2CZCA 2QVGA 1VPLA 4XTRA 4Z8YA 4Z3OA 3SE0A 1P0FA 3FYUB 3E0XA 1RXSA 2HY7A 3RBAA 1BEUB 1UMDB 2OGTA 4ZEVA 2GEVA 4L0MA 2IUEA 4OF4A 4RJIA 1CUAA 1B7GO 3C85A 3IOEA 2IEBA 5EIBC 1BX0A 4FI3C 3V4OA 1JFFA 1LH0A 1R6XA 2JGRA 2WB4A 4OA8A 3M3HA 3REGA 1J5PA 4MV8A 1VDZA 2IP4A 4GKKB 3T7CA 3IQIX 3PENA 2H6EA 2PMKA 1U9CA 2Z6VA 4D7AA 5HKKD 5C80A 5EWJB 2EDCA 5KVAA 1TGVA 1M2HA 1TU3A 1X77A 1CF2O 4CWAA 2QU8A 3EFOB 3MRXA 4AT1A 2V5AA 3C3EA 1TCVA 1ZI6A 2CE7A 3INRA 4INZA 1NJSA 5P21A 4P98A 2PLAA 2V59A 1YI0A 3U81A 1AV6A 4C0XA 3G59A 3GEDA 3IQEA 3Q4GA 1SEVA 3FVWA 3FPFA 3UFXB 5I7UA 5HP4A 3PXUA 3BJEA 1SXGA 4K46A 2R7NA 1Y89A 1PVDA 1TW3A 4XQGA 4ZGBA 2IDMA 1PV2A 1N5RA 3OJEA 4GSKA 2B34A 2EKLA 1RKXA 1H1LA 1WXQA 4OH1A 4Q6BA 3ZDRA 4CDNA 4CEIA 1GG2A 4MWSA 4D43A 4BXOA 1EDZA 1NN0A 1OGYA 3GY0A 4MRAA 2PZEA 2L17A 2B2NA 4YJHB 2H52A 3FWYA 2OCXA 1FFAA 3JQ9A 3MT9A 3OSUA 4X7BA 3WGYA 1OT5A 2JAQA 4OYYA 3OQIB 4LYGA 4BNKA 1F6WA 1L3IA 3N53A 5BQ3A 3V48A 5ECWA 2CT8A 3SEQA 1Q2XA 2QLFA 2V7WA 2O54A 3OZFA 3ADKA 2A0YA 4Y67A 4DQDA 1FS5A 1B8VA 2JEOA 3S6JA 4TUYA 4G84A 1WUTA 4GVLA 1GFIA 2QSZA 1W581 3NWJA 4GMGA 4F71A 4BFCA 4B1FA 1AF4A 3M5PA 4TRNA 4C78A 3PEYA 2BELA 2AEMA 4KJZA 4ABYA 3HHEA 3ZV3A 3TVDA 1PJZA 1X1DA 1UMDA 1W8DA 2QLNA 3P71T 5EL0A 5DMXA 3EPKA 4HAOA 1J2YA 4RNDB 1JEDA 2FMXA 2OB2A 2QM8A 1L5QA 2C00A 3QFCA 3R0JA 4G0YA 4V0ME 1AGXA 3KSRA 4ZAXA 1WBDA 4AQ7A 5AK3A 2XXAB 4KPUA 4AJKA 1SC4A 5I4KA 2EHDA 4B3MB 1EM8B 3D0OA 4LJ6A 3QQ5A 1DG3A 3ZVKA 1WMFA 2B20A 5JANA 2RB5A 3CVYA 2BVNA 1FPMA 1H1TA 1YGYA 5LDDC 4YP1A 4EHHA 4L22A 4I8XA 4DNQA 1J9ZA 4NCHA 2PWPA 5JQGB 1MENA 5KTKA 4BNGA 5GGXA 3KYCB 2ZDQA 1PFVA 1T8SA 4NYJQ 4IIJB 4WHMA 2EFHB 2ZDGA 4GVXA 4H3KB 4B46A 5K0ZA 1PT6A 2NP6A 3FFAA 3MRTA 1I0ZA 1CIPA 3RFXA 1YQQA 3AF3A 1USWA 3UWMA 4ZYVA 4L78A 2GJ4A 3LK7A 1XHEA 1U0RA 4NU5A 1X15A 1CS0B 2VH5R 1QHEA 3OQVA 5AJZA 3MCTA 1WSDA 4AICA 5CLJA 4CLOA 3NCHA 4JLVA 3WLHA 5A2GA 1EVZA 3KELA 3TFOA 2DR0A 4J1QA 1W96A 3O4VA 4CMBA 3W1EA 5LJIA 3V1MA 1Z5GA 4HC4A 3SZ3A 1P2DA 3DKIA 4YJ3A 2X8LA 3FFTA 1HC7A 3HKDA 2VWPA 3NIGB 1OLXA 1UBTS 3AWIA 5DM2A 1TO1E 4BLWA 3U4CA 1L5WA 1FU8A 2DY0A 4D9HA 1LBHA 1EUZA 2I54A 3EOZA 4CE6A 2O07A 2RC6A 2NN3C 1HG1A 4AO7A 3KKMA 2AG6A 3MWKA 4H7DA 4R7TA 2H1LA 3DCNA 1F0PA 1FLDA 2FSGA 2KHZA 4Q5IA 4NV0A 5LDGA 3I5AA 3MOSA 3V9AA 4BNIA 5AUOB 5JD4A 1NMYA 4K7JA 4BJ1A 4GR4A 5B7NA 2EOAA 3I09A 3S2UA 5FH9A 1DX6A 1NU6A 2TECE 5JFOA 1YULA 1AZWA 4KNYA 3HN2A 4HB0A 2IXAA 3TW0A 1DBPA 1XVAA 3GQBB 2GZDA 1QKKA 2WSMA 4WNAB 3E2IA 4HS4A 3TLCA 4DIUA 2X42A 1I10A 3O9ZA 4TSRA 4W1QA 4YBRA 1H05A 4HAZA 1T0JB 2EZ4A 2HQSA 4IRUB 4FW8A 3RNLA 4G67A 1DLJA 4C20A 2VXCA 2VF7A 3C1AA 3DL0A 3DT9A 4OJYA 2EFGA 1SCUA 2OVBA 1HPLA 3EWNA 4OQMA 2HDWA 2UXCB 5GV7A 2Y67A 3R7SA 4WUTA 3CMMA 4PU0A 3ROGA 1G55A 3NUQA 3ET4A 5H3HA 3AOEC 1BCSA 1KU0A 3CA8A 3DOUA 5IVPA 1Z2OX 4Y6SA 4CYMA 4PG6A 3MINB 2HNBA 3DWEX 1UBMS 3EK2A 3LQ1A 1E7MA 4PC2A 3LAWA 4JR0A 3AR4A 3R9XB 3Q7PA 3FOEC 4OO3A 4XUCA 5AJVB 4BLRA 1I8TA 1XX6A 5BN1A 1H6BA 1USKA 1VPVA 4PS1A 4R8KA 1KFCB 3KP1A 2OUKA 2UXDB 2X8BA 1QIFA 1XLWA 2XUZA 1ISPA 1IMOA 4G0ZA 4U7PB 2GN1A 5IVHA 2Q3HA 1B6TA 3FRHA 2QTHA 2B8NA 1YF3A 3PA6A 3RB8A 5DSXA 2ZE7A 4LTMA 4XJSA 2XRFA 1SIBE 2WILA 4QODA 4UXIA 1FUIA 3UXMA 5JTTA 1ISGA 4V24A 1RXWA 4QTYA 3EEQA 3UYLA 2H4XA 3ZCRA 2ETXA 5BSUA 3E4CA 1JDBB 2WFAA 3L9XA 4FFLA 4IOLA 4EGQA 2JIZD 2IEGA 3OMXA 3RKUA 1DKQA 2GO7A 3RRNA 3C6QA 4O2AF 4V2IA 1T2DA 4E30A 2R7KA 3ZKWB 4B4UA 2FPLA 1XEAA 3OTGA 1CHNA 3PSHA 4TXHA 4V03A 5A2QA 1TVMA 4I6GA 4W8OA 5LD2B 1TKRA 2CK3A 1K7CA 2B35A 4K3VA 4OLFA 3OOEA 3FPLA 3TH5A 4UD2A 3WHIA 4EPRA 1HT3A 4TTTS 3L6BA 4Q0MA 2R6JA 3RWOA 4H15A 3IXQA 3T9DA 2PX8A 3KQNA 1F7UA 2AKYA 3JQBA 1OIXA 3X2SA 1G5PA 3IULA 4COOA 4F92B 2BEUB 3O74A 4OSEA 4ZN6A 1YNOA 2XQGA 3GARA 1ODIA 1QBGA 3DNFA 4M7RA 4BVLA 3WDKA 2OFFA 3WLAA 7MDHA 2IUFA 3VFDA 4BFLA 4KO1S 3MRSA 1GSIA 4XJTA 4AKTA 1WY7A 1I4TD 2QQFA 4YRPA 4UVGA 4LC0A 4OQQA 1MW8X 1JHRA 3EC2A 1Q0LA 1S3GA 3CKMA 3FWKA 4WZBA 1VIMA 1HY3A 3P9RA 1ARZA 1TI7A 1J0BA 5K6RA 1KVSA 4D26A 4FZRA 4KV7A 2LXNA 5E8RA 7AT1A 4POAA 4O8ZA 2J4CA 1K5DA 4LXYA 2HA3A 5JARA 1XPOA 1HNWB 3KOUA 5DX0A 2GCOA 3UC5A 6REQB 3ORHA 3TSCA 4F2DA 2WZBA 2G40A 2VJQA 2H85A 2FG7C 4RJLA 3V6MA 1YKGA 3G2NA 5DYWA 4U2DA 2ECOA 2BI4A 4Q82A 4IIYA 2IIBA 1UWKA 2YJNA 3E53A 4M9ZA 1JLLA 2VI5A 3T61A 5KCMA 3M1AA 5CGQB 1L5YA 2GEJA 3BRWD 4U2FA 3RVQA 1VECA 2VYNA 1XJWA 4F0JA 5BSKA 1G63A 2LUOA 3GCZA 2PUHA 3JWPA 5A7FA 5ALWA 2JIOA 2OVFA 4DL9A 4G0VA 4YO8A 1H8HD 4D4MA 4MKXA 5JRDS 2QAGC 4D9GA 1AN9A 2W2VA 4ARAA 3ANYB 1P5ZB 1SOAA 3ESCA 1CJSA 2C42A 4E5NA 3QUCA 1AZSC 5C8YB 1NWCA 3LVQE 4KO8A 1HDOA 3HG7A 4AMVA 4XFKA 1SA0B 3E6AA 3J7TA 3V3KA 1JVBA 2ACWA 5I8PA 3CZQA 4NJMA 1AUQA 3MJFA 2PJZA 3ITDA 3K3PA 1YBAA 1QVRA 1QO7A 2RHHA 5G4LA 1WMBA 2OGUA 1U0SY 2RHLA 3KAPA 4FILA 1FXWF 1JFRA 3SJUA 3EXFB 1M2OA 4KLRA 4CBVA 4OSOA 1HZZC 4HQKA 3TZ6A 5AIBA 3R3JA 3DVAB 1ML4A 3CNEA 2RONA 2Q7XA 1R4NB 3FTCA 4JT2A 1XQ9A 2ASEA 4LTNA 4OUKX 4XM0A 1C0EA 4CF3A 4DIEA 3ETDA 1YQUA 1ZK4A 2B2CA 4XLZA 4V02A 4FFVA 5CVVA 2ZUEA 1IZZA 5EFOA 2Q1UA 1A8QA 3RNOA 3RS9A 3H1FA 1MO4A 1OFUX 4Z8XA 2EFJA 2WU8A 1I9GA 5BURA 5AK0A 1ZD4A 4MGIR 2O5CA 5F4ZA 1FXWA 1QZTA 2RI0A 3TZBA 1EA7A 4F11A 2QXUA 3T35A 4CCAA 2OR3A 2EQBA 3NXSA 4L2IA 1N2SA 4L3VA 2QL5A 3EQZA 4MYDA 4X63A 4K1XA 4ZU3A 3FPAA 1R5BA 3ZQ6A 5IJWA 2PRZA 5EMHA 8MHTA 3H9JA 2MYPA 1C7EA 4L76A 1FDIA 1TYZA 4DY6A 3AEZA 4LHEA 4ON9A 1FFWA 4DTIA 4ZQEA 4ZTBA 2A67A 5FA5A 2EL7A 4QGHA 1E1QA 1PHPA 1TE2A 3QVTA 1T4CB 5GV8A 2DEUA 2C2OA 5FLYA 2AN5A 2HSWA