5KQLA

Co-crystal structure of lmw-ptp in complex with 2-oxo-1-phenyl-2-(phenylamino)ethanesulfonic acid
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
154
structure length
154
Chain Sequence
ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibition of low molecular weight protein tyrosine phosphatase by an induced-fit mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
total genus 66
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2016-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kqlA00
3H5VA 2HQBA 1RXEA 3OLWA 4JOQA 2IOYA 4QYWA 4E7PA 5HM6A 2F8SA 4N76A 3EULA 4YLEA 2GBPA 3ILYA 1A0OA 1QQAA 1D5WA 4LZLA 1YMUA 5BQ3A 3OQOA 4NCAA 5CHYA 4Z4IA 5FWYA 2FN8A 2ID7A 3OMWA 1DBQA 5EWJB 4G86A 1MAVA 4ZYLA 4Z0NA 5KQGA 4RDCA 5JNTA 1ZAYA 1L5ZA 1BA2A 4IRXA 1JDPA 1JFVA 3RQIA 2TMYA 3I42A 4KV7A 1MB0A 2OENG 4TLMB 4Z9AA 1NXPA 1VKRA 1TJYA 3EQZA 1PEYA 1JHZA 5IC5A 4G0MA 1ISSA 1QO0A 4EVQA 1JYFA 4WZZA 4OLAA 1Z2DA 1JBEA 4PICA 3CNBA 3QLUA 5TPWA 2JBAB 2H3HA 2V0NA 3LUJA 4XFKA 1YMVA 4ZJPA 1RZRA 4Q6WA 1BDHA 4L4UA 1QP7A 4RZSA 3SNKA 2DRIA 2MYTA 4ETNA 4RKRA 4WUTA 1DRKA 1QPZA 2PL1A 4F11A 3QX8A 4G0PA 3GRCA 5T3YA 1EHCA 3H1FA 5CNMA 1ZH2A 4W5OA 3Q7SA 4MRMA 3EGCA 3GL9A 5BRAA 3FFTA 3KLNA 1LBIA 5KQLA 4YRZA 1HEYA 5KQMA 1P6QA 3Q9SA 1DBWA 5FWXB 3TMYA 4RSMA 4CBVA 3KHTA 3M6MD 1MIHA 5JS2A 5EWJA 4KPYA 4MS1A 2JBAA 2VYCA 4NV3A 1PNRA 4MPTA 1J56A 3K4HA 2IDMA 3QLTA 4KQ9A 4KZKA 3RVRA 4RU1A 2W42A 2NUBA 1DP4A 1FFWA 2FQXA 2NT3A 4MAAA 1GLGA 3O1IC 4WXMA 4G0XA 3QX9A 1BAPA 4RY0A 3VNAA 9ABPA 4W5QA 3F6CA 3IDOA 3GWGA 4D6YA 3H6HA 2I6FA 3LKBA 3H1GA 2FMHA 5HSGA 3SG0A 1P2FA 3QLUC 2E4WA 1JX6A 4QICA 4Y9TA 3GBVA 3N0RA 1JLKA 2PUFA 1E2BA 3OM1A 4RK4A 3OLYA 2CHEA 4YWHA 3H1EA 3HJFA 3C97A 4YS6A 1B00A 3JPWA 3UUGA 5TQ2B 4EYOA 2HSGA 3HDGA 2A9PA 1NXXA 4MS4A 4RWEA 2FTKE 4MLDA 3OO1A 1H9CA 3E61A 1D1QA 4DQDA 1TMYA 2L17A 5IULC 2PUCA 5KWSA 5ABPA 2CHFA 4F3TA 3GYBA 3FMVA 4FB4A 1NXVA 1DC8A 3L6UA 2PUAA 3I09A 3VNBA 1USKA 5IX8A 4B09A 1Z16A 3I45A 2FEKA 2LBPA 1USIA 1ZGZA 2FEWB 3LUDA 5IUKC 5JS1A 2ZAYA 4JB2A 1E6MA 5B3JA 1DBPA 4YR7A 5C5EA 2YHAA 5ED4A 3QLVC 4KQCA 3B2NA 1YS6A 4W5RA 3N0XA 3RVMA 4MR7A 5GOTA 3N8IA 3O2JA 4G0OA 1YTUA 1XHFA 4RK6A 3HDVA 1GCGA 5PNTA 3OO0A 4MQFB 1BDJA 4EYGA 1S8NA 4RK7A 5IBQA 5KQPA 1FFSA 3DGFC 4JB0A 2LIVA 4EY3A 1P6UA 4TLLB 3T8YA 2R47A 2IKSA 3BBLA 6CHYA 4KMRA 4KVFA 5BR1A 1EAYA 2AYXA 1NXTA 3H6GA 3SAJA 1YK0A 1L5YA 4ZPJA 3TB6A 2QW1A 3MF4A 3KS9A 4N0QA 4JA2A 3TO5A 3T38A 2ZWMA 4XXHA 5CNKA 3LOPA 3KSMA 5DTEA 5EWMB 4P98A 1P8AA 5JNSA 3OQMA 4E7OA 3JVDA 5KC9A 3CRNA 4LE1A 4RK5A 5HKOA 2A9RA 3URMA 1KGSA 3QLVA 1VRVA 1LJUA 4XASA 3FFXA 3Q15C 2JCGA 5CNJA 4LE0A 3JTEA 2FQYA 4MS3B 5D2CA 5EWLB 2PUEA 2JB9A 3W9SA 1U04A 1U8TA 2FMIA 3MQ4A 1BVHA 4Z99A 5IEBA 3QEMB 4JP1A 1SXHA 3Q7TA 4MLCA 4XARA 3KLOA 2ID9A 2H0AA 3N75A 2FSPA 3H5IA 4RXMA 4EYQA 4TMYA 1JDNA 3SM9A 1VPWA 4RXTA 2BGGA 3CZCA 2OQRA 3BILA 4OBBA 2QU7A 3CFYA 3O75A 3EJWA 5JNRA 1DZ3A 5TPZD 1RPJA 3CG4A 4G0YA 2PKXA 1Y1LA 3HO1A 2PUGA 4ETIA 3LKVA 3NBMA 3RVOA 1QQBA 3A10A 2KYRA 1K68A 2L2QA 4RY9A 2QV0A 3JS5A 4MR7B 4OTZA 4L85A 4G0QA 3HXMA 4MS1B 1QO0D 4Z4FA 3EODA 2MSWA 1ZGGA 2VK2A 4PYRA 4YP9A 1VLZA 3NNSA 1ZITA 4Z4CA 1USGA 4EUKA 1AB5A 2E4XA 2NZVG 3CHYA 4RKQA 2IPNA 2WRZA 1C0EA 3IP6A 3T6KA 3LUFA 5EWMA 4F8JA 2NZUG 1E6KA 2M1ZA 3KJXA 3RVKA 2R48A 7ABPA 4LX8A 4H3KB 3GBPA 4OG2A 2X7XA 1JFSA 4QYMA 1QP0A 3MA0A 2MYUA 2QVCA 4ZMSA 3FGZA 1ABEA 1DG9A 1EWVA 1MVOA 2L19A 4YV7A 4MQEA 3EQ2A 2J48A 1JL3A 3IPCA 2RJNA 3MYYA 4YO7A 3Q41A 1GCAA 3N53A 4FE7A 4IILA 1LK0A 1EWTA 1U2PA 1ZVVA 1WETA 1NXOA 3OLVA 1ZDMA 4D6XA 3TD9A 1K66A 1Z15A 3CLKA 2R4QA 3IP5A 2FXIA 2FLWA 2LPMA 3SY8A 1U2QA 3I5AA 3NHZA 4XLTA 4S04A 5FWYB 1A04A 3O2SB 3CS3A 1CHNA 3JVIA 4HNRA 1QP4A 1DCMA 4QPJC 3L49A 1JH9A 2WWVD 1DJMA 3G85A 4UHJA 1ISRA 1SXGA 3O21A 4MYRA 1AB6A 4W5NA 4IMIB 1DC7A 2JK1A 3RVNA 4FE4A 1OXBB 4O1HA 2FMKA 3MIZA 4PZ0A 2Q5CA 2CD7A 4M88A 3CTPA 1NTRA 1D1PA 2FW0A 5BRJA 3GA5A 3LUHA 4NICA 3O1JC 2RDMA 4KFCA 2QVGA 3O2QB 3KTOA 4KRFA 5DCLA 1LBHA 1M5TA 2XDYA 3HS3A 5DLEA 5E3JA 1CYEA 4OLBA 1D4ZA 1RXIA 2PMCA 2MSKA 2VUIB 3DZDA 1NATA 2PL9A 4MR9B 2WMYA 2PLNA 3F6PA 2PUDA 1OXKB 1KRXA 3IP9A 3KYJB 1FSPA 2IPLA 4Q6BA 3CG0A 1F4VA 1Z18A 3JY6A 1YVUA 3HSYA 4ML3A 2FKAA 4EVSA 3CU5A 1Z2EA 5CNIA 4GNRA 3H5TA 3RVPA 4ZMRA 1M2EA 3OM0A 1LJLA 2QXYA 2WJWA 3DLBA 2B1JA 3ILHA 1T34A 3QELB 2F8TA 2JVJA 3BRQA 3HK2A 4DADA 1QKKA 2FLKA 3EDCA 2MYNA 4HYEA 4Z4EA 2FEPA 2AYZA 3OLXA 3KCNA 3D02A 5TQJA 3H75A 4RV5A 5C5CA 4G97A 3KYIB 1Z17A 2CWDA 1NY5A 1YS7A 1E6LA 1Z25A 5B3JC 1JYEA 2P4UA 4MS4B 3QEMA 5FWXA 2JVIA 2GWRA 1XWWA 1M2FA 4N0PA 2PE5A 2HPHA 3ROFA 3QK7A 1ABFA 3SQNA 4G0ZA 1BDIA 2R25B 4KNYA 3H5LA 2HQOA 1PNTA 2QSJA 4IGAA 2JRLA 1URPA 4ETMA 5TQ0A 1Z26A 4GPAA 1RNLA 5GQSA 2NT4A 3R0JA 4WT7A 1FFGA 3LUCA 3S99A 4MQEB 4N47A 1W9HA 3DBIA 5TPWB 1ZESA 3HUTA 3C6QA 1DCFA 3FFWA 3LTEA 4NQRA 3C3KA 3H5WA 3NHMA 4LE2A 1FQWA 3GV0A 2L18A 2RJOA 3G1WA 4W5TA 3JPYA 1R8JA 1CEYA 3UK0A 3LFTA 4O1IA 3N0WA 5JNWA 5KC8A 4UHKA 4WWHA 2FVYA 1F51E 5DKFA 1EFAA 1GUBA 4MR8B 3NNNA 3UKJA 4XAQA 3P9YA 1C4WA 3CZ5A 4LRQA 4HNSA 4RK1A 3O74A 4S05A 4IMJB 4MGEA 2HQRA 4P1ZA 6ABPA 1MB3A 3IP7A 1YIOA 2MYPA 1DRJA 2A9OA 2E4UA 4RS3A 2MSLA 3E3MA 5KI6A 1SRRA 1DCKA 4YGXB 4IF4A 1A2OA 1D2AA 2WB4A 3A0RB 4F12A 1W25A 3DGEC 1KMIY 1I3CA 4LDAA 4MR8A 2YHBA 1QMPA 5JNVA 1IIBA 3RVLA 3M9WA 3RH0A 4LDZA 4TN5A 1SD5A 1UDRA 3A3KA 2LP4Y 1JF8A 1SXIA 5IEJA 1U0SY 3C3MA 1Z13A 5DGCA 2WJAA 3LUKA 2HJ9A 4N41A 2PAFA 4NCBA 3KKEA 3HEBA 2B4AA 4JASB 5FBKA 1APBA 3LMKA 2VUHB 2LUOA 5JNUA 4KK3A 4EVRA 3HM9A 2E4YA 1TM2A 4F06A 3ROTA 1ZH4A 2PUBA 2FN9A 4OATA 3OQNA 3BREA 1PHRA 3NNDA 4D74A 4HNQA 3F73A 1XHEA 3T95A 3O1HB 4Z9BA 1ZY2A 3OMXA 5TE9A 1Z12A 2FMFA 3A0UA 3LUGA 5TQ2A 3RVQA 2M98A 3F7NA 3DLHA 1JFTA 3BRSA 5EWLA 3HUUA 1RZRD 4MS3A 4JAVC 3RVJA 3K9CA 2IPAB 3FDFA 4PEVA 3EAFA 4MQFA 5FBHA 4MR9A 4N03A 4EGSA 2GX6A 3IPAA 5IUJC 4KK4A 3H5OA 3QEKA 4KREA 3QELA 3HVRA 1TVMA 1M5UA 3TX6A 2N9UA 1JWLA 8ABPA 2O20A 2A9QA 4H3HB 3MMNA 1GUDA 1PEAA 1PUXA 1ZHHA 4DN6A 2GKGA 4YCSA 1ZN2A 2JVKA 4Q7EA 5T7BA 4Z4GA 4PE5B 3OLZA 2IYNA 3RVSA 3GT7A 2FQWA 3M9XA 4RK0A 4RXUA 2WY2D 5F64A 4MRMB 3D8UA 3C3WA 4RY8A 2RGYA 1EWKA 4H60A 2P9HA 3HCWA 5I4CA 3MM4A 1YK1A 3LUAA 3CKMA 2QR3A 2IPMA 2QZJA 5TPZA 1KRWA 1TLFA 3HV2A 1NXWA 3N6VA 2GI4A 4O5AA 3KG2A 3Q7RA 1QNLA 2E4VA 4Z4HA 4WXEA 5TQ0B 2E4ZA 5HQJA 2PJUA 3HZHA 5IUNC 4EYKA 1NXSA
chains in the Genus database with same CATH superfamily
3H65A 4ZVPA 3MJ4A 4JC4A 1PP4A 1SK8A 2X4IA 3EULA 3HU5A 4EBFA 3M9LA 4S1WA 1L6IA 4YMVA 4ZPXA 3WL7A 1X7XA 5EE3A 1U2DA 3DWGA 1LC3A 2H4WA 3KWFA 4J6EA 4GI7A 4AKSA 3QW4B 3LUBA 1V3QE 2X5KO 4Q03A 4RUKA 5KQGA 3PNQA 2Q9AA 4PCLA 3CNHA 2XD4A 3QUSA 1FVFA 4GVPA 3ND8A 2ADMA 3G5AA 5T4FA 4BWFB 4DM7A 5JAQA 4TMTA 1VKRA 4IP0A 5TEWA 1C7EA 3EXG1 3UJ9A 3GJ7A 2AQHA 2JANA 2QNIA 4DCGA 1L1RA 4O4LB 4EVQA 1TMOA 1G20B 2O07A 4KH1A 2H8GA 1L1FA 3ZX5A 2IE8A 4WN9B 5BT8A 1IN6A 3QLUA 3JZFA 4D8UA 1C9YA 2J7PA 2BMAA 3D7KA 4QRIA 3T7TA 1SCDA 3GVIA 3HEMA 1SC9A 2HK7A 2C5SA 1RLOA 3N2YA 3O26A 1MOZA 4BLTA 3D6HA 4H15A 4OLHA 2P9EA 4KXMA 2BFCB 5ICFA 5A6SA 2CKMA 2F9MA 1FFAA 2IUEA 3BFPA 3GFGA 3DVRX 2G88A 4EABA 1MO2A 1QG0A 5CP8A 1K6XA 1XQVA 2B0CA 3F6BX 4MRMA 5HYVA 3MGBA 1I6WA 1ZIPA 3KLNA 4ZZ0A 2Q62A 3QKIA 1TM3E 5GONB 4F86A 2V6FA 2BFBA 3K7EA 3GNQA 1TTQB 4QGSA 3P9PA 1T8TA 4Y2YA 3WKEA 2VVTA 1PFVA 1IBCA 5LIPA 4HRYA 4X00A 2ZROA 3BXOA 4S0XA 1MPXA 2WAAA 4CEHA 3T1YB 1E1NA 5I8PA 4YHBA 5IBPA 2LXNA 2XUDA 4TKLA 5AO9A 1IZ8A 3RLFA 3O1IC 4PTYA 1T1JA 2B8NA 4KQ2A 3CT4A 1UOQA 1T6NA 4Y98A 2UVDA 4H35A 3ECCA 1BGWA 1UM8A 4MV4A 4B7CA 3NHJA 5K09A 1KEKA 1OREA 1ZJ5A 3ICEA 5JD5A 3D2AA 4R83A 1XVUA 2J0EA 3NXKA 5K3AA 2CNKA 3C7TA 4EB3A 5C8VA 1QFXA 1CKEA 1XRSB 3THWB 4JI4B 3G6KA 3ZD6A 3KELA 4G56A 3BD9A 4A2CA 4TPKA 3I5XA 1OZHA 1E2BA 2FCRA 3WY9A 2B78A 3ASUA 4BNDB 2ETVA 3E9MA 2OMEA 3P2YA 1KYVA 1POXA 5T6MA 3FMFA 1XRJA 3H84A 3N7UA 4B3RB 3PGMA 1OLUB 3FMPB 4UQPA 3BB1A 5TQ2B 3FI9A 3PPYA 4J0HA 1MEOA 1FLAA 4TMXA 1N0WA 1SCAA 4PQYA 4Z6KA 4PC3A 3X1DA 1WS6A 1NGSA 3MCAA 3OO1A 4YUAA 1HV8A 4OMUA 2DT5A 1KORA 5KZMB 1NP3A 2HNAA 3DXXA 3EXG2 4M6WA 4YVFA 3WJ2A 3NOQA 2C9MA 2PKCA 4J75A 1W1IA 3K72B 3UW1A 4Y6LA 3KSZO 3W4IA 4MX8A 1XCBA 1T9GR 3E03A 3IQXA 3PDIB 2WP8J 3VR6H 2OHIA 5LQSA 4RTPA 3IH5A 2FEKA 1TUIA 1GIAA 4PQFA 4HRAA 3U4AA 3ZDXB 1QHYA 1ZGZA 3O4GA 4ZQBA 1SULA 2VPZA 2PXCA 4V0RA 5TRTA 4BO5A 1ZEMA 2C1ZA 2PRZA 5GJVC 1HF3A 5HIMA 3DPIA 4YJHA 2NVUA 2O6LA 1SOMA 3GIWA 2WYIA 4NV1A 4X41A 4YYEA 3A1VA 2FDRA 1NM5C 4J8PA 5T67A 1P6UA 3MTBA 2OBMA 1RKQA 2ECPA 3IKVA 821PA 2PEZA 1GNLA 4CG0A 6CHYA 4PBTA 5KSZA 2GSWA 5CCXA 4IDOA 2WVGA 1Z5NA 3PQEA 4OIFA 3B8EA 2WV9A 4TKZA 4JUIA 2ZKLA 5DHTA 4CMGA 5JCJD 1XRNA 2AK3A 3O94A 3LPAA 3MTQA 2DLCX 1PLLA 2VJOA 5KSYA 1LV8A 1Y8RB 2ENWA 4XTRA 3S2SA 1MC1A 2HLNA 3LX4A 3OE5A 1NVVR 3D7SA 3O8LA 3NT4A 5LQNA 3R5XA 2V1UA 4UBOA 3TGWA 3Q9LA 1EFRD 2J87A 3LK7A 5ED0A 1NQWA 1YU6A 1JV2B 3BZUA 4AZ0B 5BPHA 3D3WA 4WSOA 2WF8A 4DZRA 4CTNA 4WIAA 3HLTA 4ERXA 3FH0A 3MK31 1AD2A 2IYUA 3DV0A 5AKYA 5B30A 5EMLA 4WMLA 1GKIA 5CNJA 1P7YA 3AF5A 2EV9A 1H23A 3DZ8A 5EWLB 4BCDA 1GFSA 2VYVA 2B5VA 4M8NE 4EFNA 4YR9A 1RPAA 2JLZA 5AUOB 1QIKA 4OQQA 3C6XA 4C43A 3OHMA 4ZT2A 3RIMA 3Q7TA 4DDMA 2Y4OA 3BZBA 3OOSA 1QZZA 4KAXA 4KQMA 3WGGA 4ARUA 5DZSA 4HDSA 1H9BA 1UK6A 3D1LA 3R4CA 1VPWA 5BOVA 3DVAB 3STTA 1N78A 2ZYWX 3PLAE 1KYXA 2VPYA 4NR0A 1UOOA 3TQIA 1SCBA 2FN3A 1EFCA 2QVZX 3B2EA 521PA 1SC4A 2YZKA 3H11B 4D97A 1M54A 5FV4A 1T1SA 4RS4A 3UAWA 3LA6A 4BQNA 5A5EA 1G5FA 3LL7A 3HO1A 5B4TA 5AW5A 4BAGA 3L7NA 1MIOA 1U6KA 3AXSA 4UNRA 4KR7A 4HDAA 3W77A 1AU9A 5JQGB 2NTVA 1GPNA 4GMXA 2VZ0A 1PJ4A 1NYQA 3KWMA 4XGRA 4WBNB 3QP9A 2YV3A 1AZLA 2HMUA 1E2JA 1ZJ4A 4BU0A 3E2MA 4L3OA 5J5AA 1Q2XA 4KYUA 4ZKEA 1L5KA 4BO9A 4M1OA 2O2YA 1AN9A 1U2TA 1KKMA 2Q46A 3NUQA 2OCYC 5EWMA 4M9RA 4YA6A 2CEAA 3WWDA 2IIVA 3BSWA 5LZ4A 2F55A 4GXTA 1U3DA 1C0LA 2MYUA 3Q11A 4US0R 1WJGA 3FGZA 1DG9A 1SN7A 1YL6A 3T7IA 1QBKC 4QOSA 1JEOA 4J0EA 3DLCA 2NU9B 3TZQA 1R4MA 4B3MB 2A9FA 4FE7A 4G65A 2QIOA 2RB4A 3SZRA 3VNBA 1THTA 3UJ3X 3PD0A 4TWAA 3GRPA 5CB0A 1TZMA 1LBSA 1SH7A 4NHOA 1NYLA 2GM5A 4UULA 1U3TA 3CLKA 2C3PA 2Z95A 2VYQA 3GDGA 4MV3A 4R5MA 4RVDA 2IHBA 1PJ3A 1EX7A 4X24A 5DX1A 3ZTTA 1S4QA 5EXPA 3V4PB 2WZDA 2ES4A 1CHNA 3BM5A 4F2GA 4X44A 3ZZ0A 1UKAA 2E1PA 2RI6A 3BICA 4MDYA 4O4LA 4RHUA 4BVHA 4D8WA 3ZDAA 2JA2A 1DJMA 2DFVA 2SHKA 1SXGA 1HT0A 3LT5A 3N0VA 4PINA 4S1TA 4MYRA 2VPWA 2GTHA 2GN6A 1EVIA 1AXEA 1H69A 3I1IA 4KO1S 4O1HA 4Q4JB 1ZQ1A 2HRCA 2PUHA 1MENA 4FWIB 4EW2A 5FI5A 4N7RA 1NTRA 1D1PA 2OXRA 2X5XA 2VK8A 2OECA 3OCCA 4J16C 1U31A 2RI1A 1U5AA 1B8NA 1HDYA 1WW8A 3KXDA 1GA6A 2RDMA 3O9MA 3KB8A 4YGYA 2VDQB 1CB7A 5AI8A 3A2MA 1JXQA 3KZVA 4H0NA 4RQAA 5GPBA 3OQIA 2C7RA 1WXXA 3GEEA 4LV5B 3F7TA 2VT2A 4IIBA 3BDVA 4I3HA 4UZFA 2HMWA 1I4LD 3DZDA 3Q6MA 3GUUA 5REQB 3K0CC 3G23A 4MR9B 4P83A 3UPTA 1O0SA 2PMFA 3RBAA 1QE0A 1PJCA 2SBTA 2ZB7A 3D0KA 1PGOA 1TADA 3VI4B 4EO9A 4PQRA 4HLCA 1VKHA 1PYDA 2JAPA 1X87A 2RKOA 5CFRA 4L5YA 5K1ZA 4NXNB 2FP4A 1POWA 2Z8ZA 5EN4A 3E9DA 4L3WA 4Y2PA 1GU0A 4ZODA 5L4LA 2HYIC 4XX0B 1EX6A 3TTTA 1KAEA 1FRFS 5BUSA 2ZSJA 3FWNA 1L7EA 4FT2A 1QONA 5CNIA 2H1WA 5LB4A 4KYVA 2QW0X 4TKVA 2W00A 4BZWA 1SVIA 1AQJA 3RGWS 2VDMB 3L2OB 3WKAA 3IB6A 1CUSA 2J32A 4JXXA 1Z6XA 2JVJA 3BRQA 4B6EA 1ML3A 2HO4A 1G3UA 1M2NA 3OLQA 4RTRA 3T7KA 4RYLA 1H2AS 2VS1A 1CE8A 2Z2KA 4RGVA 1U2ZA 2VKTA 2Y4NA 2ZT8A 4H7FA 4Y2UA 4YJFB 4AJHA 1A1VA 3BMQB 3PDHA 3D64A 5I7UA 3HADA 2OLKA 4JI1B 1WDKA 4OHXA 3VR3D 3PDWA 5ALNA 4LXTA 2NTEA 5FUVA 2WEKA 1BDBA 1Z17A 1J07A 2XUOA 4WEOA 1RQ2A 1X80A 3GFSA 5FB3A 1IHPA 3TFWA 4ADSG 5AW8A 1DX9A 3OZAA 4MS4B 2P9CA 4HL6A 4QL3A 4QX6A 4I5FA 3SS7X 4HAZA 4X85A 1C4OA 4RA9B 1S2DA 5GZ6A 3ZE8A 3GJ5A 1BE6A 4GIBA 2WV7A 2Q5QA 3FVVA 4Y6GB 3KKZA 4I1PA 2HU8A 3GMSA 4G8CA 2O5CA 1URPA 1R0SA 1VHLA 3BWDD 4GPEA 4S12A 2VDJA 2DFLA 2AS0A 2ZFUA 4K9MA 1BX1A 1C9JA 1U02A 3D7RA 4FDVA 4ND5A 1I3LA 3F3SA 3VSAA 1O58A 1T4CB 4JNCA 2G5GX 5GVRA 4N54A 1YDGA 4JJFA 2ORWA 5A5VA 4GICA 1M8FA 1GLVA 2VP5A 4YUVA 1P4SA 3FPHA 3C3KA 5HZMA 5L53A 3GJRA 4I2VA 5FFNA 3DKVA 3KAPA 3BE5A 5AK6A 1IM5A 2EG9A 4O2BB 1ZOIA 3CRRA 4PCAA 2X76A 1Y42X 4BNGA 3MJEA 5IXSA 1E60A 3QMWA 5EXTA 2G80A 1Z3CA 1EK1A 1R0RE 2CK3A 1SUCA 3DTVB 3L7CA 3MJSA 4TMFA 3TAXA 3QHQA 3R1IA 5DKFA 1EFAA 2F9LA 2R62A 3D4NA 3K1AA 4Z3OA 3JD2A 4K9OA 3QJGA 3V7UA 1C4WA 4DGQA 2XUKA 2WIDA 2OBLA 2GD2A 3U61B 2H4YA 2OQIA 3LQ4A 4IUDS 2Q2WA 3ANNA 1FFBA 4IHKA 2P9FA 4Y2HA 1GQYA 3ZZTA 4J94A 2A9OA 2HNKA 3LT4A 1NMXA 1OU4A 1UUFA 3Q3CA 5HFJA 3L1IA 3RT7A 2ZJ0A 4KV9A 3JZMA 1A2OA 1T8PA 3PQDA 2QX6A 4G0NA 4F12A 1CZNA 4LZOA 4S1OA 1CR6A 1G3RA 1B73A 1C14A 1ECFA 1FYXA 1OMOA 1SCKA 3HYNA 4HWSA 5E6UB 5F7ZA 2ZQYA 1WXWA 2H1LA 1FLVA 2Y0DA 4UHFA 4XVHA 4EI7A 5ICGA 4WLNA 4D41A 2VTBA 3NTRA 4CM8A 2Q6TA 2KWIA 3KD2A 1VCOA 4OGLA 4G41A 4HTFB 1NBAA 4GWKA 3WGMA 4TSFA 2VKQA 4YRLA 3EGDA 5T6BA 1OH6A 3GZJA 5DGCA 3WNBA 4DLTA 1RAFA 4IOMA 1XDWA 3IE2A 2X1HA 4Y8VA 1QRRA 3RFUA 1U7HA 3AR8A 4K9RA 2D6FA 4BU1A 3PTZA 1XEWX 1RS0A 3E81A 4O4IB 4UXHA 5JZSA 5KX5F 3EK2A 1H93A 3PXBA 2APJA 1PVDA 5TJHA 1VJ0A 5G0WA 2VDPB 5J4YA 1XQ6A 1X1BA 4JR0A 2H1IA 5AT1A 3WRVA 4HN9A 1RPZA 1FDIA 3BIXA 3T0GA 4R1OA 1EP9A 1I7QB 2Z1NA 1OLSA 3PWZA 4Q4AB 2OZEA 4YAJA 2ACKA 4MS3A 5IJXA 3N7AA 1Z8NA 2DWUA 3K70D 5LD2C 1Y89A 3EAFA 4URWR 5J58A 1ZI9A 3ETHA 4F7WA 4DUYB 1RWPA 4JROA 5TLSA 4ZU6X 1XUOA 2V9CA 3R44A 4Q82A 5JAZA 1O95A 4IQGA 4U2BA 4JZYA 1KEEA 3K9HA 4KLNA 1GVNB 4M0DA 3MG9A 2ZZKA 2BI4A 1XZLA 3P5BA 5EKSA 4CKBB 3BEOA 3IC5A 3E15A 4OYRA 2RKWA 3BWCA 4FB5A 1N75A 4K26A 2X6QA 1P1IA 1FNMA 1FP4A 2G77B 2GKGA 4Q7EA 4Z54A 3H5RA 5JJKA 3NLLA 1E20A 4JJ6A 1DKMA 2BSXA 4N6NA 2YL2A 1YB1A 3V1MA 1KK2A 3U2QA 1NMYA 3KSRA 2RBKA 2C04A 3L43A 3LUAA 1XXHA 4F6RB 4GOND 1E3WB 3U4IA 1DV2A 5K05A 4D3XA 1J5EB 1YJ5A 4EO7A 4GAEA 1KMCA 4XX1A 1L4EA 1QTIA 4HQOA 4QYIB 1QIIA 3JQ6A 4MW0A 1U7PA 2VJMB 1MO5A 4LC1A 3LYAA 4CN9A 2PFGA 2XDWA 1J70A 1T3ZA 2A57A 2R2GA 1LWNA 1NONA 3H0CA 4UTNA 2RG7A 1BZYA 3U13A 5C7OO 4BMVA 3VAYA 4YECA 1DPFA 2WD7B 3ZLTA 5G1OA 3L46A 4Q47A 3WWOA 1D5WA 1NVMB 5A3QA 5K0LA 1N2JA 5I7VA 2G82A 5CHYA 1D2RA 3I23A 1UPUA 3CGWA 2XQJA 3V1UA 2QP9X 3LF2A 2GAOA 2NPIA 3JAMA 1NW6A 2WUEA 2FWPA 4JR1A 3EWSA 3E53A 4OM8A 3T4PA 2CZQA 5NULA 3W6UA 2REOA 2JHAA 1W2WB 3ZHVA 2XNDA 4LQLA 2NU6B 4UU0A 1BA2A 1W93A 5HHTA 1N9KA 1PGNA 4R2IA 2Q4TA 5REQA 4J29A 4IDEA 5IABA 4ND6A 2JIPA 5BR4A 2WJIA 4ESEA 4HAYA 5AVVA 2QYSA 4O4IF 2O5VA 4TLDA 3WHKA 3DDHA 1USVA 1BHSA 3IJPA 3PR1A 5CYGA 3MN1A 3PGJA 2FZLA 4CT0A 4OP1A 1LNSA 3RS5A 4QJBA 2AW5A 3FPLA 4BVEA 4MWOA 4RV4A 1XYVA 1KIMA 2CMFA 4MUHA 4P8RA 4PG8A 1ODJA 3F2VA 4LYEA 2BKAA 1Z4IA 2YFQA 4K9DA 1VGRA 5K51A 3R77A 3IAHA 1TPYA 4G0PA 4W7IA 4B43A 4QLOA 4W9MC 1CNFA 3FI0A 1U0GA 2Z8YM 3GEBA 4YPFA 3GJ3A 4A8TA 3GL9A 1DQSA 2PZEA 4GFDA 2VHXA 2FZ5A 1R6UA 3C39A 4B8ZA 2Z58A 1W7AA 3O82A 2AUTA 3LDUA 3Q3GE 4JBNA 2HJWA 4OI0A 2VNAA 3THWA 2UAGA 3M6MD 3DEIA 5JCOC 4KPYA 1XD2A 4MS1A 4BQIA 1RRCA 5JAIA 2SKEA 3U3DA 3HL4A 2C03A 4ZO9A 3RVRA 4DEXA 1KXJA 2D4AA 5JT1A 3IBSA 1ZCJA 2RH8A 4XRRA 5JWRA 1VJCA 2XT9A 1EFRA 1UKCA 3L0OA 1CX9B 4UHEA 4HPJB 5AM3A 4IO0A 1QX3A 1D7AA 2ZRBA 1GGFA 3TW6A 1W5BA 2WJPA 3QVGB 4B3IA 4B2PA 3HDHA 4H6PA 4KC0A 2EERA 3G13A 4LJAA 1JE1A 4K2AA 3QLUC 1TM7E 1THZA 4JVMA 1PSDA 3JWHA 3N0RA 4AECA 4DBLE 3HSKA 1US8B 5ERGB 1EVEA 3IUBA 3MMZA 1SUWA 3AUTA 4JL5A 1GQQA 3FVRA 5MF6A 2DPGA 5J2TB 1E7WA 4FVTA 4KIFA 4AS3A 4D82A 2QMZA 1L7OA 2WYWA 1AQIA 1RBMA 1UP7A 4XJVA 3FCSB 4CKEB 1B00A 5FO1A 4NYIR 5DNAA 4D4IA 1JJVA 1BHJA 3MCTA 1BWRA 4LZPA 1X8JA 4PLCA 5A02A 2EBUA 2PGOA 4R3UC 1NZDA 3VZSA 3ZGZA 1P8JA 1W88B 5BVGB 1H4QA 1UBNA 1Z22A 4O4HF 2WVHA 2NZ2A 2O5EA 2XDAA 3JV7A 2L17A 5MHTA 1OBOA 2BFWA 3AUSA 2CL6X 4RM2A 3TLYA 4ER7A 1AJEA 4WZ6A 2OYCA 1UBSB 3WAJA 3CNLA 1W8IA 2IZ6A 2OXEA 1V2GA 2W2KB 4H59A 4LCJA 5L3SA 3Q7EA 1F4LA 1V9CA 4DY4A 4ZI7A 1VZ3A 4RYDA 1Y3BE 2LBPA 3DNPA 3CVWA 3F97A 2F59A 2PGIA 3ZJ4A 3FNBA 2H54A 1HTTA 4I2NA 5B3JA 1BEUB 5IFLA 2PH3A 2ZETA 4RBNA 2ONZA 4TYQA 4P5EA 1T26A 1G0OA 3SWWA 2GPAA 1VHTA 5AK4A 4QGAA 2YH2A 5IBRA 4KW7A 3W5UA 4YH1A 2XYHA 1T9AA 2WWRA 1AQYA 3O7MA 4WK4B 4DLLA 2G28A 2WHQA 3OO0A 4E14A 5I48A 2RB5A 3NCHA 4YAUA 3RHTA 2O3RA 2OHOA 3F2IA 3MUOA 4QRDA 5B7PA 2X77A 3GGCA 4HDRB 4EGQA 4TQ9A 3RCBA 5H4GA 2R47A 2OAQ1 3NANA 2YR0A 3PC4A 4KVFA 2FUKA 2BE7A 1EAYA 3MQFA 3E9QA 2C1EA 3GIDA 3R41A 4P36A 5JECA 1ZGJA 4DLXA 4F84A 4Q9IA 1KSJA 3N8KA 4K87A 3IKLA 1UP4A 5CDFE 1FS5A 3AEZA 4N0QA 4BVAA 2H2AA 2YV1A 1PNVA 1X1RA 4L51A 4XXHA 3UBMA 3HJRA 1F2UA 1Z2OX 2ZYUX 1YBMA 5JNSA 3X1JA 4I5DA 3DT9A 3FFAA 1KNQA 3JVDA 3ZN2A 4DS3A 3MLAA 1NJ1A 3U3KA 4REOA 2FZ4A 3IA7A 3DFIA 5DVZA 1WPGA 2AJDA 4KNWA 3RBZA 3RSLA 3KHSA 1QFMA 1THGA 5FI0B 2OQ2A 4G1VA 4ZHQF 4B8YA 3JZAA 1DAFA 1QCZA 3JTEA 3GU3A 4MS3B 3T9FA 1EU1A 1L7AA 3DDZX 2JLAA 3RAFC 3HTXA 4GXQA 1M8KA 2XCLA 3KOMA 3ELYA 3IVGA 3MQ4A 4LRXA 1UBCA 2H4FA 2CHVA 4QM7A 4MA4A 1QC5A 4Z99A 3LCRA 3EZLA 4J3FA 2K5UA 4JP1A 2QEQA 5IDVA 4RL6A 3EFHA 1XRMA 4EG8A 2BFDA 3E8MA 4XJXA 4ZYWA 4XIFA 1LDBA 1YZUA 2P9JA 1SUIA 2O5RA 2VJBA 3D3KA 2NQTA 4HDNB 4ZQGA 3RREA 4CMEA 5JV5A 1N9GB 4ZARA 4FFWA 1A7UA 2JZOA 2WSBA 4V0SA 1ZUNB 2R8EA 2C3UA 2R5NA 2PEYA 3NV7A 4JLUA 3WGZA 5EZSA 4R1LA 1NBIA 1EK6A 3A10A 3KVNA 3I2YX 1SKYE 4CU5A 3PEYA 2H00A 1N77A 3SC3A 4EUFA 5MDHA 3QE2A 1EDZA 3GZ4A 5EXDA 3TUJC 4LCBA 2D7JA 1Y8QA 2GDZA 2QXUA 1GFWA 3FSGA 4W1PA 1N3YA 1CWUA 4BUJA 1X42A 2WM9B 3IT0A 1SK9A 5HOQA 2DX7A 5JTUA 2W6JA 1ZITA 2WMNB 2LTAA 1HQYE 3BE4A 3T35A 1T0IA 3CHYA 4XSHA 4ER5A 1GNVA 5BXQC 2OHGA 4CODB 4S2UA 1W4CA 1QTQA 4GUAA 7ABPA 3NYRA 1DLJA 4QHYA 1SXJC 4XPIB 4CLHA 4W5JA 5IAEA 5AM5A 2MMCA 2VC2B 2OCBA 3E27A 4XVQA 1NVAA 3IPRA 1M8GA 4Q1CA 2C59A 5I7AA 3LVQE 1XZBA 4FZRA 4GP6A 4MW2A 3W04A 1M1NB 4M1EA 4WXPA 5CLFA 3M6FA 3N53A 4AUEA 4ZGBA 4A36A 2BHRA 1AC5A 4TT3A 4ZC8A 3BC1A 5ENVA 1P0MA 2EJBA 1CSEE 1UBRS 2VIIA 3AUUA 5CJPA 1WULS 1X38A 4GOKA 2J5RA 3RS9A 3U7GA 1W4ZA 1XJ5A 3ZDYB 4P80A 5JYEA 3CYFA 3LRXA 2I9PA 5BWNA 2KHZA 3T1NA 5H8WA 3B48A 5FFMA 3M4NA 5I9SA 3QV1A 1ZD5A 4KAJA 1JQJC 1FW6A 4AJOA 3GGGA 3JQEA 4Q3OA 1XDDA 1QSGA 2QI9C 5CYOA 1FCJA 2M9MA 5B1HA 3V8NA 3O3MB 4R6WA 5D85A 3ZD8A 4QNRA 2Y1EA 1GRCA 1VG1A 2XUHA 4IXTA 4YBRA 1WMSA 4RSHA 4KR2A 1SPXA 4D9IA 1X1DA 4ZZ1A 4DWJA 3NHKA 3IEVA 4AZ3A 4HCJA 1H2FA 5EPOA 1FDOA 1U5CA 3REQA 2QVYX 5AVXA 1DEHA 4LUCA 4XGQA 1QHXA 3N8GA 3V8EA 3T1TA 1F60A 4IQ8A 1QGUB 5EP3A 3DZCA 2J7KA 4M0MA 4A6DA 2JEOA 2VUIB 4AJ4A 1W94A 2OCKA 4RKWA 4CV0A 1Y4ZA 1DFIA 3U48A 2YN4A 3B6ZA 4TYPA 3HI4A 4YJFA 5B1YA 4IFEA 4EF4A 1KY2A 3I05A 5T64A 1BXZA 2R7KA 3AH8A 3GRFA 3JY6A 3M89A 4WW0A 5DNWA 3KQKA 4G1CA 1U3CA 1Y9ZA 1JIUA 2WD8A 3K15A 3QKRA 4NATA 4YS6A 5TX7A 3JD0A 4ZICA 5FTLA 2AG1A 4JI2B 4MJXA 1J39A 1KAHA 1ZC4A 2H63A 2V74B 2I6XA 4S24A 2JAWA 1RM0A 1NW4A 3TQFA 4F4JA 1KARA 1DEAA 5KDOA 5FOUA 3KE8A 3IKJA 1NQOA 3H3JA 2V0CA 1VSTA 1OWNA 4NAVA 5D8DA 2P75A 1T9DA 1X7XB 3L1JA 3VZCA 4E4YA 4HVCA 2OP0A 3QELB 4X1YA 4LRTB 2QRLA 2EP7A 3G0OA 3MMPA 3ZHSA 3LQQA 4D1YA 2OT3B 4HYEA 2F1KA 1CUCA 1ZI6A 1G17A 2FJ0A 4P35A 1M34B 2GD0A 1KYZA 3MMXA 2CL5A 3M6UA 1VBNA 3P2MA 1P2GA 3EEBA 1ID8A 2B3TA 3PHIA 1W44A 5COBA 1V1RA 3R3WA 4LYHA 4JHXA 3T7DA 3B3AA 4Y6PA 4QQRA 5BVGA 3TNDA 1KRHA 3LYLA 4ABTA 2WSMA 4DXAA 2GM9A 3AF2A 2XB4A 2EYUA 2EFYA 1BOFA 3QPBA 4QTYA 1QMGA 4CTMA 1TIKA 4A91A 3IVCA 1E79D 2HPHA 3KJZA 4HAXA 2DFPA 5BWOA 2R85A 4EHHA 3FVWA 1MQAA 3PPWA 3R6LA 4DFDA 1A8QA 1E98A 1PNTA 3QMMA 2IEGA 4IGAA 4AJ9A 4UHBA 5KU1A 2BUBA 3IIIA 4JEIA 2ZBEA 1Z26A 3ZDZB 3W79A 3S55A 1FDSA 3RBVA 3FWKA 2G9RA 3R0JA 3QYAA 3FNQA 3D3EA 1QOZA 3S40A 3X3HA 3M3DA 1PJTA 3BTVA 3KKKA 1KY4A 4RLSA 3UMRA 2ZK7A 4B40A 1AKRA 1MF7A 1O95D 2WVAA 2YN2A 3ZEAA 3LX8A 2P9YA 1P4RA 1AVTA 4NS1A 4YN3A 2AJ8A 1F48A 4HPXB 5J4LA 3KSUA 2OC9A 3AFNA 3N3BC 1EK5A 2VH5R 1HDIA 2CLDX 2VPTA 1XZGA 2WTNA 4EFMA 2HA0A 3P2OA 4M1KA 4PX9A 4WLOA 5T4HA 5JNWA 1H4TA 1CF4A 3ZWYA 3OZXA 4M0LA 2PFKA 2ZJ6A 4RQUA 3PXEA 3S1SA 2OYSA 3GMDA 3A37A 5ULLA 4GWGA 1H6AA 2K6GA 4BYGA 2HR1A 1RCFA 2ZULA 4IO1A 3W9UA 2HQRA 4K46A 2OPHA 1OF1A 3TZEA 1TU0A 4L08A 3TZCA 5KTKA 1Z0JA 1ZIYA 4MTLA 5L3ZA 1CS0A 1P2UA 3RBXA 4Z3KA 2VP4A 3OJLA 2IS4A 1D6JA 3QY9A 3MHTA 1H3FA 2GERA 1Q16A 5FHRA 1D2AA 5L8VA 1K88A 5EIXA 1NVKA 2HZBA 1P9WA 2IDZA 1QOPB 1O6ZA 1QIJA 3H9CA 3J7TA 2XZDA 3OAAA 4RAOA 4HY3A 1CU1A 1O6BA 4E0BA 2BFMA 3A1NA 2X0KA 1O2DA 3TZBA 4G4SP 1PKEA 5K9ZA 4J07A 2BEVB 1L8XA 4KN8A 3TOSA 4A0QA 3PQCA 4KPGA 4ZA2A 5BYKA 2PX4A 4GRAA 3VQTA 1Z13A 1CS4C 5BMVA 2AF3C 4AG6A 4HR7A 5C46F 4QEKA 4K8OA 4DCTA 3N28A 2WHXA 2BBSA 1NJGA 2ZR8A 3IBYA 3NC4A 4BECA 3ZW8A 3CX6A 1Z2CA 1HYHA 4HMQA 3NONA 4L8LA 1C29B 2PSSA 5F1YA 5CFPA 1TYAE 4MKIA 3MUEA 3V4RA 1SU7A 2QL6A 3AIOA 4P2BA 4RORA 2WTAA 1Q83A 3L4KA 1L5RA 1TT7A 2OUKA 4WKPA 1OZAA 1XB2A 2BDUA 4K6GA 3ZU6A 2PRKA 3A0UA 4TMWA 3KUUA 3TZLA 3MT0A 3PGVA 1K5HA 3NX4A 4FGWA 4CM7A 1VRWA 2YHSA 3B8HA 5EWLA 3H6KA 4EUSA 2ZM6B 1W8DA 2MIIA 1G2IA 1R0CA 5K8LA 3ROEA 3A36A 4REQB 3THSA 2RHBA 2ZUTA 5AVOA 1AXGA 3SU8A 1HDXA 1T0JB 5GP1A 1DO0A 4L0DA 2ZIUB 2FZWA 1YZQA 4DHEA 5CHEA 1PR0A 2RGEA 4NE2A 3EARA 4RVGA 1IAQA 5I7FA 2YWEA 2HSJA 4GW3A 5G2OA 4NQZA 1HNXB 4BY9E 4IX1A 5K0SA 2C5HA 2G67A 3BKWA 4Y7DA 2ZYGA 3BN3A 1P0FA 2QD4A 3PIIA 4TS4A 2YWBA 2UZ3A 3CLVA 2ZBFA 2BSQA 4UVDA 2WY2D 5F33A 5FDFA 1YQGA 2B1QA 1ZVKA 4I9NA 5AJUA 1KF0A 5D6OA 4DMFA 3HUFA 2OAEA 4NE9A 4AIIA 4C4AA 1COWD 5FPPA 1GTJ1 1IHOA 3P96A 4JI6B 2RSLA 5K01A 2OVFA 3G88A 3IDZA 3KL4A 3OF2A 3ZHZA 2WJYA 1DAIA 3TDKA 4BQOA 3RV4A 4QUKA 4UU1A 4N5DA 5TPZA 3LT2A 2V7EA 3GUHA 5C53B 9MHTA 3AHEA 3HV2A 1VYTA 2BI7A 2VDNB 5FI3A 4AB1A 2BUCA 2XQGA 4JT8A 1T5OA 5BSMA 4AMBA 1E1QD 1GPDG 1V39A 2C00A 3GLGA 2AHOA 3OM9A 1Q3TA 2WAYA 4B33A 1HL3A 1T1GA 4PX5A 4DCPA 5HKKA 5LBIA 4QYWA 2YWDA 4KQ6A 1RQNA 3EGXB 1M83A 3ZQUA 4D5GA 2X40A 1S9HA 3W7BA 5A4JA 3G3EA 4CM4A 1UDBA 1YUNA 4EMTA 1U7DA 1XROA 2VOJA 3DE0X 4NSNA 4BNUA 2CDAA 4V0LA 2QSZA 3NC1C 5H83A 1ACMA 1YDHA 4L22A 4H4DA 3PLRA 5FBZA 1LSUA 2Q4RA 2OFPA 4UAGA 2PGDA 1CXZA 3G0DA 3TXAA 1OZFA 3ICVA 3IQDB 2E9SA 5BW8A 3PI6A 1QYRA 4YCNA 3DCNA 1I7DA 4QOHA 3E7WA 3S70A 1IBKB 2C3YA 2WK1A 5L7YA 3G8CA 1YB5A 2G6TA 4YRPA 3NWOA 1K4YA 1DHRA 4XCVA 1UQUA 5FUMA 2DYKA 3EIWA 3KB2A 2VPXA 3KTFA 4LMAA 2V0NA 4G9GA 2YMPA 5F3RA 1FYEA 4L9AA 4B3CA 2IOFK 4O25A 3AINA 1BX0A 1NPDA 5H59A 4W9RA 3FTQA 3QPAA 1S2GA 3EXEA 1U4OA 3SNKA 1BU5A 3VPHA 1VLMA 3UC5A 3NR2A 4CXMA 1SVUA 3IODA 4KAAA 3H1FA 3ANSA 1WCIB 1J8MF 2L0XA 3CSDA 4KR0A 4EJ2A 3ZY3A 1C1DA 2J45A 4F3YA 3NTQA 4RSMA 2HQSA 2NV2B 3JQBC 4Z7JA 4CM3A 2P0EA 3OZDA 4GG1A 1E2IA 4C3OB 4BQEA 2IHUA 5F98A 2DTXA 2WKWA 3X1YA 2JKVA 1ADFA 3K4HA 3OAAD 1FOEB 5BRAA 1I3OA 5IM5A 3UMSA 1Y6QA 2LKCA 3X1MA 1I2CA 2IYXA 3NBFA 4BQFA 3AR2A 3QXHA 4Y2QA 1N6RA 5G4KA 4LVCA 3OJFA 2V6JA 5FUYA 4IV0A 1Y0BA 4UOEA 1RLIA 4JODA 4X45A 5I7WA 1L7NA 1QAOA 4HNVA 4QEZA 2YW2A 3O47A 4TTIA 2A7XA 2PJZA 4S1PA 1RXYA 1ZMBA 3QWIA 3K94A 1QG4A 3GP3A 1A2KC 2QJWA 1LF0A 2PJRA 2OO5A 2B35A 3U7QA 4JI7B 3U39A 3EVBA 5EJ2A 2ZAGA 2JH9A 3QU5A 1L4FA 2W6PA 2YWFA 2V5UA 1QE5A 4RK4A 5C7YA 5CB4B 5JH7F 2WHEA 2H7YA 3W0LB 1SQ6A 3HQ4O 5LYJA 5LP6F 1F17A 3B53X 4KU4A 1D3AA 1X2BA 4OEHA 3LLVA 3MT9A 4XIYA 3PRKE 4B2YA 4JBYA 1CUGA 4ACAA 3GLIA 1UXOA 5HTKA 5JXIA 4HGZA 4MS4A 4AO7A 1ZKMA 4S1NA 1Z4MA 2OFWA 5AVWA 1VJTA 1M2HA 4DC9A 1ZP6A 3WK9A 4AXXA 2X7JA 3C3JA 5KPDA 1KDRA 4DT1B 4ETWA 5IULC 2AW3A 2FRDA 1K9SA 4L50A 6YASA 1DC8A 2WUGA 2XB6A 1SBNE 1RC1A 3I09A 4QOIA 3TEMA 3PCRB 1PIWA 2AHRA 3RRXA 4H3SA 4E12A 1IC6A 3EVDA 1Z16A 1XQYA 5E4TA 4IIXA 1MVNA 2V7UA 3N8NA 4HLUA 5CA1F 1HO3A 2JLRA 5FKJA 3IHKA 5KVSA 4NULA 3HUEA 4CMIA 2GAFA 3SX0A 3UK6A 1CS0B 3QLVC 4LJ8A 4MIOA 3R8FA 4CM1A 4H1VA 1ZUWA 2YJ3A 1MGPA 2VQSA 2DT8A 3N8IA 1PF7E 4C7OB 2V7GA 4Q9NA 3RYCB 1A3CA 1TKRA 5E9JA 4L9RA 3AG6A 3BMQA 1W36B 3DTVA 4EYGA 2A4MA 4W6QA 3IOEA 5E8JA 1L5OA 3S68A 1OH8A 4QJ4A 3I62A 3TQRA 1NVUQ 4WAUA 3M1IA 4CL0A 3TSOA 1GZ3A 1W6RA 1ZRNA 5EJ9A 2VF5X 3NFYA 4V0MA 1E1QA 1L5YA 2EKLA 2JRCA 2NYVA 2ZRJA 2NXJA 1FMJA 3UHAA 3WC4A 2JGJA 3JARB 2AWOA 3G2NA 4LNAA 3NGMA 4R1PA 1BG6A 3KSMA 4HNGA 2BFNA 2BKUA 1SM4A 4GYJA 4NG5A 4C5CA 4Q9KA 1PG0A 3AUKA 1I51A 2NO0A 2YICA 4EYEA 4YRIA 2ZT7A 1OXVA 3L7MA 4NHEA 1IMOA 1Q7TA 2FR0A 1EVQA 4QC2A 2CVZA 4UJ3A 3WV4A 1CYEA 1QRTA 1I0LA 3MZ0A 2VP9A 4KODA 1LJUA 2QP4A 3UHOA 3FSEA 1FJXA 3HB5X 1BDMA 1C50A 4PO8A 3GOHA 3LCCA 1MEJA 5ALDA 1U04A 1IPHA 2QRVA 5EERA 1NQAO 3PGKA 2JLYA 5B58C 2HTFA 1YGYA 3TRHA 1UWKA 1PTJC 3GYGA 4XARA 1KMMA 3ONEA 2QTTA 1P73A 1GPWB 4L8YA 2IODA 3VZBA 4RXMA 1IRXA 1UQRA 3A27A 3TMKA 3K1AB 3NH9A 4CEJB 2HWYA 1QF6A 4AI6A 2W8ZA 2V7BA 3HCFA 2Z2JA 4IUYA 221PA 2V1XA 3OOEA 1R37A 1QFZA 3QQPA 1U65A 4I8DA 1YBHA 3ENVA 1GG9A 3HYRA 5FBLB 3EQ7A 4FQ5A 5TPZD 5FA6A 4KPFC 3TLZA 4DCNA 1M73E 1MXHA 4KXNA 2N0SA 5FF9A 2J30A 3NI2A 3IQFA 3WQHA 4BVGA 1S2IA 4L8WB 2WUDA 4ZQCB 4AP9A 1LW7A 3LCJA 2VAMA 3RVOA 3PTAA 1K68A 1KOFA 3HEAA 5KVAA 3WMRA 3OPYB 1CUIA 4TM8A 1IYZA 2WM2A 1RW4A 4UU7A 1KFEB 4WVLA 3AJ8A 3HY6A 2XSZD 1GZ7A 1W96A 2JEZA 3ICQB 4Z4FA 1DOZA 2MSWA 3EPRA 4H6WA 4K2HA 3QVVA 2ZJ2A 3IX7A 721PA 3FUXA 4JI8B 2EJVA 2JFYA 2QROA 1KPIA 3UWMA 2VTBB 4FMDF 2WYHA 4F9EA 1T4BA 2RARA 3KJXA 1PDVA 1VIYA 2QU8A 4F5WA 1U9JA 1I7SB 4U8HA 3B1WA 3KWLA 1JR2A 2JGKA 3HYCA 4BV8A 5KJCA 3MA0A 5JJLA 3LXUX 1LEHA 1MFPA 4IIVA 3NWEA 4RNCA 4U7DA 3IMEA 3QA3E 2J48A 5DM2A 1U6IA 1V43A 1XTTA 1COZA 4OHBA 3VBEA 3N07A 1QS0A 1P1KA 5DBEX 4FMCB 3WIUA 5AK3A 3RAJA 4V0KA 1D03A 1LD3A 1A77A 4LHXA 1EE1A 2KLBA 2NO5A 2GCOA 4EW6A 2ZVQX 3PHHA 4W7HA 1RT9A 3TD9A 2VJQA 2ZJ8A 3PQ8A 2I4LA 4UM7A 4YLYA 1J5XA 1WXIA 2AFIE 4PAWA 1C30B 2YJZA 2QMYA 1DUVG 1K0FA 3KK0A 3C5CA 4TS3A 2VQ3A 4DKJA 1W2HA 1AZWA 2YQ5A 4IGEA 4YJ2B 3MD9A 4YRGA 5G41A 1V8FA 3EA4A 2JBWA 5IYZA 1E1CB 4J7CA 2W0SA 1DIRA 2GCPA 4YO8A 1E69A 3F4LA 1CY1A 2OR3A 2YUIA 3C3BA 3VSBA 3DBRA 5M7EA 4P38A 2JHPA 2AFVA 3BF8A 3PIDA 1CZRA 1R1DA 1NUTA 3SS9X 3QWAA 3THYA 3NGLA 1A9ZA 3HJGA 3DOFA 2NUAB 4ZVSA 2HHLA 2ZS7A 1XZIA 3HCDA 2FW0A 2ZT6A 1JDUA 5ALMA 2DETA 3HWWA 4PO3X 1EFVB 2QTVA 2Z3ZA 4URHA 4TTPA 2JH3A 3E35A 1MO4A 3V1LA 3M6XA 4FBGA 1TM4E 3GJ8A 3OOJA 1ZIOA 4N4AA 4OL0A 2PMCA 3K20A 2PL9A 5CH8A 4A82A 2PLNA 1VIAA 1SR8A 4YAGA 2C4MA 4QTUB 1KMHA 4JYCA 3PEUA 2JLBA 4JJEA 4W8HA 3FGNA 4IDAA 4Y9UA 3GRYA 3R6GA 1FSPA 4X66B 2H5LA 2GTIA 3F78A 2GAJA 2XA2A 3I6ZA 3BB4A 5F3WB 2IXDA 3H9QA 5DBOA 1B8PA 1DIHA 1NNSA 4AQYB 5FR1A 1TW3A 5E4YA 1E64A 1U9CA 2IYVA 1CUZA 1DG1G 1DL5A 3GCDA 3CU5A 4ZAGA 1OBVA 1WF6A 2V9ZA 2X4LA 4CLDA 4TRJA 1TJNA 2I1LA 1PI3A 2PKYX 3MELA 1WW3A 2CK3D 3KJGA 3DLBA 4MVWA 4C21A 2P7IA 4J1QA 2VI5A 3IGFA 1IQ0A 2A4KA 3AF6A 4BFLA 5HXAA 1XCMA 3EZFA 3F7OA 1XD2B 4MCIA 1E9BA 3V7NA 1CHDA 4E7PA 1GWNA 2OILA 3CN9A 3NASA 4KUEA 3UHJA 4ATNA 3DR3A 1UBLS 2REBA 3GFFA 3S5UA 1U9IC 2FPOA 2AQKA 3FNGA 3LQFA 3OLXA 1BS2A 3MPUA 3I3SR 1PZEA 2FYTA 4CTJA 2CUKA 2CLSA 2VWPA 4FYIA 3JQFA 2V7QA 3WZMA 1DT5A 4ZAYA 4TQAA 1R10A 1O97C 3D43A 5A3VA 4XOIA 3L7JA 4GKAA 5HWSA 5HFNA 2OV1A 4UNIA 3DV2A 3WICA 3IULA 3IALA 3VH3A 4HUJA 1JG2A 4E3WA 2PXHA 2CJPA 1O1YA 4LF6B 3NHWA 2PAAA 3W3AD 4M1SA 2HRQA 2QBYB 2W83A 3HCOA 4WJKB 4HUQA 4UUNA 4JN6B 2JGMA 2XRMA 2E1RA 1RNLA 3JASA 4X97A 3BMCA 4XIIA 1JKJB 1GKLA 3JQ9A 2G5TA 1RP7A 2EWMA 1ORDA 3S99A 2ZE5A 5ALHA 2YXLA 4N5IX 3UGQA 2C1XA 3PRHA 2IQ5A 4X1KA 1ZESA 1JI3A 2I3ZA 1ISMA 3GCGA 1DCFA 3HM2A 1UBFA 2PM8A 3FFWA 3Q87B 4CIBA 1XF9A 2TECE 2ERCA 3L6BA 3GFPA 3PDCA 4HEA1 3WIOA 2VSXA 1Z6GA 2AC2A 3G1WA 2PDAA 3L7DA 2PKRA 3B1KA 3KB1A 4PWYA 4EHAA 4E2FA 1NR1A 2QX9A 1DX4A 3K0BA 3ZCRA 3MCVA 2FVYA 5HP4A 1N9ZA 5DTMA 1PT9A 1PJBA 4D3DA 4BJ5A 3EVFA 3PT5A 2WU0A 4QYTA 4R2WA 2YN0A 1J9ZA 5B6PA 2WNSA 2QVLA 3L8MA 1KAOA 1Q21A 3OFSA 2ZRAA 4PIPA 3O74A 1QHHB 4DLUA 4FMDB 3ZXSA 4Z53A 3G5TA 3O8RA 1RC0A 1PR1A 4HYTA 2C54A 2R44A 3HZOA 1NN1A 3BE6A 2Q41A 3A1WA 3CV3A 2BAGA 1ECJA 2NIPA 1MTZA 3O0TA 2MSLA 1W36C 5L3RA 2GA9A 3MCZA 2PKWA 2WBLC 5BWMA 4YRCA 5LYJF 1RI4A 4HVAA 4XWKA 1GA4A 1TU3A 1X39A 2JZNA 2XQVA 1N0VC 3PFIA 3QM1A 4NOLA 3U09A 1A9TA 2PZ8A 3AJAA 4D56A 3HB9A 3RADC 3VV2A 4YRBA 4FCWA 2WJZB 5EZYA 1P60A 2QUAA 4K9KA 4R6XA 1GKYA 4BB6A 4E4TA 3WYAA 2G9UA 3PQ7A 4GM4A 2LP4Y 1SXIA 2CZCA 5EIFA 5A0VA 2BH9A 2Y66A 3KD3A 4GYYA 2MSCB 5IHXA 3L0IB 1U3VA 2QGFA 1PN3A 2D1TA 3D31A 4KP7A 2PMWB 3VKVA 3W1WA 3AVQA 1JDJA 3Q7PA 2VCYA 5FBKA 3I01A 2WIKA 4GI3A 4JJZA 2ZZMA 5AJHA 1QPGA 4LSGA 1AUVA 2EW2A 1A9RA 1SU6A 3OF5A 1B8VA 4OATA 4AJEA 5HW0A 4MIYA 4WZAA 2O4CA 1M0EA 3VV3A 1YBFA 4FYJA 4PO9A 3B1YA 2WIGA 3ZHCA 2NSDA 2WU3A 3OLCX 4LHWA 3TEFA 3VPFA 5K6AC 2OZLB 4CHTA 5TQ2A 3RVQA 2QT9A 1N8NA 2PZFA 3H7AA 5ICEA 4BKPA 1G5PA 2CF5A 1W4AA 1WM1A 4N01A 2GBLC 5KNBA 3DV9A 2FGJA 3JWGA 3NKFA 2UUBB 4EOGA 2NN3C 4MI1A 4DBZA 5T8KC 1GJRA 2REQA 4LWOA 2EL7A 1DBIA 2FVXA 2GETA 2GNOA 5L7TA 3LQYA 5JISA 3C8UA 4GL4A 1P3DA 3A4VA 1VDZA 3U3OA 1IWPB 3W2IA 1PL8A 4TXLA 4E6PA 1AT1A 2R1VB 2BWJA 5AICA 4H3HB 3MMNA 1RWWA 1XYYA 3PUHA 5B4UA 1KDOA 2YXNA 4JQSA 3CZAA 1IPEA 4F1JA 1BCRA 1Q91A 1YT5A 3QKTA 1DIOB 1SXJB 2QP3A 3L0SA 1G18A 3TZKA 1RWOA 4PS0A 1HRKA 5L3VA 1H6DA 1VDMA 2W2PA 1LJ8A 5FPSA 3HCWA 5LVAA 1KC1A 3TLAA 5BVHB 4YJGB 1CIJA 1N8TA 3DPSA 1R5NA 1ZM7A 3K3PA 2ZYTX 3QU2A 3A9CA 1R18A 3DAPA 1PLKA 2I54A 4LMPA 5CEEA 2QNBA 3AGPA 2VTEA 3F5MA 3FDZB 1QGYA 4WASA 4F21A 1Q1GA 4F92B 3T3PB 4NPCA 2ZE8A 3LWNA 1HQKA 3HXOA 3CUVA 1NKSA 3MC1A 1V37A 1KDTA 5HCUA 3QV2A 5JSUA 4NPHA 3OX3A 1UBTS 2D59A 3DMGA 1TI7A 1E2QA 4LRYA 3KETA 3AHGA 1R27A 4BDSA 3CKKA 4YLEA 4MPPA 3ECSA 1A0OA 1QQAA 2LWIA 3ADKA 2VF8A 2C99A 1BYIA 3FXAA 3K0HA 5DH9A 4XQ9A 4C3UA 4Z1OA 2P6NA 2I78A 4GOOD 4HX5A 4ZAWA 3DBHB 3HWX1 1Z0UA 5DV9A 4H1WA 1YUBA 3ESAA 4BO0A 2C5GA 1QH8B 3VU8A 5JNTA 1OFGA 2QT0A 2YBDA 2ON6A 4FYVA 3RYIA 3SMQA 3T4UA 4BLQA 2X6RA 4YFVA 2XVYA 4A5SA 4HUTA 4O4JA 2PUVA 1S8OA 2RHHA 1N8SA 2JGLA 3QLJA 4PR3A 4X3PA 1NR5A 2QYOA 3WRYC 1C5KA 1CUXA 1JHZA 3A7EA 3B82A 3GLHA 2GHQA 1N2CE 4N1AA 1ZJZA 3A04A 5F12A 5SYAA 3IVXA 3KAKA 4LHVA 1E77A 1LRJA 1S01A 3ZV7A 1QU3A 5BSWA 3LE8A 4J49A 1B1AA 4DDKA 1CJCA 1NBOA 1KO7A 2QIPA 3FE2A 4B7XA 4DMKA 2BGMA 5C81A 3GQBA 2XHEA 1CIVA 4DJDC 5L95A 1T9GS 2R6FA 1GAWA 1Y5MA 1DRKA 2Q0SA 3EWIA 4L4ZA 4X8LA 4EKGA 1FNSA 1N7JA 4Y1GA 1Z8HA 1Y3AA 2GXQA 2O7RA 5H70A 2W2VA 4KOEC 4KXQA 2D7CA 1QGUA 2FAXA 1NY6A 4EVIA 2I7DA 1T6BY 1XPJA 3A4TA 1HEYA 4FNGA 1ENPA 4G1UC 2W6QA 3RAPR 3O8CA 2PPVA 2OM6A 2B92A 3B89A 1GYRA 1I1QB 1MIHA 4JEMA 4C4PA 2WWHA 3HJHA 3ZZ1A 4BEWA 5BY2A 4YP5A 4B3FX 4OYYA 4IDNA 5L40A 2VP3A 5BSVA 1ZD3A 4L5BA 5CA1A 2TMKA 3L4BC 1NBMD 4DIMA 2WKSA 3L6OO 3ABQB 4FR0A 5E6SA 3TLEA 1EBFA 2P91A 2IYYA 4F5EA 2I4OA 3UG6A 1FRNA 4M7OA 5JHHB 2CXUA 2DQKA 4U7JA 2R7LA 1ULAA 1P7PA 4XDHA 2QGNA 5C1IA 4BC1A 4CE6A 2IUUA 4C0HA 4J16A 2AE2A 4CQMD 3PE3A 3USCS 1UEJA 3HZRA 3A4IA 5HSGA 2UVQA 5ALRA 4V39A 1ZICA 3G8BA 1R6TA 1W0CA 5C8YB 3JASB 3IAEA 3SDBA 4ZHQB 1MO3A 3RUIA 3CW8X 1NAHA 4LOJA 1EFTA 3DFMA 3CEJA 4K1LA 5H16A 3H1EA 1XU9A 5J2UF 4C08A 1G8PA 3R5KA 1YTLA 4MP3A 1ECCA 1Z7BA 4N8SA 4RPLA 5KKAA 1Y82A 1QB8A 3V7FA 1I4DD 4Z51A 1AOXA 1E99A 4MKHA 3E58A 1XZKA 1CULC 3I9JA 3RE1A 5ITVA 2I91A 2VH1A 1BXRB 5LWHA 2FTKE 3EGIA 1BW9B 3T3MB 1DWQA 2P3QA 4FSXA 4QD3A 2HFKA 3FOCA 3WKCA 4F71A 1K7YA 1GEEA 1QZ3A 3H8SA 3LG2A 4FHGA 4ZO7A 5AVSA 4G8JA 1W0KD 3S2EA 4B9EA 2WT9A 4D4HA 1N36B 1VIDA 2WB2A 3GXOA 2VBGA 4FB4A 3OTIA 3UCFA 3VR4H 3RTAA 3RUHA 4HGNA 1MX5A 3G9XA 4UDNA 4QU8A 5HMLA 1D7OA 4UEOA 5EL0A 5JNLA 2XWJI 4XJSA 4PNHA 4X92A 1V3TA 1CZOA 3FIUA 3W3ZB 4AWBA 2VBFA 1VL2A 4HGQA 3ZLUA 5EP1A 4E94A 3GLFE 5FNVB 3U80A 2AXNA 2IQIA 5KQSA 3RLIA 1E0AA 1L8AA 4E07A 3IJRA 5KJFA 4RMGA 3GVCA 4POAA 3K09A 4DRXB 1TAGA 2WHPB 2GESA 1SPBS 1FSFA 1RQRA 2XA1A 3HDVA 2NU8B 1X1SA 4OI2A 4OP2A 1D6SA 3USZA 5EMNA 4NCJA 5EE9A 3AZOA 1N6NA 1JQAA 2D1SA 2LIVA 3ROKA 4CR8A 1M2OB 3DCIA 3HP1A 4C89A 3IS3A 3FN4A 5TR9A 3Q3VA 1M8JA 3IEPA 3PNMA 3HC7A 3W9YA 1WAMA 1TC2A 2FPIA 3DL4A 4XUEA 1YK0A 2E87A 2OUIA 4FKBA 1FPQA 1LI4A 3ZV4A 5DN9A 5CIWA 2VWGA 3ON5A 5F1KA 5ICMA 2JCSA 5KYGA 1N32B 3UAZA 1RI2A 4EECA 4LWZA 5DP1A 3OE4A 4P5DA 1DNPA 1Q22A 4LYDA 1OWPA 3DWEX 1U2RA 3V1NA 3T06B 3MTJA 3KEQA 3LW8A 5HKOA 4O33A 5A4MS 2DKFA 3VNQA 4KCGA 2EP5A 2O48X 3B6JA 3B6KA 2W2LD 4CKCB 3ROGA 2FQYA 5IJ9A 1KZGB 3L40A 3ZIAD 4AZVA 4M1MA 3WGYA 3CN7A 1UMDB 1UMCB 4TVKA 3SBOA 4DHWA 3U1TA 1SOUA 1YSCA 3HMKA 3LPLA 5BV2P 2FE1A 3MD0A 2R68A 5HJ5A 1F7VA 2PNJA 2C98A 2O1EA 4A2QA 4BJ1A 2OQRA 3UK1A 4YP6A 3ZJYA 3T9AA 3VYUB 2FX2A 1TQ4A 1RI5A 2FU5C 4KIWA 4RPJA 1YS9A 3SK0A 5AW1A 5FEMA 2YDXA 1PWEA 4ZK2A 2O2XA 3R9WA 3E18A 3QVSA 4YROA 3I12A 4IWNA 4PXAA 3B1VA 3CUWA 3GROA 3QI7A 4KGXA 4RMJA 4CG2A 1E2UA 3UAGA 4ETIA 2PUGA 1A8UA 4EM6A 1S1CA 1QQBA 1P72A 3IERA 4V38A 2QV0A 4ZI3A 2DXIA 1QDEA 1C0PA 5SICE 2JHCA 2HOQA 3E8XA 1FPMA 3N5KA 4D9CA 1EUYA 1JN0A 1CF2O 1Z5PA 4QGBA 3EODA 4XWOA 2VK2A 1YZ3A 3F90A 2H2IA 1OVGA 4KWHA 3RG8A 1G38A 4Z4CA 2VAVA 3KU1A 4XM2A 2Q4OA 2BEVA 3ENKA 3W7AA 2H85A 4C0LA 4EJFA 2JFPA 5FTNA 1V1MA 1Q50A 4N0MA 3I2KA 2Q1TA 3AOEA 4EB6A 4IIDA 4UHCA 3GEDA 3SFZA 1PUJA 1ZVJA 2GPYA 2XF8A 4OHPA 2QVCA 4ZMSA 5KYWB 1L5VA 1LFDB 2BGGA 1ABEA 1QV9A 4I6EA 3WNVA 2RIPA 4YACA 4Q3DA 5AJYA 4WZBB 1QZTA 3GD7A 4IILA 3HJNA 3QBDA 3GRRA 4GC9A 4RIFA 5TXGA 4C0WA 5JC1A 1KYWA 1QKJA 4GLBA 4AX4A 1P5FA 2JL1A 4NMXB 1LSJA 3JQAD 5D5HA 1ZDMA 4ZCPA 3FYUA 5HF8A 4EKDA 1KWGA 1GAJA 2WU4A 3A6PC 3FZGA 5JDCC 2V96A 4MSUA 4FKZA 1KQOA 1N2CB 1YONA 2NO9A 2LPMA 2O14A 1T8SA 2R3SA 2R4QA 3HBAA 3L04A 4LZZA 4MRAA 1E9EA 4V0OA 4A2WA 4MUKA 5M5BA 4BGIA 3IQWA 4CM8B 1AKQA 3F49S 3HL0A 3I0NA 1GOTA 4QIHA 3OEHD 3QKUA 5CJJA 3G1UA 4LTNA 4YJ3A 2VNKA 5ANRB 3OIYA 1Z0ZA 5H4HA 3CMCO 1M1UA 1JLRA 1GNPA 4BE4A 3B5EA 4D96A 1G2PA 3RIEA 2OLEA 4UE3S 2CJFA 3PDJA 3WGNA 4WV3A 1X7YA 3OH8A 4GF5A 2VTKA 3SF8B 4D26A 1JIKA 1H65A 1PWXA 3N1UA 1XGKA 2FX3A 3NHRA 4PZ0A 4C6RA 3AVVA 2J46A 3WLFA 4E5YA 2Y1OA 3C1OA 1EA5A 3CLTD 16PKA 3KOWA 5CW2A 4ZJYA 1Q7BA 1GHTA 3IUJA 4NBSA 2O23A 4Q3EA 1MRZA 1ZNWA 2WD9A 3MAAC 2G9QA 5K0JA 3B9BA 5JRZA 4FFRA 5B53A 1HT3A 3ZLBA 3CMMA 1HA3A 5GINE 4Q05A 4C78A 4CMCA 3HS3A 2RHDA 1JBKA 2PXXA 1E0JA 2C20A 2PT6A 3AHCA 3KTAA 5FFFA 1CJMA 3W3AH 3R24A 4FMBB 1NI4A 3R40A 4H3VA 3WOHA 5LOVA 2I2AA 1XTUA 2PKQP 3EIOA 4LXXA 4JA0A 2WMYA 2H2WA 4JYPA 4BDTA 3CVOA 3DDOA 4B6GA 4BP1A 4EKNB 2C5LA 4OB8A 4UBLA 4D99A 4ID3A 1JECA 3G5UA 4PSVA 4WNAB 3NDIA 4IKEA 4QT0A 4Y9DA 5DW0A 4HATA 2B94A 3TSWA 1F4VA 2C4UA 2EQBA 1NF3A 3GOQA 5LXTF 3OF3A 3PPXA 2BMWA 4YIKA 3ZQ6A 2IX9A 2DFDA 2Y27A 4N0EA 1EXDA 5DT2A 2XLBA 4FFMA 3ZCUA 4Z0PA 5C7IO 2ZB3A 4D57A 4HDMA 3OZFA 4CM4B 2VAXA 2AR7A 1WCIA 2XKJE 3DZFA 4MAFA 1D2EA 3DAOA 4PQGA 5HS4A 3F6YA 2H7CA 2WJWA 3TM4A 1Q0QA 5KOJA 2Q8PA 1JPNA 2GDJA 3DSRA 5KIAA 5KKCA 1E3TA 2AR9A 2C83A 2QORA 1CEXA 3THYB 1Q74A 2B5OA 1MZVA 3AFIA 3PFBA 3R3UA 3WIVA 4YY3B 1XEXA 2IHZA 2OORC 2A0UA 3D2LA 2FEPA 4WERA 5KOHA 3PPVA 3BTUA 4BO3A 1SQ0A 1RZVA 2M6LA 1ZNZA 2D0IA 3DEHA 5HGXA 1VLJA 2DHEA 4LOKA 1Y7HA 1NSTA 1RFLA 2NQ2C 3UJNA 2VNHA 1SURA 2BTQB 3OOWA 3TE6A 4WTOA 1IMJA 4K3UA 4KI7A 4Q1EA 5TMBA 5HRAA 1T5TA 3JQCA 4FOTA 3ZUGA 3MS7A 2JJ1D 3DZBA 3H5AA 3D6VA 1IVNA 1PT5A 1VMKA 3E3OA 5H68A 4HEA6 1F5SA 2F48A 3ONWA 2X9QA 4E31A 1BDIA 3O8BA 3W1VA 4RCZA 3LPMA 4D46A 5B12A 1AMUA 1I7LA 1PR6A 2CNWA 3HXTA 5FO0A 5MFZA 2WZBA 2YBEA 4X71A 5DBHX 1YO6A 1XPOA 2OTCA 4G84A 1Y9EA 1UFQA 1CY4A 1C1YA 1E5LA 1S2MA 3D5TA 3DE5X 2DLNA 3N2LA 3LVFO 1G5HA 1GTG1 3KM0A 5AYVA 4BATA 2AL7A 1KYQA 3RRZA 3U9LA 5FNVA 5JCOA 2ZZNA 5IP5A 5CTAA 2X2FA 1WLSA 3COPA 2IYWA 4A23A 4FNOA 4AG5A 1UWVA 5K99A 1QO7A 2PBZA 3WBJA 3NM6B 3GV0A 3RROA 4BPBA 2OWEA 4BEJA 1E1RD 3NUZA 3FCEA 3PDIA 4RNDB 3B6EA 4YMTA 1X7GA 3IP1A 4Q7LA 5KOYA 4D7AA 1XA0A 5CK5A 3EDYA 4LQ4A 3CIFA 3JZDA 5EG5A 1BKSB 1X86B 4PSKA 1F51E 1RCTE 1ZM9A 2P69A 3HB7A 2FFBA 3IUQA 4KO2S 4W4TA 2ANBA 3WGLA 4EFKA 5IF9A 2CV2A 5BORA 3KR9A 3CZ5A 2NAPA 3TYXA 2NO7A 4G4JA 5ENZA 4A0SA 1I2MA 4TKMA 5BN1A 2Z6VA 5DYTA 5HNKA 4MYUA 1GCUA 4INAA 3U7JA 5K8CA 3PEEA 3TE7A 2Q3BA 1N3BA 4RF5A 3EZXA 3HB0A 3DJYA 3Q40A 5LDGA 3TD6A 1JQEA 5AK0A 4E21A 3JXEA 2MYPA 1DRJA 2R7NA 4EATA 1V4BA 2HRRA 4ARCA 1A69A 3E3MA 2O2IA 3UUFA 5JG7A 5HUJA 4I1VA 3QEBZ 2KBFA 3ANMA 1QHSA 3G2KA 2A7QA 1H3EA 5CT9A 3LV8A 3OEWA 4JJ7A 4E32A 2DJ5A 4YUWA 1DUIA 2O6HA 4I5EA 2FETA 1CDOA 2F6RA 1ZCAA 3C3XA 4M36A 2EU8A 3ITEA 3P9QA 1JVBA 3I6IA 4BO8A 4MV6A 3H3XA 3P19A 5EAIA 5KNDH 1IEWA 4URYR 4IVPA 3I58A 4Z0HO 4PZDA 3DAFA 2I66A 4A8JC 5JIBA 4DABA 3FHCB 5H9VA 1GTSA 1JF8A 1F14A 3BAFA 1COWA 2BRUC 3QVUA 2FK8A 4MQLA 4TL6A 3EW7A 3WS7A 4BO1A 3QSYA 2E48A 1JKIA 1WHSA 2GKSA 2QTAA 3JSAA 4QTXA 4F3KA 1AKVA 2CCJA 3CUYA 4MH0R 2YNMC 4PQEA 1XJQA 1VSQA 2H9YA 4Z9FA 3UYKA 4X64B 3LECA 4HQ6A 4P33A 1APBA 2LVBA 1P4JA 1ZH6A 2AX3A 2Y68A 1XZEA 3LX5A 4KK3A 4Q1AA 5C3UA 2QSUA 3I9LA 4ND2A 5EJ5A 3X0DA 1K5PA 1OX4B 2IYRA 2OK8A 4MAMA 5CYPA 4DT1A 2GCIA 5ILGA 3I4FA 2A1IA 1YHNA 3ORYA 1IN5A 1GXSB 1HE8B 4JC8A 4KX5A 1R0YA 4I5GA 4UVGA 1U3WA 2M98A 4KO8A 1JDBC 2GBIA 4RLQA 2MCFA 4DMCA 1BTOA 1Z0KA 2NZJA 2ID8A 2WMDA 2ZAMA 1HQCA 3K9CA 1GUFA 5B57C 1RMQA 2IPAB 1T2AA 4FFLA 4BNTA 4C3ZA 4DXDA 1YVPA 1AKNA 2EJUA 1Q77A 1D6NA 4ILEA 4YHHB 1GAEO 1ISIA 3HHPA 5J23A 1QRDA 3B9QA 4KKXB 1OPXA 4Q4DA 5LKRA 1P61B 3IOMA 2GPSA 4QUHA 4ZAFA 3FCYA 2Y71A 3V8PA 3KNZA 4ZCTA 2P5SA 3Q8XB 3LTNC 2ZB8A 2Z9DA 1F7UA 2HCJB 2D1RA 3ZOZA 2XMGA 4OHMA 4Q4HB 3SXUA 4CFYA 4Z7QB 1ZHHA 3MWEA 3D6AA 5E7QA 5BSTA 2XSZA 3C1AA 4UCXA 4YCSA 1OFTA 1CK4A 1TZ2A 3OLZA 5IVDA 1SG6A 1XRRA 3RVSA 3NG1A 3B5JA 2EQ5A 2CMDA 1G7SA 4HGYA 1EH5A 2BGNA 2PKQO 5C9ZA 3ZJVA 3C3WA 1M67A 4C1NA 1KIAA 3W78A 1X6VA 3K35A 2AFHB 1CZUA 1L0BA 1QTRA 3AP2A 5DIZA 1WXQA 4YMLA 4JV5B 4FE3A 2BEJA 4A27A 3LHSA 1A4XA 4U9HS 5LQDA 2FG7C 1TLFA 1O96A 1A9PA 1QDLB 2AZTA 5B7GA 1B42A 2PA0A 1B43A 1XMPA 5D01A 3ZNNA 3DOOA 1H2YA 3K9NA 3OQVA 4WXEA 3VGJA 3C4QA 4Z4HA 3KQYA 5HQJA 1DKOA 1T6YA 3HO6A 1EDDA 1L1QA 3Q12A 1VQ1A 4E1VA 1E2MA 3U49A 1G6KA 5B36A 4CEJA 1R5JA 4LGMA 4QFMA 3IIKA 1SBHA 3GCZA 3IR6A 3GRUA 3AMVA 3IAS6 2RGNA 1IM8A 4JT2A 4RZQA 4CIYA 5KVQA 4G2NA 4E11A 4B3SB 2Q27A 1N1MA 1QLHA 3CPHA 3CZPA 2EP8A 4IDHA 2OZKA 5KOIA 5ILQA 1XMVA 1A7KA 1CJUC 1K3UB 5EWJB 3AW9A 3TRFA 4C76A 1JB9A 3E1GA 1DTEA 3OZ7A 1DKLA 4WCVA 5KJ6A 2ANCA 4MRRA 4WGFA 3RQIA 1LTKA 2EFHB 3EDQA 4Z9AA 3UMFA 2XDQA 5ELLA 3SHTA 1P1RA 2IYQA 3HA2A 2V9PA 3QW2A 3TQTA 1WUYA 1EESA 3IMFA 1Q1NA 1M1XB 4HWTA 1W5AA 3MAJA 3M4JA 4GYWA 1R9GA 2BFDB 5E4FA 4UFPA 5F73A 3UT0A 3DBRB 1RWNA 1JBEA 3NWPA 8OHMA 5LQJA 5TPWA 2OGSA 3R3VA 2XVMA 1JZQA 2I3DA 2K7ZA 3M83A 3TI7A 1YDEA 1C1XA 3KP1A 4L9SA 3PHGA 1REQB 5DI3A 4P4GA 1JU9A 5SY6A 3PIRA 3DDCA 2JPDA 1ORTA 1U0LA 3IA2A 2PL1A 1QPZA 1T0HB 2X7HA 3EGXA 4YDHB 5F2OA 3EMVA 4B1FA 1TUEA 5DO9A 1PJZA 3EH2A 4KRGA 2WE7A 4PGHA 3IRUA 3MBOA 3RC1A 4CMKA 1LBIA 1NW5A 2ZYAA 3L5KA 1YD7A 1P6QA 1JDZA 5D7NA 3UY4A 3SJAA 3AJRA 3GLFA 3TS1A 4RTKA 5I01A 4UFOA 2Y1LA 1V16B 4WOCA 1FDRA 1H2WA 2IDMA 2PLWA 1C1HA 4UUBA 1NDHA 2ODBA 1JHVA 4TLCA 3G49A 5FNZA 3KVVA 2FQXA 1MV8A 1FUUA 2VA8A 2OCPA 4U1RA 2NU7A 4H16A 2R6ZA 3S0JA 3T5CA 2IL1A 2C5BA 5TT0A 4JLWA 1SIWA 4PZEA 3HA3A 1Y5NA 2ZUFA 2P0YA 1H4SA 3ZH9B 2VHZA 4PSAA 1I5OA 3CY6A 4G24A 4C06A 2FMHA 1IH8A 4G07A 1WSAA 5EZ5A 1N6HA 2M2IA 3AY0A 1JX6A 3BHJA 3AKZA 3HKDA 4TSKA 1JLKA 4BWVA 2DTDA 4ZYZA 5CIYA 3BMXA 3LP5A 4RMIA 5KDDA 5LQAA 1PR4A 2X6TA 4DJEC 1F5NA 3W3AA 1PKXA 3M1YA 1SCUA 1L5QA 1P44A 1U0RA 3H8WA 2QUHA 1WTCA 3EWAA 4RA9A 4WXHA 5DPMA 1ID1A 1VL6A 3MINB 3VOAA 4J76A 2XQIA 1E1LA 1IDN1 1ORVA 4V24A 5AKLA 1IK4A 5AJWA 2Y1FA 3F6EX 5HCNA 3OTOB 1JEYA 4I4IA 4PRYA 4HB2A 5SZHB 5AW4A 5CEJA 1EUCA 2R6GA 3RU7A 3ZBQA 4EP1A 2NNLD 3E61A 3MS4A 2HDHA 4X7MA 1U28C 1M74A 2XRZA 1QP8A 1ZM3A 4PZUA 3I9KA 4TL9A 3FMVA 1AQLA 5IWCA 3W2FA 2XUGA 4RTSA 3BE8A 2FPXA 4HMPA 5AUPB 4LSWA 3DMDA 3PNBA 4PPYA 3PK0A 3GEIA 1JFLA 4JP2A 2FV8A 1ZMRA 3TL3A 5I9MA 2V55B 1LDMA 4I50F 5BT9A 2WAXA 4FGJA 4JD5A 2FSVA 4LBWA 4M2LA 1YZLA 1CG6A 3EXHA 1DBPA 2SKCA 3R8XA 3O31A 4ZRDA 4HYYA 1GL3A 2VR1A 3G9UA 2EZUA 4BMOB 5KWJA 3D2CA 3V1KA 2D2VA 1SOAA 2PSFA 3H97A 4HPWA 1RAGA 4PO1A 3TCKA 3BOSA 4D9MA 2VQFB 3Q3JB 2WMOB 4H1TA 3TWOA 2RGCA 1WUTA 3CH6A 3MUNA 1L7VC 1ULZA 2EDCA 4I99A 4GOJA 4MEAA 4XFDA 3ZCSA 1D9XA 1ZLXA 5DK6A 4ZDWA 1UBUS 3T8YA 3ZYZA 3FTEA 4LDJA 2OOKA 4CKCA 2E6UX 3VPSA 4PCVA 1YMQA 4DILA 4Z1MA 2AYXA 1C7IA 5TMPA 4B3GA 1ILWA 1FU8A 3AB7A 3SAJA 4EX6A 1N2XA 5CLHA 4IHAA 3U4HA 4CQLB 2V0GA 3SYTA 1DC3A 1EVZA 1L5HB 3RUEA 2WWYA 3FBWA 1U5BB 3P0RA 4KXWA 3E82A 2ZRHA 2YV4A 2ZSBA 3HVIA 3QI2A 1BFKA 3OQMA 3MCWA 4E7OA 4RA6B 2X41A 1IHXA 2ZTMA 1TQ8A 3FMOB 4JUAA 4E08A 5IAOA 4QUBA 1VSBA 1EQ2A 2ARKA 5A05A 3TM5A 1XKTA 1KMNA 4HTFA 1CY6A 4KDEA 1UP6A 3MSCA 1Y1TA 1QJCA 1HLFA 2C2GA 1U6JA 4MO9A 4UCFA 3CRQA 3QMPA 4I14A 1JQ3A 1V7QA 2WM8A 2EQAA 3L92A 5T4BA 3W9SA 4X1IB 2DEUA 3IIEA 2O8CB 3TDNA 3QEMB 5JZVA 1PBTA 4DSAA 3H2GA 2JBHA 2Z3VA 4NFSA 4ZJUA 1G7RA 5B2FA 3P32A 2CLCX 4G1MB 1O94C 1AA9A 3BDAA 1NVXQ 3EYWA 1JVNA 3CFYA 4EWLA 2AT1A 1OI7A 5K3FA 4XJTA 2GQ0A 2PZMA 4AROA 4HH0A 3VKHA 5JR3A 4BO6A 3WV5A 4P22A 1IDOA 1TJ4A 5JASA 5M34A 4LBVA 1D5CA 1CUAA 2O0JA 1CR1A 3K0CA 4TMZA 3U6KA 2PL5A 1N2SA 3HJUA 4B85A 3I2GA 1K27A 3QIVA 1XZNA 1YRWA 4L85A 5EA2A 2NV0A 4G4SO 4IJMA 4L28A 4L4YA 3G68A 4LY9A 4EGFA 5KYXB 1VMIA 2W90A 1YJ8A 4B81A 4CV3A 1R0LA 2W5UA 3P9ZA 4LDQA 1B6TA 1ESEA 4H0CA 3LHIA 2QRNA 2FR8A 2QTWB 3D0RA 4K9PA