5KQLA

Co-crystal structure of lmw-ptp in complex with 2-oxo-1-phenyl-2-(phenylamino)ethanesulfonic acid
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
154
structure length
154
Chain Sequence
b'ATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Low molecular weight phosphotyrosine protein phosphatase
publication title Inhibition of low molecular weight protein tyrosine phosphatase by an induced-fit mechanism.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 66
structure length 154
sequence length 154
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2016-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 5kqlA00
3JTEA 3JY6A 3FGZA 5CNJA 1U2QA 4NV3A 4N03A 2R25B 2V0NA 4LRQA 5TQ2A 2H0AA 1TM2A 4RKQA 4JB0A 1JL3A 2QZJA 3OMXA 1QNLA 3TMYA 1DBPA 1USIA 3RVNA 2FVYA 5C5EA 1T34A 4P98A 3RVOA 2NZVG 1KRWA 4WWHA 1TVMA 1R8JA 7ABPA 5T7BA 1PNRA 3QLUC 5TPZD 1EWVA 1JWLA 4RXUA 2PL9A 3QLVC 5IULC 5JNRA 1DZ3A 3OM1A 4JASB 3OLXA 2P4UA 2F8SA 4FB4A 2MYUA 2A9RA 3A0RB 1PEAA 3VNAA 1RXIA 3F6PA 3BILA 1BVHA 3HUUA 4G86A 2AYXA 3DLHA 3RVMA 2B4AA 1NXTA 3QEMA 2QR3A 2CHFA 4FE4A 4LDZA 4CBVA 5ABPA 2FQXA 4KVFA 2WJWA 2L17A 5JNUA 1Z16A 3H5IA 4UHKA 1BA2A 1M2FA 4XAQA 3OO1A 2VYCA 5B3JA 5IUKC 1DBWA 4KK4A 4Z9AA 3DLBA 3JPWA 2HQRA 4Z4IA 5EWMB 3HDGA 4WXEA 1ZESA 4QYMA 5BQ3A 5IEJA 3N0RA 4RY9A 4MLDA 1QMPA 3B2NA 3ROFA 5KWSA 2IKSA 2NT4A 5TQ0B 2PUEA 3N6VA 3CZCA 4XFKA 2FQWA 1URPA 3RVQA 2PUBA 5CNKA 4RS3A 4EVSA 5CNMA 2FMHA 5E3JA 2IPAB 4EVQA 3GA5A 1PHRA 4PICA 3H75A 3HXMA 4M88A 4EUKA 2I6FA 3O21A 2OENG 5B3JC 2VK2A 3O1HB 1ISSA 5KC8A 1SRRA 4GNRA 4RK4A 1OXBB 3Q7RA 3EJWA 4MRMA 1BDJA 3LUKA 3ROTA 2FLWA 4RU1A 2CWDA 4YGXB 4N41A 5IX8A 1W25A 2ID7A 1D4ZA 3JS5A 5HQJA 2GI4A 2QU7A 3KKEA 4OBBA 1JDPA 3MA0A 2IOYA 2JVKA 1GCAA 3VNBA 1JH9A 4OTZA 1DCKA 2RDMA 3OMWA 4ML3A 3EODA 4TN5A 2GWRA 4JA2A 3SY8A 2Q5CA 1MB3A 2JBAA 3O2QB 3HO1A 4P1ZA 2X7XA 1QKKA 3KYJB 5D2CA 4MR9A 3GWGA 1KGSA 4RK7A 4W5NA 2H3HA 5KI6A 1GLGA 1JX6A 2JB9A 1F4VA 1A04A 1L5ZA 1L5YA 4PYRA 4WT7A 4Z9BA 2PKXA 3URMA 1BDIA 4XASA 1LBHA 1LJUA 4G0XA 1DG9A 2LP4Y 4IMJB 3RH0A 3ILYA 3JPYA 3GL9A 2FEWB 3NNDA 5HM6A 2PAFA 4N47A 2FMKA 2N9UA 3K4HA 3OLVA 4LDAA 1KMIY 1ZH2A 2HQBA 4WZZA 2R47A 4YCSA 2GX6A 3KYIB 1DBQA 1ABEA 2LUOA 3QEMB 4O5AA 3H6HA 5FWXA 4E7OA 1U2PA 4HNRA 4RXMA 1Z12A 3HS3A 1U0SY 2E4ZA 2JK1A 2IPNA 1PEYA 1NXSA 4Z0NA 4ZPJA 1XHEA 4F8JA 5TPWA 3ILHA 3H1GA 5TE9A 4KREA 4MS1B 5GQSA 3LUJA 2QSJA 4Z4FA 2RGYA 2IYNA 3QELB 4XARA 1DC8A 1EWTA 3Q7SA 1YIOA 4MS3A 1RNLA 3DGEC 4LE1A 4OATA 4WUTA 5T3YA 3RQIA 4PEVA 5EWJB 3O74A 4W5OA 4ETMA 5DCLA 5BRJA 1Y1LA 4MQFA 3EQ2A 3TO5A 2E4VA 3LUDA 3EAFA 3F6CA 4NICA 1MIHA 5JNTA 2L18A 3T6KA 5EWLB 4Z4EA 2FTKE 3GT7A 4MRMB 2ZAYA 3OLYA 4MQEA 2WY2D 1M5TA 4QPJC 2LBPA 2PUFA 1JFVA 1I3CA 2TMYA 4IILA 3SG0A 3P9YA 3Q15C 5KC9A 4D6YA 3GYBA 1FQWA 1ZDMA 2E4XA 3A0UA 3QK7A 5TQJA 4KNYA 3EGCA 1YS6A 2E4WA 3LKVA 5C5CA 2A9QA 2OQRA 3MF4A 1H9CA 2JVIA 4RK0A 3KCNA 4DQDA 3IPCA 2JBAB 3LUGA 1NXVA 4Q6WA 2IPMA 3FDFA 4IMIB 3RVSA 2PUAA 4Z4HA 5JNVA 1SXIA 3OQMA 4YR7A 4KPYA 3D02A 5JNWA 4KRFA 1SXHA 4G0YA 3OM0A 4MR9B 3F73A 1MB0A 4KK3A 3CG0A 1CYEA 2PUDA 1JYEA 1DJMA 2E4UA 4H3KB 4ZMRA 3HV2A 3Q7TA 3OQNA 3EDCA 2P9HA 1USGA 2ID9A 4G0QA 4MS1A 4UHJA 1E2BA 1ZHHA 3NBMA 2FXIA 3TB6A 2LPMA 3QELA 1OXKB 4G0ZA 4RXTA 3KTOA 4ZMSA 4O1HA 1CHNA 3CG4A 1FFSA 1U8TA 2FSPA 4KMRA 4TLLB 4EGSA 1DC7A 4ZYLA 3CRNA 4EYOA 3O75A 4YS6A 5EWJA 3EQZA 4MR8A 5FBKA 1PUXA 1YK0A 5FWXB 4Z99A 3CKMA 3TD9A 2R4QA 2WB4A 2A9PA 3RVJA 3SQNA 2HPHA 1NATA 5DTEA 3FMVA 1M5UA 5EWLA 3HVRA 1USKA 1NXPA 3KJXA 4RKRA 4MPTA 1QO0D 3FFTA 5TPWB 2PL1A 3I42A 1S8NA 3SAJA 1YVUA 5KQGA 3GRCA 2L2QA 4H60A 1AB5A 4KZKA 1JLKA 3IP9A 5PNTA 1RZRA 1NY5A 4IF4A 1CEYA 1EHCA 2O20A 4MS3B 3RVLA 3HUTA 4QICA 2HJ9A 4F11A 3QEKA 2WRZA 3MQ4A 1K68A 2M98A 4KQ9A 3CHYA 4MQFB 3O1JC 2MYNA 1JYFA 3T95A 2VUIB 3I09A 8ABPA 2FN9A 1ZGGA 1E6KA 3LUCA 3HK2A 3CFYA 5KQMA 4MQEB 3OQOA 1JFSA 2QVGA 3KG2A 1JDNA 1C0EA 1Z26A 4G0PA 3T8YA 2ZWMA 3Q41A 4EVRA 1FFWA 2XDYA 4GPAA 3BRQA 1QQBA 3I45A 4TMYA 3HDVA 2FW0A 4YO7A 1JF8A 3BRSA 1JBEA 1ZVVA 9ABPA 3LTEA 5HKOA 3DBIA 4EYKA 3KSMA 4LE2A 2HQOA 1U04A 1SXGA 2QVCA 5DKFA 2B1JA 4OLBA 1BDHA 5IUJC 3F7NA 1EAYA 3A10A 2WMYA 1FFGA 4RDCA 4RK5A 4WXMA 3C6QA 1RXEA 1DRKA 2J48A 3H5VA 3GBVA 1M2EA 5KQPA 1QP0A 3FFWA 3H5TA 1ABFA 2L19A 2FN8A 4RK6A 3LOPA 4KQCA 3HJFA 1JFTA 1Z25A 4RK1A 3A3KA 4W5QA 2CHEA 3M6MD 1VRVA 4F06A 2MSWA 4MLCA 1D1PA 2FQYA 3N0XA 1APBA 2MYTA 3LMKA 2RJNA 3OLWA 4YWHA 1GCGA 3N0WA 4LE0A 4MR8B 1IIBA 3N8IA 4B09A 1NXXA 2QW1A 3C3KA 5FWYB 1VLZA 1LJLA 3KS9A 3DGFC 3NHZA 1VKRA 1Z18A 3W9SA 3SNKA 1A2OA 3H6GA 3GV0A 2IDMA 3LKBA 1F51E 4ETNA 3CNBA 1A0OA 1GUDA 1DP4A 1Z2DA 3QLUA 3O2JA 4RSMA 3HZHA 3GBPA 4HYEA 4PZ0A 1QQAA 2FEKA 4G0OA 4H3HB 3QLVA 1HEYA 4KV7A 4O1IA 4YLEA 3E61A 3IP6A 3H5LA 6CHYA 2IPLA 2FEPA 3NNNA 1FSPA 4HNQA 2HSGA 3N75A 4YRZA 3KHTA 3RVRA 1QPZA 4L85A 3HM9A 1Z2EA 4N76A 1D5WA 5FBHA 3H5WA 4RY8A 1BAPA 3NNSA 3K9CA 5TPZA 4KFCA 1P8AA 1QP4A 1ZGZA 2PJUA 1UDRA 3CU5A 4JP1A 4L4UA 1DCFA 2YHAA 4MS4B 3RVKA 2CD7A 3Q9SA 4Q7EA 4DADA 2LIVA 3BREA 1ZH4A 2WJAA 5F64A 3LUAA 1DRJA 4IGAA 4Z4CA 2PE5A 1RPJA 2FLKA 3C3MA 4MGEA 5I4CA 1EWKA 3CLKA 4XLTA 4D6XA 4ZJPA 3G85A 1ZN2A 4S05A 4F3TA 1ZAYA 4MR7B 1W9HA 2AYZA 4MYRA 4OG2A 3L49A 4MAAA 3UK0A 4E7PA 3G1WA 5CNIA 3LUFA 3H5OA 5IC5A 2VUHB 4RY0A 5DGCA 3CTPA 3H1EA 5KQLA 3D8UA 3C3WA 4NCAA 4OLAA 1D1QA 3OO0A 1NTRA 2NZUG 4F12A 5IUNC 4FE7A 4YP9A 4XXHA 3LFTA 2KYRA 1E6LA 3KLNA 1TJYA 3N53A 3SM9A 5FWYA 4Q6BA 6ABPA 3DZDA 1XWWA 4PE5B 2BGGA 4JOQA 1D2AA 3OLZA 3JVDA 4HNSA 2PUGA 5JS1A 2QV0A 2RJOA 4QYWA 3LUHA 1VPWA 4EYGA 1TMYA 3H1FA 4G97A 4TLMB 2JRLA 4YV7A 1Z17A 2E4YA 3JVIA 4LZLA 4G0MA 1TLFA 1NXWA 4EYQA 3CS3A 2R48A 1EFAA 3E3MA 1MAVA 1RZRD 1JHZA 5ED4A 3MMNA 1QO0A 2FMFA 3L6UA 4S04A 4W5RA 2GKGA 1P6QA 3O1IC 2NUBA 4RWEA 2MSKA 4Y9TA 1Z13A 3O2SB 4MS4A 5GOTA 4DN6A 2GBPA 3EULA 1ISRA 3IP5A 3MIZA 1B00A 2PMCA 3I5AA 4RV5A 1YTUA 5BRAA 3IDOA 5TQ2B 3QLTA 1YMVA 4N0PA 1PNTA 1AB6A 2A9OA 1DCMA 1K66A 1Z15A 1LBIA 3M9WA 3MM4A 4MR7A 5JS2A 1NXOA 1KRXA 4ETIA 4JAVC 3C97A 2M1ZA 3UUGA 4JB2A 2WWVD 3UKJA 5HSGA 2W42A 4NCBA 1LK0A 2FKAA 3HCWA 5IBQA 1XHFA 3M9XA 2MYPA 4Z4GA 2JVJA 1E6MA 5IEBA 1YS7A 1WETA 4D74A 2JCGA 1ZY2A 3HEBA 1YK1A 5EWMA 2F8TA 1C4WA 1P2FA 4EY3A 5JNSA 3BBLA 3IP7A 3S99A 3TX6A 2PUCA 2NT3A 2FMIA 1GUBA 2DRIA 1YMUA 5TQ0A 3NHMA 4NQRA 4RZSA 3FFXA 3KLOA 1J56A 3CZ5A 3QX8A 3R0JA 4IRXA 3HSYA 2PLNA 4W5TA 1SD5A 3QX9A 5BR1A 5CHYA 3IPAA 3MYYA 1ZITA 4N0QA 5DLEA 2MSLA 4LX8A 3RVPA 1QP7A 1MVOA 2QXYA 1P6UA 2YHBA 3T38A
chains in the Genus database with same CATH superfamily
4QOGA 3C4JA 1N6PA 5CNJA 1MMFB 5BSUA 1U2QA 3I6MA 1QYCA 3IAXA 1L7AA 3EUEA 1SKAA 5JMOA 3BL5A 1IY9A 4ZOCA 5EXSA 1DTWA 1XYVA 1SCJA 2BTEA 2WIBA 4IJWA 3TM4A 3G68A 1RPAA 1C2TA 1LFAA 1FLAA 2ZR0A 3DEJA 3JZIA 2RGCA 4IMPA 1Q11A 3QPUA 1AG9A 4LG1A 1PN3A 1ECBA 1Y8RA 2OHFA 1YGPA 3MJTA 4QBFA 5IVDA 1T4MA 4UPEA 5B7NA 5HM8A 1M54A 1X77A 2VPQA 1C1XA 2IS2A 4WLEA 5JQWA 4BLRA 1H0HA 1EWVA 4RXUA 3RUHA 4BZXA 4E94A 5A9TA 4UBOA 3WRWA 5D85A 3N2EA 4DARA 1XR3A 1O1YA 1A8IA 5K1ZA 2FX3A 2H29A 2NNWB 3UJ9A 2AWOA 4DSZA 1IE3A 3GLHE 1UBJS 4TL9A 2QX8A 2J5QA 2B5WA 1FFXB 2IYAA 1DO2A 1XXHE 1NQXA 2BRUA 3TFWA 2NV0A 2QRHA 1SXQA 1TPYA 2XGSA 1OYYA 2ZI3A 5CH5A 5CFLA 1ZK2A 1HTBA 5FUMA 4LDZA 1NZDA 2IEBA 1KI6A 4G56A 1TUBA 3F5QA 3SXJA 4MW4A 1KH1A 2H54A 2QTBA 1XRJA 3QNWA 2A0XA 2AK3A 4GOKA 3LBNA 4WGGA 4LEIA 1DBWA 5FO1A 3UA4A 1CZUA 3AUJB 3G6WA 4HJRA 1T5OA 1W4LA 2ZBQA 4Z9AA 3K2EA 3PC3A 4KLNA 3HDGA 1Y8AA 2NO0A 4LCJA 2ZRHA 3GLFA 4KFTA 2C4TA 4BE7B 4LF5B 2VYNA 2XT9A 5A0TA 1XZQA 2HRQA 3SD7A 3N2KA 4DB2A 1WU8A 2H8KA 3GI1A 4O4LB 5ISMA 3V3TA 1HNWB 1SA0A 2W4QA 3HCBA 5CNMA 1NE7A 2PSEA 3N2LA 3Q7EA 4IIXA 4FCCA 1QF6A 3CM0A 1XP5A 3EPPA 5AKGA 3I1YA 1RRPA 1IMOA 4FGLA 3KBBA 4PICA 5LD2C 4M88A 4R0MA 3VGPA 3UJ3X 2OENG 4YBRA 2I2CA 4JGIA 3RC3A 2VP6A 1IK4A 1BS2A 3BM5A 4AJHA 5IABA 2X15A 4MH0R 1FFCA 3D6NB 5I7HA 1WUYA 2HWYA 3NT2A 3GZ4A 1CJSA 4YGXB 2Q4RA 1UC4B 4C06A 2UZ1B 1NF2A 5HG0A 2P67A 1SBTA 4LOHA 3DP7A 4BNUA 1BA3A 5TLSA 1JH9A 4CQNA 1L5WA 2JRCA 1XTUA 1GEEA 4EHKA 4HG2A 4BC0A 4FHGA 1LTHR 3DFMA 4HDRA 3H8WA 3O2QB 4BCCA 5LP1A 3TMAA 5A62A 5K0FA 4BNHA 1E4VA 1VJTA 2BHRA 3G7SA 3WQHA 1BYUA 3PKIA 4RFSB 1GL9B 1T3GA 1SO8A 2NO7A 4G25A 1EFKA 3C6MA 5SZKB 5A06A 3WLNA 1MW8X 2QPAA 4GZ3A 4NS1A 1E3IA 1AJEA 2IXEA 2OO5A 2XHZA 4DPMA 4DCNA 3CZRA 4PG5A 4YNBA 1N33B 4LYFA 2LP4Y 2BD0A 3KJQA 4ED9A 2CV2A 2WF9A 2AFHB 2YWHA 1XBTA 1LZLA 4ZOEA 3L4EA 4YCSA 1GP2A 1TF7A 1QDLB 3DC2A 3EG9B 3SE0A 1TEXA 4PGAA 3A9CA 3BQMB 3R5JA 1LPOA 4D9CA 2C9OA 3TE6A 3R3VA 3RTGA 2AMJA 3OM8A 4RHCA 1M2JA 4DWVA 2AZXA 1E1MA 4QM7A 1G63A 1O57A 2FRDC 5TPWA 1PGQA 2VQ6A 1FDSA 3ESZA 1WP9A 2GXUA 1UZMA 2GN8A 2W90A 4QUJA 5DVZA 1HURA 1G20B 2VXOA 4G1EB 4KH0A 5G53C 4M4SA 4MV4A 1KO4A 2NU8A 4C0KA 4D9KA 4CKWA 1N78A 5HILA 1DC8A 1YIOA 5K0LA 1Y48E 5C8YB 2BM9A 2BI8A 1IIRA 4JH0A 1L5HB 3U40A 3HCAA 3L0BA 3IHLA 4JKYA 4FMDB 4OATA 4YT5A 4LZZA 1PJ8A 3IEIA 1WKBA 1KI9A 1G5IA 2J9ZB 4MQFA 1V41E 3EQ2A 3MOIA 3RU3A 3E8MA 5I51A 2BW0A 1YZUA 1HNXB 4NICA 1E5QA 2FJUA 5IF3A 4P2GA 1U2SA 4TRJA 3FN4A 4RJKA 1F3OA 4D1YA 5ER6A 1VMEA 1M83A 2F55A 3KE9A 2LBPA 4FBLA 1CERA 2PUFA 3GJZA 3EVNA 5COAA 1T6ZA 3ZHOA 1FJXA 5DGIA 4ASUD 5INTA 3VSEA 1OASA 1JQEA 3B13B 1X7WA 3B9BA 1S6YA 3L7OA 5AYVA 2JJ2A 4CM3A 1DC6A 2JGFA 5KDLA 5BNZA 1YVDA 4IGIA 4PYMA 1CETA 2WMNB 4UTPA 4DNFA 2Y4OA 3BD9A 5L3QA 1XDUA 2K6GA 3I05A 3OTGA 4U2FA 4II3A 3R7SA 5IAAA 3F7OA 5JNVA 4FTWA 4M8KA 4FUTA 1YQ9A 1XMSA 4LBYA 1H23A 4C0AC 4EW3A 5JVDB 3SEQA 1Y5LA 3QGMA 4N3NA 5JZSA 4NL4H 1JYEA 4M55A 1S5PA 2Q7XA 1U4SA 1Z0SA 2CLMB 2WOJA 2FN4A 3KJNA 3JCZA 4MS1A 5IM4A 2ZUDA 1UF9A 1CZNA 2OCKA 1SH7A 1EVYA 1WXFA 3TZBA 3UMYA 1FZQA 2HIHA 1LSSA 1OPRA 4Z1MD 1K92A 3FNIA 4FZRA 1J22A 2JFZA 1MDBA 4AKGA 2HL6A 4GPD1 1V5GA 4LXIA 1UEXC 1XCBA 3P5SA 3FSGA 1B8UA 1TM5E 2ADMA 4NMWA 1E0KA 3ESQA 4O1HA 4B87A 5LSAA 1JZQA 3E70C 1G9XA 1PT8A 1DC7A 2GYVA 4F5ZA 2IS4A 1JSCA 1NQ5A 3UMMA 2Q7OE 1PWYE 3OY2A 4JP3A 4CR6A 4D82A 2G1AA 4II7A 4G2TA 1KI7A 1R0RE 2BGLA 3U3OA 2O6HA 3H84A 1NJ6A 2PLWA 4DIBA 3RS9A 3UIEA 4I9HA 1KYZA 4RKRA 4RUKA 5IDYA 1HYBA 1I51A 3G5MA 4U39A 1GV1A 2P5YA 4HEA1 3GRCA 5BYBA 1W0JA 3GEDA 3NHWA 2RAUA 4PY2A 1LS6A 1BSVA 3G9ZA 4LTMA 4YRIA 5DGXA 5J1SB 1TJ3A 3FRJA 4R7TA 7YASA 3D1VA 3Q72A 5B4UA 1Z0UA 3GLGB 2J30A 3VBEA 2QMUA 3QEKA 3R09A 1BHO1 2J0UB 2VUSA 3A6LA 3ND6A 4R1SA 4A2QA 2CLDX 1P9LA 3GB9A 5AM4A 1UM9B 2H48A 5KBYA 4ZRDA 3FI0A 5D01A 5B7PA 1PSDA 3THXA 4I6GA 4ZCPA 4FFDA 1L7BA 4XX0A 4RTQA 5HUQA 4K9KA 3ZGOA 5KQMA 1Z5OA 4GGOA 3ES9A 3RRXA 3OQIA 1UQUA 2OCDA 2Y66A 3BIXA 4MVJP 5C1DA 1GTRA 3K70B 5GONA 4LF9B 4WKCA 1KDZA 4NMXB 3WFIA 1XGKA 4UOQA 4A8JC 2CSUA 4US1R 2AFVA 4QGGA 3WBKA 4BMSA 1DNPA 4NBSA 4YT4A 5HOEA 1V48A 5AUOB 2FG5A 1NG9A 3T7JA 2XV1A 4CCYA 1ZVVA 1L4KA 3DBIA 4G9EA 3UMRA 2O8EB 1H8EA 3GG9A 1MJ5A 4JITA 3SGLA 3GQVA 1NN5A 2NOAA 3COPA 4JS0A 3DOOA 4BBAA 5IZ4A 2OVFA 1QWOA 2VJPA 2VRCD 2HCBA 4HL6A 5I3ZA 4DC0A 5JCJD 4J16A 1VZ3A 2XAAA 2J48A 4OIMA 5KYXB 2X0EA 2HRDA 1CR4A 2LDXA 2A5YB 3CIOA 4LV6A 4OV6B 4I8DA 2H1RA 1B43A 4PG4A 1W8IA 4C0JA 4CMHA 1EXVA 1F2UB 3CIFA 1LD3A 1CTQA 4YRGA 5KSOA 4J1TA 1KR5A 1XCPA 2ATXA 4EBFA 4YQZA 3UJ6A 1UQRA 1DKQA 2C59A 4DIMA 3ZLBA 3MRTA 2VHEA 4I6JA 4KPFC 3G02A 5J58A 4CFSA 1HT0A 5KSPA 4P4SB 1UPXA 5JH7A 4ZAVA 4LE0A 2RHJA 3DV2A 3N8IA 2ONZA 3M4JA 2GEDA 2EP5A 3BH7A 4O4HB 5C3UA 3M4YA 3LWBA 2YBEA 3KQNA 2O54A 1UKEA 3GJSA 1TX4B 2BFPA 4BDTA 4BFUA 2GCOA 4BNTA 4G0OA 3CLHA 4NCNA 3ZGZA 3E61A 1RLIA 3RK1A 2DERA 2WICA 1HDIA 1QFZA 2XDQA 4LMAA 4AVYA 4YRAA 4R1TA 1N6HA 4BJHB 4PRLA 3T5DA 3N75A 5KJCA 3WV4A 4LI0A 4M0LA 3WNDA 1WW8A 3QJGA 1LF0A 5AH0A 2PV7A 2RKWA 3HI6A 2QTZA 4GOMD 3V4PB 4NH4A 2O8CB 1G21B 3BXPA 3LW8A 4FI3F 1QTIA 3B51X 2JH9A 3AB3A 1QIIA 1Q91A 1VXRA 4B3TB 4KHPB 1BE6A 2GAIA 2W6IA 4KYTA 1DKRA 1YJCA 4YRFA 2A3NA 4BYMA 5FPKA 4JI6B 4QEKA 3BMOA 1NI4A 3OE1A 2A0FA 2CWWA 3O8BA 4FI3C 2B4YA 4BO9A 1KJ9A 3NPMA 3VSCA 4E22A 5CA1A 1FVOA 2PEYA 1P7CA 2NU9A 3AM3A 1N5IA 2RC6A 4GXTA 4GUDA 4RX1A 4CKBA 1FRQA 4OLJA 1A8HA 1W36D 1I4OA 3H4MA 3UEOA 3DWGA 2IS1A 4QAQA 3FAZA 1UXGA 1X7YA 2VYND 4H0NA 4HDKA 2WQ7A 2WU3A 3D8UA 4NCAA 1PR4A 2PGIA 4F12A 5ESXA 2ECFA 4DCOA 2P9GA 4ZU6X 3I39X 4R1PA 4E33A 1D0VA 2D0OB 1YOVB 5JEDA 1E6LA 2WSIA 1KOFA 1XNGA 1ZPDA 3I73A 4FEGA 5DO9A 1HYGA 2P5UA 1NDQA 3PFFA 1ECFA 2ZBFA 4OEHA 5EP1A 1WVMA 2X7HA 4G6ZA 1MNQA 3L4SO 1E7MA 4EJSB 1AZWA 2Y1DA 3MCUA 3ZWMA 1HZZA 4YAFA 1KYXA 2KLBA 2PXAA 1TMYA 3AUYA 4E5UA 1CQIA 1M6NA 3AEKB 2WD8A 2YDYA 4LC9A 4IEIA 3RAGA 1G2QA 1Y0BA 3L04A 2VT6A 3K2QA 1S02A 4HWSA 4N82A 4RO0A 2PX8A 1DKNA 3BX1A 5DB4A 5ES3A 4BRUA 2FVXA 3OPQA 4Q3AA 1NXWA 3C70A 3TF5A 2JLQA 2QMQA 2CN1A 1ESCA 1K08A 3HSKA 4URFA 3UQZA 1BHSA 1VCIA 3D2AA 1BCSB 3WO1A 4EB8A 5JEEA 3THYB 5JZVA 4Q9IA 3DTNA 2B6NA 4S04A 1N2ZA 1XXLA 3DYIA 4X1IB 1WWKA 1BNCA 4OQDA 2CVQA 1DPGA 4IGEA 1TTTA 2VQSA 2ZKIA 2B4KA 3GU3A 4LZWA 4MARA 4MS4A 5UKDA 5J1TB 4DY6A 4B3SB 4DR7B 2PVPA 2WF5A 3NYWA 2C2YA 3MIZA 1I3LA 3FBGA 3PEVA 1I7QB 1SKMA 4G0WA 1F8XA 1KMCA 1W5EA 1UXKA 3GYGA 3IULA 3H42B 3HKEA 4DREA 5TQ2B 3D8NA 3NVMB 3UW1A 1WDMA 3N7UA 4N0PA 3EXAA 1BEEA 3LHFA 1HE2A 4JLOA 2GK7A 2G0TA 1KDTA 5ILGA 1P61B 2NXJA 1LJ8A 2XNHA 3PEEA 4BOYA 1NM5C 2WJ4A 1OC2A 2BBSA 3NORA 3MLBA 4IHQA 4P9NA 1Z82A 3A6ZA 1W2HA 5EVJA 1Y98A 5H5JA 3LS2A 1YCGA 1MRSA 5TX7A 2NUAB 2AN1A 4P0QB 3S40A 1Z3IX 1Z4MA 3KHUA 4WNCA 1Y6RA 2CMKA 3WLEA 3C15C 1R18A 2AB0A 4OB6A 4BP9A 1IJKA 1J7JA 1YK1A 3KKMA 4U2GA 1E59A 3C6ZA 4GAEA 1Q1ZA 4U6SA 4YVFA 2QYHA 4UCWA 5F98A 2XB8A 3MT0A 4PX2A 2RCYA 1IOVA 1SVSA 1NMYA 2KMLA 1EP2B 3DB1A 4XM0A 5TQ0A 3V34A 1RWOA 4BMCA 3HJGA 1J2YA 3FFXA 2YHIA 4X9XA 1HSOA 3T1YB 3DPSA 1H2RS 3CCCA 2ZTLA 3L8EA 3NOVA 4F92B 5BSEA 4GUAA 5EQJB 1O8BA 4HAZA 3MYYA 5AHOA 1ZITA 4LSMA 4XQGA 3OLQA 4N0QA 3UXHA 3RRZA 3LLUA 1RJDA 2EOAA 4Q9KA 4YP0A 5FOUA 2XCTB 3LKZA 4MIEA 5K3BA 3GLSA 2OB2A 3R8FA 3WB0A 1P6UA 2QY6A 5BSGA 4K9OA 3UGQA 2VJMB 1I5EA 1PJZA 1U5BB 3EQ9A 4ZVQA 5IJAA 1Z0KA 3EXIB 4Z9FA 4D43A 1T29A 1U3TA 1OTXA 3QKIA 1N32B 3JWEA 5BSRA 3E9QA 2QZPA 4I99A 2R5NA 3INTA 2JFQA 1XCMA 2EFYA 1YL6A 1MOPA 4IUDS 2XTMA 1ICIA 5IMSA 3M4ZA 5LWHA 2Z4SA 3EVEA 2C29D 2WM2A 2VZ8A 5DN9A 2ZE8A 3NC1C 2FPGB 3FLEA 3RK4A 1THGA 1DJQA 3FWZA 3LQ4A 4G5RA 3VOTA 1PEDA 1V11B 2RBEA 4UHFA 3WSVA 1NW5A 1W35A 2ZJ1A 3EXHC 1EB9A 3O4FA 4HGYA 5EIFA 3VV2A 4QVIA 3M6VA 3ENKA 2D13A 3ITNA 4BJ3A 5FD8A 2JJ2D 3RO7A 4M1YA 5IFKA 3WK9A 3HKDB 1T4GA 9LDBA 3GXOA 2R1UA 1N5JA 4QYIB 4EEZA 1YZYA 4HLUA 2BJWA 2FSSA 1LX6A 4YJ2B 4OU4A 2DWOA 3UFBA 1RI2A 1AUVA 4EWLA 1VPEA 4CT0A 1BS1A 3TI9A 5IULC 4JYPA 5JNRA 4GPBA 2XGGA 1BS9A 1J5EB 2R8RA 2UVPB 3II6X 2YCBA 4AI6A 1WXXA 3EOZA 3RREA 1QHHA 1BCRA 1B8VA 1IHPA 1OWMA 3AEZA 1XZJA 4IH4A 1WB6A 2A94A 4TYQA 4H9GA 2G07A 4JZKA 1PJAA 1A1SA 4M38A 4M99A 2A33A 3FOEC 5DNYB 2NU6A 4IBOA 4IHJA 1IDN1 4HAUA 4F2DA 1IY8A 3F6EX 2FUCA 2A92A 1V39A 4RELA 3VU0A 3AILA 4XB2A 5E1BA 3REGA 2C04A 3NTXA 3A1VA 3GUCA 4LWOA 1M1YE 1V45E 3DO8A 4G5HA 5E95A 4YQEA 2P91A 2PGLA 4M1ZA 1NJSA 3JALB 5NLLA 3VISA 4DLXA 3T3EA 4PX3A 2I55A 2W4IA 4BRWA 2HDWA 1AUOA 1U3DA 4B33A 2XWJI 3HUDA 4KSYA 5A5FA 1G66A 2MR5A 5AUNB 4HNVA 5E3JA 1EP3B 1A9PA 4D0RA 2EFHB 3EC1A 3AUSA 1SC6A 1ZR4A 2W8BA 2OD2A 2I6FA 1PFVA 2IHKA 3PI7A 4FEEA 1KQNA 1ZW6A 4XOIA 4Q7LA 1GPDG 3ZLVA 5SY4A 1AF7A 1GYPA 5AJVB 3MJCA 3PHGA 5H3LA 2B9EA 4EK9A 4DV4B 1OXBB 1ZD3A 5AT1A 2XXAA 3BGOS 4F84A 1SHKA 2W4MA 4U7TB 5E6RB 3M3DA 4F3CA 2LZ0A 3PX3A 4N41A 4OBXA 5FL7A 1NLYA 3PNPA 1U2GC 2MMGA 2Y93A 1K2WA 4HP8A 1HH4A 4U6NA 2J7PD 3RROA 2B82A 3AY0A 5EXEA 3TR6A 3V7UA 1JU4A 1ODCA 3PQ8A 1L1RA 2FWJA 3UWKA 1KDRA 4N9WA 5MFPA 3BKWA 1LTKA 5AVSA 5KJ6A 1EXWA 4MRAA 4Q9NA 2ZI5A 4ONEA 3S81A 4J76A 5A2QA 3TSOA 3KKLA 1MV5A 3KT3A 2AJTA 4AZ3B 4M7RA 3REFA 3CWCA 2B35A 1FIUA 2PZFA 2DB3A 2HUPA 3E3LA 4KE6A 3E9CA 5G0TA 2R8OA 1QGYA 2QYSA 3AF4A 2H3HA 4J7XA 4NBKA 1THMA 3Q8MA 2AG0A 2QM7A 2PGOA 2DFVA 1J9ZA 4D3YA 2X0RA 2GS9A 2Z5VA 1Z83A 3H0CA 3O03A 1Z08A 1BDIA 1CUSA 2W6ZA 1RWPA 3E81A 4HQRA 2QLFA 2HK8A 3ZJ5A 1Z6PA 2QJOA 5LVAA 1XX6A 4F3RA 4JJ4A 5DWDA 4Y2XA 1F2DA 3EFBA 1ZYUA 1FE8A 1Y1SA 2LUOA 1ESDA 2C94A 4PNEA 3TZEA 3AUAA 1LWOA 3QUAA 5FP0A 3LHKA 5A5GA 5EJ8A 1XYGA 4Q4JB 2PMEA 5LQDA 2PIDA 1YR8A 1MX5A 2DFDA 3ISJA 4O2AF 4AWBA 2V4MA 3TGPA 3EZGA 3R3WA 4OQYA 3C24A 5IPFA 1UEIA 1VOTA 2X8WA 4NCHA 3U7HB 3CNNA 4D25A 2YJZA 2II6A 3OCXA 5AKKA 4BO0A 2IH4A 4Z4FA 1DJPA 3T5PA 1Z56C 3KZKA 4I4TB 1SOWA 2VTDA 5EPOA 1WCYA 5JD3A 2GRAA 3OCWA 4EIWA 1SK9A 1Z6QA 3B3JA 3SSMA 4AN1A 3U62A 4TWAA 1A27A 5L9AA 2FDRA 1GDTA 1MFZA 3ZDRA 5BN5A 4IV0A 1DEKA 5CGQB 4KAJA 4C4OA 1DPFA 4AYWA 1L5GB 4C21A 4GOXA 3F6CA 3DLIA 1P80A 1NQOA 4JBYA 3D2BA 4HXEB 1WHSB 3W1EA 4A1OA 3UFXB 2VCEA 4Q7KA 1EFRD 1M8GA 1XLVA 2A86A 4HX5A 4COKA 1NVBA 3SG0A 3PJGA 2HZBA 3BCUA 3V4OA 1OLUA 1T36A 4B48A 5I5GA 3UYLA 5JRZA 1PX2A 5TQJA 1Z0ZA 2W6ID 4REMA 3Q2KA 3FZEA 1ZISA 1QTQA 1M1UA 3PEFA 1WR8A 2QG4A 4FMPA 2P9BA 3RF6A 1RLOA 1Y6FA 3WK6A 1LK7A 1FLDA 2QEQA 4Q3CA 1K5GA 5FI5A 4TM7A 3OY7A 3PR1A 3L8FA 3NBFA 1EZZA 4YR7A 1E64A 1LI4A 4PG6A 3HRIA 3D02A 3UTDA 4QA9A 5SV2A 1I1HA 3BWEA 3L77A 1S2MA 3MOSA 5DTRA 3SVTA 3RIGA 1SQFA 1ZIXA 3ONDA 4V0LA 5I7SA 4C5BA 3FYDA 4KFSA 3JVVA 2PU5A 1Y80A 4M7WA 5CT6A 3DVAA 2LPMA 4CF4A 2VF7A 3PD7A 1EAMA 2FG7C 5KAMA 3VX4A 2IEIA 2IYXA 4NULA 5DSTA 1CHNA 4MW6A 2JCVA 2XUHA 1CLEA 3GPCA 1T25A 1WW2A 2ATCA 4MYDA 1AHIA 2A1UB 3A05A 2X2EA 4Z99A 1KFEB 1NNI1 4EY8A 3COJA 4FYVA 3CUSA 1E7RA 4KMMA 5K03A 1WM1A 1X1CA 4ER0A 5TEVA 3SEFA 1TD1A 4NXNB 5CXQA 1L1EA 2HPHA 4EYEA 4TV8A 5IJ9B 3PKZA 4TKUB 1YAJA 4HB3A 3WNQA 4H7KA 1W36C 3C39A 2IYEA 4RCZA 4Z53A 1R1DA 3W2HA 2RI1A 1ML4A 4CE6A 3DEZA 4J1SA 3MUFA 2O3TA 4Q4HA 3ASVA 4ZT4A 5AQ1A 5DV9A 4C08A 5KQRA 1ULHA 3CR8A 3T1QA 2YOFA 3KR0A 2R6ZA 5EHNA 1OV4A 2RB5A 3W7BA 3RIXA 3KUKA 1OAAA 4EA8A 5HKAA 4LFAB 2C61A 2R6HA 3LRTA 1YL7A 5GIOE 1MVLA 1DAFA 5HGXA 5BW8A 4A6PA 4KQ9A 2P2CA 3KVOA 4EGAA 3RUPA 1E5TA 1IB6A 4IIUA 4KYVA 4PPQA 5E9JA 4RMJA 4CEIB 5A4IS 5FNVB 1ZK1A 2ZSIA 3N59A 8ABPA 1RR6A 2CMGA 5FUQA 1E7WA 1J9EA 2CKDA 2H7YA 2V7VA 5D51S 1U7OA 1QVAA 2CLEB 3X1YA 2J85A 3JYOA 2P41A 3KG2A 1EVZA 4O08A 3RKRA 1N5DA 3I5XA 1HRDA 2C83A 2JGKA 2VSXA 5MHTA 3JD2A 2ZZMA 2ZREA 3TRHA 2ZWMA 3I6YA 3F97A 4L08A 2XYVA 2QSYA 2VDOB 4OHOA 4B73A 3I45A 2GVNA 1GAEO 3V42A 1A4UA 1XRSB 3EASA 3U31A 4BGDA 3IEVA 3JQAA 4YFVA 1DLJA 4BWGA 3ZTWA 2HHHB 4RPGA 2O7VA 1MB9A 1XIVA 3TI7A 1L8OA 1YDHA 1M8FA 2IHVA 5HJ5A 3DL7A 3FA2A 1US8B 1KAHA 2WMYA 4IFBA 2XA9A 2Z04A 4D9IA 1VE3A 2WDZA 4ZOLA 1DRKA 1V3QE 1Z6GA 2PRZA 4K03A 2OO5C 5B57C 5KOYA 4QQ8A 3DPIA 3GN2A 1NC3A 4LZAA 1QP8A 3DLCA 2F43B 3LQQA 4KQEA 1GL3A 1KY4A 4O4IA 4IDFA 4I55B 3KPUA 2YVAA 5LA6F 2A5DA 2EGHA 3D8HA 1SBIA 2DR3A 2F3QA 2AFRA 2CHEA 4IEEA 4W5QA 1GNVA 4PS1A 3DZHA 4A91A 1PV4A 2Q46A 1V9LA 4X92A 3MMZA 3EVZA 3RVDA 4HY3A 2C4UA 2E85A 2KX7A 3NU1A 4G0NA 3QX3A 3DQPA 2RJNA 3I9NA 1YS1X 1F9AA 2V6JA 1IIBA 2ZYIA 3HGQA 3TMKA 3C3KA 2F3RA 1A5SB 4Z4QA 1VLZA 1GGEA 2RGUA 4QHSA 3CA8A 4FGJA 4BNGA 1VG1A 4GBMA 4RPIA 2W6CX 3W9SA 1EDOA 4AO8A 4BNNA 1TZBA 4Z2AA 1KJIA 4KWTA 3O47A 2YMPA 4Q3DA 1CUGA 3OECA 5EIOA 2PH1A 4OGLA 5DHSA 4P34A 4ZTBA 3SIPA 4L7VA 1MAWA 2IYSA 5LQKA 3K5PA 3FNBA 1JNXX 3GAAA 2Q9AA 1ADCA 3ILXA 3U39A 1J20A 5DEIA 2Y1GA 3VR2A 4AT1A 4EO7A 1FU8A 3AB7A 2I3ZA 3KHTA 3PRHA 3USZA 3AUTA 3MXOA 4DMCA 2GTIA 1E7SA 3GZTB 3BCHA 1Z2EA 1AX9A 2W6JD 1JAZA 3TAXA 5BPHA 5A5DA 2HSDA 5TPZA 3ZX5A 1K5PA 4H1TA 3W77A 3WGUA 1MQAA 4TKVB 1XF9A 1GGHA 1UZNA 1VGVA 4XCXA 4L9AA 3Q3VA 4DLLA 4OFXA 3DQZA 4CEJB 1GQSA 2PFGA 5HP4A 4UE6A 3SFZA 4ZJYA 4RDXA 5LQRA 1XAHA 2X41A 3S1AB 3EEOA 5K2MA 3JR3A 1SD1A 1Y5MA 2VA8A 2Z3WA 3EIOA 2R0QC 1VIDA 1NVKA 1XMOB 1ZN2A 3UICA 2FU5C 2EYUA 4HR7A 4IM7A 2YKGA 4OG2A 4BYGA 2AFIB 3IQHX 4D42A 1DKMA 2NLOA 3T0FA 3T9DA 5LIPA 1A9XB 1KVTA 1ADGA 5DW0A 2OFXA 3K35A 3RAFC 4A2WA 4PR3A 3Q12A 2G08A 4CODB 2QUBA 3IKJA 3RV4A 1A8UA 2CFCA 2XMDA 2H11A 1PWEA 4Z2YA 3R8XA 2VSQA 2QTAA 1AUQA 2JA2A 4A8TA 1TCCA 3ZGNA 3OH8A 5CB8A 1XJ5A 4S12A 1MTOA 2RJOA 1QR6A 3E2IA 3PITA 2GNOA 2W70A 3TBHA 2DR0A 2XCOA 3VH1A 4I4NA 1WXIA 2PA0A 3G6KA 2ORVA 4JODA 1Z17A 3I92A 1A98A 4G1VA 3CX7A 3GOHA 2GTPA 4G84A 4CM7A 5IXJA 1DBIA 5BW4A 3F3SA 2OLKA 1MC1A 2ALJA 4EHLA 1M2HA 4QC2A 5TVGA 5HX7A 1KDVA 3WWCA 4LNUA 1AVTA 3TZLA 1YI0A 5JHGB 1PTKA 4U7HA 3TPFA 4J3FA 1ZH0A 5AKZA 3IBCA 3B6MA 3O1IC 1PV1A 4NJMA 3DTVB 1F0NA 1BWRA 5K0ZA 2IBTA 4I14A 3AC0A 3L6RA 1LI5A 2GZMA 5LOVF 2V7TA 3DAPA 1TYEB 5JALA 4R98A 3LGAA 3W8EA 3ZBUA 3IB6A 2JHFA 1FP7A 2Q3LA 3R6TA 1OMOA 4RVFA 4NWIA 1GZ7A 4JU9A 4EI8A 4NABA 1IYZA 2FZCA 4PRYA 3NVDA 2WAOA 2XMRA 1YMVA 1ISIA 1K2VN 5KVCA 1E1LA 3IA2A 5EP3A 1WNTA 1NPYA 5EKDA 3EXFA 2INGX 3GJ7A 3JQGB 1TK2A 4J0CA 4KE7A 2OSVA 1IEVA 1JYSA 4A82A 3WA7A 1OY1A 1WDKA 2J6BA 2H1IA 2HN9A 1VHLA 1JG6A 1A8PA 2G5PA 2VHQA 4QXAA 1CP3A 3A31A 3E22A 3H2IA 5DCWA 4LJRA 3I3SR 3SR0A 1OZGA 3WLJA 5EKUA 2ZR8A 3HEBA 4ZRNA 4G1UC 4WA8A 4DA0A 2W83A 4MCIA 1TW2A 3ZZTA 5AQEA 2OHXA 3JD3A 3X1XA 2TECE 1U8UA 2C2XA 3A7DA 5MGBA 2WNHA 3KQHA 1P4SA 3MJFA 3NHMA 1N1GA 1XFDA 3VR3A 3I64A 1E1DA 4M7PA 2NUTA 5C9ZA 1U4NA 3TNFA 4G1CA 1EP9A 4CYMA 1XXHA 4ARBA 4BZWA 4MJXA 1CIVA 2ZUCA 1R16A 3VH4A 3WGOA 1SBZA 3A4TA 4I1RA 5ENDA 1DKUA 3H1AA 4OUKX 2OAQ1 5LD2B 1ZUIA 4J16C 1MVOA 4AZ0B 3QXSA 5AKXA 2VBGA 1FNNA 2WU4A 2NVUB 2HW8A 3AI2A 3O31A 3WLPA 3AEUA 4KDEA 3U1TA 3B1WA 1E0DA 4OKSA 4RIEA 4C3ZA 4DJ5X 4FINA 1IVSA 4J1TC 4V02A 1DXHA 4CFZA 3B1YA 1S8AA 4O2BF 3CCBA 1TM2A 2FB9A 5FOQA 1QR2A 3T1TA 5IT9A 2PR7A 4MB0A 5LDDC 3IUNA 1PVOA 2VJDA 4B2YA 2FF7A 2XTNA 3B2QA 5E8RA 2J0EA 3V00A 4YAEA 2GK6A 3IIKA 1ODKA 1USIA 1V7QA 3G2LA 4BO7A 2EWMA 4C76A 3AG6A 1KFJB 2GPAA 4EL0A 2GNPA 1KSFX 4FT4A 1HEUA 2R62A 4E08A 3A36A 3ROPA 1Y7TA 4DZTA 2J07A 3Q7QA 2UVQA 3RRMA 1SPXA 1TQ4A 2WE8A 1TVMA 3FPJA 2JBHA 2NTVA 2IOHA 2ZVQX 4MYSA 2JHPA 4LF7B 5JRDS 4QUAA 4RPLA 4LHZA 4UUMA 2WNIA 2EKPA 2WE7A 3JAMA 4R9SA 2AE1A 1JW9B 2OZLB 3IFSA 1PTJA 1FPMA 4OP2A 1YO6A 4W8GA 2D6FA 3L02A 3H2JA 1NJ5A 4JLJA 4GS5A 1KZ7B 1TC1A 1E7YA 4ZICA 3G0HA 2AYXA 5JDCC 2CHGA 1DIHA 1FNCA 2PXXA 2Q3MA 3LLCA 2XXBA 2D62A 3KB2A 4AJNA 4AMUA 2L17A 4CDRA 5C7IO 4MDFA 3K0HA 2P3SA 4EHFA 3VPSA 4JHXA 4OLHA 4KK4A 1TYBE 3G2OA 1K7FB 1ULTA 3BF8A 2YY5A 2QGFA 5EWMB 3UCFA 4DA9A 2V1UA 2GD1O 1Z73A 5EMMA 4I1PA 3B2EA 1E3JA 2ODNA 4RD2A 4CHTA 5C35A 2QRJA 1WHTB 1OV6A 2C9DA 1TD9A 3COYA 5JCPA 2IX3A 5LLTA 1TECE 1CC1S 2ZRIA 3QKWA 4KBYA 4B8ZA 2FE4A 3AYZB 4D26A 1FUEA 1R0CA 2FETA 2JIZA 4JVLA 1W4ZA 2PV0A 2QN8A 4NP6A 4RS3A 4TLCA 3CF2A 4BP8A 4XUEA 3LUBA 2EBUA 3P0RA 1GSAA 4JNKA 4ABYA 1CT9A 3MLEA 5BXQC 3PVSA 4ITRC 4OCZA 4QRHA 3SWWA 1MXHA 1NUUA 2VK2A 3U6BA 3MWYW 3V7YA 2ILVA 2EJCA 3NCHA 4S3MA 2CHQA 5CTAA 3ZDAA 5K8VA 4LVUA 4CF6A 1L3BA 2VOJA 3MB5A 1P0PA 1GL7A 3IP3A 1HZZC 2POCA 3QUSA 2CVFA 3DFFA 5IX8A 4V03A 3QOXA 1DUSA 2HV9A 2QR5A 2XNDA 2V7EA 2QU7A 1QBGA 1P45A 1EUDA 1TAQA 2JVKA 4ALNA 3ONNA 1JTVA 5KWJA 5F3RA 1T26A 3H04A 2IYYA 4CEHB 3EODA 2FWBA 2ZJ2A 3JASB 3CF4A 1I2AA 2AOVA 4R1NA 1KL7A 1P1RA 4C0BA 4BCDA 1VL8A 3KLBA 1E2KA 2WYUA 3BGIA 3HO1A 5I9TA 3KYCB 2GXSA 4DR1B 3AINA 3T7EA 1RTKA 1D7OA 1RWWA 3C5WP 5FPHA 4WH0A 3ADCA 1AM4D 4OI0A 2HGZA 3IMCA 1A5ZA 1V1MA 3AQ4A 4L2IB 1J8VA 1VL6A 5TGTA 3KKPA 5KUTA 3UPTA 1RSZA 2QRNA 2MSDB 4JQCA 4OU5A 4RCVA 3UOGA 1CNMA 1XTIA 2XEXA 4X94A 1N6LA 2D5IA 4QSMA 1SC1A 2PKXA 1K3UB 2I2BA 2PT5A 3ZUGA 3RYTC 4C2TA 4UTVA 1QC5A 3NXSA 3IVAA 5A71A 1JRLA 4MP3A 4YP7A 1ZGCA 3DMGA 5KVVA 1FMTA 3GEIA 2Z09A 3DE4X 1V9CA 1RQ7A 4ES6A 2DJIA 4HPWA 4R1MA 3WXMA 1HLPA 1BX1A 1KP9A 2CKMA 4PZEA 4TMXA 3B5IA 1ZS9A 3KYIB 4W6ZA 5F7JA 2H65A 4QELA 1G6HA 4UTRA 3OC6A 4E4RA 3D6HA 3KYDA 3RG2A 1TADA 3VR6A 4MW7A 3UKDA 4HN9A 2G70A 2QRGA 3G0CA 4HWKA 4Q3OA 3Q0EA 4L73A 3M1AA 1TZCA 4IOKA 5CT5A 3S2GA 2H2HA 4DMRA 3KAQA 1V8PA 2GAJA 2PANA 4G4SP 3SI7A 4HCJA 4UASA 1Z8FA 3LUJA 1U2DA 2EP8A 2E6KA 2R00A 2QSJA 2Z2IA 3H2HA 4TQGA 4ZCQA 3SQLA 1FC0A 3OZIA 3WKCA 2QMZA 3HNPA 4ZO9A 1ODSA 1G21E 1T10A 1DDGA 2Z6QA 3K9HA 1YB4A 1N2BA 1BXZA 2P2DA 3HB0A 3I2YX 3IVGA 3JAWA 1JJIA 1X42A 1P72A 2SKCA 1EFUA 1OVMA 4JDPA 5H8WA 1ZJJA 2HUNA 2Z56A 3N70A 4Q05A 5ELMA 3HXQA 1Z33A 4HTFB 2GVDC 1NVFA 2VNKA 2FOXA 1X1QA 4FX2A 4KQXA 5A6VA 3BTVA 4WXPA 1W59A 3SKXA 2C5BA 3QU9A 3B3FA 4OHWA 1JFVA 1U2ZA 2QNIA 2ZYTX 4QTZA 4W5WA 4V0RA 3W6NA 2V6BA 2SKDA 5FEUA 4XWWA 3H8JA 5IWAB 3ZBQA 1IVYA 1PFQA 3DOJA 1P4HA 3P4XA 2PM8A 4A8JB 3ZHVA 1FYDA 1N2CB 4FLFA 1SUIA 2VBIA 3EG5A 2YXDA 5ECGC 1Z0FA 1G5PA 2GEJA 2JBAB 3OWOA 5DYYA 2D4AA 2WA2A 4HAXA 4N5LA 5LU9A 4INZA 3TQQA 4WNAA 3V8MA 3O8LA 4RHYA 3ETNA 3IE2A 3F6SA 3EAQA 5DCYA 1ID8A 3GA0A 4CQMA 4JCOA 4V24A 1SXHA 2JLZA 1EZ4A 3F73A 3QTLA 2E7ZA 1YRWA 2O2GA 2X7JA 3DR3A 1W5AA 2IPOA 3LQKA 4KK3A 4TLAA 1UMDB 3LC2O 5GMOA 1EA7A 3EWNA 2DX7A 3OQNA 4G0QA 1QH9A 2FZWA 1N7JA 2VT7A 3UWOA 1XVUA 4K6MA 3UBTA 1ONSA 2L0XA 4P38A 3DXXA 3WWPA 4C3VA 4PWZA 1RJ9B 1Y82A 5JADA 1GIAA 1I80A 1ZD4A 2Z30A 2Y99A 3F47A 1I3KA 3KTOA 2ZE5A 4FOTA 4IW3B 1XD8A 1QOZA 4RPJA 3FTEA 3VC7A 1Z2NX 4HZGA 5JG7A 1T4DA 2ETXA 5EWJA 2C4HA 1C3JA 5LKAA 2PYDA 2J87A 2VDJA 1SG9A 1S9DA 1QK5A 3F71A 3PEUA 4LY6A 4BQIA 1RZ3A 2NYVA 1PQYA 2X1LA 3MT8A 3NR2A 2FPSA 3SPXA 2Q2WA 2JFNA 3NAQA 2OUIA 2FOIA 1Z6TA 4WW0A 5LYYA 2PL1A 1AZSC 3DXFA 1J21A 4W8HA 3RAPR 1EUYA 4EJ0A 2Q07A 2ORYA 4EPRA 1CUBA 3L7NA 5K51A 1GGMA 2X4GA 1SVOA 2WF7A 3PFGA 4M37A 5BOSA 1RZRA 3UCEA 3LT5A 3PDHA 3WBBA 2AEMA 2FUEA 2IDZA 1P3JA 1TNDA 4UUNA 3BHNA 3V8NA 1NBAA 1XZCA 3ZHCA 5KO2A 4R6XA 2HHJA 2PGNA 3QWAA 3IT1A 4X62B 3UMFA 4ZHQF 4RIIA 3AF3A 5DM1A 3H7AA 3EEFA 2EDAA 3T95A 2Q9CA 3FPGA 1LDBA 1YBFA 3CGWA 2F00A 3K0BA 3UJBA 5K05A 1PL0A 2PPLA 3F8WA 4JV5B 4XDGA 2PEZA 4JOSA 5ULLA 4MDHA 3BSYA 1B76A 2X8JB 4R51A 1Y8QB 3PXBA 1B8PA 4D9NA 1HY3A 3ZW9A 2O7RA 4YXWA 2B5VA 4G8DA 3K9FC 2DG2A 2QDXA 3NJ4A 3Q41A 3GGOA 3IBYA 2GZAA 1L4MA 1CNEA 3CSUA 1FU7A 3EIHA 2HU2A 2JI8A 3C1AA 3FB1A 4MV0A 5HIIA 3MGGA 3IE0A 4IS3A 4MV1A 1BO6A 9ABPA 1Q7EA 3EGEA 4X91A 3VO2A 3VC2A 1P77A 2FEOA 1A9RA 3TE7A 4C0QC 5AVZA 5HRCA 1VIYA 4XWTA 2CSXA 4H77A 2QLBA 4UARA 4XX1A 4HD8A 3FSJX 2QSZA 4RA6A 2BH2A 5K01A 1UZUA 5IAKA 3S0JA 3KOOA 1DC4A 2PBFA 2VPYA 1TAHA 3C6QA 3EH2A 1A7UA 4PIPA 1OLXA 1R5JA 2JIPA 4LY9A 3A7EA 1RLMA 1FVHA 4MV9A 3SSNA 4KXWA 2XGJA 2W2VA 2J0QA 4DTIA 4H3SA 1E0SA 4GLLA 3GLGA 4TMKA 3UMCA 3ZIAA 4H6XA 1X1TA 1R00A 4JLBA 4I81A 4UC0A 2OXEA 1E6EA 3LF2A 4IV5A 3ZCUA 5B4TA 4CM4B 3HXOA 1Y8ZA 1CNFA 1F20A 4HATA 2UYYA 3R77A 3HQ4O 1HFWA 2IUFA 1QH0A 2M6SA 3QVJA 4B6OA 1CQXA 3S7ZA 3LMKA 3IKVA 2GCEA 4E3WA 5FOVA 1H4SA 3BL6A 3HN6A 2O2CA 3PNQA 2UUOA 4NOKA 2P2GA 3LU1A 4QQFA 4IZIA 5E8JA 4C7MA 4BE4A 4UTZA 2IXFA 1MEOA 5ERXA 3T9EA 3PDJA 3ZD8A 5BMVF 2OECA 3OICA 3JZFA 2OV4A 4NE7A 5CFZA 2AG5A 3L8MA 3LOUA 1IC6A 2HH9A 1H3NA 3U3MA 3F9IA 2O5RA 2O52A 3K3PA 4KTVE 3T94A 3QLVA 1HEYA 4R0VA 4YLEA 2G09A 2LCQA 1PR6A 1OKKA 1VYUA 4B79A 1MD9A 1SPBS 4LNAA 4B7AA 3K6SB 4F5DA 1MZPA 1UKAA 1Y9ZA 1V7ZA 3CRQA 3KJIA 3UJCA 4HEJA 4P5EA 2ZANA 1G5RA 1N1MA 3EVGA 5DTJA 5LB2A 4NOJA 3QKSA 4JFRA 2BF4A 4RDHA 4PFSA 2JAWA 1ZM9A 4EFMA 4V1CA 4RKEA 3A70A 1NRWA 2O8FB 4KE8A 2VH5R 3IBGA 4P36A 3C8MA 2CD7A 2WTAA 3AHFA 3HFJA 4EPYA 1WBBA 1RKBA 4GU5A 5F64A 2YL2A 2BZ1A 5I6DA 5CG2A 3M82A 2GCGA 3M6IA 1W5SA 4N6GA 3VI3B 1WMDA 3V1UA 3C3MA 1Y6QA 3OZEA 4GYKA 3OOSA 2CFOA 3UHAA 5CA0B 2FE1A 3URKA 3ILSA 3WIVA 3AGQA 5ALTA 5DBFA 4DOMA 4EMUA 4YRBA 3L49A 3ZWYA 2O7QA 1W85A 4QULA 2HRCA 2EKZA 4NU8X 3RT1A 5CNIA 5DNDA 3S3TA 3I23A 4E7PA 3VYSB 2XKAA 4UMFA 1RQGA 5KX5A 1EMDA 1QYVA 2PMBA 4KL8S 4M9SA 5AHRA 1F2TB 1GFIA 2AVDA 2WFLA 4A0FA 4EM6A 4FE3A 3TD6A 4EG6A 2JIZD 3L46A 2RCNA 1S2GA 3RKUA 3UJPA 4WV3A 2QP9X 1MW9X 5CEEA 2QVLA 3WLKX 3SQWA 2O2IA 4AY3A 1MO5A 1AGYA 1C81A 4CFYA 3SX0A 3EEQA 4P32A 3RBAA 2VHVA 4EYGA 2XUAA 5LQSA 1EZ1A 2OV2A 4DKXA 5L8VA 4X65B 1I0LA 3N87A 3C43A 2H00A 2IPXA 4GOLD 4UTXA 2PGAA 2XMSA 4G0MA 2AMLA 2GT1A 4GXNA 5FLKA 1XDSA 2JFXA 4TVKA 2WTEA 3LXRA 1RVDA 1U0OC 4MIYA 1ZD9A 3CS3A 4RD6A 3NAZA 3Q40A 2GPSA 1PJ3A 1JKIA 1N6KA 1P3DA 3VVMA 3WAJA 4AYXA 1AXEA 5EZYB 1GD1O 3OTOB 1E2LA 1E96A 2YVKA 1PWHA 3DLTA 1HWYA 3EXHB 3HGMA 3ZYCA 1Y6GA 5HJEA 1B6SA 1P6QA 1F8FA 4BVLA 2QL9A 1V8ZA 2IXTA 3NH9A 4HOYA 1A97A 4I9GA 3CX4A 1SQSA 4M1EA 5JFOA 2QE7A 4LOJA 1B0PA 2WWRA 1M2VB 2ECQA 1WA5A 3GRZA 2OCGA 4JYCA 4LIPD 4P58A 1PLKA 3S44A 4AN4A 1MBZA 3ZXIA 1H4TA 5EGSA 1PZMA 3C16C 1NV9A 4PZAA 1NBHA 2XRMA 1UFRA 3DKPA 1PNTA 3WIOA 3OZTA 2FK7A 3GOQA 3WLFA 2N42A 4QGAA 4WA7A 1WMBA 1Z8HA 2YOHA 5I47A 1UBEA 1RFGE 1FYFA 3P19A 4ISCA 4XEHA 5B53A 4CDGA 2FZVA 3UWPA 5CCXA 3GQBA 1FRVA 3HKBA 1MFPA 3HWSA 2BFBA 3O5AA 5K3OA 2WAXA 1PRYA 2HA2A 1DFIA 3IPRA 2PS9A 2H92A 4FGWA 4YFYA 1V2HE 1HBJA 4ZT3A 1OLSA 3RW9A 3NGLA 2CB0A 2ZGVA 4ZK2A 4WBNB 2W43A 1R37A 2WR8A 3ESDA 3KV3O 2ZKLA 4R5HA 4B4WA 1TDJA 5KTKA 2JLWA 2VF4X 3A4VA 1QK4A 3BBLA 3NIFB 1UM8A 4YIHA 1E2PA 4U8GA 3SXUB 1P9RA 1EM6A 1QFJA 4ROSA 2ZRCA 1N0VC 2OE2A 3IDZA 3R41A 4LDQA 3RTEA 3K1TA 1U9YA 3AZQA 5TMBA 1FTQA 1M72A 3HA5A 4O2RA 5J5VA 3D0OA 5J2TA 4TL7A 4YACA 5FOWA 3GEEA 3VC3A 3E9DA 1XNJA 4J7UA 3DO6A 3AVPA 4M9XA 3LO8A 2CMHA 3FFAA 4DLZA 5ALLA 4H4EA 5CP8A 1SHUX 2B4QA 3BDAA 1D2HA 7MDHA 1SBHA 2PGJA 3ZW8A 5JZMA 1F06A 4F2GA 3F7MA 4GBED 2FI1A 3K2IA 4JZYA 4N03A 3KUXA 4GX1A 2PL3A 5LNK6 1U5CA 2H18A 4TZTA 4U2EA 2YS6A 1W6RA 1SUSA 3LYUA 5EA2A 5U4QA 3SP1A 4WEOA 4ARAA 4KCGA 1R0WA 2R8BA 2ROQA 3DVSX 4QREA 1MN6A 4HX9A 2G9UA 1M7BA 3R44A 4C14A 5U9CA 2HOQA 1CR1A 3WOHA 3AF2A 3O4GA 1ZA2A 4L27A 1TK3A 5C81A 2C9YA 2CUKA 4IDBA 4N7RA 1LVGA 1FMLA 5EJFA 1W4BA 3CVWA 2WU8A 5HZGA 1FDRA 4XZ3A 3QYFA 2DHQA 4IV8A 3Q9NA 4CGZA 5CX1B 4MVJG 1G8MA 1SUCA 3A8TA 1O7JA 2JLUA 3E0XA 4AS2A 1D0IA 1GTMA 2O3QA 4O4JF 2Q2OA 1JIVA 3OIVA 4KYUA 2BVNA 5C34B 2GWHA 3I1JA 2A1TR 4IDAA 4IDEA 2X77A 3D43A 3S2YA 1PEAA 3WKEA 2QOEA 1FX1A 1FYVA 2C0CA 2QMOA 1ACMA 1R0SA 3GLUA 3UYKA 3W5DA 1N4AA 1FFAA 3ITDA 3TKLA 1M0EA 3GCWA 4W8OA 1Q77A 1B6TA 3T7CA 1GFWA 1U1GA 1WDLA 2GBCA 5BYKA 3BDVA 2KBEA 2OG1A 3L2OB 5FLXA 2FSGA 5AFSA 1SCUB 5B3JA 2B36A 1JT9A 3I12A 5CJPA 5LZ4A 2HCFA 3KQTA 3VBCA 3W06A 3CWZA 2VBFA 4JT2A 1WZUA 2JLBA 2GJKA 4RVDA 5DLYA 4ZT5A 2C98A 4F6LA 5C4IA 2GEBA 4PZZA 2C00A 5CB6A 2E87A 2ZSEA 3FAKA 1XEXA 2VSYA 4FKMA 2REQB 3GUYA 1LA2A 2Q9BA 1SEPA 2QXUA 5BWBA 1A2QA 4QG3A 2VPWA 1CCWA 5M34A 4P2BA 3QEBZ 4FZ5A 4N54A 1R4NA 1PHRA 4S24A 3PUKA 3ERCA 1Q3KA 3HXMA 4EUKA 4DV3B 2HEGA 3IJEB 4HH4A 3H6KA 4X3PA 2A5LA 2QG6A 4LJ9A 3REQA 3FVQA 3VJMA 5LP6A 4G3XA 4ZO8A 2RGWA 1EDDA 3L0PA 5ELLA 3F46A 4GX0A 3SMVA 2PN1A 3PJDA 3FKSA 3LUKA 4PLVA 3CMMA 4PWYA 4RU1A 1S01A 3CH5A 4G9BA 1X7XA 4Q5IA 4OHXA 1V6AA 3AI3A 1KYTA 3NHSA 2WIAA 1D4ZA 5BUZA 1U1IA 2X1VA 3K9GA 1DTWB 1KKUA 1JHUA 4UHCA 4BTLA 1EFVA 1LNZA 3OHMA 1X92A 5ERGB 4UDXX 1N3BA 3RV3A 4QOFA 2QT1A 1V47A 1NR7A 1A5AB 5BN1A 3S55A 3OTHA 3EW7A 3G5LA 5F23A 1R27A 1R10A 4BWYA 1LPAB 4L0QA 3AESA 2ZRNA 1GRVA 1JA1A 3G0GA 1QKKA 4KXUA 2OHVA 1XT6A 3O2NA 4MR9A 3VOAA 3DEHA 1JEDA 4Z8YA 2HT6A 4XJXA 1W73A 1ZIDA 1HQDA 3CRW1 3LLVA 3TQRA 4AWXA 1M67A 1QIDA 4FHDA 3URMA 4LX0A 3SS8A 2YIVX 1HQYE 1IPFA 3WK7A 1Z5GA 2D1YA 3INRA 5FNZA 3TUZC 1YOBA 4ZJUA 4MINA 2CL6X 1EFLA 3OCCA 3P32A 1SRQA 2FCAA 3NRBA 1PJCA 3EB9A 4DAOA 1I8TA 3NWOA 4AMVA 3ZIAD 1FRZA 3MHPA 4IIYA 2KS6A 1P62B 2AR7A 1GHTA 4B80A 2I66A 3MWKA 4DUPA 1KI6B 1TUBB 3NEJA 1JEOA 4KLAA 1LU9A 2D54A 3L4JA 3KQUA 5EZ6B 2H9YA 3PEYA 2QJRA 1DDOA 1XEFA 3T9AA 1Z4IA 5C51B 1QRTA 1U8XX 4BP3A 4RYLA 1W36B 1G6Q1 3GLFB 3FYCA 1A82A 2F6RA 4BTVA 5JSFA 3LGXA 3IEMA 1Y7IA 2H1OA 2P9ZA 1GJRA 2W2LD 3VQTA 2VP2A 3FWHA 1ADJA 1ID1A 4TL8A 3VU8A 3N2KB 4MMZB 4RF3A 5F51A 1SA0B 5KYUB 4MUHA 3KSBC 1T24A 2J41A 1L4LA 1Q84A 1SVIA 2O06A 4TYMA 1UOEA 4URYR 1T0IA 3W2TA 4BVKA 1Z4NA 2C5LA 2AKYA 4M54A 2O05A 1Y1LA 2OGZA 3JQPA 3WGTA 1GPYA 6ADHA 3FWPA 2F4NA 3CX3A 2Q2QA 4HKTA 1Y81A 4WKGA 1QIHA 4IH9A 1K5DA 3KTAB 3IR6A 2NZ8A 2WJIA 3M6LA 2ZAYA 4JJ6A 4P54A 4XRGA 5I7EA 4DUZB 4HQFA 2ZJ3A 3FB4A 2QTMA 4IMRA 2QLJA 3PGJA 3LYLA 4RIFA 3AJ9A 3LW7A 4ZGBA 3AERA 5K3SA 5KC9A 2CXOA 1RRMA 2HA6A 4LJ6A 1B16A 3HU1A 3A4YA 4WCFB 1U0BB 1JQ3A 2J46A 2O07A 3HWRA 2AL7A 1JKMA 4JT9A 4I50A 2YRWA 2J5RA 5ALRA 1HG0A 2Y67A 5IAJA 3VSBA 2X19A 3LUGA 4HS4A 4TROA 4NV0A 5C3MA 2EKQA 2YZMA 2BFCB 5ARDA 3UMGA 5DFAA 5I4KA 1UKBA 5K5EA 1ABBA 1GG2A 3G5UA 3VKHA 4MUXA 1X9HA 2Q6IA 4DBVO 3WBJA 1BW9A 3PXCX 4KRFA 2IEDA 4FHZA 5LQCA 2GD2A 1L4EA 3M6FA 2PUDA 3V8VA 4ESOA 1E9BA 1K97A 1D7AA 1E1KA 2OYRA 3VVCA 5DLDA 1USGA 1JLMA 1GZDA 2QN7A 1TMKA 2QR2A 1NVXQ 1PTJC 2X3FA 4H1VA 2DGDA 4FNAA 3QVWA 1RFLA 1ZMBA 3MTIA 1UC5B 3OKCA 1U80A 1YA6A 3MSCA 1N2HA 2PZEA 3T5CA 4Z7JA 5IT4A 2D5BA 3JQDA 2XNKA 2VS1A 2QZSA 3QLEA 1DJLA 2RK3A 1K88A 2A7QA 3ILVA 1BEUB 3Q88A 4FFBA 4INPA 4MA5A 5CITA 4PO9A 1IAVA 2ZIEA 3M5WA 1N8KA 3DCNA 4CMJA 8ATCA 3HVHA 4ZALA 4E2ZA 2WPDD 2OFWA 3TEJA 1HOXA 5HEKA 4ADSG 1YDGA 2OZEA 2ZYGA 1VKJA 3K6KA 4B82A 2OGTA 3LX5A 1XJ0A 1EFTA 5TPWB 4ZI5A 1CSEE 4ARZA 3YASA 4FONA 1HMPA 2PKWA 2XR1A 3MN1A 4H60A 2NU8B 1JLKA 3VU1A 1HC7A 4INAA 4IZHA 3HPRA 4CZ2A 5JZBA 2VYVA 3D5EA 3EVCA 3B36A 4BP1A 1PYGA 2PGDA 3HI4A 2HWWA 2VP0A 2XZDA 2BKUA 2JH8A 3F6YA 3IQEA 4QBKA 3EHEA 3LECA 2XUJA 4LRSB 1RZVA 1DEOA 2ZAGA 1C30A 1C8KA 1KY5A 3C3CA 3F96A 4MQFB 1INLA 2V3WA 1Q0LA 2RIPA 1FTYA 4XCVA 5TNXA 1O5OA 1PYDA 2NW6A 1O4VA 1KO5A 1J4AA 1SXJD 3V55A 5HBRA 4ZCRA 2BE7A 2FSHA 3JARA 4AQYB 3FUCA 3QF4A 3MCTA 3B3AA 2KJQA 3PGLA 5EYPB 3ONVA 4YDRA 3TLMA 1PD0A 2AMVA 3GMSA 2EX1A 1XELA 4YRRA 5T8KC 5BN4A 2JCBA 4ZQCB 2DOKA 4UDYX 5HJ2A 1NRIA 1VG0B 1IXRC 1OAOA 4MUEA 4V0NA 4BLUA 3X0DA 1UC8A 1Y63A 1JBEA 1F0PA 2G9QA 3BQNB 4ZKDA 3QV1A 3WYDA 4AC9A 5B6IA 4CG0A 4EMBA 2GZHA 3CSSA 3ONFA 3W79A 3ZU4A 4RAQA 3F7NA 1T3HA 1XQVA 3RT7A 1KNQA 1UBHS 3IQXA 3RSFA 5ES4B 5FEMA 2CNNA 2QYTA 1U28A 3BEOA 1Q5PA 4D97A 3UJ7A 2PZMA 2G1JA 1M2EA 3MJSA 1P9WA 1R6DA 3BD7A 1IHYA 4PNZA 2YQZA 5AVKA 3OFNA 1W34A 3I3OA 1ATZA 4HQLA 5JLJA 4ZI7F 3SF8B 4O33A 1NVGA 5KOIA 5AKLA 3OF2A 5BSWA 1S3GA 1WF3A 3AHIA 2BI4A 3ZK8A 1VRVA 3ZV5A 5CAEA 1A9QA 2AHRA 5B7QA 3U0BA 1QQTA 5DYWA 1EE1A 2VAPA 2ZTSA 1L5QA 2FF5A 3CRRA 3ETHA 1OU0A 1NNLA 4M8LA 4QVGA 5HE9A 1ORDA 2TSYB 1GCGA 1KETA 2DFNA 5FBRB 5BW6B 3LY7A 2G1UA 3UJAA 1ZINA 5A7FA 2GB4A 3U3XA 3PIRA 1G4HA 4K3UA 4QLOA 2OCPA 3T54A 5FBQB 1F51E 1NRXA 2WHYA 4W1QA 5JAHA 2WFAA 3O3CA 4ARUA 1U2DC 2R00C 4K1XA 4B2IA 2Q6KA 4TMVA 2RHRA 2XRYA 1W0CA 3GGGA 4IXWA 1QG4A 2RD2A 1M1XB 3N2ZB 1GY8A 3V8QA 1KI3A 2LE0A 3N2YA 1QPZA 2YMMA 4GP9A 1Q3TA 1N9GB 3ZBPA 3BWVA 2V65A 3HFSA 4QFBA 2Z58A 1GA6A 1Q6ZA 3V4ZA 1M34E 4KXYA 4QUDA 3FYTA 3DEIA 1PCXA 2J3LA 3P2MA 2DPHA 3ZZNA 3EZXA 1BXGB 5KVSA 4J49A 2VJOA 5HR5A 3THXB 2XYPA 2GM9A 4Q7EA 3L7IA 4OI1A 4XX0B 3KWMA 2DZDA 4TS3A 1H6DA 4UJ3A 3QBJA 1LC3A 4ESEA 5IDXA 3RWMB 4L0DA 2HXYA 1ORVA 3PFHA 5B1EA 2JI9A 2QBYA 4MGEA 2I1QA 4RIGA 1BVRA 5GONB 1YUNA 2EKDA 2X3UA 4DXDA 4YJHA 2G1PA 1R5NA 2WAAA 5CD9A 3DEYX 4OHPA 2PNFA 2GLTA 3BDIA 3TH5A 3I53A 1AMOA 2GN1A 4KXVA 1U1FA 5KVQA 3GRAA 4CCYB 1NC1A 1OZHA 2QGZA 5JASA 3BD6A 2RFLA 3MUOA 3PWTA 1GPNA 2V7PA 4Z0PA 1IWPB 2BKEA 1FUYB 3GEBA 5L3RA 4XM2A 4BFCA 1WZIA 3K0AA 1OT5A 1X1BA 5EXXA 3R9KA 2XUGA 1UPTA 3FY4A 5AVQA 3OLZA 3W5JA 3NWJA 3OIYA 3PVZA 4HNSA 3BJRA 4WOPA 2UZ4A 1UBSB 3IPXA 2OGSA 2QPTA 1VKOA 1XSEA 3HACA 4LSZA 4Q21A 3X1MA 3ND7A 4C1NA 5CDGA 4Q24A 1ZLXA 1YE3A 4R8MA 1B4DA 5LM3A 1MEJA 4LZLA 5JXGA 4EFDA 3ZCQA 1XE3A 2OG2A 3I6ZA 3ZU6A 2O9JA 1R8QA 4DLKA 1WB9A 5JBIA 3ADBA 3M7IA 2QA5A 3BWYA 1ZL2A 3P9CA 4FHEA 4O2BB 2UZ3A 1QKJA 1QPGA 2CZGA 3KR1A 4FNOA 4KQ2A 5CDFA 4RABA 5AW9A 1IL0A 5LQJA 4X7MA 1K5HA 2ODPA 3IHKA 2A59A 4J90A 2B21A 1TGVA 1VHTA 2R6FA 3H9CA 3D3WB 4H0FA 4LQ4A 2XOKA 2XF8A 4P0TA 5FTMA 1YTUA 4N6OA 4ZYZA 4KWCA 2G76A 4H7HA 2EBHX 3U4GA 3C14C 3ZWBA 5FUYA 8ADHA 4JJKA 3FVRA 3SHWA 1IONA 2IXAA 5HDQA 4BEVA 5L4SA 4W9MC 4OAOA 3EXG1 4WKBA 3O8OA 3WQBA 2R9VA 3EVDA 5JSZB 3ZEAA 4Y0AA 3QBDA 3UB3A 4BUJA 3I5UA 3NATA 2O8BB 4L72A 3N05A 1T9DA 3MS2A 2BM0A 5DHPA 1DAIA 4R83A 5REQB 4OGFA 2D5CA 3MCWA 1L7MA 5D3KA 5JPDA 1ZU4A 1U7UA 3WHLA 1N36B 10MHA 4EH1A 2R4TA 3AG5A 5CGZA 5LUBA 4AZWA 2FMUA 4J4HA 4LBZA 4TWRA 1NQUA 1XDGA 4MWCA 1PIWA 3PQFA 1C4WA 3BMOB 1NI4B 3JQ8B 4HEQA 3SQMA 2VXYA 5B7GA 3HNOA 1T5IA 5JNSA 2GAAA 3RYFA 2EJBA 3CEAA 2MMCA 2NU9B 1N2XA 3IP8A 3MWDA 1QGED 3DF9A 2DYKA 1WOYA 3KLOA 5H68A 5E6SA 4OO3A 1NSFA 2G72A 4JXKA 1X7YB 1Q14A 2Z43A 3AL2A 4CM1A 1NX9A 5IWCA 1HRKA 1N6IA 1N0HA 1FDTA 1NSYA 2TRSB 2CEAA 5CCDA 1DX6A 1VPVA 1JJFA 2H51A 2PO5A 1E3WA 2VNJA 3CVJA 2AXEA 2Q0QA 5CLQA 5L3SA 2ZAOA 4WK0B 1DOHA 2I1VB 3OEHD 2QW0X 1QUFA 3ROGA 5FWDA 3HL0A 1KQGA 1KJQA 3AB8A 2GNAA 1VECA 5CM9C 3AM1A 2WILA 1R6AA 3EVTA 1AURA 1ML3A 3CNLA 3EGDA 5KYGA 1BWPA 2R25B 1CQIB 3SMQA 1T8UA 1PR0A 2MJLA 5LUAA 4GF5A 2OAP1 2V6FA 2I54A 4B0OA 1JL3A 2QZJA 5GADl 1DLIA 2CJWB 2I99A 3RYCA 3RJZA 3OZSA 3OPYA 4RH3A 2HEIA 2ATIA 4BN0A 3IKTA 3LXUX 4UU7A 5ESDA 3DFUA 5EJAA 4KAFA 4HI0E 3IIJA 3N7AA 5SY6A 5B1HA 1RYBA 1QWSA 3E48A 5FORA 1Q0ZA 5IYZF 3R7AA 3TL6A 1JWAB 1RM5A 5H70A 4HAOA 2CBXA 1DX4A 2GAOA 2DFTA 3PGKA 4I3FA 3TS1A 2ISCA 3OZAA 2A9KA 3QLVC 2QZ9A 4QU9A 1FLNA 4WASA 2UU9B 3WKAA 5K7SA 6REQB 4XWKA 4JASB 5FR1A 1SCDA 3HKEB 1LPMA 4NCJA 5G1PA 5KNDD 4ZTUB 2DE0X 2MYUA 2O0JA 2F8SA 5J9FA 4II2A 4IIJA 3GDFA 5EC8A 2G63A 2D7JA 1MA3A 3P2OA 2G1KA 4PAMA 5ED0A 2W48A 1EPUA 1YIAA 2FGKA 4HXFB 5A6SB 1SQGA 2PBRA 3TD2A 2GEKA 2V8OA 4MIOA 2QR3A 1C5KA 2X1HA 2PWYA 2ODEA 4EF6A 1J07A 1C41A 1M2FA 3BQ9A 3GZNB 1P74A 3PT9A 1WZEA 3U1BA 3DZCA 5IH7A 5AJHA 4FD3A 4BEJA 1T8RA 4J0QA 4ZVUA 4EJMA 2B99A 2G25A 4HVCA 2V7UA 3T9BA 3A32A 4B76A 1YMQA 4RY9A 5CDUA 4C43A 4QDJA 4PM4A 2WB2A 4GXRA 5TQ0B 2QUZA 4XUDA 1UWKA 4O3MA 3UHJA 1SCAA 3EBLA 3IHTA 2ID8A 2ZQ5A 4Y6RA 2K87A 3QBVA 2BKVA 1ZD1A 3BGDA 4KLZA 4EVSA 5D1NA 1UBTS 1E58A 3T4UA 1ADYA 3WYNA 3BN3A 1H4VB 3KAJA 1G4UR 2QVXX 2A35A 3GFGA 2GRJA 5DXAA 3Q8LA 2RGXA 3ACCA 3P2IA 5D3ZA 4PN7A 4PZPA 3O4VA 4D80A 1P7VA 1Z4QA 1J5PA 2PS3A 1QIJA 1G8GA 3KPVA 4FD2A 4NAVA 1ZRHA 5DWVA 1TKRA 1PAUA 2AXPA 3DDUA 3ICPA 5DE3A 4ZKEA 4R5MA 3RS3A 3L7LA 1CUIA 4X6YA 4KR3A 1WSDA 5JHHB 1KEEB 2WHPA 1QIFA 3FBTA 2LWIA 4CTKA 2ZSFA 5BVGA 1E60A 1KQPA 4MXDA 5H02A 5HKKA 1PZGA 5FH9A 3ESYA 2IOYA 1GCAA 5KNBD 4RFLA 3ZTYA 2VT3A 3C6KA 1MPXA 1TK9A 2FX5A 1CJTC 2JIQA 3OZXA 1HE8B 1KMNA 4QFDA 4M60A 4X20A 4IVPA 2R6GA 3UAZA 4K05A 2Q5CA 3KT8A 2EYQA 3F8SA 4PGGA 4BQFA 4YAUA 5IS2A 2NU7B 3MCAA 5JJIA 3GUZA 1L0BA 1L7OA 2HSJA 3BC1A 1VCNA 2Y2VA 2FG6C 3KYJB 4KLCA 3O4HA 5D3MA 2BL4A 3TK1A 4W5HA 5KDOA 1KGSA 4UXJA 3FDIA 5HJ7A 4CR7A 2H5LA 3PHCA 4Y2TA 1KO1A 4JC5A 1UBKS 4OH7A 1F4VA 1A04A 2YX1A 2GH1A 3CVUA 3WGMA 2YFQA 3HBFA 2Q8NA 3PQDA 2YVLA 3LP5A 1LBHA 2FW1A 4Q48A 4WN9A 4V0MA 5DMHA 3BH6A 4PS0A 4E1BA 3ILYA 3JPYA 1MDFA 1SOUA 2QF7A 1R4MA 4RTNA 2B8EA 2CNWA 5JD4A 5KU1A 1QHHB 2W2PA 2PAFA 1MO2A 2FDXA 2QG9A 2H07A 2AK2A 2Z6VA 1RHJA 2FMKA 3LF1A 3Q98A 1EWQA 4M22A 2VAWA 4ICIA 2AT1A 2BR4A 4WK2B 2BOVA 5JC1A 3O8CA 4JY7A 1W1WA 1PGJA 1R12A 2C2HA 2ISSD 2X0KA 3DEFA 3RGGA 4ND8B 1NXSA 1KE1A 2D1SA 2P35A 2R6DA 1A9TA 2CJPA 4Y2JA 1NLZA 4MB2A 3KLPX 2JZCA 4WBSA 1QTRA 2PFSA 2IX9A 1JFRA 4B0PA 3KXPA 3TRFA 2WC1A 3PC2A 1ZICA 3DOHA 5JI3E 1PX0A 4XARA 4MYHA 1P7YA 1QZTA 1WAMA 4L15A 1L8AA 1RYYA 4KO8A 3T15A 4BZPA 1P1CA 3LHIA 1RNLA 1GN9A 4GZMA 3PS9A 3FH0A 2JFHA 3RQIA 3J7AC 1JJBA 3UA3A 3W78A 3RHSA 3WWEA 1SHZA 2GO7A 4K6HA 5ITZA 4L76A 2JS7A 3DLPX 4JSYA 4D5EA 1XDWA 5TIIA 3TJZA 1Z0IA 4F9TA 1NJ2A 3A6FA 5CDTA 2ODBA 3KUDA 4N9QA 3FXAA 5DSXA 3SZUA 3LQFA 3KEOA 4FFVA 5F77A 1JHQA 1YJQA 2F3PA 5J63A 5BPFA 5BW5A 2AZDA 5EJGA 5KTMA 3BXZA 4D6YA 2OAEA 3A0UA 3B8EA 3O8QB 4B47A 1QRSA 4OHYA 1C50A 2G06A 3PHIA 1GFSA 4GPEA 2C31A 4WLNA 2PWPA 1NOJA 2JVIA 4JJFA 1ZH6A 4HUTA 3VO8A 4JBGA 1NW8A 4JENA 4NBTA 3BJEA 1ONNA 4LZJA 1RI4A 4U9HS 1E2DA 4QSHA 2O57A 5BUSA 3B9RA 4B3RB 3Q3HA 4FIZA 4RZHA 3E9EA 4Z8XA 4YUWA 2P8JA 3ZLJA 1GQ2A 1ZNXA 3NHLA 3HMKA 5C5IA 5HIKA 2QK4A 4Z9YA 1BROA 1T3LA 2IF2A 2XUOA 2XUIA 3L79A 4PGFA 4MV8A 4B9EA 1DQRA 3HTXA 4JLVA 3Q2IA 2QAGA 4R9VA 2ECKA 3UWSA 5JDIA 3CPJB 1ZSYA 2VRBA 1FY2A 1OXKB 3ENWA 4FSHA 4OMDA 3NTLA 3H9UA 1XTSA 4EG7A 3FWNA 2VTBA 3Q9UA 1FFSA 4OOEA 4JBXA 2E18A 4GKVA 1FP6A 3SFVA 1U8CB 1K75A 2FPPA 2QTVB 1CQPA 2YHSA 4DV2B 4CLOA 3ZY2A 3CKMA 5COBA 3TD9A 4CIYA 2D00A 3PL5A 2HSEA 3JQEA 4PQFA 1ZR2A 2P79A 1B14A 4K1LA 3L7AA 4WOKA 2XE4A 1T9KA 4I5EA 5HDBB 3FRHA 1F1BA 4M76B 4CI0B 3HB4X 1ST2A 1W9MA 5CEJA 2ILTA 4O3FA 3BULA 5EERA 4CLDA 1G3QA 4GSYA 3EOBI 1YIDA 3CZMA 4UAGA 4KX5A 3P0EA 2P78A 1W75A 5BMVB 1FXWA 4LXHA 3Q1KA 4IWYA 2WJGA 4PQRA 4BO4A 3AF0A 3HYNA 2RHGB 1E2JA 5M04A 1T2AA 5EAIA 4D3SA 3DV0A 2Q3DA 3GJ8A 3MQ4A 4ZREA 5FHRA 3UK2A 5BN5B 4TTPA 5LP6C 3LBAA 3OAAD 1Z5UA 4MWSA 2G4VA 4ID3A 3UQYS 2BGUA 1YAHA 1JG1A 2ZYWX 1E8NA 3HB7A 1JDUA 1OX4B 1KJYA 2FEAA 3C3AA 3T5MA 2FZKA 4E51A 5IDQA 3HK2A 1JUDA 2JF0A 3OA2A 4L6IA 5AHKA 2P3LA 2Z5FA 3IOYA 3IXMA 1V4BA 2XGOA 2XMPA 3UH0A 2EL9A 3DULA 3EVAA 2EW8A 1C29B 1LF5A 1OLUB 2O0KA 3CF6R 3E8XA 4JSRA 4YRJA 2C2BA 1FFWA 4GPAA 3COVA 4RM2A 3BRQA 2CMFA 1JSXA 1P7PA 4TMYA 3HDVA 4TXMA 1UBMS 5T67A 4DR6B 2V7QD 5E2AA 3GH1A 5DN6A 3BRSA 4MIKA 4EHDA 2E48A 3SICE 4H15A 4DJAA 3X1WA 2G8NA 2BY4A 4ZZ1A 5B4VA 1DWPA 3OPXA 4J4TA 4YO8A 1C7QA 4E07A 3A10A 3AKCA 3FETA 4YAKA 3LM8A 3V32A 1DC5A 2HO4A 3L8ZA 2OR3A 5I9BA 4QODA 4UNRA 4P7BA 1WPGA 1SUFA 3UM9A 3GVCA 3S8EA 4GZ6A 4ZANA 1S8FA 3FOZA 2RKOA 2EF1A 1K7XB 3SZMA 5ALFA 4D9MA 2RGEA 1KZ9A 1JR3A 2A88A 2AEFA 2ISQA 3JRNA 2QRUA 3KEQA 4B3IA 3TFQA 3U9SA 3DVAB 3OOJA 1CHDA 2GBGA 3IALA 4HQ6A