5KRSA

Hiv-1 integrase catalytic core domain in complex with an allosteric inhibitor, 3-(1h-pyrrol-1-yl)-2-thiophenecarboxylic acid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
146
Chain Sequence
DSSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNPGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Allosteric HIV-1 Integrase Inhibitors Identified by Crystallographic Fragment Screening of the Catalytic Core Domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase, transferase/inhibitor
total genus 49
structure length 146
sequence length 153
ec nomenclature
pdb deposition date 2016-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5krsA00
5DK5A 5C42A 3VQ9A 2G8IA 1S9EA 4B08A 4DFKA 4YNQA 2ATQA 3AO5A 1TKDA 3K57A 1BQNA 3CFRA 1JLQA 3SJJA 4R5PA 3CG7A 4Y1CA 3DOKA 4CHOA 2Y1JA 4ZTJA 1HYZA 4QOZB 3BGRA 3M8QA 4FZYA 1C0MA 2ETJA 4DTNA 3OJSA 3QNNA 3OYKA 2F8SA 1TVRA 3NBPA 1XC9A 1C1AA 3V9UA 3NHGA 2DFFA 4GVMA 3P83D 3KK1A 2O4GA 1SL0A 3KLHA 4FJ8A 4O0IA 1Z26A 1U04A 1W0HA 4N47A 4QCLA 3NH2A 3SUNA 4DF4A 1N6QA 2B5JA 3ZSRA 2PZSA 2PY5A 2R7YA 4JS4A 2XRIA 3U6FA 3HO1A 2XO7A 3KK3A 3ZSOA 1WNSA 1I3AA 3PO4A 1J9AA 4IKFA 3AO3A 1KLMA 1HQEA 2JLEA 4DSFA 4KO0A 1NOYA 4O44A 4CFCA 3OS0A 3AA2A 3M8SA 3HXMA 3LAKA 3NDKA 1O1WA 3AVAA 3HPHA 3MECA 3ISNC 3LAMA 3WNEA 3SQ1A 1ITGA 1S1TA 1T8EA 4J2BA 4J2EA 2VG7A 1Q8IA 3MAQA 1VSEA 1IKVA 4DSLA 1ASUA 1SKWA 2LSNA 3DOLA 3RRHA 4CEAA 4CGFA 1D9DA 4Z4FA 1ZBHA 1RILA 5HBMA 4Q5VA 3OY9A 4E89A 4RW6A 1LWCA 3VA3A 4DTJA 1KVBA 3OYNA 1BHLA 2YKMA 4E7LA 3T3FA 1WN7A 3MXMA 1CLQA 2IGIA 4I9LA 1XHXA 4DS4A 2A1RA 1WSJA 5HLFA 5C24A 2XY8A 4PQUA 4CHYA 4C8MA 4B8CA 5KGWA 3SNNA 1D8YA 3K5OA 3HP6A 3PX0A 2ZQBA 3LPTA 4OKJA 2PYJA 2HW3A 3OYMA 1VSMA 5HROA 5I42A 3V1RA 2D0AA 3LALA 3LWMA 3QNOA 3HP9A 1T7PA 1VSDA 4HVJA 1FXXA 4IBNA 1TK8A 4Z4GA 2BANA 1C1BA 4CK3A 1S5JA 3QLHA 4C8NA 1RT4A 1C1CA 1JXBA 1RBRA 4AHUA 4CJWA 1JXEA 1B9FA 4CFDA 1VK0A 1RT1A 1LV5A 4W5RA 4HCBA 5KRTA 1KTQA 4KHUA 1RT7A 1RT5A 4FJJA 4FJNA 3VQEA 3QEVA 4M3ZA 3B6OA 4FK2A 4CK1A 4CF1A 1S1WA 5J2PA 2RF2A 4DTRA 4M3RA 1BCMA 4QAGA 3I8DA 2OZSA 1EETA 4FCYA 3L3VA 3ZSYA 1WSGA 4B8AB 3QEPA 3C6TA 1RTDA 2OPSA 1L5UA 4M3TA 4FYDA 1T03A 4DFPA 1TL3A 3KLFA 4I2QA 2VG6A 4RW8A 4CEDA 4CF8A 2KFZA 5C25A 4XIUA 4BE2A 4FLWA 3SV3A 3QEXA 1UA1A 4OKEA 2YNHA 4CHPA 4KHSA 3PO5A 1C0UA 1FKPA 4O55A 1LWEA 4GMJB 3T19A 4HHTA 4DTXA 3A2FA 3HVTA 2FBVA 1NK4A 2IC3A 1BL3A 1DTQA 3U3YA 4LD0A 4RG8A 3OYLA 2GUIA 3QINA 3SUPA 1IKXA 4F4KA 4FK4A 4DSKA 3ZSWA 1JLAA 4PWDA 1T05A 3AVGA 1ASWA 2XY5A 1LAVA 1NK0A 4H4MA 1MU2A 3PUFA 4ZTFA 4DS5A 3V81A 4Z4CA 4PA1A 1D5AA 3VQ6A 3LZJA 1YTAA 4DTUA 3OJUA 4ELTA 1UA0A 4DSIA 4E1NA 3JYTA 4KI4A 1QSYA 4B9NA 3KKSA 4JS5A 1HYSA 3U3GA 2XY6A 1HJRA 1RCHA 3EY1A 4GW6A 3SQ0A 3RWUA 5HRNA 1IH7A 3CYMA 2XHBA 2HHVA 3SPZA 1C0TA 1TAQA 1NKEA 3EZ5A 4HTUA 1SL1A 4FZXC 2E6MA 4FLUA 4BACA 4FJLA 2P5OA 3S3NA 2JGUA 3AVIA 2FBTA 2NUBA 4LSNA 4CJ3A 4CEEA 4O4GA 1VRTA 1KFDA 3P5JA 4BWJA 3OYCA 1TKXA 3NCIA 3SQ2A 5T7BA 1NK9A 1KFSA 4HCCA 4E1MA 4DU1A 3I0RA 4W5OA 4FK0A 4KHWA 1F21A 3NGIA 4CCHA 1JLFA 4OPJA 2G8WA 2OZMA 4FLYA 4CJLA 3K2PA 4DU3A 5J2MA 5JS2A 4KKOA 5HRSA 5DMRA 3V9ZA 4ELVA 4M3WA 3F9KA 3RTVA 3NH1A 4FJMA 3SZ2A 1BI4A 1CXQA 4DFJA 3SQ4A 5FRNA 4KB0A 4FJGA 3SPYA 4CJPA 4CE9A 5FDLA 1S6PA 4IFYA 4FXDA 1SUQA 4LH5A 1J5OA 1RDBA 1UAXA 2GBZA 1TV6A 1RDDA 3FFIA 1U45A 4PY5A 1LAWA 2HNYA 3OYBA 3K58A 2P51A 3LP3A 4B9UA 1B9DA 1VSLA 1VSKA 4B9LA 3S3OA 1CZ9A 1J53A 2QK9A 1HRHA 2F8TA 2YNIA 2YV0X 4CJSA 3RMAA 5CYMA 4KTWA 1LW0A 4OJRA 4CHQA 4CJUA 2D0BA 3VQQA 1RBTA 3HPOA 1KSPA 3QEWA 4LH4A 3B6PA 3AA3A 1ZBUA 3VQDA 4FW1A 4NCGA 4CF9A 4EP5A 1NK5A 3NAEA 3LP0A 5FRMA 1EXQA 2IOCA 3LPUA 3SCXA 4DSJA 4KV8A 1WLJA 4E19A 1KLNA 4AHSA 4FZZA 3KLIA 4JRPA 4OGEA 3DLEA 4CHNA 1WSIA 3G10A 2A1SA 1RBVA 4E3SA 1DTTA 1TKTA 3AVJA 3OYDA 3QEIA 1ZBFA 3HT3A 1YVUA 3DRRA 3L3UA 4M41A 3TAEA 4EZ9A 4AHTA 1BISA 1ASVA 3WNHA 1JLCA 4N41A 2HHTA 2G8FA 3IAYA 2I5JA 4JRQA 3QIOA 3HPGA 4CJFA 4CEZA 2VWKA 3L2QA 3I0SA 1U47A 1B92A 1EX4A 1VSIA 4H4OA 3ZSXA 4FM0A 2E6LA 4PUOA 4JLHA 3SYZA 1QSSA 3IS9A 4O5BA 4KB1A 3KIOA 4FLTA 3TAMA 2P1JA 1RBUA 4M45A 4AH9A 1BQMA 2O4IA 3OS2A 4CIGA 3O4QA 4LY7A 3OVNA 1ZBLA 2Y1IA 2HHXA 3AVKA 1EP4A 4C8OA 4M3UA 2FC0A 1HPZA 4W5NA 5CY4A 3O3HA 1VRUA 2BE2A 5CZ1A 3KLGA 3SI6A 1HMVA 3CFOA 1BGXT 1X9SA 2FBXA 4CESA 4CGGA 3K59A 5J2NA 3TI0A 2YNGA 1A5WA 3NE6A 3ULDA 1KVCA 1FK9A 4DFMA 3WNFA 1Q9YA 2G8UA 1JLGA 5FROA 4F3OA 1QHTA 3ZCMA 4CF2A 2YNFA 3DYAA 4CEQA 4FLXA 1G15A 4LSLA 5KI6A 5HRPA 1ZYQA 3DI6A 1N5YA 4M42A 3K5MA 4KTQA 1REVA 3RMDA 4CFAA 3TAPA 4KTZA 3S3MA 4TSXA 1NK8A 1NKCA 4B9TA 4C8KA 2KQ2A 5CYQA 4KFBA 4KPYA 1HQUA 2HHWA 3MXJA 5SZTA 3LP2A 1BI4B 1JKHA 1R0AA 2DTUA 4CK2A 3AO4A 4DG1A 1I39A 1X9MA 5KTQA 1SKRA 4OLBA 2DY4A 1BCOA 2Z1JA 4AHRA 3TWHA 5JS1A 4DTSA 4IG3A 3OYAA 3OYEA 1L3SA 4DTOA 4OGCA 1RDCA 4FLZA 4EZ6A 2P5GA 2Z1IA 3ASMA 1QQCA 2G8KA 3QIPA 4O0JA 1JL2A 4FJIA 1RTHA 2W42A 3F73A 3ZT3A 3L8BA 4DTPA 5HP1A 3DLGA 4E7HA 2EHGA 1KRPA 1TK0A 3V9SA 4DQSA 4DF8A 4DLGA 2FBYA 2AJQA 2GV9A 4BDYA 3QO9A 4NCAA 2HNZA 3EYZA 1XWLA 5KRSA 4CJEA 1IG9A 3ZT2A 3QERA 3VQBA 3VA0A 3VQAA 3TAQA 3L2UA 3IRXA 3TAFA 1JL1A 3TANA 1TKZA 4KHNA 2BGGA 3O3GA 1RBSA 4BE0A 4OLAA 1RTIA 4CEOA 3VQPA 1CZBA 1DLOA 4DQQA 3SUOA 3TR8A 3TAGA 2D5RA 2QKKA 4N5SA 4BWMA 1NKBA 2X6SA 2PYLA 2KZMA 3VQ4A 3DMJA 1XI1A 3P1GA 4FJHA 3TARA 4K8XA 3HK2A 4L8RB 4W5TA 1K6YA 1S1UA 3M8PA 4ELUA 1NJZA 2OPPA 1QSLA 4E0DA 4CJ4A 5KGXA 3MEEA 4Z4HA 1SKSA 4E7KA 4B9SA 2HNDA 4CEBA 3THVA 1U49A 3RMCA 3QETA 1A5XA 3L2RA 5J1EA 4M3YA 4FW2A 1QS4A 2X6NA 3AVMA 1WSFA 3T1AA 3LP1A 3LWLA 4CEFA 4CGDA 4F3TA 4B3OA 2XY7A 1L3UA 3PX6A 2HB5A 1RTJA 4J2DA 1GOCA 3L2VA 4HUFA 3D0PA 2VG5A 3ZSZA 3LANA 3WNGA 1A5VA 2E4LA 3OYGA 4BE1A 4CHZA 2HHUA 3AO2A 3KD5E 4ICLA 3VQ7A 1TAUA 3MEDA 3AO1A 1QTMA 1L3VA 3OYIA 4OPKA 3M8RA 1X9WA 1JLEA 3DLKA 1VSFA 3NF7A 1JLBA 4ID1A 4E7JA 1NJWA 3VN5A 3AA4A 5J2QA 3O3FA 5I3UA 4J2AA 4H8KA 3DM2A 3RRGA 1ZBIA 5HRRA 1YTUA 2YKNA 2HVHA 2IS3A 1RT2A 3G0ZA 4B9VA 4KAZA 1KVAA 3CM6A 4IG0A 2DFEA 1SV5A 1FKOA 3SV4A 4FM1A 3SUQA 3C95A 3RMBA 3V1QA 4FJ5A 3C94A 2OYQA 3VQ5A 3AVNA 3AVHA 3DRSA 3VQ8A 4Z0UA 4N76A 4BDPA 2ZE2A 4CJTA 3K5NA 3HM9A 1GOBA 4Y1DA 4F2SA 3K5LA 1IKYA 1HYVA 3KLEA 3QESA 3TABA 3HL8A 4EP4A 4E7IA 1VSHA 4CGIA 3AVFA 2EX3A 3NH0A 3CQ8A 1L3TA 4C8LA 4KI6A 4I2PA 5CZ2A 4AHVA 4CF0A 3AA5X 3JSMA 1NK6A 2OA8A 2B6AA 1SL2A 2X74A 1Q9XA 4B9MA 3VQCA 2HVIA 3ITHA 2WONA 4MQ3A 1U4BA 3HJFA 4I9QA 4KHQA 2HHQA 1LW2A 2HHSA 4RW9A 3AVBA 4KREA 1NJXA 4CFBA 3AVLA 2RKIA 1LWFA 2YHAA 2Z1HA 1TK5A 1Y97A 2B4JA 2YHBA 4ID5A 4IFVA 3BDPA 1GOAA 3DLHA 4DU4A 2RN2A 3ZT0A 1RDAA 3PY8A 3NGZA 1IO2A 1RT6A 3NF6A 4KHYA 4F2RA 3PX4A 4AILC 1HNIA 1UOCA 4W5QA 4DQIA 1BIUA 4DMNA 4DTMA 1NK7A 1RT3A 4UQGA 3V6DA 3ZT1A 4G1QA 3NGYA 1EKEA 1D9FA 3L2WA 3RR7A 1WAFA 3ALYA 4DSEA 1X1PA 3RR8A 4BDZA 5EU7A 3ZT4A 1S6QA 3OS1A 1U48A 3UIQA 3ZSVA 4YFUA 4DWIA 4CJRA 2G8HA 3OYFA 4FJXA 4FVMA 3DLRA 1KCFA 2ZD1A 1WSHA 1S1VA 2HMIA 1J54A 2Q3SA 2KFNA 4HUGA 4ZHRA 4K8ZA 4Q0BA 1TL1A 4CIEA 4DQRA 3V4IA 2ITGA 1W9HA 3NF8A 4FLVA 1IKWA 4DQPA 3O4NA 3KJVA 1CXUA 3KTQA 3DRPA 2QKBA 5K14A 4CECA 3V9XA 4CGHA 3KD1E 2OPQA 4M3XA 3CM5A 3E01A 1NOZA 3H08A 4WE1A 1RNHA 4HUEA 3AVCA 1NJYA 4OKKA 3OYHA 3AV9A 2IDOA 1UWBA 4I7FA 3MEGA 2X78A 2RPIA 4DLEA 2G8VA 3V1OA 3C6UA 3IG1A 2WOMA 2Z1GA 4OVLA 3ZSQA 3D45A 4CJQA 3LDSA 2DFHA 4FJ7A 2QXFA 3NFAA 3HVRA 1XHZA 4N56A 2BDPA 1C6VA 2F96A 2VWJA 4MFBA 1VSJA 1WSEA 3HSTB 2KW4A 4NYNA 4CJVA 3V9WA 4RW4A 5SWMA 3S9HA 4Z4IA 3KKRA 4CGJA 3LZIA 5D3GA 4RW7A 2KTQA 4NCBA 4CJ5A 4KRFA 3MXIA 3CFPA 4FM2A 3NF9A 2OPRA 3HYFA 1YT3A 4IDKA 4CIFA 4Z4EA 1WAJA 4F8RA 4FJ9A 3DLBA 1QE1A 1Z25A 4NYFA 4FJKA 1HNVA 4CERA 3PV8A 2IAJA 1TGOA 2D0CA 1S1XA 1S9GA 4CJKA 3KK2A 5E41A 2KZZA 1BIZA 4AHCA 3OYJA
chains in the Genus database with same CATH superfamily
2O8DA 2YHWA 1TKDA 3K57A 4FVUA 3CFRA 3HM8A 3SJJA 4JI6K 2CGJA 4QOZB 3BGRA 3CCRN 3OJSA 2V7YA 1VQMN 2E8AA 3OBYA 5BPMA 1VQ5N 3V9UA 3NHGA 3FE1A 4O0IA 1Z26A 2E2NA 4JS4A 2XRIA 1SZ2A 3U6FA 3HO1A 4NB4A 4ILGB 1WNSA 1I3AA 5LMNK 3CD6N 5EOYA 4BG8A 4GV6A 4IKFA 4CFCA 4O8UA 3AA2A 3HXMA 3LAKA 3HPHA 4J2EA 1T8EA 4H5WA 3G25A 4JI8K 1ZBHA 1T6DA 1GLFO 1BHLA 4E7LA 3T3FA 2A5XA 2IVPA 1WSJA 3BZKA 4AM7A 2FF3B 3LDLA 3HP6A 3LDOA 3PX0A 2HW3A 2WC9A 5F0XA 3ATVA 1VSMA 2PYJA 4BVOA 1HPMA 3QNOA 1T7PA 4H03B 4CK3A 4C8NA 1RT4A 4CJWA 1LV5A 1E4FT 5HL7L 5BN8A 1YVNA 1QQOA 1KTQA 2ZF5O 5KRTA 1RT5A 3KZBA 4M3ZA 4FK2A 4JI3K 1NLVA 1KD1O 4DTRA 4M3RA 1NM1A 1YXQA 3ZX3A 2OZSA 3VTHA 1EETA 1VQLN 3FZKA 3ZSYA 4H0VB 3C6TA 1TL3A 1Y64A 5BN9A 1M1KO 4YOTA 4CBWA 1VQKN 4XIUA 4MLHA 4WQ5C 2GWJA 3PO5A 3AAQA 1NK4A 1NGIA 3ZETB 4F4KA 1YUWA 5AQSA 3KK7A 1JLAA 4PWDA 5CHIA 2QEXN 4H4MA 3AY9A 3THWB 4FO0A 4DS5A 4Z4CA 1SQKA 3VQ6A 1DEJA 3KVGA 1GLLO 3OJUA 2NRRA 1GLEG 3CCUN 1S22A 3PIOL 5AQWA 4B9NA 1VHXA 3QFPA 2D0OA 4GW6A 3RWUA 5HRNA 3CYMA 3SPZA 4HTUA 4FL9A 4FLUA 5AQXA 2JGUA 4CJ3A 4FPBA 4CEEA 1KFSA 4AM6A 1TKXA 2P9NB 1NK9A 4IEEA 2Q0RA 3I0RA 4KHWA 1JLFA 2OZMA 3R8EA 3E9PA 3VENA 1EWQA 4DU3A 5JS2A 4FWNA 4KKOA 5DMRA 4XH4A 4FJMA 4DFJA 3VOVA 3SPYA 3EO3A 4CE9A 4GVEA 1OKJA 4LFAK 4LFBK 4LH5A 1J5OA 1XUPO 3KHYA 3QICA 1LAWA 3K58A 2P51A 4B1VA 4JKAA 3TU5A 4CBUA 4JHDB 4GKJK 2QK9A 1HRHA 2F8TA 3THWA 4CD1A 3C6AA 3RMAA 4IDHA 4CJUA 2P9KA 2Q97A 3EE9A 4FW1A 4NCGA 4EP5A 5KPTA 5FRMA 1YHQN 4DSJA 4A2AA 4KV8A 2Q2RA 1KLNA 4AHSA 3HBTA 1K73O 1TKTA 3AVJA 3CQXA 3OYDA 3HT3A 3L3UA 3L4IA 3IAYA 4MO4A 4CZEA 4I6MA 2QM1A 4WFAL 3ID8A 4FOEA 3WEEA 1U47A 4JI4K 1B92A 1EX4A 1TYQB 4H4OA 3MWTA 4PUOA 2BUPA 3VF4A 1RDUA 1RBUA 4AH9A 1BQMA 2HF3A 4CZJA 4CIGA 3OS2A 1HKBA 2Y1IA 1NGJA 3AVKA 2HF4A 1TUYA 3O3HA 2QWNA 3CFOA 1BGXT 3ENBA 3O5BA 4CESA 3K59A 5J2NA 3TI0A 3NE6A 1KVCA 1FK9A 4JHDA 2G8UA 4F3OA 4H0YB 3DYAA 4CEQA 4LSLA 3Q7BA 3DI6A 5F2RA 1N5YA 4CFAA 3PIPL 1Z05A 4EIAA 3A5MC 4C8KA 5M1QA 2QTDA 2KQ2A 5CYQA 1WUAA 4LF4K 1NGHA 1BI4B 1JKHA 2V7ZA 3I55N 5AQVA 4BRFA 4OLBA 4BGBA 4AHRA 3TWHA 3CC7N 3K0SA 1IV0A 4CVNE 3U4LA 1L3SA 1ATRA 1KQSM 3DXKB 4OGCA 4EZ6A 4FLZA 4JK7A 3BP8A 5LJWA 1P8ZA 2QWMA 5AQIA 1NNEA 1KRPA 4PKGA 3V9SA 4FWLA 2GV9A 4BDYA 3VPZA 5KRSA 4C23A 4O5FA 3TAQA 3L2UA 1JL1A 1TKZA 3O3GA 1RBSA 4OLAA 4BC2A 4HTLA 3WT0A 1DLOA 4DQQA 3TAGA 1ZBSA 1IJJA 3LDNA 3HI0A 3VQ4A 5DM6L 3ZX0A 1XI1A 3PLAA 3HK2A 1C0FA 4W5TA 1S1UA 2PAVA 1QSLA 4CJ4A 2P9UB 3THVA 3QETA 4FW2A 3LP1A 4CGDA 5IWAK 3CCLN 3CPWM 3TSPA 1RTJA 4HUFA 3WNGA 1A5VA 2E4LA 4DR2K 4DR7K 1TUUA 1QTMA 4NLCA 3OYIA 3ZLJA 3GOIA 1ATSA 1X3NA 4GNIA 5GADP 1QVGM 1NJWA 4RTFD 3AA4A 3VN5A 5J2QA 3MN7A 4J2AA 4DR4K 2HVHA 2NLXA 4BQLA 1RT2A 2Q0UA 3MDQA 4KAZA 4AF1A 1KAZA 3RMBA 4FJ5A 5M1NA 3CI5A 5FPMA 3VQ5A 3J7YP 3DRSA 4BDPA 1KC8O 1HYVA 3WXJA 3TABA 4CZIA 4KI6A 4C8LA 5CZ2A 3AA5X 2P9UA 5E84A 1NK6A 2YHXA 1VQ4N 4B9MA 1Q9XA 4BRPA 4MQ3A 2HHQA 1LW2A 3AVBA 4A2BA 1NJXA 3MK6A 4YOXA 2RKIA 1LWFA 3E1YA 2B4JA 4IFVA 3BDPA 3DLHA 3ZT0A 5LY3A 2VGNA 3NF6A 4F2RA 1HNIA 4W5QA 4DQIA 1RT3A 2DPNA 4G1QA 4JKBA 3NGYA 3OW2M 1X1PA 4BDZA 3ZT4A 1S6QA 1U48A 2F9TA 4CBXA 3OYFA 4FJXA 1WOQA 1KAXA 3DWLA 1WSHA 4B1XB 5JLFA 2WBNA 4XH1A 4Q0BA 3V4IA 3NF8A 1W9HA 3O4NA 1ILYA 3DRPA 2QKBA 5K14A 4CECA 4CGHA 1VQON 3KD1E 4M3XA 1W2BM 3CM5A 4CJ7A 4WE1A 4HUEA 4O8KA 4BRQA 4OKKA 3ULEB 3OYHA 1XC3A 5FLXO 2G8VA 3CJAA 2Z1GA 3J8AA 4OVLA 3VGKA 3ZSQA 4M63C 4X62K 3L0QA 2QWPA 1OVYA 3CJ9A 3VGMA 3MN6A 3O08A 3QBWA 1C6VA 1N33K 3GE1A 1G99A 2KW4A 3KKRA 3VESA 4BRHA 4RW7A 4CJ5A 3CFPA 4MO5A 4FM2A 3IUCA 2OPRA 4IDKA 1BG3A 3ID6A 1WAJA 4FJKA 4CERA 3KK2A 1S9GA 3H1QA 1BIZA 3G71N 4L8RB 2UYTA 2G8IA 5CR4A 3AO5A 4A59A 4MLEA 1XMOK 4BR7A 2E2PA 4ZTJA 1HYZA 2FSKA 3M8QA 5I9EB 4WFBL 2ETJA 3QNNA 5TKYA 3OYKA 2F8SA 2NRTA 2WUSA 5M1OA 3ULEA 3SK3A 1K8KB 4GVMA 2O4GA 1SL0A 4QCLA 1U04A 4DF4A 5HOOA 2B5JA 2V52B 2PY5A 3VF2A 4NXNK 1W97L 3ZSOA 4K0KK 1FJGK 1J9AA 2RE2A 3AO3A 1NOYA 3NDKA 3AVAA 3MECA 1SKWA 3ISNC 3EE8A 1ITGA 5MLCQ 4J2BA 4BRCA 1Q8IA 3CHWA 3T1YK 1D9DA 4CEAA 4Z4FA 3GBTA 1OH5A 5AQQA 3VA3A 3CMAN 3AGKA 3T69A 5KPZA 2YKMA 1WN7A 1CLQA 2IGIA 1XHXA 4DS4A 2A1RA 5C24A 4YOWA 4CHYA 3THYB 3SNNA 3D6RA 3H45C 2H3GX 3ZEUB 4DUYK 5HROA 2ZM6K 5I42A 4JKEA 3LALA 3LWMA 5GAGP 1VSDA 5DM7L 1TK8A 4Z4GA 3HSCA 4Q5VA 2VWBA 1C1CA 1JXBA 4RWTA 1JXEA 1B9FA 2E5LK 1VK0A 4HCBA 3H46O 4DV7K 3QEVA 4WFNL 4CF1A 4IOXA 1BCMA 4QAGA 1QZ5A 2OCEA 4BY9C 2O8DB 4EAHD 1WSGA 2UUBK 2OPSA 1T3VA 4JI1K 5A2QO 2VG6A 4B1YB 4RW8A 1IBLK 4KHPK 2KFZA 5C25A 4BE2A 4OKEA 3QB0A 1C0UA 4QS7A 4BR5A 3T19A 5EY4A 5F1XA 2NRZA 3CJBA 5AZIA 2IIRA 4M7XA 3CCJN 1BL3A 3U3YA 4RG8A 2P9SB 4UY8O 4B9QA 4GKKK 4GV9A 1N34K 4QS9A 4DSKA 1T05A 1MA9B 2E2OA 1LAVA 3ZEUA 3PSIA 1NK0A 1MU2A 4ZTFA 2FF6A 4PA1A 3THXB 2QWRA 3CC2N 1UA0A 2NRHA 3NVKA 2HBJA 3KKSA 2XY6A 2A40A 4FWSA 1C0TA 1TAQA 4LF8K 1Q81O 1SL1A 3AARA 2YJFA 4BACA 2HBLA 5LL6Z 5EXWA 2P5OA 3S3NA 4CHOA 2FBTA 1NGAA 1NJZA 3SQ2A 3P5JA 3NCIA 4JI7K 4W5OA 1H1VA 1CZAN 1HLUA 3JXUA 4CJLA 3K2PA 2O8BA 4ELVA 4U67L 4M3WA 3RTVA 4CZHA 3NH1A 3SZ2A 1CXQA 3SQ4A 3CJ1A 4KH4A 2P9SA 1FW6A 2GBZA 5AQZA 3PSFA 3ENOA 2HNYA 3LP3A 4U7BA 1IBMK 1J53A 5BR8K 4B3SK 2QWLA 4CJSA 3THXA 5BRDA 4JD2B 5CYMA 4LFCK 2D0BA 3QEWA 3BUZB 3CCEN 3AA3A 1ZBUA 3VQDA 3NAEA 3LP0A 3G4SN 4NLBA 4CI6A 1WLJA 5AFUA 3KWIA 3H6EA 5AFUH 3TTDA 3KLIA 1QVFM 3DLEA 2QI2A 2YI1A 2A1SA 4BREA 1DTTA 1ZBFA 3OHRA 4IJAA 4OO1J 1BISA 1ASVA 4N41A 1JLCA 5KPRA 4JRQA 3HPGA 4CJFA 4CEZA 2VWKA 3FGUA 2YJEA 3CQYA 3I0SA 1YIJN 3BF1A 2FXUA 1P90A 4JLHA 4A5BA 5AQNA 1YJ9N 3KIOA 4FLTA 3TAMA 2P9IB 3GDQA 2VQFK 2NZTA 3CF5L 2HHXA 4C8OA 4EHTA 2BE2A 3KLGA 2FBXA 4CGGA 5FPNA 3ULDA 1LOTB 3WNFA 2ZJPL 5FROA 1QHTA 3P38A 4FLXA 4M42A 4JD2A 3K5MA 4KTQA 3RMDA 4WCEL 3S3MA 1NK8A 1NKCA 3WXIA 4B9TA 3BF3A 3MXJA 3W0LA 1WBDA 4CK2A 1GLBG 3AO4A 1SKRA 2Z1JA 4JI0K 3E9LA 2GTDA 4PHTX 2P9PA 2GUPA 1W7AA 1J5EK 3OYAA 2ZJQL 3OYEA 3LDPA 1RDCA 2P5GA 2Z1IA 2G8KA 4FJIA 5HP1A 2EHGA 3IMXA 4DF8A 2P9KB 1MWMA 1T6CA 3QO9A 4X65K 2P9IA 4NCAA 1JCFA 3ZT2A 3QERA 3VQAA 1RGIA 3TANA 5AQKA 4PL7A 4NXMK 4CEOA 4CW7B 4N5SA 2X6SA 2KZMA 3DMJA 5GINA 4FJHA 3TARA 4K8XA 4I6MB 1K6YA 3WEEB 3H3NO 5KGXA 2GX9A 4JI2K 2O8CB 2HNDA 5ELZA 1U49A 3RMCA 1QS4A 3CJCA 1WSFA 2YHYA 5C10A 4B3OA 3PX6A 4X66K 3L2VA 2ZWHA 3D0PA 3DXMB 4BE1A 1HNWK 2HHUA 4ICLA 1TAUA 3MEDA 2D4WA 4DB3A 5CE3A 3AO1A 4IJNA 5JICA 4OPKA 1YJWN 3M8RA 1JLEA 3NF7A 4JYAK 3LL3A 3T7ZA 3J7ZO 4V19S 4DQ8A 4H8KA 1S3XA 3DM2A 3RRGA 5HRRA 1YTUA 3SJHA 2IS3A 3G0ZA 5BREA 4B9VA 5FPEA 3LM2A 2GWKA 1YAGA 3C94A 2A41A 3O6WA 3AVHA 3ENHA 4K42A 4WQ5A 4Z0UA 3RSEB 1N36K 3JS6A 4F2SA 1IKYA 3QESA 4EP4A 3AVFA 2EX3A 3JSMA 3MX5A 3QFUA 2O8CA 3VQCA 1SAZA 2HHSA 1VQ9N 4KREA 4CFBA 3AVLA 2Z1HA 2E1YA 2YHAA 4JKGB 5AQJA 3DXMA 4J8FA 2RN2A 3PY8A 1RDAA 4RCHA 2RHKA 3NGZA 1RT6A 4FWPA 4BR9A 1UOCA 5AQRA 1ZXOA 3V6DA 2E20A 4WQ4A 2O8EB 1EKEA 2VCPA 5GIOA 1D9FA 3L6QA 3RR8A 1EQYA 3ZSVA 3SMPA 3WUHA 4CJRA 3EEQA 2ZD1A 2CH5A 1S1VA 2BTFA 2HMIA 2KFNA 4HUGA 3NMUA 4WYBA 4DQRA 3FR0A 3RSEA 2OTJN 4DQPA 4BRLA 1CXUA 2OPQA 3A5NC 1NOZA 3M3ZA 3CXCM 4CZGA 3I56N 2IDOA 4BRGA 2RPIA 3V1OA 3C6UA 2WOMA 4HWIA 3D45A 3LDSA 3HVRA 2ASPA 4JKGA 5AQGA 1XHZA 2VWJA 4CJVA 5AQMA 4BR0A 4RW4A 2HBMA 4Z4IA 3OBWA 4IO8A 2D1KA 4KRFA 2O8EA 3CERA 4BQZA 1YT3A 4CIFA 2PBDA 4Z4EA 3FLCO 4YHHK 3IFRA 5BRHA 1WBBA 1HNVA 3VEVA 1NK5A 2F4VK 5E41A 4Y0WA 2KZZA 3OYJA 4DHYA 3VQ9A 3R9PA 4B08A 4YNQA 1VQNN 2ASOA 3AAPA 1BQNA 3UKUB 3CG7A 4R5PA 3DOKA 3LDQA 4B1WB 2A42A 3ATUA 1TVRA 1XC9A 4H0PA 4BR4A 1C1AA 4C1NK 4A61A 2DFFA 1W0HA 1NGFA 4JK9A 3JAMO 3SUNA 3M1FA 3EKSA 3WQTA 5JLHA 3MMVA 4XH5A 1HQEA 4DSFA 4KO0A 4O44A 3OS0A 3M8SA 4FOIA 3LAMA 3WNEA 3SQ1A 1S1TA 3N4QA 4PKIA 1IKVA 4DSLA 2LSNA 3DOLA 3RRHA 4CGFA 1IG8A 3MX2A 1RILA 5HBMA 4E89A 4RW6A 4H5RA 1KVBA 3OYNA 4QS8A 3SMSA 3MXMA 1HJOA 3H3OB 5C15A 2ZJRL 5FPDA 1NU0A 4B8CA 1WB9A 2ZQBA 3LPTA 3UKUA 1Q18A 3U9DA 3OYMA 1VQ8N 4IZ9A 5BR9A 1FXXA 5BPLA 1C1BA 1S5JA 1RBRA 4H0XB 4CFDA 4AHUA 1RT1A 1DKGD 3TSUA 2I7PA 4KHUA 1RT7A 5AR0A 4MDBA 4NO7A 3B6OA 3G6EN 3H1VX 1S1WA 5J2PA 2RF2A 3I8DA 3L4QA 1VAZA 2ASMA 4FCYA 4B8AB 1T03A 4DFPA 3KLFA 1V4TA 4CF8A 3O8MA 3HRGA 4PKHA 2YNHA 5BPNA 1LWEA 4GMJB 4HHTA 3A2FA 2FBVA 3RVCA 4BRMA 1DTQA 3OYLA 3QINA 3SUPA 4JV5K 1IKXA 3ZSWA 2OANA 2P9LA 5M1PA 4B1ZA 3PUFA 1D5AA 3E9OA 1YTAA 1XQSC 5GAEP 4ELTA 2AA4A 5AJ3K 4DSIA 4E1NA 3JYTA 4KI4A 1QSYA 1NGCA 3EY1A 4IOAL 3D7EO 1NKEA 3CIPA 4FPAA 3SQ0A 3D2EA 4LSNA 3EZ5A 3PO4A 3OYCA 1QZ6A 3AGRA 4CCHA 1NGDA 4OPJA 2G8WA 4FLYA 5HRSA 2Q1NA 3F9KA 5H1SQ 3O9UA 3EN9A 1NWKA 5C12A 4CZLA 1S6PA 4IFYA 4FXDA 1SUQA 1X9JA 4LF7K 1RDBA 1UAXA 2W41A 3MN9A 1TV6A 1RDDA 1U45A 4PY5A 4IWVA 4B9UA 1VSKA 4A62A 3S3OA 3BEXA 2UU9K 2YNIA 4H0OA 3TTFA 4OJRA 4CHQA 1HKGA 4OX9K 1RBTA 3HPOA 1KSPA 4JN4A 3B6PA 4LH4A 1NGBA 3LPUA 2IOCA 3SCXA 2VQEK 4E19A 5AZIB 4FZZA 4JRPA 4OGEA 1BO5O 4FWRA 4JK8A 3QEIA 1YVUA 3DRRA 4M41A 4JNEA 3TAEA 3WNHA 2I5JA 1BWFO 5LMUK 3L2QA 4OPHA 2GEMA 4FM0A 5LJVA 3IS9A 4O5BA 1QSSA 2P1JA 4M45A 4DV1K 2NRWA 4LY7A 3I33A 4M3UA 1HPZA 5CY4A 1VRUA 5CZ1A 3SBTA 2QXLA 2YNGA 1JLGA 1QQMA 1G15A 4ILHA 5KI6A 5HRPA 3U9ZA 4BC5A 3CCMN 1YITN 4X64K 3MCAB 2O8BB 4GY2B 4KBOA 4KPYA 4KFBA 1HQUA 2HHWA 2F7TA 5SZTA 3LP2A 3C0BA 3FZHA 2A3ZA 1R0AA 2DTUA 4DV5K 4DG1A 1X9MA 4BC4A 5KTQA 2DY4A 4C1NI 1BCOA 4OPAA 5JS1A 4G9ZA 4JKCA 3J80O 2NRXA 1IBKK 2BGGA 3ASMA 4O0JA 1JL2A 1GLCG 3ZT3A 4DTPA 3DLGA 4DQSA 4DLGA 2FBYA 2AJQA 2HNZA 3QMLA 3EYZA 1XWLA 5AQYA 1IG9A 1X3MA 2HSTA 3VA0A 4LC9B 5AZJA 2BH1A 1RTIA 3VQPA 1BA0A 1NG9A 3S41A 4BWMA 2PYLA 4CZFA 4PL8A 3M8PA 4ELUA 4FWQA 2KHOA 1SKSA 3MEEA 1J6ZA 4CD3A 5TKWA 1JJ2M 1HR0K 4M3YA 5J1EA 3AVMA 3T1AA 3LWLA 2FSNA 4F3TA 3Q7CA 2HB5A 3ZSZA 3LANA 3OYGA 3HOSA 1E4GT 3AO2A 3CC4N 4LF5K 4YDUA 3VQ7A 2WTUA 2OTLN 1L3VA 3VEZA 5C2DA 1X9WA 2Q31A 3O9TA 4ID1A 5B8HA 3DLLL 2V51B 3O3FA 3GG4A 2YKNA 1KVAA 5AQUA 3CM6A 3HTVA 3SV4A 3C95A 4DV0K 3V1QA 2OYQA 5BRFA 4BROA 5JMVA 3CJ7A 4N76A 2P9PB 4CJTA 3HM9A 1GOBA 3M6GA 4Y1DA 1XNQK 1T44A 3KLEA 1Q82O 2JWKA 3HL8A 4DR1K 3CQ8A 5EX5A 4I2PA 4AHVA 2W6KA 4XEIA 1SL2A 2X74A 3D2FB 3HJFA 4I9QA 4IOCL 1Q7YO 4RW9A 1OH7A 1TK5A 1Y97A 3TPQA 2YHBA 4ID5A 1GOAA 1U6ZA 4B1UB 1LCUA 3EL2A 1Z6RA 4KHYA 3CMEN 1BIUA 4DMNA 3IKMA 1NK7A 3WQUA 3ZT1A 1BUPA 3RR7A 5EU7A 2VGMA 3OS1A 1JCEA 4DV2K 2G8HA 1VQPN 1OH6A 1GLDG 1J54A 2Q3SA 4BR2A 4CIEA 2EWSA 3A5OC 4FLVA 3KJVA 3KTQA 3V9XA 3VEWA 3E01A 3H08A 3VEOA 1EWRA 1NJYA 4DKWA 3VTIA 3MEGA 2X78A 3D2FA 3IG1A 1E3MA 5EVZA 2DFHA 4FJ7A 2QXFA 3NFAA 4JKFA 5E26A 2BDPA 1VSJA 1WSEA 4NYNA 3V9WA 2QWQA 5SWMA 3S9HA 2UXDK 5D3GA 4A5AA 1XNRK 3NF9A 3HYFA 4DUZK 2IVNA 3FZFA 2QA4N 4F8RA 4JKDA 3HOTA 2J4RA 1K8AO 1Z25A 4R79A 3O1BA 4WQ4C 4LF6K 1TGOA 2D0CA 4CJKA 4JI5K 5DK5A 5C42A 1S9EA 3A5LC 4DFKA 2ATQA 3U8XA 2VYPA 1HKCA 4ISEA 4FWKA 1JLQA 2Y1JA 4Y1CA 3ZYYX 3CCVN 4FZYA 1C0MA 4DTNA 4BRDA 1BA1A 3C7NB 3GL1A 3NBPA 1U2VB 3P83D 3KK1A 3KLHA 4FJ8A 4N47A 3NH2A 4A57A 3ZETA 3ZSRA 2PZSA 2R7YA 2XO7A 3KK3A 4BRAA 2F9WA 1KLMA 4FWOA 2JLEA 2D0PA 2PFUA 4B3MK 1O1WA 4BC3A 2KKZA 2VG7A 3MAQA 1VSEA 3A8YA 3HZ6A 1ASUA 3J7AP 3W3DA 3OY9A 1LWCA 4DTJA 4I9LA 5HLFA 2XY8A 4PQUA 2GELA 3R6MA 3K9JA 1VQ7N 4C8MA 1D8YA 5KGWA 2P9NA 4DR5K 3K5OA 4JKHA 4JAXA 4OKJA 5AQPA 3V1RA 5AQOA 2D0AA 3CETA 5GIPA 1N32K 3HP9A 4HVJA 3C7NA 4IBNA 2BANA 3QLHA 1N6QA 4J2DA 1U2VA 1ATNA 4W5RA 5M1KA 4FJJA 1N8RO 4FJNA 3VQEA 4ILJA 3SBGA 5ADXA 4CK1A 1I94K 5ADXH 2NRVA 3A0IX 3L3VA 2W6LA 3QEPA 4FYDA 1RTDA 1L5UA 1NGEA 4M3TA 4I2QA 3C6HA 2UUCK 3VEXA 4CEDA 1OVQA 1BU6O 2I7NA 3I8BA 4BRIA 4FLWA 3SV3A 3QEXA 1C0GA 1UA1A 4CHPA 4GV3A 2HBKA 3NVMA 4KHSA 1FKPA 4K41A 4O55A 2NNWA 4DTXA 3HVTA 4FSVA 2IC3A 2JWLA 4LD0A 4F9OA 4LF9K 2GUIA 4CZKA 3O4WA 4FK4A 2HOEA 5KQDA 1QHAA 5AQHA 3AVGA 1ASWA 2XY5A 3FFKB 3BZCA 3MCPA 3V81A 3N4PA 3LZJA 4DTUA 4H5TA 1TYQA 4H0TB 1YI2N 3R3LA 1EO1A 4JS5A 1YF5L 1HYSA 4IFEA 3U3GA 4DR6K 2AP1A 5JVHL 3T1HK 1HJRA 1RCHA 1NGGA 1NBWA 4H5NA 1NMDA 3K9KA 1IH7A 2XHBA 2HHVA 1ZC6A 3SAHA 5C2FA 4FZXC 2E6MA 3O9QA 3QBXA 4FJLA 1R59O 3AVIA 2NUBA 3MXIA 3WXMB 4O4GA 1VRTA 1KFDA 4BWJA 5T7BA 4HCCA 4E1MA 4DU1A 2ZGZA 4JEPA 4FK0A 1RDWX 1RFQA 1F21A 3OA9A 3NGIA 1VQ6N 1M90O 2YX6A 3VGLA 5J2MA 3V9ZA 5FRNA 1BI4A 1GLAG 4DV3K 3QDKA 4KB0A 4FJGA 4CJPA 5FDLA 1XMQK 3FFIA 3IDHA 4B3TK 3OYBA 2CGLA 1B9DA 1VSLA 4B9LA 4DR3K 1CZ9A 3DXKA 5AQTA 2YV0X 2O8FB 4KTWA 1LW0A 4BRNA 3VQQA 4DV6K 4CF9A 1DT9A 1EXQA 1D4XA 3MN5A 4AQYK 3VMFB 2CH6A 3VERA 2QW9A 3UB5A 4CHNA 1WSIA 3G10A 1RBVA 4E3SA 3EKUA 5AQFA 4EZ9A 4AHTA 4IEIA 2HHTA 1MWKA 2P9LB 2G8FA 4YOUA 3QIOA 3EZWA 3CCSN 1HUXA 3UKRB 1JCGA 4K43A 4H5VA 1VSIA 3ZSXA 2E6LA 3SYZA 4KB1A 1V4SA 4IXCA 2O4IA 3O4QA 3OVNA 1ZBLA 1EP4A 3F9MA 2FC0A 3FZLA 4W5NA 1K9MO 4WF9L 1NJIO 3SI6A 1HMVA 1X9SA 3D2EB 2E88A 2A6AA 1A5WA 1Q9YA 4DFMA 3ZCMA 4CF2A 2O8FA 2YNFA 1ZYQA 3WXKA 1REVA 3TAPA 4KTZA 4M7YA 4TSXA 2ZGYA 4KH6A 2E1ZA 2W40A 1I39A 4FWMA 3VETA 4DTSA 4IG3A 3M5RA 4DTOA 3O1WA 1QQCA 3QIPA 1RTHA 1KXPA 2W42A 3F73A 3L8BA 3UKRA 4E7HA 5M1FA 3J81O 1TK0A 3CPEA 4CJEA 4K25A 3VQBA 5GAHP 3LM9A 3IRXA 3TAFA 4KHNA 4BE0A 3P39A 1CZBA 3O9RA 3SUOA 3TR8A 1HX1A 2D5RA 3KWGA 3F2KA 2E2QA 1Q86O 2QKKA 2HMPA 1NKBA 1YJNN 4EFHA 3P1GA 3CCQN 2OPPA 4E0DA 3O80A 4Z4HA 4E7KA 4B9SA 4CEBA 1A5XA 3L2RA 4Z94A 2X6NA 3MWPA 4CEFA 3BY5A 3O9SA 3TSQA 2XY7A 3FZMA 1L3UA 1GOCA 2VG5A 4CZMA 3DAWA 2HHHK 4CHZA 2Q36A 3KD5E 3TTCA 2FLOA 1DGKN 1S72N 2FSJA 4IO9L 4DCHA 3DLKA 1VSFA 1JLBA 4E7JA 5I3UA 4BG9A 1ZBIA 3P4IA 4L3QA 4ISFA 4KH5A 1BDGA 2KLAA 4IG0A 1SV5A 1FKOA 2DFEA 2ITMA 4YORA 4FM1A 3SUQA 2UXCK 3DJCA 3P31A 3AVNA 3VQ8A 3C65A 2ZE2A 3K5NA 4BRKA 1BOTO 1MDUB 3K5LA 3OTOK 4E7IA 1VSHA 4CGIA 3F5TA 3NH0A 1L3TA 4CF0A 5JVGL 2OA8A 2B6AA 2WFBA 1ESVA 1HNXK 2HVIA 3ITHA 2WONA 1U4BA 4KHQA 1KAYA 3ZX2A 3E66A 3VF6A 4B3RK 5AZJB 4YY3K 4YOVA 4DU4A 3UE5A 3R1XA 5AQLA 1IO2A 4BGAA 2CGKA 3PX4A 4AILC 4DTMA 5C0YA 4MDAA 4UQGA 2UXBK 3L2WA 1WAFA 3ALYA 4DSEA 4YDUC 3SLCA 1K8KA 1NMNA 1QQNA 3SAFA 4YFUA 4E1JA 4FVMA 3DLRA 1KCFA 4ZHRA 4K8ZA 1TL1A 2ITGA 1IKWA 4BVPA 2IVOA 1RNHA 3AVCA 1O13A 3AV9A 1UWBA 5KQ8A 4I7FA 4DLEA 4EHUA 3SAGA 2YCHA 3B8AX 1GLJO 4CJQA 1OH8A 3THYA 3WXLA 4N56A 2UUAK 2F96A 3VEYA 4MFBA 1SS6A 3HSTB 1HNZK 3LZIA 4CGJA 4YOYA 2KTQA 4NCBA 4ISGA 4DV4K 4FJ9A 3DLBA 1QE1A 4NYFA 5IT9O 3PV8A 2IAJA 1S1XA 3UIQA 4DWIA 4AHCA 2QWOA
chains in the Genus database with same CATH topology
5DK5A 5C42A 3VQ9A 2G8IA 1S9EA 4B08A 4DFKA 4YNQA 2ATQA 3AO5A 1TKDA 3K57A 1BQNA 3CFRA 1JLQA 3SJJA 4R5PA 3CG7A 4Y1CA 3DOKA 4CHOA 2Y1JA 4ZTJA 1HYZA 4QOZB 3BGRA 3M8QA 4FZYA 1C0MA 2ETJA 4DTNA 3OJSA 3QNNA 3OYKA 2F8SA 1TVRA 3NBPA 1XC9A 1C1AA 3V9UA 3NHGA 2DFFA 4GVMA 3P83D 3KK1A 2O4GA 1SL0A 3KLHA 4FJ8A 4O0IA 1Z26A 1U04A 1W0HA 4N47A 4QCLA 3NH2A 3SUNA 4DF4A 1N6QA 2B5JA 3ZSRA 2PZSA 2PY5A 2R7YA 4JS4A 2XRIA 3U6FA 3HO1A 2XO7A 3KK3A 3ZSOA 1WNSA 1I3AA 3PO4A 1J9AA 4IKFA 3AO3A 1KLMA 1HQEA 2JLEA 4DSFA 4KO0A 1NOYA 4O44A 4CFCA 3OS0A 3AA2A 3M8SA 3HXMA 3LAKA 3NDKA 1O1WA 3AVAA 3HPHA 3MECA 3ISNC 3LAMA 3WNEA 3SQ1A 1ITGA 1S1TA 1T8EA 4J2BA 4J2EA 2VG7A 1Q8IA 3MAQA 1VSEA 1IKVA 4DSLA 1ASUA 1SKWA 2LSNA 3DOLA 3RRHA 4CEAA 4CGFA 1D9DA 4Z4FA 1ZBHA 1RILA 5HBMA 4Q5VA 3OY9A 4E89A 4RW6A 1LWCA 3VA3A 4DTJA 1KVBA 3OYNA 1BHLA 2YKMA 4E7LA 3T3FA 1WN7A 3MXMA 1CLQA 2IGIA 4I9LA 1XHXA 4DS4A 2A1RA 1WSJA 5HLFA 5C24A 2XY8A 4PQUA 4CHYA 4C8MA 4B8CA 5KGWA 3SNNA 1D8YA 3K5OA 3HP6A 3PX0A 2ZQBA 3LPTA 4OKJA 2PYJA 2HW3A 3OYMA 1VSMA 5HROA 5I42A 3V1RA 2D0AA 3LALA 3LWMA 3QNOA 3HP9A 1T7PA 1VSDA 4HVJA 1FXXA 4IBNA 1TK8A 4Z4GA 2BANA 1C1BA 4CK3A 1S5JA 3QLHA 4C8NA 1RT4A 1C1CA 1JXBA 1RBRA 4AHUA 4CJWA 1JXEA 1B9FA 4CFDA 1VK0A 1RT1A 1LV5A 4W5RA 4HCBA 5KRTA 1KTQA 4KHUA 1RT7A 1RT5A 4FJJA 4FJNA 3VQEA 3QEVA 4M3ZA 3B6OA 4FK2A 4CK1A 4CF1A 1S1WA 5J2PA 2RF2A 4DTRA 4M3RA 1BCMA 4QAGA 3I8DA 2OZSA 1EETA 4FCYA 3L3VA 3ZSYA 1WSGA 4B8AB 3QEPA 3C6TA 1RTDA 2OPSA 1L5UA 4M3TA 4FYDA 1T03A 4DFPA 1TL3A 3KLFA 4I2QA 2VG6A 4RW8A 4CEDA 4CF8A 2KFZA 5C25A 4XIUA 4BE2A 4FLWA 3SV3A 3QEXA 1UA1A 4OKEA 2YNHA 4CHPA 4KHSA 3PO5A 1C0UA 1FKPA 4O55A 1LWEA 4GMJB 3T19A 4HHTA 4DTXA 3A2FA 3HVTA 2FBVA 1NK4A 2IC3A 1BL3A 1DTQA 3U3YA 4LD0A 4RG8A 3OYLA 2GUIA 3QINA 3SUPA 1IKXA 4F4KA 4FK4A 4DSKA 3ZSWA 1JLAA 4PWDA 1T05A 3AVGA 1ASWA 2XY5A 1LAVA 1NK0A 4H4MA 1MU2A 3PUFA 4ZTFA 4DS5A 3V81A 4Z4CA 4PA1A 1D5AA 3VQ6A 3LZJA 1YTAA 4DTUA 3OJUA 4ELTA 1UA0A 4DSIA 4E1NA 3JYTA 4KI4A 1QSYA 4B9NA 3KKSA 4JS5A 1HYSA 3U3GA 2XY6A 1HJRA 1RCHA 3EY1A 4GW6A 3SQ0A 3RWUA 5HRNA 1IH7A 3CYMA 2XHBA 2HHVA 3SPZA 1C0TA 1TAQA 1NKEA 3EZ5A 4HTUA 1SL1A 4FZXC 2E6MA 4FLUA 4BACA 4FJLA 2P5OA 3S3NA 2JGUA 3AVIA 2FBTA 2NUBA 4LSNA 4CJ3A 4CEEA 4O4GA 1VRTA 1KFDA 3P5JA 4BWJA 3OYCA 1TKXA 3NCIA 3SQ2A 5T7BA 1NK9A 1KFSA 4HCCA 4E1MA 4DU1A 3I0RA 4W5OA 4FK0A 4KHWA 1F21A 3NGIA 4CCHA 1JLFA 4OPJA 2G8WA 2OZMA 4FLYA 4CJLA 3K2PA 4DU3A 5J2MA 5JS2A 4KKOA 5HRSA 5DMRA 3V9ZA 4ELVA 4M3WA 3F9KA 3RTVA 3NH1A 4FJMA 3SZ2A 1BI4A 1CXQA 4DFJA 3SQ4A 5FRNA 4KB0A 4FJGA 3SPYA 4CJPA 4CE9A 5FDLA 1S6PA 4IFYA 4FXDA 1SUQA 4LH5A 1J5OA 1RDBA 1UAXA 2GBZA 1TV6A 1RDDA 3FFIA 1U45A 4PY5A 1LAWA 2HNYA 3OYBA 3K58A 2P51A 3LP3A 4B9UA 1B9DA 1VSLA 1VSKA 4B9LA 3S3OA 1CZ9A 1J53A 2QK9A 1HRHA 2F8TA 2YNIA 2YV0X 4CJSA 3RMAA 5CYMA 4KTWA 1LW0A 4OJRA 4CHQA 4CJUA 2D0BA 3VQQA 1RBTA 3HPOA 1KSPA 3QEWA 4LH4A 3B6PA 3AA3A 1ZBUA 3VQDA 4FW1A 4NCGA 4CF9A 4EP5A 1NK5A 3NAEA 3LP0A 5FRMA 1EXQA 2IOCA 3LPUA 3SCXA 4DSJA 4KV8A 1WLJA 4E19A 1KLNA 4AHSA 4FZZA 3KLIA 4JRPA 4OGEA 3DLEA 4CHNA 1WSIA 3G10A 2A1SA 1RBVA 4E3SA 1DTTA 1TKTA 3AVJA 3OYDA 3QEIA 1ZBFA 3HT3A 1YVUA 3DRRA 3L3UA 4M41A 3TAEA 4EZ9A 4AHTA 1BISA 1ASVA 3WNHA 1JLCA 4N41A 2HHTA 2G8FA 3IAYA 2I5JA 4JRQA 3QIOA 3HPGA 4CJFA 4CEZA 2VWKA 3L2QA 3I0SA 1U47A 1B92A 1EX4A 1VSIA 4H4OA 3ZSXA 4FM0A 2E6LA 4PUOA 4JLHA 3SYZA 1QSSA 3IS9A 4O5BA 4KB1A 3KIOA 4FLTA 3TAMA 2P1JA 1RBUA 4M45A 4AH9A 1BQMA 2O4IA 3OS2A 4CIGA 3O4QA 4LY7A 3OVNA 1ZBLA 2Y1IA 2HHXA 3AVKA 1EP4A 4C8OA 4M3UA 2FC0A 1HPZA 4W5NA 5CY4A 3O3HA 1VRUA 2BE2A 5CZ1A 3KLGA 3SI6A 1HMVA 3CFOA 1BGXT 1X9SA 2FBXA 4CESA 4CGGA 3K59A 5J2NA 3TI0A 2YNGA 1A5WA 3NE6A 3ULDA 1KVCA 1FK9A 4DFMA 3WNFA 1Q9YA 2G8UA 1JLGA 5FROA 4F3OA 1QHTA 3ZCMA 4CF2A 2YNFA 3DYAA 4CEQA 4FLXA 1G15A 4LSLA 5KI6A 5HRPA 1ZYQA 3DI6A 1N5YA 4M42A 3K5MA 4KTQA 1REVA 3RMDA 4CFAA 3TAPA 4KTZA 3S3MA 4TSXA 1NK8A 1NKCA 4B9TA 4C8KA 2KQ2A 5CYQA 4KFBA 4KPYA 1HQUA 2HHWA 3MXJA 5SZTA 3LP2A 1BI4B 1JKHA 1R0AA 2DTUA 4CK2A 3AO4A 4DG1A 1I39A 1X9MA 5KTQA 1SKRA 4OLBA 2DY4A 1BCOA 2Z1JA 4AHRA 3TWHA 5JS1A 4DTSA 4IG3A 3OYAA 3OYEA 1L3SA 4DTOA 4OGCA 1RDCA 4FLZA 4EZ6A 2P5GA 2Z1IA 3ASMA 1QQCA 2G8KA 3QIPA 4O0JA 1JL2A 4FJIA 1RTHA 2W42A 3F73A 3ZT3A 3L8BA 4DTPA 5HP1A 3DLGA 4E7HA 2EHGA 1KRPA 1TK0A 3V9SA 4DQSA 4DF8A 4DLGA 2FBYA 2AJQA 2GV9A 4BDYA 3QO9A 4NCAA 2HNZA 3EYZA 1XWLA 5KRSA 4CJEA 1IG9A 3ZT2A 3QERA 3VQBA 3VA0A 3VQAA 3TAQA 3L2UA 3IRXA 3TAFA 1JL1A 3TANA 1TKZA 4KHNA 2BGGA 3O3GA 1RBSA 4BE0A 4OLAA 1RTIA 4CEOA 3VQPA 1CZBA 1DLOA 4DQQA 3SUOA 3TR8A 3TAGA 2D5RA 2QKKA 4N5SA 4BWMA 1NKBA 2X6SA 2PYLA 2KZMA 3VQ4A 3DMJA 1XI1A 3P1GA 4FJHA 3TARA 4K8XA 3HK2A 4L8RB 4W5TA 1K6YA 1S1UA 3M8PA 4ELUA 1NJZA 2OPPA 1QSLA 4E0DA 4CJ4A 5KGXA 3MEEA 4Z4HA 1SKSA 4E7KA 4B9SA 2HNDA 4CEBA 3THVA 1U49A 3RMCA 3QETA 1A5XA 3L2RA 5J1EA 4M3YA 4FW2A 1QS4A 2X6NA 3AVMA 1WSFA 3T1AA 3LP1A 3LWLA 4CEFA 4CGDA 4F3TA 4B3OA 2XY7A 1L3UA 3PX6A 2HB5A 1RTJA 4J2DA 1GOCA 3L2VA 4HUFA 3D0PA 2VG5A 3ZSZA 3LANA 3WNGA 1A5VA 2E4LA 3OYGA 4BE1A 4CHZA 2HHUA 3AO2A 3KD5E 4ICLA 3VQ7A 1TAUA 3MEDA 3AO1A 1QTMA 1L3VA 3OYIA 4OPKA 3M8RA 1X9WA 1JLEA 3DLKA 1VSFA 3NF7A 1JLBA 4ID1A 4E7JA 1NJWA 3VN5A 3AA4A 5J2QA 3O3FA 5I3UA 4J2AA 4H8KA 3DM2A 3RRGA 1ZBIA 5HRRA 1YTUA 2YKNA 2HVHA 2IS3A 1RT2A 3G0ZA 4B9VA 4KAZA 1KVAA 3CM6A 4IG0A 2DFEA 1SV5A 1FKOA 3SV4A 4FM1A 3SUQA 3C95A 3RMBA 3V1QA 4FJ5A 3C94A 2OYQA 3VQ5A 3AVNA 3AVHA 3DRSA 3VQ8A 4Z0UA 4N76A 4BDPA 2ZE2A 4CJTA 3K5NA 3HM9A 1GOBA 4Y1DA 4F2SA 3K5LA 1IKYA 1HYVA 3KLEA 3QESA 3TABA 3HL8A 4EP4A 4E7IA 1VSHA 4CGIA 3AVFA 2EX3A 3NH0A 3CQ8A 1L3TA 4C8LA 4KI6A 4I2PA 5CZ2A 4AHVA 4CF0A 3AA5X 3JSMA 1NK6A 2OA8A 2B6AA 1SL2A 2X74A 1Q9XA 4B9MA 3VQCA 2HVIA 3ITHA 2WONA 4MQ3A 1U4BA 3HJFA 4I9QA 4KHQA 2HHQA 1LW2A 2HHSA 4RW9A 3AVBA 4KREA 1NJXA 4CFBA 3AVLA 2RKIA 1LWFA 2YHAA 2Z1HA 1TK5A 1Y97A 2B4JA 2YHBA 4ID5A 4IFVA 3BDPA 1GOAA 3DLHA 4DU4A 2RN2A 3ZT0A 1RDAA 3PY8A 3NGZA 1IO2A 1RT6A 3NF6A 4KHYA 4F2RA 3PX4A 4AILC 1HNIA 1UOCA 4W5QA 4DQIA 1BIUA 4DMNA 4DTMA 1NK7A 1RT3A 4UQGA 3V6DA 3ZT1A 4G1QA 3NGYA 1EKEA 1D9FA 3L2WA 3RR7A 1WAFA 3ALYA 4DSEA 1X1PA 3RR8A 4BDZA 5EU7A 3ZT4A 1S6QA 3OS1A 1U48A 3UIQA 3ZSVA 4YFUA 4DWIA 4CJRA 2G8HA 3OYFA 4FJXA 4FVMA 3DLRA 1KCFA 2ZD1A 1WSHA 1S1VA 2HMIA 1J54A 2Q3SA 2KFNA 4HUGA 4ZHRA 4K8ZA 4Q0BA 1TL1A 4CIEA 4DQRA 3V4IA 2ITGA 1W9HA 3NF8A 4FLVA 1IKWA 4DQPA 3O4NA 3KJVA 1CXUA 3KTQA 3DRPA 2QKBA 5K14A 4CECA 3V9XA 4CGHA 3KD1E 2OPQA 4M3XA 3CM5A 3E01A 1NOZA 3H08A 4WE1A 1RNHA 4HUEA 3AVCA 1NJYA 4OKKA 3OYHA 3AV9A 2IDOA 1UWBA 4I7FA 3MEGA 2X78A 2RPIA 4DLEA 2G8VA 3V1OA 3C6UA 3IG1A 2WOMA 2Z1GA 4OVLA 3ZSQA 3D45A 4CJQA 3LDSA 2DFHA 4FJ7A 2QXFA 3NFAA 3HVRA 1XHZA 4N56A 2BDPA 1C6VA 2F96A 2VWJA 4MFBA 1VSJA 1WSEA 3HSTB 2KW4A 4NYNA 4CJVA 3V9WA 4RW4A 5SWMA 3S9HA 4Z4IA 3KKRA 4CGJA 3LZIA 5D3GA 4RW7A 2KTQA 4NCBA 4CJ5A 4KRFA 3MXIA 3CFPA 4FM2A 3NF9A 2OPRA 3HYFA 1YT3A 4IDKA 4CIFA 4Z4EA 1WAJA 4F8RA 4FJ9A 3DLBA 1QE1A 1Z25A 4NYFA 4FJKA 1HNVA 4CERA 3PV8A 2IAJA 1TGOA 2D0CA 1S1XA 1S9GA 4CJKA 3KK2A 5E41A 2KZZA 1BIZA 4AHCA 3OYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DK5 A;  5C42 A;  3VQ9 A;  2G8I A;  1S9E A;  4B08 A;  4DFK A;  4YNQ A;  2ATQ A;  3AO5 A;  1TKD A;  3K57 A;  1BQN A;  3CFR A;  1JLQ A;  3SJJ A;  4R5P A;  3CG7 A;  4Y1C A;  3DOK A;  4CHO A;  2Y1J A;  4ZTJ A;  1HYZ A;  4QOZ B;  3BGR A;  3M8Q A;  4FZY A;  1C0M A;  2ETJ A;  4DTN A;  3OJS A;  3QNN A;  3OYK A;  2F8S A;  1TVR A;  3NBP A;  1XC9 A;  1C1A A;  3V9U A;  3NHG A;  2DFF A;  4GVM A;  3P83 D;  3KK1 A;  2O4G A;  1SL0 A;  3KLH A;  4FJ8 A;  4O0I A;  1Z26 A;  1U04 A;  1W0H A;  4N47 A;  4QCL A;  3NH2 A;  3SUN A;  4DF4 A;  1N6Q A;  2B5J A;  3ZSR A;  2PZS A;  2PY5 A;  2R7Y A;  4JS4 A;  2XRI A;  3U6F A;  3HO1 A;  2XO7 A;  3KK3 A;  3ZSO A;  1WNS A;  1I3A A;  3PO4 A;  1J9A A;  4IKF A;  3AO3 A;  1KLM A;  1HQE A;  2JLE A;  4DSF A;  4KO0 A;  1NOY A;  4O44 A;  4CFC A;  3OS0 A;  3AA2 A;  3M8S A;  3HXM A;  3LAK A;  3NDK A;  1O1W A;  3AVA A;  3HPH A;  3MEC A;  3ISN C;  3LAM A;  3WNE A;  3SQ1 A;  1ITG A;  1S1T A;  1T8E A;  4J2B A;  4J2E A;  2VG7 A;  1Q8I A;  3MAQ A;  1VSE A;  1IKV A;  4DSL A;  1ASU A;  1SKW A;  2LSN A;  3DOL A;  3RRH A;  4CEA A;  4CGF A;  1D9D A;  4Z4F A;  1ZBH A;  1RIL A;  5HBM A;  4Q5V A;  3OY9 A;  4E89 A;  4RW6 A;  1LWC A;  3VA3 A;  4DTJ A;  1KVB A;  3OYN A;  1BHL A;  2YKM A;  4E7L A;  3T3F A;  1WN7 A;  3MXM A;  1CLQ A;  2IGI A;  4I9L A;  1XHX A;  4DS4 A;  2A1R A;  1WSJ A;  5HLF A;  5C24 A;  2XY8 A;  4PQU A;  4CHY A;  4C8M A;  4B8C A;  5KGW A;  3SNN A;  1D8Y A;  3K5O A;  3HP6 A;  3PX0 A;  2ZQB A;  3LPT A;  4OKJ A;  2PYJ A;  2HW3 A;  3OYM A;  1VSM A;  5HRO A;  5I42 A;  3V1R A;  2D0A A;  3LAL A;  3LWM A;  3QNO A;  3HP9 A;  1T7P A;  1VSD A;  4HVJ A;  1FXX A;  4IBN A;  1TK8 A;  4Z4G A;  2BAN A;  1C1B A;  4CK3 A;  1S5J A;  3QLH A;  4C8N A;  1RT4 A;  1C1C A;  1JXB A;  1RBR A;  4AHU A;  4CJW A;  1JXE A;  1B9F A;  4CFD A;  1VK0 A;  1RT1 A;  1LV5 A;  4W5R A;  4HCB A;  5KRT A;  1KTQ A;  4KHU A;  1RT7 A;  1RT5 A;  4FJJ A;  4FJN A;  3VQE A;  3QEV A;  4M3Z A;  3B6O A;  4FK2 A;  4CK1 A;  4CF1 A;  1S1W A;  5J2P A;  2RF2 A;  4DTR A;  4M3R A;  1BCM A;  4QAG A;  3I8D A;  2OZS A;  1EET A;  4FCY A;  3L3V A;  3ZSY A;  1WSG A;  4B8A B;  3QEP A;  3C6T A;  1RTD A;  2OPS A;  1L5U A;  4M3T A;  4FYD A;  1T03 A;  4DFP A;  1TL3 A;  3KLF A;  4I2Q A;  2VG6 A;  4RW8 A;  4CED A;  4CF8 A;  2KFZ A;  5C25 A;  4XIU A;  4BE2 A;  4FLW A;  3SV3 A;  3QEX A;  1UA1 A;  4OKE A;  2YNH A;  4CHP A;  4KHS A;  3PO5 A;  1C0U A;  1FKP A;  4O55 A;  1LWE A;  4GMJ B;  3T19 A;  4HHT A;  4DTX A;  3A2F A;  3HVT A;  2FBV A;  1NK4 A;  2IC3 A;  1BL3 A;  1DTQ A;  3U3Y A;  4LD0 A;  4RG8 A;  3OYL A;  2GUI A;  3QIN A;  3SUP A;  1IKX A;  4F4K A;  4FK4 A;  4DSK A;  3ZSW A;  1JLA A;  4PWD A;  1T05 A;  3AVG A;  1ASW A;  2XY5 A;  1LAV A;  1NK0 A;  4H4M A;  1MU2 A;  3PUF A;  4ZTF A;  4DS5 A;  3V81 A;  4Z4C A;  4PA1 A;  1D5A A;  3VQ6 A;  3LZJ A;  1YTA A;  4DTU A;  3OJU A;  4ELT A;  1UA0 A;  4DSI A;  4E1N A;  3JYT A;  4KI4 A;  1QSY A;  4B9N A;  3KKS A;  4JS5 A;  1HYS A;  3U3G A;  2XY6 A;  1HJR A;  1RCH A;  3EY1 A;  4GW6 A;  3SQ0 A;  3RWU A;  5HRN A;  1IH7 A;  3CYM A;  2XHB A;  2HHV A;  3SPZ A;  1C0T A;  1TAQ A;  1NKE A;  3EZ5 A;  4HTU A;  1SL1 A;  4FZX C;  2E6M A;  4FLU A;  4BAC A;  4FJL A;  2P5O A;  3S3N A;  2JGU A;  3AVI A;  2FBT A;  2NUB A;  4LSN A;  4CJ3 A;  4CEE A;  4O4G A;  1VRT A;  1KFD A;  3P5J A;  4BWJ A;  3OYC A;  1TKX A;  3NCI A;  3SQ2 A;  5T7B A;  1NK9 A;  1KFS A;  4HCC A;  4E1M A;  4DU1 A;  3I0R A;  4W5O A;  4FK0 A;  4KHW A;  1F21 A;  3NGI A;  4CCH A;  1JLF A;  4OPJ A;  2G8W A;  2OZM A;  4FLY A;  4CJL A;  3K2P A;  4DU3 A;  5J2M A;  5JS2 A;  4KKO A;  5HRS A;  5DMR A;  3V9Z A;  4ELV A;  4M3W A;  3F9K A;  3RTV A;  3NH1 A;  4FJM A;  3SZ2 A;  1BI4 A;  1CXQ A;  4DFJ A;  3SQ4 A;  5FRN A;  4KB0 A;  4FJG A;  3SPY A;  4CJP A;  4CE9 A;  5FDL A;  1S6P A;  4IFY A;  4FXD A;  1SUQ A;  4LH5 A;  1J5O A;  1RDB A;  1UAX A;  2GBZ A;  1TV6 A;  1RDD A;  3FFI A;  1U45 A;  4PY5 A;  1LAW A;  2HNY A;  3OYB A;  3K58 A;  2P51 A;  3LP3 A;  4B9U A;  1B9D A;  1VSL A;  1VSK A;  4B9L A;  3S3O A;  1CZ9 A;  1J53 A;  2QK9 A;  1HRH A;  2F8T A;  2YNI A;  2YV0 X;  4CJS A;  3RMA A;  5CYM A;  4KTW A;  1LW0 A;  4OJR A;  4CHQ A;  4CJU A;  2D0B A;  3VQQ A;  1RBT A;  3HPO A;  1KSP A;  3QEW A;  4LH4 A;  3B6P A;  3AA3 A;  1ZBU A;  3VQD A;  4FW1 A;  4NCG A;  4CF9 A;  4EP5 A;  1NK5 A;  3NAE A;  3LP0 A;  5FRM A;  1EXQ A;  2IOC A;  3LPU A;  3SCX A;  4DSJ A;  4KV8 A;  1WLJ A;  4E19 A;  1KLN A;  4AHS A;  4FZZ A;  3KLI A;  4JRP A;  4OGE A;  3DLE A;  4CHN A;  1WSI A;  3G10 A;  2A1S A;  1RBV A;  4E3S A;  1DTT A;  1TKT A;  3AVJ A;  3OYD A;  3QEI A;  1ZBF A;  3HT3 A;  1YVU A;  3DRR A;  3L3U A;  4M41 A;  3TAE A;  4EZ9 A;  4AHT A;  1BIS A;  1ASV A;  3WNH A;  1JLC A;  4N41 A;  2HHT A;  2G8F A;  3IAY A;  2I5J A;  4JRQ A;  3QIO A;  3HPG A;  4CJF A;  4CEZ A;  2VWK A;  3L2Q A;  3I0S A;  1U47 A;  1B92 A;  1EX4 A;  1VSI A;  4H4O A;  3ZSX A;  4FM0 A;  2E6L A;  4PUO A;  4JLH A;  3SYZ A;  1QSS A;  3IS9 A;  4O5B A;  4KB1 A;  3KIO A;  4FLT A;  3TAM A;  2P1J A;  1RBU A;  4M45 A;  4AH9 A;  1BQM A;  2O4I A;  3OS2 A;  4CIG A;  3O4Q A;  4LY7 A;  3OVN A;  1ZBL A;  2Y1I A;  2HHX A;  3AVK A;  1EP4 A;  4C8O A;  4M3U A;  2FC0 A;  1HPZ A;  4W5N A;  5CY4 A;  3O3H A;  1VRU A;  2BE2 A;  5CZ1 A;  3KLG A;  3SI6 A;  1HMV A;  3CFO A;  1BGX T;  1X9S A;  2FBX A;  4CES A;  4CGG A;  3K59 A;  5J2N A;  3TI0 A;  2YNG A;  1A5W A;  3NE6 A;  3ULD A;  1KVC A;  1FK9 A;  4DFM A;  3WNF A;  1Q9Y A;  2G8U A;  1JLG A;  5FRO A;  4F3O A;  1QHT A;  3ZCM A;  4CF2 A;  2YNF A;  3DYA A;  4CEQ A;  4FLX A;  1G15 A;  4LSL A;  5KI6 A;  5HRP A;  1ZYQ A;  3DI6 A;  1N5Y A;  4M42 A;  3K5M A;  4KTQ A;  1REV A;  3RMD A;  4CFA A;  3TAP A;  4KTZ A;  3S3M A;  4TSX A;  1NK8 A;  1NKC A;  4B9T A;  4C8K A;  2KQ2 A;  5CYQ A;  4KFB A;  4KPY A;  1HQU A;  2HHW A;  3MXJ A;  5SZT A;  3LP2 A;  1BI4 B;  1JKH A;  1R0A A;  2DTU A;  4CK2 A;  3AO4 A;  4DG1 A;  1I39 A;  1X9M A;  5KTQ A;  1SKR A;  4OLB A;  2DY4 A;  1BCO A;  2Z1J A;  4AHR A;  3TWH A;  5JS1 A;  4DTS A;  4IG3 A;  3OYA A;  3OYE A;  1L3S A;  4DTO A;  4OGC A;  1RDC A;  4FLZ A;  4EZ6 A;  2P5G A;  2Z1I A;  3ASM A;  1QQC A;  2G8K A;  3QIP A;  4O0J A;  1JL2 A;  4FJI A;  1RTH A;  2W42 A;  3F73 A;  3ZT3 A;  3L8B A;  4DTP A;  5HP1 A;  3DLG A;  4E7H A;  2EHG A;  1KRP A;  1TK0 A;  3V9S A;  4DQS A;  4DF8 A;  4DLG A;  2FBY A;  2AJQ A;  2GV9 A;  4BDY A;  3QO9 A;  4NCA A;  2HNZ A;  3EYZ A;  1XWL A;  5KRS A;  4CJE A;  1IG9 A;  3ZT2 A;  3QER A;  3VQB A;  3VA0 A;  3VQA A;  3TAQ A;  3L2U A;  3IRX A;  3TAF A;  1JL1 A;  3TAN A;  1TKZ A;  4KHN A;  2BGG A;  3O3G A;  1RBS A;  4BE0 A;  4OLA A;  1RTI A;  4CEO A;  3VQP A;  1CZB A;  1DLO A;  4DQQ A;  3SUO A;  3TR8 A;  3TAG A;  2D5R A;  2QKK A;  4N5S A;  4BWM A;  1NKB A;  2X6S A;  2PYL A;  2KZM A;  3VQ4 A;  3DMJ A;  1XI1 A;  3P1G A;  4FJH A;  3TAR A;  4K8X A;  3HK2 A;  4L8R B;  4W5T A;  1K6Y A;  1S1U A;  3M8P A;  4ELU A;  1NJZ A;  2OPP A;  1QSL A;  4E0D A;  4CJ4 A;  5KGX A;  3MEE A;  4Z4H A;  1SKS A;  4E7K A;  4B9S A;  2HND A;  4CEB A;  3THV A;  1U49 A;  3RMC A;  3QET A;  1A5X A;  3L2R A;  5J1E A;  4M3Y A;  4FW2 A;  1QS4 A;  2X6N A;  3AVM A;  1WSF A;  3T1A A;  3LP1 A;  3LWL A;  4CEF A;  4CGD A;  4F3T A;  4B3O A;  2XY7 A;  1L3U A;  3PX6 A;  2HB5 A;  1RTJ A;  4J2D A;  1GOC A;  3L2V A;  4HUF A;  3D0P A;  2VG5 A;  3ZSZ A;  3LAN A;  3WNG A;  1A5V A;  2E4L A;  3OYG A;  4BE1 A;  4CHZ A;  2HHU A;  3AO2 A;  3KD5 E;  4ICL A;  3VQ7 A;  1TAU A;  3MED A;  3AO1 A;  1QTM A;  1L3V A;  3OYI A;  4OPK A;  3M8R A;  1X9W A;  1JLE A;  3DLK A;  1VSF A;  3NF7 A;  1JLB A;  4ID1 A;  4E7J A;  1NJW A;  3VN5 A;  3AA4 A;  5J2Q A;  3O3F A;  5I3U A;  4J2A A;  4H8K A;  3DM2 A;  3RRG A;  1ZBI A;  5HRR A;  1YTU A;  2YKN A;  2HVH A;  2IS3 A;  1RT2 A;  3G0Z A;  4B9V A;  4KAZ A;  1KVA A;  3CM6 A;  4IG0 A;  2DFE A;  1SV5 A;  1FKO A;  3SV4 A;  4FM1 A;  3SUQ A;  3C95 A;  3RMB A;  3V1Q A;  4FJ5 A;  3C94 A;  2OYQ A;  3VQ5 A;  3AVN A;  3AVH A;  3DRS A;  3VQ8 A;  4Z0U A;  4N76 A;  4BDP A;  2ZE2 A;  4CJT A;  3K5N A;  3HM9 A;  1GOB A;  4Y1D A;  4F2S A;  3K5L A;  1IKY A;  1HYV A;  3KLE A;  3QES A;  3TAB A;  3HL8 A;  4EP4 A;  4E7I A;  1VSH A;  4CGI A;  3AVF A;  2EX3 A;  3NH0 A;  3CQ8 A;  1L3T A;  4C8L A;  4KI6 A;  4I2P A;  5CZ2 A;  4AHV A;  4CF0 A;  3AA5 X;  3JSM A;  1NK6 A;  2OA8 A;  2B6A A;  1SL2 A;  2X74 A;  1Q9X A;  4B9M A;  3VQC A;  2HVI A;  3ITH A;  2WON A;  4MQ3 A;  1U4B A;  3HJF A;  4I9Q A;  4KHQ A;  2HHQ A;  1LW2 A;  2HHS A;  4RW9 A;  3AVB A;  4KRE A;  1NJX A;  4CFB A;  3AVL A;  2RKI A;  1LWF A;  2YHA A;  2Z1H A;  1TK5 A;  1Y97 A;  2B4J A;  2YHB A;  4ID5 A;  4IFV A;  3BDP A;  1GOA A;  3DLH A;  4DU4 A;  2RN2 A;  3ZT0 A;  1RDA A;  3PY8 A;  3NGZ A;  1IO2 A;  1RT6 A;  3NF6 A;  4KHY A;  4F2R A;  3PX4 A;  4AIL C;  1HNI A;  1UOC A;  4W5Q A;  4DQI A;  1BIU A;  4DMN A;  4DTM A;  1NK7 A;  1RT3 A;  4UQG A;  3V6D A;  3ZT1 A;  4G1Q A;  3NGY A;  1EKE A;  1D9F A;  3L2W A;  3RR7 A;  1WAF A;  3ALY A;  4DSE A;  1X1P A;  3RR8 A;  4BDZ A;  5EU7 A;  3ZT4 A;  1S6Q A;  3OS1 A;  1U48 A;  3UIQ A;  3ZSV A;  4YFU A;  4DWI A;  4CJR A;  2G8H A;  3OYF A;  4FJX A;  4FVM A;  3DLR A;  1KCF A;  2ZD1 A;  1WSH A;  1S1V A;  2HMI A;  1J54 A;  2Q3S A;  2KFN A;  4HUG A;  4ZHR A;  4K8Z A;  4Q0B A;  1TL1 A;  4CIE A;  4DQR A;  3V4I A;  2ITG A;  1W9H A;  3NF8 A;  4FLV A;  1IKW A;  4DQP A;  3O4N A;  3KJV A;  1CXU A;  3KTQ A;  3DRP A;  2QKB A;  5K14 A;  4CEC A;  3V9X A;  4CGH A;  3KD1 E;  2OPQ A;  4M3X A;  3CM5 A;  3E01 A;  1NOZ A;  3H08 A;  4WE1 A;  1RNH A;  4HUE A;  3AVC A;  1NJY A;  4OKK A;  3OYH A;  3AV9 A;  2IDO A;  1UWB A;  4I7F A;  3MEG A;  2X78 A;  2RPI A;  4DLE A;  2G8V A;  3V1O A;  3C6U A;  3IG1 A;  2WOM A;  2Z1G A;  4OVL A;  3ZSQ A;  3D45 A;  4CJQ A;  3LDS A;  2DFH A;  4FJ7 A;  2QXF A;  3NFA A;  3HVR A;  1XHZ A;  4N56 A;  2BDP A;  1C6V A;  2F96 A;  2VWJ A;  4MFB A;  1VSJ A;  1WSE A;  3HST B;  2KW4 A;  4NYN A;  4CJV A;  3V9W A;  4RW4 A;  5SWM A;  3S9H A;  4Z4I A;  3KKR A;  4CGJ A;  3LZI A;  5D3G A;  4RW7 A;  2KTQ A;  4NCB A;  4CJ5 A;  4KRF A;  3MXI A;  3CFP A;  4FM2 A;  3NF9 A;  2OPR A;  3HYF A;  1YT3 A;  4IDK A;  4CIF A;  4Z4E A;  1WAJ A;  4F8R A;  4FJ9 A;  3DLB A;  1QE1 A;  1Z25 A;  4NYF A;  4FJK A;  1HNV A;  4CER A;  3PV8 A;  2IAJ A;  1TGO A;  2D0C A;  1S1X A;  1S9G A;  4CJK A;  3KK2 A;  5E41 A;  2KZZ A;  1BIZ A;  4AHC A;  3OYJ A; 
#chains in the Genus database with same CATH topology
 2O8D A;  2YHW A;  1TKD A;  3K57 A;  4FVU A;  3CFR A;  3HM8 A;  3SJJ A;  4JI6 K;  2CGJ A;  4QOZ B;  3BGR A;  3CCR N;  3OJS A;  2V7Y A;  1VQM N;  2E8A A;  3OBY A;  5BPM A;  1VQ5 N;  3V9U A;  3NHG A;  3FE1 A;  4O0I A;  1Z26 A;  2E2N A;  4JS4 A;  2XRI A;  1SZ2 A;  3U6F A;  3HO1 A;  4NB4 A;  4ILG B;  1WNS A;  1I3A A;  5LMN K;  3CD6 N;  5EOY A;  4BG8 A;  4GV6 A;  4IKF A;  4CFC A;  4O8U A;  3AA2 A;  3HXM A;  3LAK A;  3HPH A;  4J2E A;  1T8E A;  4H5W A;  3G25 A;  4JI8 K;  1ZBH A;  1T6D A;  1GLF O;  1BHL A;  4E7L A;  3T3F A;  2A5X A;  2IVP A;  1WSJ A;  3BZK A;  4AM7 A;  2FF3 B;  3LDL A;  3HP6 A;  3LDO A;  3PX0 A;  2HW3 A;  2WC9 A;  5F0X A;  3ATV A;  1VSM A;  2PYJ A;  4BVO A;  1HPM A;  3QNO A;  1T7P A;  4H03 B;  4CK3 A;  4C8N A;  1RT4 A;  4CJW A;  1LV5 A;  1E4F T;  5HL7 L;  5BN8 A;  1YVN A;  1QQO A;  1KTQ A;  2ZF5 O;  5KRT A;  1RT5 A;  3KZB A;  4M3Z A;  4FK2 A;  4JI3 K;  1NLV A;  1KD1 O;  4DTR A;  4M3R A;  1NM1 A;  1YXQ A;  3ZX3 A;  2OZS A;  3VTH A;  1EET A;  1VQL N;  3FZK A;  3ZSY A;  4H0V B;  3C6T A;  1TL3 A;  1Y64 A;  5BN9 A;  1M1K O;  4YOT A;  4CBW A;  1VQK N;  4XIU A;  4MLH A;  4WQ5 C;  2GWJ A;  3PO5 A;  3AAQ A;  1NK4 A;  1NGI A;  3ZET B;  4F4K A;  1YUW A;  5AQS A;  3KK7 A;  1JLA A;  4PWD A;  5CHI A;  2QEX N;  4H4M A;  3AY9 A;  3THW B;  4FO0 A;  4DS5 A;  4Z4C A;  1SQK A;  3VQ6 A;  1DEJ A;  3KVG A;  1GLL O;  3OJU A;  2NRR A;  1GLE G;  3CCU N;  1S22 A;  3PIO L;  5AQW A;  4B9N A;  1VHX A;  3QFP A;  2D0O A;  4GW6 A;  3RWU A;  5HRN A;  3CYM A;  3SPZ A;  4HTU A;  4FL9 A;  4FLU A;  5AQX A;  2JGU A;  4CJ3 A;  4FPB A;  4CEE A;  1KFS A;  4AM6 A;  1TKX A;  2P9N B;  1NK9 A;  4IEE A;  2Q0R A;  3I0R A;  4KHW A;  1JLF A;  2OZM A;  3R8E A;  3E9P A;  3VEN A;  1EWQ A;  4DU3 A;  5JS2 A;  4FWN A;  4KKO A;  5DMR A;  4XH4 A;  4FJM A;  4DFJ A;  3VOV A;  3SPY A;  3EO3 A;  4CE9 A;  4GVE A;  1OKJ A;  4LFA K;  4LFB K;  4LH5 A;  1J5O A;  1XUP O;  3KHY A;  3QIC A;  1LAW A;  3K58 A;  2P51 A;  4B1V A;  4JKA A;  3TU5 A;  4CBU A;  4JHD B;  4GKJ K;  2QK9 A;  1HRH A;  2F8T A;  3THW A;  4CD1 A;  3C6A A;  3RMA A;  4IDH A;  4CJU A;  2P9K A;  2Q97 A;  3EE9 A;  4FW1 A;  4NCG A;  4EP5 A;  5KPT A;  5FRM A;  1YHQ N;  4DSJ A;  4A2A A;  4KV8 A;  2Q2R A;  1KLN A;  4AHS A;  3HBT A;  1K73 O;  1TKT A;  3AVJ A;  3CQX A;  3OYD A;  3HT3 A;  3L3U A;  3L4I A;  3IAY A;  4MO4 A;  4CZE A;  4I6M A;  2QM1 A;  4WFA L;  3ID8 A;  4FOE A;  3WEE A;  1U47 A;  4JI4 K;  1B92 A;  1EX4 A;  1TYQ B;  4H4O A;  3MWT A;  4PUO A;  2BUP A;  3VF4 A;  1RDU A;  1RBU A;  4AH9 A;  1BQM A;  2HF3 A;  4CZJ A;  4CIG A;  3OS2 A;  1HKB A;  2Y1I A;  1NGJ A;  3AVK A;  2HF4 A;  1TUY A;  3O3H A;  2QWN A;  3CFO A;  1BGX T;  3ENB A;  3O5B A;  4CES A;  3K59 A;  5J2N A;  3TI0 A;  3NE6 A;  1KVC A;  1FK9 A;  4JHD A;  2G8U A;  4F3O A;  4H0Y B;  3DYA A;  4CEQ A;  4LSL A;  3Q7B A;  3DI6 A;  5F2R A;  1N5Y A;  4CFA A;  3PIP L;  1Z05 A;  4EIA A;  3A5M C;  4C8K A;  5M1Q A;  2QTD A;  2KQ2 A;  5CYQ A;  1WUA A;  4LF4 K;  1NGH A;  1BI4 B;  1JKH A;  2V7Z A;  3I55 N;  5AQV A;  4BRF A;  4OLB A;  4BGB A;  4AHR A;  3TWH A;  3CC7 N;  3K0S A;  1IV0 A;  4CVN E;  3U4L A;  1L3S A;  1ATR A;  1KQS M;  3DXK B;  4OGC A;  4EZ6 A;  4FLZ A;  4JK7 A;  3BP8 A;  5LJW A;  1P8Z A;  2QWM A;  5AQI A;  1NNE A;  1KRP A;  4PKG A;  3V9S A;  4FWL A;  2GV9 A;  4BDY A;  3VPZ A;  5KRS A;  4C23 A;  4O5F A;  3TAQ A;  3L2U A;  1JL1 A;  1TKZ A;  3O3G A;  1RBS A;  4OLA A;  4BC2 A;  4HTL A;  3WT0 A;  1DLO A;  4DQQ A;  3TAG A;  1ZBS A;  1IJJ A;  3LDN A;  3HI0 A;  3VQ4 A;  5DM6 L;  3ZX0 A;  1XI1 A;  3PLA A;  3HK2 A;  1C0F A;  4W5T A;  1S1U A;  2PAV A;  1QSL A;  4CJ4 A;  2P9U B;  3THV A;  3QET A;  4FW2 A;  3LP1 A;  4CGD A;  5IWA K;  3CCL N;  3CPW M;  3TSP A;  1RTJ A;  4HUF A;  3WNG A;  1A5V A;  2E4L A;  4DR2 K;  4DR7 K;  1TUU A;  1QTM A;  4NLC A;  3OYI A;  3ZLJ A;  3GOI A;  1ATS A;  1X3N A;  4GNI A;  5GAD P;  1QVG M;  1NJW A;  4RTF D;  3AA4 A;  3VN5 A;  5J2Q A;  3MN7 A;  4J2A A;  4DR4 K;  2HVH A;  2NLX A;  4BQL A;  1RT2 A;  2Q0U A;  3MDQ A;  4KAZ A;  4AF1 A;  1KAZ A;  3RMB A;  4FJ5 A;  5M1N A;  3CI5 A;  5FPM A;  3VQ5 A;  3J7Y P;  3DRS A;  4BDP A;  1KC8 O;  1HYV A;  3WXJ A;  3TAB A;  4CZI A;  4KI6 A;  4C8L A;  5CZ2 A;  3AA5 X;  2P9U A;  5E84 A;  1NK6 A;  2YHX A;  1VQ4 N;  4B9M A;  1Q9X A;  4BRP A;  4MQ3 A;  2HHQ A;  1LW2 A;  3AVB A;  4A2B A;  1NJX A;  3MK6 A;  4YOX A;  2RKI A;  1LWF A;  3E1Y A;  2B4J A;  4IFV A;  3BDP A;  3DLH A;  3ZT0 A;  5LY3 A;  2VGN A;  3NF6 A;  4F2R A;  1HNI A;  4W5Q A;  4DQI A;  1RT3 A;  2DPN A;  4G1Q A;  4JKB A;  3NGY A;  3OW2 M;  1X1P A;  4BDZ A;  3ZT4 A;  1S6Q A;  1U48 A;  2F9T A;  4CBX A;  3OYF A;  4FJX A;  1WOQ A;  1KAX A;  3DWL A;  1WSH A;  4B1X B;  5JLF A;  2WBN A;  4XH1 A;  4Q0B A;  3V4I A;  3NF8 A;  1W9H A;  3O4N A;  1ILY A;  3DRP A;  2QKB A;  5K14 A;  4CEC A;  4CGH A;  1VQO N;  3KD1 E;  4M3X A;  1W2B M;  3CM5 A;  4CJ7 A;  4WE1 A;  4HUE A;  4O8K A;  4BRQ A;  4OKK A;  3ULE B;  3OYH A;  1XC3 A;  5FLX O;  2G8V A;  3CJA A;  2Z1G A;  3J8A A;  4OVL A;  3VGK A;  3ZSQ A;  4M63 C;  4X62 K;  3L0Q A;  2QWP A;  1OVY A;  3CJ9 A;  3VGM A;  3MN6 A;  3O08 A;  3QBW A;  1C6V A;  1N33 K;  3GE1 A;  1G99 A;  2KW4 A;  3KKR A;  3VES A;  4BRH A;  4RW7 A;  4CJ5 A;  3CFP A;  4MO5 A;  4FM2 A;  3IUC A;  2OPR A;  4IDK A;  1BG3 A;  3ID6 A;  1WAJ A;  4FJK A;  4CER A;  3KK2 A;  1S9G A;  3H1Q A;  1BIZ A;  3G71 N;  4L8R B;  2UYT A;  2G8I A;  5CR4 A;  3AO5 A;  4A59 A;  4MLE A;  1XMO K;  4BR7 A;  2E2P A;  4ZTJ A;  1HYZ A;  2FSK A;  3M8Q A;  5I9E B;  4WFB L;  2ETJ A;  3QNN A;  5TKY A;  3OYK A;  2F8S A;  2NRT A;  2WUS A;  5M1O A;  3ULE A;  3SK3 A;  1K8K B;  4GVM A;  2O4G A;  1SL0 A;  4QCL A;  1U04 A;  4DF4 A;  5HOO A;  2B5J A;  2V52 B;  2PY5 A;  3VF2 A;  4NXN K;  1W97 L;  3ZSO A;  4K0K K;  1FJG K;  1J9A A;  2RE2 A;  3AO3 A;  1NOY A;  3NDK A;  3AVA A;  3MEC A;  1SKW A;  3ISN C;  3EE8 A;  1ITG A;  5MLC Q;  4J2B A;  4BRC A;  1Q8I A;  3CHW A;  3T1Y K;  1D9D A;  4CEA A;  4Z4F A;  3GBT A;  1OH5 A;  5AQQ A;  3VA3 A;  3CMA N;  3AGK A;  3T69 A;  5KPZ A;  2YKM A;  1WN7 A;  1CLQ A;  2IGI A;  1XHX A;  4DS4 A;  2A1R A;  5C24 A;  4YOW A;  4CHY A;  3THY B;  3SNN A;  3D6R A;  3H45 C;  2H3G X;  3ZEU B;  4DUY K;  5HRO A;  2ZM6 K;  5I42 A;  4JKE A;  3LAL A;  3LWM A;  5GAG P;  1VSD A;  5DM7 L;  1TK8 A;  4Z4G A;  3HSC A;  4Q5V A;  2VWB A;  1C1C A;  1JXB A;  4RWT A;  1JXE A;  1B9F A;  2E5L K;  1VK0 A;  4HCB A;  3H46 O;  4DV7 K;  3QEV A;  4WFN L;  4CF1 A;  4IOX A;  1BCM A;  4QAG A;  1QZ5 A;  2OCE A;  4BY9 C;  2O8D B;  4EAH D;  1WSG A;  2UUB K;  2OPS A;  1T3V A;  4JI1 K;  5A2Q O;  2VG6 A;  4B1Y B;  4RW8 A;  1IBL K;  4KHP K;  2KFZ A;  5C25 A;  4BE2 A;  4OKE A;  3QB0 A;  1C0U A;  4QS7 A;  4BR5 A;  3T19 A;  5EY4 A;  5F1X A;  2NRZ A;  3CJB A;  5AZI A;  2IIR A;  4M7X A;  3CCJ N;  1BL3 A;  3U3Y A;  4RG8 A;  2P9S B;  4UY8 O;  4B9Q A;  4GKK K;  4GV9 A;  1N34 K;  4QS9 A;  4DSK A;  1T05 A;  1MA9 B;  2E2O A;  1LAV A;  3ZEU A;  3PSI A;  1NK0 A;  1MU2 A;  4ZTF A;  2FF6 A;  4PA1 A;  3THX B;  2QWR A;  3CC2 N;  1UA0 A;  2NRH A;  3NVK A;  2HBJ A;  3KKS A;  2XY6 A;  2A40 A;  4FWS A;  1C0T A;  1TAQ A;  4LF8 K;  1Q81 O;  1SL1 A;  3AAR A;  2YJF A;  4BAC A;  2HBL A;  5LL6 Z;  5EXW A;  2P5O A;  3S3N A;  4CHO A;  2FBT A;  1NGA A;  1NJZ A;  3SQ2 A;  3P5J A;  3NCI A;  4JI7 K;  4W5O A;  1H1V A;  1CZA N;  1HLU A;  3JXU A;  4CJL A;  3K2P A;  2O8B A;  4ELV A;  4U67 L;  4M3W A;  3RTV A;  4CZH A;  3NH1 A;  3SZ2 A;  1CXQ A;  3SQ4 A;  3CJ1 A;  4KH4 A;  2P9S A;  1FW6 A;  2GBZ A;  5AQZ A;  3PSF A;  3ENO A;  2HNY A;  3LP3 A;  4U7B A;  1IBM K;  1J53 A;  5BR8 K;  4B3S K;  2QWL A;  4CJS A;  3THX A;  5BRD A;  4JD2 B;  5CYM A;  4LFC K;  2D0B A;  3QEW A;  3BUZ B;  3CCE N;  3AA3 A;  1ZBU A;  3VQD A;  3NAE A;  3LP0 A;  3G4S N;  4NLB A;  4CI6 A;  1WLJ A;  5AFU A;  3KWI A;  3H6E A;  5AFU H;  3TTD A;  3KLI A;  1QVF M;  3DLE A;  2QI2 A;  2YI1 A;  2A1S A;  4BRE A;  1DTT A;  1ZBF A;  3OHR A;  4IJA A;  4OO1 J;  1BIS A;  1ASV A;  4N41 A;  1JLC A;  5KPR A;  4JRQ A;  3HPG A;  4CJF A;  4CEZ A;  2VWK A;  3FGU A;  2YJE A;  3CQY A;  3I0S A;  1YIJ N;  3BF1 A;  2FXU A;  1P90 A;  4JLH A;  4A5B A;  5AQN A;  1YJ9 N;  3KIO A;  4FLT A;  3TAM A;  2P9I B;  3GDQ A;  2VQF K;  2NZT A;  3CF5 L;  2HHX A;  4C8O A;  4EHT A;  2BE2 A;  3KLG A;  2FBX A;  4CGG A;  5FPN A;  3ULD A;  1LOT B;  3WNF A;  2ZJP L;  5FRO A;  1QHT A;  3P38 A;  4FLX A;  4M42 A;  4JD2 A;  3K5M A;  4KTQ A;  3RMD A;  4WCE L;  3S3M A;  1NK8 A;  1NKC A;  3WXI A;  4B9T A;  3BF3 A;  3MXJ A;  3W0L A;  1WBD A;  4CK2 A;  1GLB G;  3AO4 A;  1SKR A;  2Z1J A;  4JI0 K;  3E9L A;  2GTD A;  4PHT X;  2P9P A;  2GUP A;  1W7A A;  1J5E K;  3OYA A;  2ZJQ L;  3OYE A;  3LDP A;  1RDC A;  2P5G A;  2Z1I A;  2G8K A;  4FJI A;  5HP1 A;  2EHG A;  3IMX A;  4DF8 A;  2P9K B;  1MWM A;  1T6C A;  3QO9 A;  4X65 K;  2P9I A;  4NCA A;  1JCF A;  3ZT2 A;  3QER A;  3VQA A;  1RGI A;  3TAN A;  5AQK A;  4PL7 A;  4NXM K;  4CEO A;  4CW7 B;  4N5S A;  2X6S A;  2KZM A;  3DMJ A;  5GIN A;  4FJH A;  3TAR A;  4K8X A;  4I6M B;  1K6Y A;  3WEE B;  3H3N O;  5KGX A;  2GX9 A;  4JI2 K;  2O8C B;  2HND A;  5ELZ A;  1U49 A;  3RMC A;  1QS4 A;  3CJC A;  1WSF A;  2YHY A;  5C10 A;  4B3O A;  3PX6 A;  4X66 K;  3L2V A;  2ZWH A;  3D0P A;  3DXM B;  4BE1 A;  1HNW K;  2HHU A;  4ICL A;  1TAU A;  3MED A;  2D4W A;  4DB3 A;  5CE3 A;  3AO1 A;  4IJN A;  5JIC A;  4OPK A;  1YJW N;  3M8R A;  1JLE A;  3NF7 A;  4JYA K;  3LL3 A;  3T7Z A;  3J7Z O;  4V19 S;  4DQ8 A;  4H8K A;  1S3X A;  3DM2 A;  3RRG A;  5HRR A;  1YTU A;  3SJH A;  2IS3 A;  3G0Z A;  5BRE A;  4B9V A;  5FPE A;  3LM2 A;  2GWK A;  1YAG A;  3C94 A;  2A41 A;  3O6W A;  3AVH A;  3ENH A;  4K42 A;  4WQ5 A;  4Z0U A;  3RSE B;  1N36 K;  3JS6 A;  4F2S A;  1IKY A;  3QES A;  4EP4 A;  3AVF A;  2EX3 A;  3JSM A;  3MX5 A;  3QFU A;  2O8C A;  3VQC A;  1SAZ A;  2HHS A;  1VQ9 N;  4KRE A;  4CFB A;  3AVL A;  2Z1H A;  2E1Y A;  2YHA A;  4JKG B;  5AQJ A;  3DXM A;  4J8F A;  2RN2 A;  3PY8 A;  1RDA A;  4RCH A;  2RHK A;  3NGZ A;  1RT6 A;  4FWP A;  4BR9 A;  1UOC A;  5AQR A;  1ZXO A;  3V6D A;  2E20 A;  4WQ4 A;  2O8E B;  1EKE A;  2VCP A;  5GIO A;  1D9F A;  3L6Q A;  3RR8 A;  1EQY A;  3ZSV A;  3SMP A;  3WUH A;  4CJR A;  3EEQ A;  2ZD1 A;  2CH5 A;  1S1V A;  2BTF A;  2HMI A;  2KFN A;  4HUG A;  3NMU A;  4WYB A;  4DQR A;  3FR0 A;  3RSE A;  2OTJ N;  4DQP A;  4BRL A;  1CXU A;  2OPQ A;  3A5N C;  1NOZ A;  3M3Z A;  3CXC M;  4CZG A;  3I56 N;  2IDO A;  4BRG A;  2RPI A;  3V1O A;  3C6U A;  2WOM A;  4HWI A;  3D45 A;  3LDS A;  3HVR A;  2ASP A;  4JKG A;  5AQG A;  1XHZ A;  2VWJ A;  4CJV A;  5AQM A;  4BR0 A;  4RW4 A;  2HBM A;  4Z4I A;  3OBW A;  4IO8 A;  2D1K A;  4KRF A;  2O8E A;  3CER A;  4BQZ A;  1YT3 A;  4CIF A;  2PBD A;  4Z4E A;  3FLC O;  4YHH K;  3IFR A;  5BRH A;  1WBB A;  1HNV A;  3VEV A;  1NK5 A;  2F4V K;  5E41 A;  4Y0W A;  2KZZ A;  3OYJ A;  4DHY A;  3VQ9 A;  3R9P A;  4B08 A;  4YNQ A;  1VQN N;  2ASO A;  3AAP A;  1BQN A;  3UKU B;  3CG7 A;  4R5P A;  3DOK A;  3LDQ A;  4B1W B;  2A42 A;  3ATU A;  1TVR A;  1XC9 A;  4H0P A;  4BR4 A;  1C1A A;  4C1N K;  4A61 A;  2DFF A;  1W0H A;  1NGF A;  4JK9 A;  3JAM O;  3SUN A;  3M1F A;  3EKS A;  3WQT A;  5JLH A;  3MMV A;  4XH5 A;  1HQE A;  4DSF A;  4KO0 A;  4O44 A;  3OS0 A;  3M8S A;  4FOI A;  3LAM A;  3WNE A;  3SQ1 A;  1S1T A;  3N4Q A;  4PKI A;  1IKV A;  4DSL A;  2LSN A;  3DOL A;  3RRH A;  4CGF A;  1IG8 A;  3MX2 A;  1RIL A;  5HBM A;  4E89 A;  4RW6 A;  4H5R A;  1KVB A;  3OYN A;  4QS8 A;  3SMS A;  3MXM A;  1HJO A;  3H3O B;  5C15 A;  2ZJR L;  5FPD A;  1NU0 A;  4B8C A;  1WB9 A;  2ZQB A;  3LPT A;  3UKU A;  1Q18 A;  3U9D A;  3OYM A;  1VQ8 N;  4IZ9 A;  5BR9 A;  1FXX A;  5BPL A;  1C1B A;  1S5J A;  1RBR A;  4H0X B;  4CFD A;  4AHU A;  1RT1 A;  1DKG D;  3TSU A;  2I7P A;  4KHU A;  1RT7 A;  5AR0 A;  4MDB A;  4NO7 A;  3B6O A;  3G6E N;  3H1V X;  1S1W A;  5J2P A;  2RF2 A;  3I8D A;  3L4Q A;  1VAZ A;  2ASM A;  4FCY A;  4B8A B;  1T03 A;  4DFP A;  3KLF A;  1V4T A;  4CF8 A;  3O8M A;  3HRG A;  4PKH A;  2YNH A;  5BPN A;  1LWE A;  4GMJ B;  4HHT A;  3A2F A;  2FBV A;  3RVC A;  4BRM A;  1DTQ A;  3OYL A;  3QIN A;  3SUP A;  4JV5 K;  1IKX A;  3ZSW A;  2OAN A;  2P9L A;  5M1P A;  4B1Z A;  3PUF A;  1D5A A;  3E9O A;  1YTA A;  1XQS C;  5GAE P;  4ELT A;  2AA4 A;  5AJ3 K;  4DSI A;  4E1N A;  3JYT A;  4KI4 A;  1QSY A;  1NGC A;  3EY1 A;  4IOA L;  3D7E O;  1NKE A;  3CIP A;  4FPA A;  3SQ0 A;  3D2E A;  4LSN A;  3EZ5 A;  3PO4 A;  3OYC A;  1QZ6 A;  3AGR A;  4CCH A;  1NGD A;  4OPJ A;  2G8W A;  4FLY A;  5HRS A;  2Q1N A;  3F9K A;  5H1S Q;  3O9U A;  3EN9 A;  1NWK A;  5C12 A;  4CZL A;  1S6P A;  4IFY A;  4FXD A;  1SUQ A;  1X9J A;  4LF7 K;  1RDB A;  1UAX A;  2W41 A;  3MN9 A;  1TV6 A;  1RDD A;  1U45 A;  4PY5 A;  4IWV A;  4B9U A;  1VSK A;  4A62 A;  3S3O A;  3BEX A;  2UU9 K;  2YNI A;  4H0O A;  3TTF A;  4OJR A;  4CHQ A;  1HKG A;  4OX9 K;  1RBT A;  3HPO A;  1KSP A;  4JN4 A;  3B6P A;  4LH4 A;  1NGB A;  3LPU A;  2IOC A;  3SCX A;  2VQE K;  4E19 A;  5AZI B;  4FZZ A;  4JRP A;  4OGE A;  1BO5 O;  4FWR A;  4JK8 A;  3QEI A;  1YVU A;  3DRR A;  4M41 A;  4JNE A;  3TAE A;  3WNH A;  2I5J A;  1BWF O;  5LMU K;  3L2Q A;  4OPH A;  2GEM A;  4FM0 A;  5LJV A;  3IS9 A;  4O5B A;  1QSS A;  2P1J A;  4M45 A;  4DV1 K;  2NRW A;  4LY7 A;  3I33 A;  4M3U A;  1HPZ A;  5CY4 A;  1VRU A;  5CZ1 A;  3SBT A;  2QXL A;  2YNG A;  1JLG A;  1QQM A;  1G15 A;  4ILH A;  5KI6 A;  5HRP A;  3U9Z A;  4BC5 A;  3CCM N;  1YIT N;  4X64 K;  3MCA B;  2O8B B;  4GY2 B;  4KBO A;  4KPY A;  4KFB A;  1HQU A;  2HHW A;  2F7T A;  5SZT A;  3LP2 A;  3C0B A;  3FZH A;  2A3Z A;  1R0A A;  2DTU A;  4DV5 K;  4DG1 A;  1X9M A;  4BC4 A;  5KTQ A;  2DY4 A;  4C1N I;  1BCO A;  4OPA A;  5JS1 A;  4G9Z A;  4JKC A;  3J80 O;  2NRX A;  1IBK K;  2BGG A;  3ASM A;  4O0J A;  1JL2 A;  1GLC G;  3ZT3 A;  4DTP A;  3DLG A;  4DQS A;  4DLG A;  2FBY A;  2AJQ A;  2HNZ A;  3QML A;  3EYZ A;  1XWL A;  5AQY A;  1IG9 A;  1X3M A;  2HST A;  3VA0 A;  4LC9 B;  5AZJ A;  2BH1 A;  1RTI A;  3VQP A;  1BA0 A;  1NG9 A;  3S41 A;  4BWM A;  2PYL A;  4CZF A;  4PL8 A;  3M8P A;  4ELU A;  4FWQ A;  2KHO A;  1SKS A;  3MEE A;  1J6Z A;  4CD3 A;  5TKW A;  1JJ2 M;  1HR0 K;  4M3Y A;  5J1E A;  3AVM A;  3T1A A;  3LWL A;  2FSN A;  4F3T A;  3Q7C A;  2HB5 A;  3ZSZ A;  3LAN A;  3OYG A;  3HOS A;  1E4G T;  3AO2 A;  3CC4 N;  4LF5 K;  4YDU A;  3VQ7 A;  2WTU A;  2OTL N;  1L3V A;  3VEZ A;  5C2D A;  1X9W A;  2Q31 A;  3O9T A;  4ID1 A;  5B8H A;  3DLL L;  2V51 B;  3O3F A;  3GG4 A;  2YKN A;  1KVA A;  5AQU A;  3CM6 A;  3HTV A;  3SV4 A;  3C95 A;  4DV0 K;  3V1Q A;  2OYQ A;  5BRF A;  4BRO A;  5JMV A;  3CJ7 A;  4N76 A;  2P9P B;  4CJT A;  3HM9 A;  1GOB A;  3M6G A;  4Y1D A;  1XNQ K;  1T44 A;  3KLE A;  1Q82 O;  2JWK A;  3HL8 A;  4DR1 K;  3CQ8 A;  5EX5 A;  4I2P A;  4AHV A;  2W6K A;  4XEI A;  1SL2 A;  2X74 A;  3D2F B;  3HJF A;  4I9Q A;  4IOC L;  1Q7Y O;  4RW9 A;  1OH7 A;  1TK5 A;  1Y97 A;  3TPQ A;  2YHB A;  4ID5 A;  1GOA A;  1U6Z A;  4B1U B;  1LCU A;  3EL2 A;  1Z6R A;  4KHY A;  3CME N;  1BIU A;  4DMN A;  3IKM A;  1NK7 A;  3WQU A;  3ZT1 A;  1BUP A;  3RR7 A;  5EU7 A;  2VGM A;  3OS1 A;  1JCE A;  4DV2 K;  2G8H A;  1VQP N;  1OH6 A;  1GLD G;  1J54 A;  2Q3S A;  4BR2 A;  4CIE A;  2EWS A;  3A5O C;  4FLV A;  3KJV A;  3KTQ A;  3V9X A;  3VEW A;  3E01 A;  3H08 A;  3VEO A;  1EWR A;  1NJY A;  4DKW A;  3VTI A;  3MEG A;  2X78 A;  3D2F A;  3IG1 A;  1E3M A;  5EVZ A;  2DFH A;  4FJ7 A;  2QXF A;  3NFA A;  4JKF A;  5E26 A;  2BDP A;  1VSJ A;  1WSE A;  4NYN A;  3V9W A;  2QWQ A;  5SWM A;  3S9H A;  2UXD K;  5D3G A;  4A5A A;  1XNR K;  3NF9 A;  3HYF A;  4DUZ K;  2IVN A;  3FZF A;  2QA4 N;  4F8R A;  4JKD A;  3HOT A;  2J4R A;  1K8A O;  1Z25 A;  4R79 A;  3O1B A;  4WQ4 C;  4LF6 K;  1TGO A;  2D0C A;  4CJK A;  4JI5 K;  5DK5 A;  5C42 A;  1S9E A;  3A5L C;  4DFK A;  2ATQ A;  3U8X A;  2VYP A;  1HKC A;  4ISE A;  4FWK A;  1JLQ A;  2Y1J A;  4Y1C A;  3ZYY X;  3CCV N;  4FZY A;  1C0M A;  4DTN A;  4BRD A;  1BA1 A;  3C7N B;  3GL1 A;  3NBP A;  1U2V B;  3P83 D;  3KK1 A;  3KLH A;  4FJ8 A;  4N47 A;  3NH2 A;  4A57 A;  3ZET A;  3ZSR A;  2PZS A;  2R7Y A;  2XO7 A;  3KK3 A;  4BRA A;  2F9W A;  1KLM A;  4FWO A;  2JLE A;  2D0P A;  2PFU A;  4B3M K;  1O1W A;  4BC3 A;  2KKZ A;  2VG7 A;  3MAQ A;  1VSE A;  3A8Y A;  3HZ6 A;  1ASU A;  3J7A P;  3W3D A;  3OY9 A;  1LWC A;  4DTJ A;  4I9L A;  5HLF A;  2XY8 A;  4PQU A;  2GEL A;  3R6M A;  3K9J A;  1VQ7 N;  4C8M A;  1D8Y A;  5KGW A;  2P9N A;  4DR5 K;  3K5O A;  4JKH A;  4JAX A;  4OKJ A;  5AQP A;  3V1R A;  5AQO A;  2D0A A;  3CET A;  5GIP A;  1N32 K;  3HP9 A;  4HVJ A;  3C7N A;  4IBN A;  2BAN A;  3QLH A;  1N6Q A;  4J2D A;  1U2V A;  1ATN A;  4W5R A;  5M1K A;  4FJJ A;  1N8R O;  4FJN A;  3VQE A;  4ILJ A;  3SBG A;  5ADX A;  4CK1 A;  1I94 K;  5ADX H;  2NRV A;  3A0I X;  3L3V A;  2W6L A;  3QEP A;  4FYD A;  1RTD A;  1L5U A;  1NGE A;  4M3T A;  4I2Q A;  3C6H A;  2UUC K;  3VEX A;  4CED A;  1OVQ A;  1BU6 O;  2I7N A;  3I8B A;  4BRI A;  4FLW A;  3SV3 A;  3QEX A;  1C0G A;  1UA1 A;  4CHP A;  4GV3 A;  2HBK A;  3NVM A;  4KHS A;  1FKP A;  4K41 A;  4O55 A;  2NNW A;  4DTX A;  3HVT A;  4FSV A;  2IC3 A;  2JWL A;  4LD0 A;  4F9O A;  4LF9 K;  2GUI A;  4CZK A;  3O4W A;  4FK4 A;  2HOE A;  5KQD A;  1QHA A;  5AQH A;  3AVG A;  1ASW A;  2XY5 A;  3FFK B;  3BZC A;  3MCP A;  3V81 A;  3N4P A;  3LZJ A;  4DTU A;  4H5T A;  1TYQ A;  4H0T B;  1YI2 N;  3R3L A;  1EO1 A;  4JS5 A;  1YF5 L;  1HYS A;  4IFE A;  3U3G A;  4DR6 K;  2AP1 A;  5JVH L;  3T1H K;  1HJR A;  1RCH A;  1NGG A;  1NBW A;  4H5N A;  1NMD A;  3K9K A;  1IH7 A;  2XHB A;  2HHV A;  1ZC6 A;  3SAH A;  5C2F A;  4FZX C;  2E6M A;  3O9Q A;  3QBX A;  4FJL A;  1R59 O;  3AVI A;  2NUB A;  3MXI A;  3WXM B;  4O4G A;  1VRT A;  1KFD A;  4BWJ A;  5T7B A;  4HCC A;  4E1M A;  4DU1 A;  2ZGZ A;  4JEP A;  4FK0 A;  1RDW X;  1RFQ A;  1F21 A;  3OA9 A;  3NGI A;  1VQ6 N;  1M90 O;  2YX6 A;  3VGL A;  5J2M A;  3V9Z A;  5FRN A;  1BI4 A;  1GLA G;  4DV3 K;  3QDK A;  4KB0 A;  4FJG A;  4CJP A;  5FDL A;  1XMQ K;  3FFI A;  3IDH A;  4B3T K;  3OYB A;  2CGL A;  1B9D A;  1VSL A;  4B9L A;  4DR3 K;  1CZ9 A;  3DXK A;  5AQT A;  2YV0 X;  2O8F B;  4KTW A;  1LW0 A;  4BRN A;  3VQQ A;  4DV6 K;  4CF9 A;  1DT9 A;  1EXQ A;  1D4X A;  3MN5 A;  4AQY K;  3VMF B;  2CH6 A;  3VER A;  2QW9 A;  3UB5 A;  4CHN A;  1WSI A;  3G10 A;  1RBV A;  4E3S A;  3EKU A;  5AQF A;  4EZ9 A;  4AHT A;  4IEI A;  2HHT A;  1MWK A;  2P9L B;  2G8F A;  4YOU A;  3QIO A;  3EZW A;  3CCS N;  1HUX A;  3UKR B;  1JCG A;  4K43 A;  4H5V A;  1VSI A;  3ZSX A;  2E6L A;  3SYZ A;  4KB1 A;  1V4S A;  4IXC A;  2O4I A;  3O4Q A;  3OVN A;  1ZBL A;  1EP4 A;  3F9M A;  2FC0 A;  3FZL A;  4W5N A;  1K9M O;  4WF9 L;  1NJI O;  3SI6 A;  1HMV A;  1X9S A;  3D2E B;  2E88 A;  2A6A A;  1A5W A;  1Q9Y A;  4DFM A;  3ZCM A;  4CF2 A;  2O8F A;  2YNF A;  1ZYQ A;  3WXK A;  1REV A;  3TAP A;  4KTZ A;  4M7Y A;  4TSX A;  2ZGY A;  4KH6 A;  2E1Z A;  2W40 A;  1I39 A;  4FWM A;  3VET A;  4DTS A;  4IG3 A;  3M5R A;  4DTO A;  3O1W A;  1QQC A;  3QIP A;  1RTH A;  1KXP A;  2W42 A;  3F73 A;  3L8B A;  3UKR A;  4E7H A;  5M1F A;  3J81 O;  1TK0 A;  3CPE A;  4CJE A;  4K25 A;  3VQB A;  5GAH P;  3LM9 A;  3IRX A;  3TAF A;  4KHN A;  4BE0 A;  3P39 A;  1CZB A;  3O9R A;  3SUO A;  3TR8 A;  1HX1 A;  2D5R A;  3KWG A;  3F2K A;  2E2Q A;  1Q86 O;  2QKK A;  2HMP A;  1NKB A;  1YJN N;  4EFH A;  3P1G A;  3CCQ N;  2OPP A;  4E0D A;  3O80 A;  4Z4H A;  4E7K A;  4B9S A;  4CEB A;  1A5X A;  3L2R A;  4Z94 A;  2X6N A;  3MWP A;  4CEF A;  3BY5 A;  3O9S A;  3TSQ A;  2XY7 A;  3FZM A;  1L3U A;  1GOC A;  2VG5 A;  4CZM A;  3DAW A;  2HHH K;  4CHZ A;  2Q36 A;  3KD5 E;  3TTC A;  2FLO A;  1DGK N;  1S72 N;  2FSJ A;  4IO9 L;  4DCH A;  3DLK A;  1VSF A;  1JLB A;  4E7J A;  5I3U A;  4BG9 A;  1ZBI A;  3P4I A;  4L3Q A;  4ISF A;  4KH5 A;  1BDG A;  2KLA A;  4IG0 A;  1SV5 A;  1FKO A;  2DFE A;  2ITM A;  4YOR A;  4FM1 A;  3SUQ A;  2UXC K;  3DJC A;  3P31 A;  3AVN A;  3VQ8 A;  3C65 A;  2ZE2 A;  3K5N A;  4BRK A;  1BOT O;  1MDU B;  3K5L A;  3OTO K;  4E7I A;  1VSH A;  4CGI A;  3F5T A;  3NH0 A;  1L3T A;  4CF0 A;  5JVG L;  2OA8 A;  2B6A A;  2WFB A;  1ESV A;  1HNX K;  2HVI A;  3ITH A;  2WON A;  1U4B A;  4KHQ A;  1KAY A;  3ZX2 A;  3E66 A;  3VF6 A;  4B3R K;  5AZJ B;  4YY3 K;  4YOV A;  4DU4 A;  3UE5 A;  3R1X A;  5AQL A;  1IO2 A;  4BGA A;  2CGK A;  3PX4 A;  4AIL C;  4DTM A;  5C0Y A;  4MDA A;  4UQG A;  2UXB K;  3L2W A;  1WAF A;  3ALY A;  4DSE A;  4YDU C;  3SLC A;  1K8K A;  1NMN A;  1QQN A;  3SAF A;  4YFU A;  4E1J A;  4FVM A;  3DLR A;  1KCF A;  4ZHR A;  4K8Z A;  1TL1 A;  2ITG A;  1IKW A;  4BVP A;  2IVO A;  1RNH A;  3AVC A;  1O13 A;  3AV9 A;  1UWB A;  5KQ8 A;  4I7F A;  4DLE A;  4EHU A;  3SAG A;  2YCH A;  3B8A X;  1GLJ O;  4CJQ A;  1OH8 A;  3THY A;  3WXL A;  4N56 A;  2UUA K;  2F96 A;  3VEY A;  4MFB A;  1SS6 A;  3HST B;  1HNZ K;  3LZI A;  4CGJ A;  4YOY A;  2KTQ A;  4NCB A;  4ISG A;  4DV4 K;  4FJ9 A;  3DLB A;  1QE1 A;  4NYF A;  5IT9 O;  3PV8 A;  2IAJ A;  1S1X A;  3UIQ A;  4DWI A;  4AHC A;  2QWO A; 
#chains in the Genus database with same CATH homology
 5DK5 A;  5C42 A;  3VQ9 A;  2G8I A;  1S9E A;  4B08 A;  4DFK A;  4YNQ A;  2ATQ A;  3AO5 A;  1TKD A;  3K57 A;  1BQN A;  3CFR A;  1JLQ A;  3SJJ A;  4R5P A;  3CG7 A;  4Y1C A;  3DOK A;  4CHO A;  2Y1J A;  4ZTJ A;  1HYZ A;  4QOZ B;  3BGR A;  3M8Q A;  4FZY A;  1C0M A;  2ETJ A;  4DTN A;  3OJS A;  3QNN A;  3OYK A;  2F8S A;  1TVR A;  3NBP A;  1XC9 A;  1C1A A;  3V9U A;  3NHG A;  2DFF A;  4GVM A;  3P83 D;  3KK1 A;  2O4G A;  1SL0 A;  3KLH A;  4FJ8 A;  4O0I A;  1Z26 A;  1U04 A;  1W0H A;  4N47 A;  4QCL A;  3NH2 A;  3SUN A;  4DF4 A;  1N6Q A;  2B5J A;  3ZSR A;  2PZS A;  2PY5 A;  2R7Y A;  4JS4 A;  2XRI A;  3U6F A;  3HO1 A;  2XO7 A;  3KK3 A;  3ZSO A;  1WNS A;  1I3A A;  3PO4 A;  1J9A A;  4IKF A;  3AO3 A;  1KLM A;  1HQE A;  2JLE A;  4DSF A;  4KO0 A;  1NOY A;  4O44 A;  4CFC A;  3OS0 A;  3AA2 A;  3M8S A;  3HXM A;  3LAK A;  3NDK A;  1O1W A;  3AVA A;  3HPH A;  3MEC A;  3ISN C;  3LAM A;  3WNE A;  3SQ1 A;  1ITG A;  1S1T A;  1T8E A;  4J2B A;  4J2E A;  2VG7 A;  1Q8I A;  3MAQ A;  1VSE A;  1IKV A;  4DSL A;  1ASU A;  1SKW A;  2LSN A;  3DOL A;  3RRH A;  4CEA A;  4CGF A;  1D9D A;  4Z4F A;  1ZBH A;  1RIL A;  5HBM A;  4Q5V A;  3OY9 A;  4E89 A;  4RW6 A;  1LWC A;  3VA3 A;  4DTJ A;  1KVB A;  3OYN A;  1BHL A;  2YKM A;  4E7L A;  3T3F A;  1WN7 A;  3MXM A;  1CLQ A;  2IGI A;  4I9L A;  1XHX A;  4DS4 A;  2A1R A;  1WSJ A;  5HLF A;  5C24 A;  2XY8 A;  4PQU A;  4CHY A;  4C8M A;  4B8C A;  5KGW A;  3SNN A;  1D8Y A;  3K5O A;  3HP6 A;  3PX0 A;  2ZQB A;  3LPT A;  4OKJ A;  2PYJ A;  2HW3 A;  3OYM A;  1VSM A;  5HRO A;  5I42 A;  3V1R A;  2D0A A;  3LAL A;  3LWM A;  3QNO A;  3HP9 A;  1T7P A;  1VSD A;  4HVJ A;  1FXX A;  4IBN A;  1TK8 A;  4Z4G A;  2BAN A;  1C1B A;  4CK3 A;  1S5J A;  3QLH A;  4C8N A;  1RT4 A;  1C1C A;  1JXB A;  1RBR A;  4AHU A;  4CJW A;  1JXE A;  1B9F A;  4CFD A;  1VK0 A;  1RT1 A;  1LV5 A;  4W5R A;  4HCB A;  5KRT A;  1KTQ A;  4KHU A;  1RT7 A;  1RT5 A;  4FJJ A;  4FJN A;  3VQE A;  3QEV A;  4M3Z A;  3B6O A;  4FK2 A;  4CK1 A;  4CF1 A;  1S1W A;  5J2P A;  2RF2 A;  4DTR A;  4M3R A;  1BCM A;  4QAG A;  3I8D A;  2OZS A;  1EET A;  4FCY A;  3L3V A;  3ZSY A;  1WSG A;  4B8A B;  3QEP A;  3C6T A;  1RTD A;  2OPS A;  1L5U A;  4M3T A;  4FYD A;  1T03 A;  4DFP A;  1TL3 A;  3KLF A;  4I2Q A;  2VG6 A;  4RW8 A;  4CED A;  4CF8 A;  2KFZ A;  5C25 A;  4XIU A;  4BE2 A;  4FLW A;  3SV3 A;  3QEX A;  1UA1 A;  4OKE A;  2YNH A;  4CHP A;  4KHS A;  3PO5 A;  1C0U A;  1FKP A;  4O55 A;  1LWE A;  4GMJ B;  3T19 A;  4HHT A;  4DTX A;  3A2F A;  3HVT A;  2FBV A;  1NK4 A;  2IC3 A;  1BL3 A;  1DTQ A;  3U3Y A;  4LD0 A;  4RG8 A;  3OYL A;  2GUI A;  3QIN A;  3SUP A;  1IKX A;  4F4K A;  4FK4 A;  4DSK A;  3ZSW A;  1JLA A;  4PWD A;  1T05 A;  3AVG A;  1ASW A;  2XY5 A;  1LAV A;  1NK0 A;  4H4M A;  1MU2 A;  3PUF A;  4ZTF A;  4DS5 A;  3V81 A;  4Z4C A;  4PA1 A;  1D5A A;  3VQ6 A;  3LZJ A;  1YTA A;  4DTU A;  3OJU A;  4ELT A;  1UA0 A;  4DSI A;  4E1N A;  3JYT A;  4KI4 A;  1QSY A;  4B9N A;  3KKS A;  4JS5 A;  1HYS A;  3U3G A;  2XY6 A;  1HJR A;  1RCH A;  3EY1 A;  4GW6 A;  3SQ0 A;  3RWU A;  5HRN A;  1IH7 A;  3CYM A;  2XHB A;  2HHV A;  3SPZ A;  1C0T A;  1TAQ A;  1NKE A;  3EZ5 A;  4HTU A;  1SL1 A;  4FZX C;  2E6M A;  4FLU A;  4BAC A;  4FJL A;  2P5O A;  3S3N A;  2JGU A;  3AVI A;  2FBT A;  2NUB A;  4LSN A;  4CJ3 A;  4CEE A;  4O4G A;  1VRT A;  1KFD A;  3P5J A;  4BWJ A;  3OYC A;  1TKX A;  3NCI A;  3SQ2 A;  5T7B A;  1NK9 A;  1KFS A;  4HCC A;  4E1M A;  4DU1 A;  3I0R A;  4W5O A;  4FK0 A;  4KHW A;  1F21 A;  3NGI A;  4CCH A;  1JLF A;  4OPJ A;  2G8W A;  2OZM A;  4FLY A;  4CJL A;  3K2P A;  4DU3 A;  5J2M A;  5JS2 A;  4KKO A;  5HRS A;  5DMR A;  3V9Z A;  4ELV A;  4M3W A;  3F9K A;  3RTV A;  3NH1 A;  4FJM A;  3SZ2 A;  1BI4 A;  1CXQ A;  4DFJ A;  3SQ4 A;  5FRN A;  4KB0 A;  4FJG A;  3SPY A;  4CJP A;  4CE9 A;  5FDL A;  1S6P A;  4IFY A;  4FXD A;  1SUQ A;  4LH5 A;  1J5O A;  1RDB A;  1UAX A;  2GBZ A;  1TV6 A;  1RDD A;  3FFI A;  1U45 A;  4PY5 A;  1LAW A;  2HNY A;  3OYB A;  3K58 A;  2P51 A;  3LP3 A;  4B9U A;  1B9D A;  1VSL A;  1VSK A;  4B9L A;  3S3O A;  1CZ9 A;  1J53 A;  2QK9 A;  1HRH A;  2F8T A;  2YNI A;  2YV0 X;  4CJS A;  3RMA A;  5CYM A;  4KTW A;  1LW0 A;  4OJR A;  4CHQ A;  4CJU A;  2D0B A;  3VQQ A;  1RBT A;  3HPO A;  1KSP A;  3QEW A;  4LH4 A;  3B6P A;  3AA3 A;  1ZBU A;  3VQD A;  4FW1 A;  4NCG A;  4CF9 A;  4EP5 A;  1NK5 A;  3NAE A;  3LP0 A;  5FRM A;  1EXQ A;  2IOC A;  3LPU A;  3SCX A;  4DSJ A;  4KV8 A;  1WLJ A;  4E19 A;  1KLN A;  4AHS A;  4FZZ A;  3KLI A;  4JRP A;  4OGE A;  3DLE A;  4CHN A;  1WSI A;  3G10 A;  2A1S A;  1RBV A;  4E3S A;  1DTT A;  1TKT A;  3AVJ A;  3OYD A;  3QEI A;  1ZBF A;  3HT3 A;  1YVU A;  3DRR A;  3L3U A;  4M41 A;  3TAE A;  4EZ9 A;  4AHT A;  1BIS A;  1ASV A;  3WNH A;  1JLC A;  4N41 A;  2HHT A;  2G8F A;  3IAY A;  2I5J A;  4JRQ A;  3QIO A;  3HPG A;  4CJF A;  4CEZ A;  2VWK A;  3L2Q A;  3I0S A;  1U47 A;  1B92 A;  1EX4 A;  1VSI A;  4H4O A;  3ZSX A;  4FM0 A;  2E6L A;  4PUO A;  4JLH A;  3SYZ A;  1QSS A;  3IS9 A;  4O5B A;  4KB1 A;  3KIO A;  4FLT A;  3TAM A;  2P1J A;  1RBU A;  4M45 A;  4AH9 A;  1BQM A;  2O4I A;  3OS2 A;  4CIG A;  3O4Q A;  4LY7 A;  3OVN A;  1ZBL A;  2Y1I A;  2HHX A;  3AVK A;  1EP4 A;  4C8O A;  4M3U A;  2FC0 A;  1HPZ A;  4W5N A;  5CY4 A;  3O3H A;  1VRU A;  2BE2 A;  5CZ1 A;  3KLG A;  3SI6 A;  1HMV A;  3CFO A;  1BGX T;  1X9S A;  2FBX A;  4CES A;  4CGG A;  3K59 A;  5J2N A;  3TI0 A;  2YNG A;  1A5W A;  3NE6 A;  3ULD A;  1KVC A;  1FK9 A;  4DFM A;  3WNF A;  1Q9Y A;  2G8U A;  1JLG A;  5FRO A;  4F3O A;  1QHT A;  3ZCM A;  4CF2 A;  2YNF A;  3DYA A;  4CEQ A;  4FLX A;  1G15 A;  4LSL A;  5KI6 A;  5HRP A;  1ZYQ A;  3DI6 A;  1N5Y A;  4M42 A;  3K5M A;  4KTQ A;  1REV A;  3RMD A;  4CFA A;  3TAP A;  4KTZ A;  3S3M A;  4TSX A;  1NK8 A;  1NKC A;  4B9T A;  4C8K A;  2KQ2 A;  5CYQ A;  4KFB A;  4KPY A;  1HQU A;  2HHW A;  3MXJ A;  5SZT A;  3LP2 A;  1BI4 B;  1JKH A;  1R0A A;  2DTU A;  4CK2 A;  3AO4 A;  4DG1 A;  1I39 A;  1X9M A;  5KTQ A;  1SKR A;  4OLB A;  2DY4 A;  1BCO A;  2Z1J A;  4AHR A;  3TWH A;  5JS1 A;  4DTS A;  4IG3 A;  3OYA A;  3OYE A;  1L3S A;  4DTO A;  4OGC A;  1RDC A;  4FLZ A;  4EZ6 A;  2P5G A;  2Z1I A;  3ASM A;  1QQC A;  2G8K A;  3QIP A;  4O0J A;  1JL2 A;  4FJI A;  1RTH A;  2W42 A;  3F73 A;  3ZT3 A;  3L8B A;  4DTP A;  5HP1 A;  3DLG A;  4E7H A;  2EHG A;  1KRP A;  1TK0 A;  3V9S A;  4DQS A;  4DF8 A;  4DLG A;  2FBY A;  2AJQ A;  2GV9 A;  4BDY A;  3QO9 A;  4NCA A;  2HNZ A;  3EYZ A;  1XWL A;  5KRS A;  4CJE A;  1IG9 A;  3ZT2 A;  3QER A;  3VQB A;  3VA0 A;  3VQA A;  3TAQ A;  3L2U A;  3IRX A;  3TAF A;  1JL1 A;  3TAN A;  1TKZ A;  4KHN A;  2BGG A;  3O3G A;  1RBS A;  4BE0 A;  4OLA A;  1RTI A;  4CEO A;  3VQP A;  1CZB A;  1DLO A;  4DQQ A;  3SUO A;  3TR8 A;  3TAG A;  2D5R A;  2QKK A;  4N5S A;  4BWM A;  1NKB A;  2X6S A;  2PYL A;  2KZM A;  3VQ4 A;  3DMJ A;  1XI1 A;  3P1G A;  4FJH A;  3TAR A;  4K8X A;  3HK2 A;  4L8R B;  4W5T A;  1K6Y A;  1S1U A;  3M8P A;  4ELU A;  1NJZ A;  2OPP A;  1QSL A;  4E0D A;  4CJ4 A;  5KGX A;  3MEE A;  4Z4H A;  1SKS A;  4E7K A;  4B9S A;  2HND A;  4CEB A;  3THV A;  1U49 A;  3RMC A;  3QET A;  1A5X A;  3L2R A;  5J1E A;  4M3Y A;  4FW2 A;  1QS4 A;  2X6N A;  3AVM A;  1WSF A;  3T1A A;  3LP1 A;  3LWL A;  4CEF A;  4CGD A;  4F3T A;  4B3O A;  2XY7 A;  1L3U A;  3PX6 A;  2HB5 A;  1RTJ A;  4J2D A;  1GOC A;  3L2V A;  4HUF A;  3D0P A;  2VG5 A;  3ZSZ A;  3LAN A;  3WNG A;  1A5V A;  2E4L A;  3OYG A;  4BE1 A;  4CHZ A;  2HHU A;  3AO2 A;  3KD5 E;  4ICL A;  3VQ7 A;  1TAU A;  3MED A;  3AO1 A;  1QTM A;  1L3V A;  3OYI A;  4OPK A;  3M8R A;  1X9W A;  1JLE A;  3DLK A;  1VSF A;  3NF7 A;  1JLB A;  4ID1 A;  4E7J A;  1NJW A;  3VN5 A;  3AA4 A;  5J2Q A;  3O3F A;  5I3U A;  4J2A A;  4H8K A;  3DM2 A;  3RRG A;  1ZBI A;  5HRR A;  1YTU A;  2YKN A;  2HVH A;  2IS3 A;  1RT2 A;  3G0Z A;  4B9V A;  4KAZ A;  1KVA A;  3CM6 A;  4IG0 A;  2DFE A;  1SV5 A;  1FKO A;  3SV4 A;  4FM1 A;  3SUQ A;  3C95 A;  3RMB A;  3V1Q A;  4FJ5 A;  3C94 A;  2OYQ A;  3VQ5 A;  3AVN A;  3AVH A;  3DRS A;  3VQ8 A;  4Z0U A;  4N76 A;  4BDP A;  2ZE2 A;  4CJT A;  3K5N A;  3HM9 A;  1GOB A;  4Y1D A;  4F2S A;  3K5L A;  1IKY A;  1HYV A;  3KLE A;  3QES A;  3TAB A;  3HL8 A;  4EP4 A;  4E7I A;  1VSH A;  4CGI A;  3AVF A;  2EX3 A;  3NH0 A;  3CQ8 A;  1L3T A;  4C8L A;  4KI6 A;  4I2P A;  5CZ2 A;  4AHV A;  4CF0 A;  3AA5 X;  3JSM A;  1NK6 A;  2OA8 A;  2B6A A;  1SL2 A;  2X74 A;  1Q9X A;  4B9M A;  3VQC A;  2HVI A;  3ITH A;  2WON A;  4MQ3 A;  1U4B A;  3HJF A;  4I9Q A;  4KHQ A;  2HHQ A;  1LW2 A;  2HHS A;  4RW9 A;  3AVB A;  4KRE A;  1NJX A;  4CFB A;  3AVL A;  2RKI A;  1LWF A;  2YHA A;  2Z1H A;  1TK5 A;  1Y97 A;  2B4J A;  2YHB A;  4ID5 A;  4IFV A;  3BDP A;  1GOA A;  3DLH A;  4DU4 A;  2RN2 A;  3ZT0 A;  1RDA A;  3PY8 A;  3NGZ A;  1IO2 A;  1RT6 A;  3NF6 A;  4KHY A;  4F2R A;  3PX4 A;  4AIL C;  1HNI A;  1UOC A;  4W5Q A;  4DQI A;  1BIU A;  4DMN A;  4DTM A;  1NK7 A;  1RT3 A;  4UQG A;  3V6D A;  3ZT1 A;  4G1Q A;  3NGY A;  1EKE A;  1D9F A;  3L2W A;  3RR7 A;  1WAF A;  3ALY A;  4DSE A;  1X1P A;  3RR8 A;  4BDZ A;  5EU7 A;  3ZT4 A;  1S6Q A;  3OS1 A;  1U48 A;  3UIQ A;  3ZSV A;  4YFU A;  4DWI A;  4CJR A;  2G8H A;  3OYF A;  4FJX A;  4FVM A;  3DLR A;  1KCF A;  2ZD1 A;  1WSH A;  1S1V A;  2HMI A;  1J54 A;  2Q3S A;  2KFN A;  4HUG A;  4ZHR A;  4K8Z A;  4Q0B A;  1TL1 A;  4CIE A;  4DQR A;  3V4I A;  2ITG A;  1W9H A;  3NF8 A;  4FLV A;  1IKW A;  4DQP A;  3O4N A;  3KJV A;  1CXU A;  3KTQ A;  3DRP A;  2QKB A;  5K14 A;  4CEC A;  3V9X A;  4CGH A;  3KD1 E;  2OPQ A;  4M3X A;  3CM5 A;  3E01 A;  1NOZ A;  3H08 A;  4WE1 A;  1RNH A;  4HUE A;  3AVC A;  1NJY A;  4OKK A;  3OYH A;  3AV9 A;  2IDO A;  1UWB A;  4I7F A;  3MEG A;  2X78 A;  2RPI A;  4DLE A;  2G8V A;  3V1O A;  3C6U A;  3IG1 A;  2WOM A;  2Z1G A;  4OVL A;  3ZSQ A;  3D45 A;  4CJQ A;  3LDS A;  2DFH A;  4FJ7 A;  2QXF A;  3NFA A;  3HVR A;  1XHZ A;  4N56 A;  2BDP A;  1C6V A;  2F96 A;  2VWJ A;  4MFB A;  1VSJ A;  1WSE A;  3HST B;  2KW4 A;  4NYN A;  4CJV A;  3V9W A;  4RW4 A;  5SWM A;  3S9H A;  4Z4I A;  3KKR A;  4CGJ A;  3LZI A;  5D3G A;  4RW7 A;  2KTQ A;  4NCB A;  4CJ5 A;  4KRF A;  3MXI A;  3CFP A;  4FM2 A;  3NF9 A;  2OPR A;  3HYF A;  1YT3 A;  4IDK A;  4CIF A;  4Z4E A;  1WAJ A;  4F8R A;  4FJ9 A;  3DLB A;  1QE1 A;  1Z25 A;  4NYF A;  4FJK A;  1HNV A;  4CER A;  3PV8 A;  2IAJ A;  1TGO A;  2D0C A;  1S1X A;  1S9G A;  4CJK A;  3KK2 A;  5E41 A;  2KZZ A;  1BIZ A;  4AHC A;  3OYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...