5KRSA

Hiv-1 integrase catalytic core domain in complex with an allosteric inhibitor, 3-(1h-pyrrol-1-yl)-2-thiophenecarboxylic acid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
146
Chain Sequence
DSSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNPGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A New Class of Allosteric HIV-1 Integrase Inhibitors Identified by Crystallographic Fragment Screening of the Catalytic Core Domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase, transferase/inhibitor
molecule keywords Integrase
total genus 49
structure length 146
sequence length 153
ec nomenclature
pdb deposition date 2016-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5krsA00
1EP4A 3HXMA 4OPJA 3H08A 3HP9A 3ALYA 4CFDA 2NUBA 4Z4HA 4FM0A 4DTOA 1KFSA 4DSKA 4EZ6A 3E01A 1BL3A 4IBNA 3VQ8A 1RDCA 3K59A 4NYNA 4DQRA 4DU3A 1RTIA 4ELUA 4W5RA 1KVCA 4H4MA 4Z4CA 3L2QA 2VG5A 1CZ9A 3ZSQA 2YNGA 4CEBA 1U4BA 1WSJA 1B9DA 4M41A 4GVMA 1RILA 3AVKA 3SQ2A 4M3UA 3PX0A 2JGUA 4RW7A 3LAMA 1S1VA 5KGXA 3AVAA 3AVNA 3K5MA 3V4IA 1QSYA 4K8XA 1WAJA 2GUIA 3AA5X 3RMBA 4KHUA 3SJJA 3DI6A 3TARA 1NJYA 4DSIA 3AO4A 4BWMA 1GOCA 1YTUA 2XRIA 3DRPA 1G15A 4DS5A 3LZJA 1Q8IA 1SL0A 1J53A 2PY5A 4DWIA 2OA8A 4FZZA 3AA4A 2O4GA 3SUPA 3TI0A 1QS4A 4BE0A 1J9AA 5DMRA 1XC9A 4W5NA 3ZT3A 2XY8A 3NBPA 1LW0A 2FBTA 1J54A 2F96A 2KW4A 3NF6A 3NH0A 1N5YA 2FBVA 1HNIA 4M3RA 3V9XA 1S6QA 2X6SA 1EXQA 3QETA 3V9SA 3ZSWA 1KRPA 3I0RA 4F3OA 3ZSYA 3AVJA 1RTDA 1LWEA 3KKRA 4E7JA 1WAFA 4NCAA 3SV4A 3M8RA 4GMJB 4FJNA 3TAMA 4M45A 1RT4A 3DLHA 4O0JA 3VQ5A 3KTQA 4C8MA 1UA0A 3L3VA 5HRNA 1U47A 2PZSA 2AJQA 3NDKA 1C0UA 1VSIA 3MEEA 3B6PA 3RMDA 2Z1IA 3ZT0A 3KLEA 4ELVA 4DTNA 1I3AA 3AO1A 2Y1IA 1EX4A 3PO5A 5FROA 1BCOA 3U6FA 1TKZA 1BI4B 2HNZA 4PY5A 2IS3A 4E19A 5SZTA 4BDPA 3O3GA 1W0HA 4KTWA 4HTUA 1S9EA 4C8LA 5KRTA 4KHQA 1TK0A 2ITGA 2RF2A 3CFRA 4E89A 2DFEA 5I3UA 1SL2A 2KZMA 4RG8A 1QHTA 4M3YA 2P1JA 4BDZA 3OYCA 3OS1A 4OLAA 3L2VA 2Y1JA 4CF0A 4L8RB 1C6VA 4CIFA 5C42A 2IAJA 4OGCA 4IFVA 3CYMA 3EZ5A 4HUGA 4AH9A 5HP1A 3TAEA 3LPUA 1IKVA 4LH5A 2QK9A 4NCGA 4FJ5A 1ZYQA 3HVTA 3U3YA 4FYDA 1IH7A 4RW6A 4BE1A 1Q9YA 1T05A 1RCHA 3VQQA 1I39A 3RMCA 1C0TA 4CK3A 3OYMA 1F21A 3RRHA 1L3SA 1WSGA 5E41A 4E7IA 3O4QA 2HHUA 4F3TA 2RN2A 2ZE2A 1S1XA 3DLGA 1C0MA 3VQPA 2DFHA 4DTMA 4ZTFA 3L2RA 3I8DA 1ASUA 3L2UA 3SI6A 2OPPA 1QQCA 4F2SA 1VSEA 3ZSVA 4JS5A 3AVIA 1JLQA 3DRRA 3OS0A 5KI6A 4CERA 3NGYA 3C94A 4FLYA 1ASWA 4PA1A 3HP6A 3L8BA 3VA0A 1WSEA 4KAZA 2YNFA 3CM5A 3ZSXA 1NJWA 4FJIA 1HYVA 4RW4A 3U3GA 5DK5A 4DF4A 3DLBA 4FZYA 1D9DA 3HK2A 3RRGA 4IDKA 3LWLA 3RR7A 3HVRA 4KREA 4FK2A 1VSDA 4CE9A 3HYFA 3MEGA 4CF2A 3THVA 3OYDA 4H4OA 4Y1CA 3ZT2A 2QKKA 1S9GA 4B9LA 4DSJA 3VQDA 1WSFA 4DTSA 3VA3A 3QERA 1IO2A 2E4LA 4CGHA 1NK6A 4LSLA 4AHTA 3LP3A 5HRSA 1ITGA 3P83D 3K5LA 3OYJA 2FC0A 1RT6A 1FKPA 4FW1A 4MQ3A 4CHOA 4FJMA 2FBXA 1LAVA 1VSHA 3BGRA 3K2PA 3TR8A 2R7YA 5C25A 4Z4FA 2G8VA 4OGEA 4JRPA 4JLHA 4DF8A 3LAKA 3QIOA 3KIOA 3WNFA 2G8FA 1TKDA 1HYSA 5JS2A 5KGWA 3K5NA 3AVHA 4M3WA 3IAYA 5KTQA 3SQ1A 5K14A 2HW3A 1T03A 3CG7A 3IRXA 2Z1JA 3SQ0A 1N6QA 4HCBA 4QCLA 4HHTA 1TK8A 3DLEA 5C24A 4EP4A 3D0PA 4CEEA 1NK7A 3KD1E 1UA1A 3KLHA 1RT2A 3MAQA 2A1SA 3DRSA 3NF7A 4CIGA 3VQ6A 2G8IA 4CGGA 3TWHA 4DTPA 4B8AB 4ID5A 3V9ZA 4CJLA 3OJUA 4I2QA 4B9UA 3KLFA 1U04A 1LW2A 4I9QA 4CF9A 1BISA 3SUQA 3NCIA 3UIQA 1KFDA 5KRSA 2HHTA 3OYNA 4B08A 1U48A 3KD5E 4OPKA 5EU7A 1RT5A 3G10A 1RDAA 3RWUA 4PWDA 1Y97A 2OPSA 2X74A 1W9HA 4DFJA 4E1NA 2HVIA 4OKJA 4J2DA 2JLEA 3OJSA 3NAEA 4CHYA 2HB5A 2XY5A 1BHLA 2E6MA 1RTJA 2YV0X 2W42A 4R5PA 1LV5A 3DM2A 4IG3A 5T7BA 1GOAA 1RDBA 1REVA 3AVGA 3ISNC 4W5QA 4FW2A 5FDLA 4ZTJA 4PUOA 4XIUA 4CFBA 3VQ9A 4CJ4A 1A5VA 2IC3A 4FLVA 1IG9A 1NOYA 1DTQA 4KFBA 4CJ5A 3TANA 1IKWA 4O55A 4N76A 3S3MA 1SKRA 1U49A 4DLGA 2HNDA 3K58A 4BE2A 2Z1HA 2IOCA 3VQAA 2O4IA 1HPZA 4M3ZA 1TKXA 2ATQA 3V9UA 2YHAA 1SKSA 2YNHA 2GBZA 2VG7A 4CGFA 4C8KA 4DTJA 1LWFA 4N56A 4CECA 1RBRA 4FJKA 5J2NA 5J1EA 3QESA 3QEXA 4DU1A 3LP0A 3FFIA 3CFPA 4N41A 4FK4A 2F8TA 3ULDA 4OKEA 1NK0A 3AVCA 4NYFA 1B9FA 1SUQA 1IKYA 1TGOA 3MEDA 1JXBA 4KHWA 4M3TA 1S6PA 4RW9A 4CJVA 4Q5VA 1LAWA 1UWBA 5FRNA 4E7KA 3ZCMA 4KB1A 5CYMA 1RDDA 5J2PA 2HMIA 1BCMA 3PUFA 5CZ1A 1KSPA 2P5GA 2B4JA 4J2BA 1WLJA 1KVAA 2D0AA 4HUFA 3RTVA 4M42A 4JRQA 3F9KA 1JLAA 2QKBA 3QEPA 3OYKA 4FLXA 4CHQA 4CF1A 4NCBA 2BE2A 4JS4A 3KLIA 3LP2A 3QO9A 4G1QA 4FJ8A 5I42A 1TL3A 1WNSA 3S3NA 4C8NA 2B5JA 1XHZA 2X78A 4MFBA 1HMVA 3SUOA 3CM6A 1S5JA 3KKSA 4HVJA 3SCXA 1NKBA 2HHXA 2HNYA 1QSLA 4Z4GA 3VQBA 1VSLA 4YFUA 3OS2A 1VSMA 3A2FA 4FVMA 4AHSA 1ZBIA 3PV8A 4N5SA 3F73A 1T7PA 3RMAA 3LPTA 4FM1A 2E6LA 2KFZA 3OYAA 3LP1A 4FLUA 4DQIA 3OY9A 4CJPA 5J2MA 3QEWA 4CEZA 3VQEA 1BQMA 4OJRA 1HQEA 4E7LA 1NOZA 4DFPA 3TAGA 3DOKA 2RPIA 3VQ7A 1SKWA 4FK0A 4DSEA 3LANA 4I7FA 3S9HA 3MXIA 2BDPA 1FK9A 1NJZA 2IGIA 1Z26A 5J2QA 1LWCA 1S1WA 1Z25A 4LH4A 4B9MA 2WOMA 4FCYA 1HQUA 3LALA 3V9WA 4DFKA 4F2RA 1YT3A 3ZSRA 3EY1A 1RT3A 3V1QA 1FKOA 1FXXA 3AV9A 1D5AA 2XO7A 2YKMA 3AO5A 3C95A 4AHVA 4B9VA 4CJWA 2FBYA 1BGXT 3T19A 4UQGA 3PY8A 4OVLA 4FLTA 1A5XA 1SV5A 3B6OA 1JLEA 3D45A 3O3FA 1L5UA 4B9TA 1D9FA 4W5OA 4KTQA 5CY4A 3NF9A 3QNNA 3M8SA 3AA3A 1R0AA 4KPYA 3AA2A 4KKOA 4ICLA 4KV8A 4I2PA 3KJVA 4FJJA 3DMJA 4IG0A 3S3OA 4BACA 1SL1A 4CK2A 4M3XA 1BIZA 4FJXA 5JS1A 3NH1A 4KHYA 5D3GA 4FZXC 3K5OA 1TKTA 1VSJA 1ZBFA 3QLHA 1EETA 4LY7A 5HBMA 4O5BA 1L3TA 1XI1A 1KLNA 1S1UA 4TSXA 1NK4A 4DSLA 4J2AA 3V6DA 4FJ9A 2OPRA 4PQUA 3SPYA 3NFAA 3T3FA 4CJQA 3O3HA 3TAPA 1Q9XA 1JLCA 4DSFA 3RR8A 3TABA 3AVFA 4CGJA 1X9MA 4AHUA 3G0ZA 1DLOA 1QE1A 3SYZA 1J5OA 3LDSA 1ASVA 2BANA 4DLEA 3OYEA 4LD0A 1CXQA 4Z4IA 3C6UA 3CQ8A 2A1RA 1GOBA 4E1MA 3AVMA 2BGGA 3OYIA 3MXMA 2HHSA 3NGIA 3HL8A 1ZBLA 4F4KA 1VSKA 1DTTA 3MXJA 3JYTA 4CFAA 4KHSA 5HLFA 2B6AA 1JLBA 2P51A 2GV9A 3HPHA 3LWMA 2XY6A 3OYFA 1T8EA 4FJGA 1MU2A 4GW6A 4CHNA 5CYQA 2D0CA 4E3SA 1TK5A 2LSNA 1CZBA 4FXDA 1WSHA 1KVBA 1HRHA 3ZSOA 3NH2A 1JL1A 3QEVA 1KLMA 2XY7A 4CCHA 2HVHA 3AO3A 1QSSA 4ELTA 1C1AA 2OPQA 3ZT4A 4J2EA 3K57A 4CJEA 1K6YA 4BWJA 4CGDA 3HPOA 4CIEA 4DMNA 1JLFA 3OYHA 3TAQA 1X9SA 1TAUA 1RT7A 4C8OA 4FJLA 2KZZA 2ZQBA 2OZSA 4N47A 4CEAA 1TL1A 1TAQA 3NF8A 4I9LA 1NK8A 4QOZB 3ASMA 1HYZA 3VQCA 2QXFA 4CEOA 3KK3A 4E7HA 4DU4A 3IS9A 2I5JA 3HSTB 4CEDA 4HCCA 3EYZA 2G8WA 1IKXA 1BIUA 3CFOA 3M8PA 4Z4EA 2VG6A 3NHGA 1RBVA 3SV3A 4ID1A 4CEFA 3SUNA 4B9NA 3HO1A 4CGIA 4BDYA 4DFMA 3WNEA 3M8QA 3AVBA 3OYGA 4CJRA 4FJ7A 1B92A 3C6TA 4KRFA 1XWLA 3L3UA 3L2WA 4KI4A 4CJTA 2HHQA 1C1CA 2DFFA 4KHNA 1WSIA 3MECA 2X6NA 3OVNA 2PYLA 1L3VA 2D0BA 4IKFA 3VN5A 3ITHA 5SWMA 1EKEA 1A5WA 3AO2A 5HRPA 4EZ9A 1CLQA 1BQNA 4B8CA 3HJFA 4DQSA 3SPZA 1QTMA 2G8HA 3V1OA 3ZT1A 4B3OA 1YTAA 4Z0UA 4KB0A 4CF8A 1VRUA 4CJSA 2G8UA 4DG1A 3HM9A 3SZ2A 2ETJA 4DTXA 4CESA 3OYBA 4FM2A 3QINA 2KTQA 1BI4A 2KFNA 1NK5A 4ZHRA 5HRRA 1U45A 1WN7A 2KQ2A 4DS4A 1NKEA 4CEQA 4CHPA 1YVUA 4YNQA 1VRTA 4CHZA 4HUEA 4AILC 4CJKA 1S1TA 4O44A 3DOLA 3HT3A 3DLKA 3I0SA 2XHBA 4AHRA 4FLWA 4QAGA 1O1WA 3QIPA 1JLGA 2D5RA 4W5TA 3TAFA 3PX4A 1RBUA 3P5JA 1KCFA 4O0IA 1TVRA 2EX3A 1NKCA 3BDPA 5HROA 3PO4A 1HJRA 4H8KA 4KI6A 4CK1A 3AVLA 2P5OA 4KTZA 1UAXA 4DQQA 2YHBA 3QNOA 2IDOA 2DTUA 3KLGA 4CFCA 3KK1A 4OLBA 2Q3SA 4Y1DA 1NJXA 3HPGA 1RT1A 4FJHA 2OYQA 4B9SA 2RKIA 3PX6A 2Z1GA 5CZ2A 1X9WA 1KTQA 4LSNA 1JXEA 1RBTA 3DLRA 1X1PA 1VK0A 1JKHA 5FRMA 4CJUA 4F8RA 3ZSZA 3LZIA 4K8ZA 2HHWA 4O4GA 1RTHA 3IG1A 3VQ4A 3WNHA 2PYJA 3V81A 1JL2A 2EHGA 3V1RA 1CXUA 2VWJA 4E0DA 1UOCA 1C1BA 3KK2A 1NK9A 3NGZA 2F8SA 2G8KA 4KO0A 1ZBUA 4DQPA 2HHVA 3OYLA 3JSMA 2WONA 1XHXA 4AHCA 4Q0BA 3NE6A 4DTRA 1ZBHA 1VSFA 2YNIA 3T1AA 4IFYA 3SNNA 4FLZA 2ZD1A 1L3UA 1HNVA 4DTUA 3O4NA 1RBSA 2OZMA 1RNHA 3WNGA 2VWKA 4CJ3A 4OKKA 1D8YA 3DYAA 3P1GA 2YKNA 2DY4A 1TV6A 4WE1A 3QEIA 3SQ4A 4RW8A 4CJFA 4EP5A
chains in the Genus database with same CATH superfamily
3ALYA 3D6RA 3L4QA 4ILHA 1KFSA 3A8YA 3VQ8A 3K59A 4ELUA 4O8KA 1KVCA 4OPAA 1XMQK 2VG5A 1IBLK 1U4BA 2H3GX 4H0XB 3UE5A 1YJNN 4BRKA 3AVNA 5AZIA 3SAFA 2OTJN 2GUIA 3LDOA 5M1NA 3SJJA 3DI6A 3TARA 4BWMA 3DRPA 3JXUA 1Q8IA 4DWIA 3QMLA 5IT9O 4HWIA 2Q97A 3CCEN 4GV9A 2F96A 1N5YA 3VETA 3VF4A 1QQOA 3CJ9A 1EXQA 3ZSWA 1RTDA 3M8RA 1WB9A 4B1XB 3TAMA 3KTQA 5LL6Z 3L3VA 5M1PA 2PZSA 2AJQA 3R6MA 3KWGA 3RMDA 3MMVA 4LFBK 4C23A 4YOWA 5F2RA 3VEYA 2P9UA 2D4WA 3AO1A 4JNEA 1SQKA 3E9PA 1N8RO 2NLXA 5BR8K 4PY5A 4E19A 4BC2A 4CBUA 4KTWA 4HTUA 1S9EA 3O9RA 4E89A 2KZMA 4M3YA 4JN4A 3L2VA 4FWNA 4ISFA 5HP1A 3TAEA 1QZ6A 2JWLA 4NCGA 4EAHD 4ISEA 4RW6A 4Z94A 4JKAA 3C6HA 4BE1A 1Q9YA 3VQQA 1I39A 3RMCA 4BRDA 2O8BA 5F0XA 2O8BB 1L3SA 4H5VA 4F3TA 1VQ8N 1S1XA 2P9KB 3I8DA 4WFNL 1GLJO 3SI6A 1IG8A 2QM1A 3A5LC 1NGIA 3SAHA 4JS5A 4IO8A 3OS0A 4CERA 4FLYA 2QWRA 1S72N 4Y0WA 3VA0A 3WXMB 1WSEA 4YHHK 2FSKA 3CMAN 1WOQA 4MO5A 4FZYA 3HK2A 3HVRA 4K43A 3UKRB 2IIRA 4BY9C 3THVA 2GTDA 3I8BA 1S9GA 3ULEA 1NGFA 1OH6A 3PSFA 4DTSA 4GV3A 3VA3A 3U4LA 1NK6A 4LSLA 4QS9A 3P83D 3CI5A 5AFUA 1RT6A 2P9UB 4FJMA 2FBXA 4Z4FA 1JCGA 4EFHA 4CZJA 3WNFA 1TKDA 3MWPA 2YHYA 3IDHA 5JS2A 5AQVA 3T7ZA 3O6WA 4HHTA 3DLEA 3D0PA 3KD1E 4WQ4C 5AQUA 3KLHA 4FOEA 4BVPA 1NGBA 3VQ6A 2G8IA 4DTPA 5EX5A 4CJLA 3GDQA 4B9UA 4I9QA 3O80A 3KWIA 1HNWK 5KQDA 2KHOA 3E9LA 4BRIA 1YJWN 4BG9A 3CJ7A 3C6AA 2ZM6K 2JLEA 2RE2A 1RTJA 4B9QA 2JWKA 1REVA 4ZTJA 2ZF5O 4PUOA 1NOYA 2HF3A 4N76A 4PKHA 4DLGA 2QWNA 3VQAA 1TKXA 4H5WA 1QZ5A 1SKSA 4DR4K 3O9QA 1X3NA 4FJKA 5J2NA 3VEXA 5J1EA 3LP0A 3UKRA 1NK0A 5EVZA 1JXBA 1S6PA 3W3DA 4Q5VA 1LAWA 3KZBA 4E7KA 3ZCMA 4FO0A 1BCMA 1KSPA 1KVAA 4NB4A 3HTVA 4HUFA 3L4IA 4M42A 3TU5A 4YORA 4CHQA 3QO9A 3LP2A 3N4QA 5I42A 1VHXA 1WNSA 1FJGK 4C8NA 4MFBA 2A3ZA 3I56N 1YF5L 1NKBA 2W6LA 5ADXA 5LMUK 4K25A 1VSLA 4YFUA 1VSMA 4JK9A 2F9TA 4NXMK 4N5SA 3RMAA 3LP1A 3J7AP 4DQIA 3OY9A 5J2MA 4K41A 4CEZA 3CF5L 2A42A 4OJRA 1HQEA 4JK8A 4IEEA 2QWPA 4DFPA 3DOKA 3BY5A 4B3TK 4BR0A 3LANA 4I7FA 4LF9K 5AQFA 1QVFM 2WBNA 2IGIA 1LWCA 1Z25A 2WOMA 1C0GA 1YT3A 5CR4A 2XO7A 2YKMA 5AQTA 4BRGA 2FBYA 1BGXT 3UKUB 4CZFA 2GX9A 1A5XA 1SV5A 3D45A 1JLEA 4B9TA 3QNNA 4BG8A 3AA2A 4K0KK 4CZGA 4FJJA 4IG0A 4BREA 4BACA 4CK2A 1BIZA 3NH1A 3MWTA 1ZBFA 3D7EO 3D2EB 4U7BA 4TSXA 2ZJQL 3SPYA 4QS8A 3AVFA 4CGJA 3CCJN 3PSIA 1J5OA 1BOTO 4DLEA 1NGDA 1P90A 2BGGA 5GAEP 2HHSA 1ZBLA 3KHYA 4H0PA 3MXJA 3ENBA 5I9EB 4IEIA 5E84A 2XY6A 4GW6A 4CHNA 2D0CA 2VQFK 2UU9K 1KVBA 2HMPA 1HRHA 2HVHA 1KLMA 1C1AA 3OA9A 3K57A 4NLBA 4CGDA 3OYHA 3TAQA 1TAUA 4FJLA 2KZZA 2ZQBA 4B1YB 4CEAA 3OTOK 1TAQA 4BRPA 1NK8A 4YOYA 3ASMA 1HYZA 2IVOA 3KK3A 3IS9A 2I5JA 4JD2B 3K0SA 2HBMA 3U9DA 4ID1A 3HO1A 4B3SK 4JI6K 3ZLJA 4CJRA 3MCPA 4KRFA 3SBTA 4CJTA 2HHQA 4R79A 3AGRA 3OVNA 4YDUA 3M3ZA 1A5WA 1BUPA 1BQNA 1QTMA 3C0BA 3V1OA 4KB0A 4EIAA 4JI0K 5LMNK 5F1XA 4G9ZA 3EEQA 3CQYA 3SZ2A 4YOUA 3FZHA 4FM2A 1NK5A 5HRRA 1NKEA 4BGBA 4CEQA 3ZEUB 4YNQA 1Z6RA 1S1TA 3TAFA 1O1WA 3P5JA 1NKCA 2EX3A 3RSEB 5HROA 3RSEA 3CQXA 4CK1A 3AVLA 2P9PB 3VPZA 4KTZA 4DQQA 2DTUA 1KAYA 3KLGA 4CFCA 4FJHA 4GKJK 4B9SA 3PX6A 5CZ2A 2UXBK 2GELA 4LSNA 3SAGA 2GUPA 1VK0A 1JKHA 5FRMA 4L3QA 3LZIA 4FOIA 4E0DA 2VWJA 1NK9A 3UKUA 1Q81O 2G8KA 3JSMA 2WONA 2AA4A 3T1AA 4IFYA 1HNVA 2E5LK 1NU0A 1RNHA 3MK6A 2VWKA 4ILJA 1HKCA 4CJ3A 3D2EA 1K73O 3P1GA 1IJJA 2DY4A 3QEIA 3SQ4A 4DHYA 4IWVA 1EP4A 1XNRK 1YTUA 4Z4HA 4DTOA 4DSKA 3H6EA 3E01A 4IBNA 3J7ZO 1NNEA 4DQRA 4NYNA 1NJIO 2O8EA 2NRTA 3NVMA 3LDNA 2VCPA 4Z4CA 5CE3A 3P38A 1R59O 1YITN 1CZ9A 2YNGA 1WSJA 1B9DA 4M41A 3T1HK 3AVKA 1MA9B 2JGUA 3LAMA 1S1VA 3FZLA 4WQ5A 3ZEUA 4UY8O 4JYAK 3AA5X 3AARA 1OVQA 3EKUA 1NJYA 3AO4A 1GOCA 5EY4A 5GADP 2KLAA 1G15A 1NGHA 4WYBA 3LZJA 5EOYA 1S22A 2OA8A 4FZZA 2WFBA 1XC9A 3ZT3A 4A5BA 2XY8A 3BEXA 3NBPA 1LW0A 4PKGA 2X6SA 4XH5A 4F3OA 3VERA 1LWEA 1KAZA 4E7JA 1WAFA 3P31A 3SV4A 5LJWA 4GMJB 4H5NA 4M45A 4JV5K 1MWMA 4C8MA 1UA0A 3MEEA 3B6PA 3KLEA 3PO5A 5FROA 1BI4B 2HNZA 4U67L 1HR0K 5KQ8A 2HBKA 5C12A 2VYPA 2J4RA 1TK0A 2ITGA 2DFEA 4H5RA 2NRXA 4RG8A 1QQNA 3OYCA 4IO9L 2QW9A 2Y1JA 3H46O 1C6VA 5C42A 4OGCA 3CJ1A 4BRCA 3EZ5A 4HUGA 4AH9A 1IKVA 4LH5A 3SMPA 2QK9A 3HVTA 1Q86O 3CJCA 3MN5A 5AQQA 4FWPA 4A5AA 1RCHA 2VGMA 3CJBA 2RN2A 5AQHA 5AQMA 1C0MA 3VQPA 4DTMA 1ASUA 3O9UA 1VSEA 3ZSVA 5DM6L 3ATUA 1D4XA 1JLQA 3DRRA 3C94A 4PA1A 3L8BA 3CM5A 4FL9A 2O8CB 4BR9A 2CH6A 1WBDA 3U3GA 5DK5A 4FWLA 3ID6A 4FK2A 1SS6A 3FLCO 1VSDA 1N32K 3MEGA 4CF2A 3OYDA 2NNWA 5BN9A 2QWLA 3U8XA 4JKFA 3QERA 1RFQA 4FWMA 4AHTA 3LP3A 1ITGA 1NMNA 3J80O 3OYJA 4I6MA 4FW1A 1FKPA 1VSHA 2E1YA 5LY3A 3KIOA 2FSJA 3W0LA 3AVHA 5E26A 2FF6A 3IAYA 5K14A 2ASOA 2Z1JA 3O9TA 1TK8A 3QDKA 4CEEA 1TUUA 1UA1A 1ZXOA 3DRSA 3NF7A 1BWFO 3TTCA 4JK7A 3OJUA 4I2QA 3CXCM 1W97L 3KLFA 4XEIA 4BRQA 1U2VB 1XUPO 3ATVA 5KRSA 3O1BA 3OYNA 4H03B 3RWUA 5EU7A 1W7AA 1RDAA 4DFJA 4J2DA 4CHYA 2XY5A 1BHLA 2E6MA 2YV0X 5GIPA 2W42A 1LV5A 3DM2A 4IG3A 4FWOA 5TKWA 4XIUA 1T44A 3KVGA 3ZX0A 4CJ5A 4HTLA 3SJHA 3S3MA 1SKRA 2HNDA 3K58A 1Q7YO 2O8CA 4GKKK 1HPZA 2YHAA 4DR1K 2YNHA 5BPLA 2HBJA 4FPBA 4CGFA 4DTJA 4C8KA 4N56A 4WFAL 5AQRA 4DU1A 3FFIA 2OANA 2F8TA 1KD1O 4OKEA 1BA1A 3AVCA 1B9FA 2I7NA 1IKYA 4M3TA 4RW9A 3JAMO 5FRNA 5J2PA 2HMIA 3PUFA 4DR7K 2BUPA 2O8FB 4DCHA 5BR9A 4JRQA 4CF1A 3G6EN 2BE2A 2W6KA 2O8DA 4G1QA 3S41A 4PL8A 1GLDG 3S3NA 1TUYA 2B5JA 2X78A 3CM6A 3SCXA 4HVJA 3D2FA 2HNYA 5HOOA 3UB5A 3SLCA 5BREA 1YUWA 3OS2A 3A2FA 4WFBL 2QWOA 4AHSA 1ZBIA 3F73A 4FM1A 3TSQA 1MDUB 3QEWA 4WQ5C 4QOZB 4E7LA 1NOZA 2RPIA 4DSEA 3S9HA 1NJZA 3U9ZA 3LALA 4DFKA 3EY1A 3IFRA 2P9NB 1YVNA 4OVLA 4WCEL 3B6OA 4FLTA 3O3FA 1EO1A 3DXMB 4KTQA 1ATNA 1R0AA 4KV8A 4LFCK 4I2PA 3KJVA 3DMJA 3S3OA 4M3XA 4M7YA 5FLXO 1XI1A 1KLNA 4DSLA 3V6DA 4GY2B 3T3FA 3TAPA 4CW7B 4DSFA 3J7YP 3RR8A 3R8EA 4X62K 1X9MA 4AHUA 4DV3K 4YOVA 4BROA 5BPMA 1EQYA 4LD0A 2KKZA 1OH7A 4Z4IA 5EXWA 3NGIA 3JYTA 4A57A 2UXCK 2B6AA 2GV9A 4ILGB 2V51B 3OYFA 1T8EA 4IZ9A 5CYQA 4DV6K 4E3SA 4FVUA 3MDQA 4CZKA 3ZSOA 2XY7A 1JL1A 2ITMA 1MWKA 2OPQA 4J2EA 1U6ZA 1K6YA 5AQGA 5BRDA 3LDLA 4C1NK 4DU4A 4H0TB 3J8AA 3CD6N 3HSTB 1EWRA 3O5BA 2G8WA 1IKXA 4Z4EA 3CFOA 3ZETA 2VG6A 3FFKB 4YDUC 3SUNA 4JKHA 5AZJB 2P9IB 5AQXA 3WNEA 3M8QA 3AVBA 3WQUA 2ZJPL 1XWLA 3L2WA 3O08A 4KI4A 4O8UA 1L3VA 3LM9A 5ADXH 4IKFA 3ITHA 5SWMA 1EKEA 2WUSA 3HJFA 3THXA 3ZT1A 3DJCA 5LJVA 4DG1A 2D0OA 3HM9A 2ETJA 3CC2N 3OYBA 4ZHRA 4DS4A 3M5RA 1JCEA 5AZIB 1NGGA 4H5TA 3D2FB 4CJKA 3DOLA 1LOTB 1GLBG 1RDWX 4QAGA 1QSYA 5BRFA 2HHXA 3PX4A 1KCFA 1SAZA 2FSNA 3PO4A 4H8KA 1IBKK 4JEPA 4LF5K 4DB3A 1S3XA 4OO1J 1V4TA 2Q3SA 4Y1DA 1RT1A 2OYQA 2RKIA 4FWSA 3AAPA 4CI6A 1RBTA 3DLRA 1X1PA 4IXCA 4CJUA 4F8RA 1RTHA 2E2OA 4H0YB 1E3MA 1JL2A 1CXUA 2UUBK 4KO0A 1ZBUA 1K8KA 3OYLA 4MLHA 5AQLA 3VMFB 3SNNA 4C1NI 4CZMA 5IWAK 4DTUA 3O4NA 1RBSA 3SBGA 3SMSA 3WT0A 4OKKA 4DUYK 4BQLA 3EKSA 1DKGD 4EP5A 2HBLA 3THWA 4OPJA 3HP9A 3HRGA 1Q82O 4CFDA 2NUBA 4FM0A 4EZ6A 3HI0A 1RDCA 4DU3A 1RTIA 4JI8K 4W5RA 4H4MA 2F4VK 2V7YA 4JI4K 1M90O 3HBTA 3THXB 4BRNA 3ZSQA 1LCUA 3CCRN 4BR2A 4GVMA 1RILA 4GV6A 4RW7A 3T1YK 4BC3A 3K5MA 3V4IA 4K8XA 1GLLO 3RMBA 4BR4A 4DS5A 2UXDK 1J53A 2PY5A 3C7NB 4BQZA 4YY3K 4JI7K 1NLVA 3C7NA 3DLLL 1QS4A 5AQWA 1J9AA 5DMRA 4W5NA 2KW4A 3NF6A 1HNIA 4AF1A 4M3RA 3V9XA 1S6QA 3QETA 3V9SA 1KRPA 3I0RA 3ZSYA 3FGUA 3KKRA 2NRRA 4NCAA 1RT4A 4FPAA 1U47A 5M1KA 4KH6A 5JVGL 2Z1IA 4ELVA 1VAZA 2YJEA 2Y1IA 3CCMN 5BN8A 1TKZA 2IS3A 3O3GA 1W0HA 4C8LA 5KRTA 2EWSA 1G99A 2P1JA 4BDZA 3OS1A 3AAQA 2QI2A 1GLCG 4L8RB 4CD3A 4CIFA 2IAJA 4IFVA 2BTFA 3ZYYX 5AQZA 1C0FA 1K8AO 4CZEA 4YOTA 2E1ZA 1ZYQA 3H3OB 4K42A 5AQJA 1YHQN 4FYDA 1T05A 1C0TA 4CK3A 4LF6K 2W40A 3OYMA 1F21A 3RRHA 2NRZA 3RVCA 5E41A 4E7IA 1XQSC 4X65K 2HHUA 2ZE2A 3DLGA 2DFHA 4MDBA 3L2UA 2P9KA 3MX2A 1QQCA 1BDGA 3IUCA 2E2PA 1BA0A 5FPNA 5KI6A 3NGYA 1ASWA 4IFEA 4KAZA 2YNFA 4FJIA 2QA4N 2WTUA 4MDAA 3EL2A 1HYVA 4RW4A 4DF4A 3DLBA 5B8HA 5AZJA 3RRGA 4IDKA 3LWLA 4QS7A 1HX1A 4FWKA 4CE9A 3HYFA 3CCVN 3ZT2A 4Y1CA 3ULEB 2QKKA 1CZAN 4B9LA 5GIOA 3VQDA 3M1FA 4WQ4A 2QXLA 4CGHA 4CJ7A 3FZFA 3E66A 1OKJA 2FC0A 4AM6A 4MQ3A 4BVOA 2GWKA 4CHOA 3K2PA 5C25A 2G8VA 4OGEA 4JRPA 4DF8A 3LAKA 2NRHA 3QIOA 2G8FA 3QFUA 5JLHA 1T03A 3CG7A 3SQ0A 4HCBA 1Q18A 2AP1A 4EP4A 5C24A 4XH1A 4BRHA 2V52B 3GE1A 3MAQA 3L6QA 4CIGA 5AQSA 5AQIA 4CGGA 3TWHA 3V9ZA 4RTFD 1U04A 2A5XA 3NCIA 1YJ9N 1KFDA 4E1JA 1FW6A 4B08A 1U48A 4OPKA 3G10A 2ZGZA 4A62A 5C2FA 4E1NA 2HVIA 4OKJA 3OJSA 1HNZK 2HB5A 3MCAB 1KQSM 1Y64A 1HJOA 4AQYK 3GOIA 1O13A 3H1VX 2V7ZA 4BRFA 4KBOA 5T7BA 3CCSN 3AVGA 4FW2A 5FDLA 4JKBA 4JKDA 4CFBA 3VQ9A 3EZWA 1A5VA 3TANA 1IKWA 4O55A 1KAXA 3FR0A 3ZX2A 4KH4A 1U49A 1VQKN 2A40A 4BE2A 2Z1HA 2IOCA 2O4IA 2NRWA 4CBXA 5KPZA 3V9UA 4CECA 3QESA 3ULDA 3PIOL 3MEDA 4PHTX 4KB1A 4BGAA 1RDDA 2A6AA 4J2BA 5CZ1A 3HOTA 3VF2A 2OCEA 1WLJA 3F9KA 1JLAA 5FPMA 4OPHA 3EE9A 1ZC6A 3LM2A 4NCBA 3KLIA 4FJ8A 1HKGA 1KXPA 3H45C 1TL3A 3VTHA 5KPRA 3TTFA 2OTLN 3Q7CA 4FWRA 1QSLA 3VQBA 1X3MA 4FVMA 3PV8A 4KH5A 2KFZA 1NGAA 1YIJN 4FLUA 1VQNN 1BQMA 4BRAA 4JD2A 3VQ7A 4CZLA 1SKWA 4H0VB 3MXIA 1DEJA 4IOAL 4CVNE 3TTDA 3DXKA 3QICA 4LH4A 3DAWA 3WXKA 4B9MA 3VTIA 1HQUA 3V9WA 1RT3A 1FXXA 3AO5A 4MO4A 3ZX3A 4B9VA 4CJWA 1VQ6N 1XMOK 4BRMA 2I7PA 5DM7L 4UQGA 3QBXA 1L5UA 5JICA 5JLFA 1D9FA 5CY4A 3NF9A 3M8SA 3AA3A 4KPYA 4KKOA 3VESA 1P8ZA 1QQMA 1GLFO 5JS1A 3TSUA 2Q2RA 1E4FT 3R9PA 3K5OA 1TKTA 3QLHA 1L3TA 1S1UA 4J2AA 4PQUA 3NFAA 4CJQA 3CETA 4GNIA 3O3HA 1DLOA 3SYZA 1T6DA 1ASVA 3LDSA 3OYEA 1CXQA 3G25A 3C6UA 2IVNA 3CQ8A 2A1RA 1GOBA 3OYIA 3MXMA 4F4KA 1VSKA 3P4IA 1H1VA 4KHSA 5AQPA 1VQMN 3DWLA 3VF6A 1WBBA 3HPHA 3LWMA 3R3LA 1TK5A 5FPDA 4JI5K 4FXDA 1OH5A 1WSHA 2HOEA 2HHHK 3AO3A 3ZT4A 1NGEA 4BWJA 3HPOA 3HSCA 4CIEA 4DMNA 4GVEA 1JLFA 1X9SA 3WXIA 4C8OA 3KK7A 3NF8A 4I9LA 4IOXA 4CEOA 3VQCA 4E7HA 4HCCA 1BIUA 1RBVA 3SV3A 3DXKB 4CEFA 4LF8K 3QB0A 4CZHA 3OYGA 3BZCA 2E20A 4FJ7A 3WEEB 3WXJA 2DFFA 3WEEA 4KHNA 2PYLA 3VN5A 5GINA 1CLQA 4EZ9A 1X9JA 4M7XA 4DQSA 3SPZA 2YHXA 2G8HA 4CZIA 4Z0UA 4RCHA 4CJSA 2G8UA 3VEVA 4CESA 3QINA 2KTQA 3CPWM 1BI4A 2KFNA 3O1WA 1K9MO 1U45A 1WN7A 4CHZA 3HT3A 3I0SA 2XHBA 4AHRA 4Q0BA 1JLGA 2A41A 2D5RA 2BH1A 1TVRA 3BDPA 4B1UB 2Q0UA 2D0PA 2P9PA 2P5OA 1UAXA 2E2NA 2IDOA 3BUZB 3KK1A 1VQPN 4OLBA 2VQEK 3EE8A 3IKMA 2Z1GA 1JXEA 1YXQA 1VQON 3CC4N 2YI1A 3ZSZA 4A2BA 1J6ZA 3VQ4A 3V81A 4B3RK 2EHGA 3SK3A 3CMEN 3KK2A 1YI2N 2F8SA 2IVPA 1IV0A 5C0YA 2CGJA 4DQPA 5ELZA 4JAXA 2HHVA 4O5FA 4AHCA 4B1WB 2RHKA 4DTRA 1VSFA 1M1KO 2ZD1A 1GLAG 4JHDA 3WNGA 4JHDB 3A0IX 3DYAA 4PL7A 2YKNA 1TV6A 4WE1A 4RW8A 5AQYA 4BC5A 5HRPA 3HXMA 3MN6A 3H08A 3HZ6A 1TYQA 3PLAA 1BL3A 3PIPL 2O8EB 1RDUA 3I55N 3L2QA 1NGCA 4NO7A 2O8FA 4DV2K 3BP8A 3LDQA 4CEBA 4CD1A 3SQ2A 3H1QA 4M3UA 3F2KA 1T6CA 2FXUA 3PX0A 1OVYA 5KGXA 3AVAA 3JS6A 1WAJA 3CCUN 3I33A 3G4SN 4KHPK 4KHUA 4DSIA 1NGJA 2XRIA 2PAVA 4A59A 1SL0A 3AA4A 2O4GA 5C15A 4DV5K 3SUPA 3TI0A 4BE0A 1NWKA 3NH0A 2FBTA 1J54A 3FE1A 3J81O 4J8FA 5TKYA 2ZJRL 1J5EK 2FBVA 4DR5K 1HNXK 3QFPA 3AVJA 2QWMA 2W41A 4DR6K 4RWTA 4AM7A 4JI1K 2FF3B 1N36K 4FJNA 3DLHA 4O0JA 3VQ5A 5HRNA 2DPNA 3NDKA 1C0UA 1VSIA 3WQTA 2VWBA 3AGKA 3ENHA 3ZT0A 4DTNA 1I3AA 2GEMA 1EX4A 1Z05A 1XC3A 4FWQA 1BCOA 3U6FA 2ZGYA 5SZTA 4BDPA 2NZTA 5KPTA 2GWJA 3FZKA 4KHQA 2RF2A 3CFRA 1SL2A 5I3UA 4B3MK 3THYA 1QHTA 2YJFA 2PBDA 4OLAA 1JCFA 4CF0A 2CGKA 4F9OA 3R1XA 5AQOA 3CYMA 5M1QA 3LPUA 3E9OA 4PKIA 4FJ5A 4DR2K 1BU6O 3U3YA 2Q0RA 3VGLA 1IH7A 1HPMA 1DT9A 4BRLA 3ID8A 4IDHA 1WSGA 3E1YA 3O4QA 5GAGP 4ZTFA 1N33K 3L2RA 2OPPA 4F2SA 3ENOA 4MLEA 2D1KA 2PFUA 3AVIA 3EN9A 5AFUH 3HP6A 2YHWA 3ZSXA 3GL1A 1NJWA 3CC7N 3OW2M 3RR7A 2E88A 1NM1A 2P9IA 2CGLA 3OHRA 4KREA 1VQ9N 2P9LA 3MN9A 3O8MA 4H4OA 2P9NA 3A5OC 1TYQB 4DSJA 1WSFA 3VOVA 1IO2A 1HKBA 2ZWHA 1E4GT 2E4LA 5HRSA 3K5LA 3L0QA 1LAVA 3BGRA 3TR8A 2R7YA 2F9WA 4JLHA 1EWQA 1HYSA 4X64K 3K5NA 5KGWA 4M3WA 5KTQA 4EHUA 4DR3K 3SQ1A 2HW3A 3IRXA 1N6QA 4QCLA 1WUAA 3HM8A 4JI2K 4A61A 3OBYA 3THYB 1NK7A 1RT2A 1NBWA 2A1SA 2UUAK 2UYTA 2QTDA 4DV7K 4B8AB 4ID5A 3WUHA 3F5TA 1LW2A 4CF9A 1BISA 5HL7L 3SUQA 3Q7BA 4BC4A 3UIQA 5AR0A 2HHTA 5AQKA 3KD5E 1RT5A 5C2DA 4JI3K 4PWDA 1Y97A 2OPSA 2X74A 1W9HA 1SZ2A 3LL3A 3NAEA 4B1ZA 4R5PA 3H3NO 2Q36A 1GOAA 1RDBA 3NMUA 4W5QA 3ISNC 5C10A 1N34K 4LF7K 4CJ4A 2IC3A 4FLVA 1IG9A 1DTQA 4KFBA 3CCQN 3MN7A 4IJNA 4WF9L 1NG9A 4M3ZA 2ATQA 2GBZA 2VG7A 1LWFA 1RBRA 1DGKN 3FZMA 3TSPA 5MLCQ 3O4WA 3CFPA 3QEXA 4FK4A 2P9LB 4NYFA 1SUQA 1TGOA 4KHWA 4CJVA 3P39A 3OBWA 1UWBA 5CYMA 2P5GA 4JKCA 2B4JA 4DKWA 1KC8O 1V4SA 2D0AA 3RTVA 3QBWA 1HUXA 2QKBA 3QEPA 3OYKA 4FLXA 4BR7A 4JS4A 4JKGA 2O8DB 1T3VA 2Q1NA 4DV1K 4NXNK 1XHZA 1GLEG 1HMVA 3SUOA 4OX9K 1S5JA 3KKSA 3NVKA 5AQNA 1ATSA 2FLOA 2VGNA 4Z4GA 3GBTA 1VQ5N 3CCLN 1T7PA 3LPTA 2E6LA 3OYAA 4CJPA 3VGMA 3VQEA 4DQ8A 3AY9A 4EHTA 4FSVA 3TAGA 4FK0A 3T69A 3HOSA 2BDPA 5BRHA 4DV4K 1FK9A 2P9SA 2QEXN 1XNQK 2HF4A 1Z26A 1RGIA 5J2QA 1S1WA 4FCYA 4H0OA 4F2RA 3ZSRA 3V1QA 1FKOA 3AV9A 1D5AA 2UUCK 3C95A 3BZKA 4AHVA 4V19S 3T19A 3K9JA 3PY8A 4LFAK 4A2AA 4W5OA 1VQ4N 1NMDA 2Q31A 4ICLA 4XH4A 5FPEA 3F9MA 3EO3A 1SL1A 4FJXA 4KHYA 3CJAA 5D3GA 4FZXC 1VSJA 5HBMA 4LY7A 1EETA 4M63C 4O5BA 1VQLN 1NK4A 4FJ9A 3CERA 4B1VA 2OPRA 5A2QO 4NLCA 4IJAA 1QHAA 5BPNA 2HSTA 5AJ3K 1Q9XA 1JLCA 3THWB 3TABA 2NRVA 3G0ZA 1QE1A 3A5MC 2BANA 5M1OA 1OH8A 1ESVA 5M1FA 1YAGA 3VENA 4E1MA 3AVMA 2ASMA 3HL8A 1DTTA 4X66K 4CFAA 2E8AA 5HLFA 1JLBA 3CIPA 4CBWA 2P51A 4FJGA 1MU2A 2LSNA 1CZBA 4CCHA 3QEVA 3NH2A 4LF4K 2CH5A 1QSSA 4ELTA 1IBMK 4CJEA 1K8KB 1RT7A 3GG4A 2OZSA 4N47A 1TL1A 1HLUA 3VEWA 2QXFA 4CEDA 3EYZA 3M8PA 3NHGA 2P9SB 1ILYA 4B9NA 4CGIA 1W2BM 4BDYA 4DFMA 1QVGM 3CHWA 3M6GA 1B92A 3C6TA 3L3UA 4LC9B 4JKEA 1C1CA 1ATRA 1WSIA 3MECA 2ASPA 2X6NA 2D0BA 3AO2A 4B8CA 3DXMA 5JMVA 4I6MB 4B3OA 1YTAA 3N4PA 1VRUA 4CF8A 4IOCL 3TPQA 3G71N 4DTXA 4JKGB 1BG3A 3B8AX 5JVHL 2KQ2A 1D9DA 4CHPA 1YVUA 4AILC 1VRTA 4HUEA 3BF1A 4O44A 3DLKA 4FLWA 3LDPA 3QIPA 3CPEA 4YOXA 4W5TA 4N41A 1RBUA 3IMXA 4O0IA 3C65A 1BO5O 1HJRA 2YX6A 4KI6A 3BF3A 1VQ7N 2YHBA 3QNOA 2E2QA 3MX5A 1NJXA 3HPGA 3WXLA 3VEOA 1X9WA 1U2VA 1KTQA 3VGKA 4ISGA 3K9KA 2QWQA 5CHIA 5H1SQ 2WC9A 4DUZK 4K8ZA 2HHWA 4O4GA 4DV0K 3IG1A 3WNHA 2PYJA 2YCHA 3V1RA 1UOCA 1C1BA 5GAHP 3NGZA 1I94K 1XHXA 3NE6A 1ZBHA 4BR5A 2YNIA 3O9SA 4FLZA 1JJ2M 1L3UA 2OZMA 3VEZA 3ZETB 1D8YA 1ZBSA 2F7TA 3A5NC 4CJFA
chains in the Genus database with same CATH topology
1EP4A 3HXMA 4OPJA 3H08A 3HP9A 3ALYA 4CFDA 2NUBA 4Z4HA 4FM0A 4DTOA 1KFSA 4DSKA 4EZ6A 3E01A 1BL3A 4IBNA 3VQ8A 1RDCA 3K59A 4NYNA 4DQRA 4DU3A 1RTIA 4ELUA 4W5RA 1KVCA 4H4MA 4Z4CA 3L2QA 2VG5A 1CZ9A 3ZSQA 2YNGA 4CEBA 1U4BA 1WSJA 1B9DA 4M41A 4GVMA 1RILA 3AVKA 3SQ2A 4M3UA 3PX0A 2JGUA 4RW7A 3LAMA 1S1VA 5KGXA 3AVAA 3AVNA 3K5MA 3V4IA 1QSYA 4K8XA 1WAJA 2GUIA 3AA5X 3RMBA 4KHUA 3SJJA 3DI6A 3TARA 1NJYA 4DSIA 3AO4A 4BWMA 1GOCA 1YTUA 2XRIA 3DRPA 1G15A 4DS5A 3LZJA 1Q8IA 1SL0A 1J53A 2PY5A 4DWIA 2OA8A 4FZZA 3AA4A 2O4GA 3SUPA 3TI0A 1QS4A 4BE0A 1J9AA 5DMRA 1XC9A 4W5NA 3ZT3A 2XY8A 3NBPA 1LW0A 2FBTA 1J54A 2F96A 2KW4A 3NF6A 3NH0A 1N5YA 2FBVA 1HNIA 4M3RA 3V9XA 1S6QA 2X6SA 1EXQA 3QETA 3V9SA 3ZSWA 1KRPA 3I0RA 4F3OA 3ZSYA 3AVJA 1RTDA 1LWEA 3KKRA 4E7JA 1WAFA 4NCAA 3SV4A 3M8RA 4GMJB 4FJNA 3TAMA 4M45A 1RT4A 3DLHA 4O0JA 3VQ5A 3KTQA 4C8MA 1UA0A 3L3VA 5HRNA 1U47A 2PZSA 2AJQA 3NDKA 1C0UA 1VSIA 3MEEA 3B6PA 3RMDA 2Z1IA 3ZT0A 3KLEA 4ELVA 4DTNA 1I3AA 3AO1A 2Y1IA 1EX4A 3PO5A 5FROA 1BCOA 3U6FA 1TKZA 1BI4B 2HNZA 4PY5A 2IS3A 4E19A 5SZTA 4BDPA 3O3GA 1W0HA 4KTWA 4HTUA 1S9EA 4C8LA 5KRTA 4KHQA 1TK0A 2ITGA 2RF2A 3CFRA 4E89A 2DFEA 5I3UA 1SL2A 2KZMA 4RG8A 1QHTA 4M3YA 2P1JA 4BDZA 3OYCA 3OS1A 4OLAA 3L2VA 2Y1JA 4CF0A 4L8RB 1C6VA 4CIFA 5C42A 2IAJA 4OGCA 4IFVA 3CYMA 3EZ5A 4HUGA 4AH9A 5HP1A 3TAEA 3LPUA 1IKVA 4LH5A 2QK9A 4NCGA 4FJ5A 1ZYQA 3HVTA 3U3YA 4FYDA 1IH7A 4RW6A 4BE1A 1Q9YA 1T05A 1RCHA 3VQQA 1I39A 3RMCA 1C0TA 4CK3A 3OYMA 1F21A 3RRHA 1L3SA 1WSGA 5E41A 4E7IA 3O4QA 2HHUA 4F3TA 2RN2A 2ZE2A 1S1XA 3DLGA 1C0MA 3VQPA 2DFHA 4DTMA 4ZTFA 3L2RA 3I8DA 1ASUA 3L2UA 3SI6A 2OPPA 1QQCA 4F2SA 1VSEA 3ZSVA 4JS5A 3AVIA 1JLQA 3DRRA 3OS0A 5KI6A 4CERA 3NGYA 3C94A 4FLYA 1ASWA 4PA1A 3HP6A 3L8BA 3VA0A 1WSEA 4KAZA 2YNFA 3CM5A 3ZSXA 1NJWA 4FJIA 1HYVA 4RW4A 3U3GA 5DK5A 4DF4A 3DLBA 4FZYA 1D9DA 3HK2A 3RRGA 4IDKA 3LWLA 3RR7A 3HVRA 4KREA 4FK2A 1VSDA 4CE9A 3HYFA 3MEGA 4CF2A 3THVA 3OYDA 4H4OA 4Y1CA 3ZT2A 2QKKA 1S9GA 4B9LA 4DSJA 3VQDA 1WSFA 4DTSA 3VA3A 3QERA 1IO2A 2E4LA 4CGHA 1NK6A 4LSLA 4AHTA 3LP3A 5HRSA 1ITGA 3P83D 3K5LA 3OYJA 2FC0A 1RT6A 1FKPA 4FW1A 4MQ3A 4CHOA 4FJMA 2FBXA 1LAVA 1VSHA 3BGRA 3K2PA 3TR8A 2R7YA 5C25A 4Z4FA 2G8VA 4OGEA 4JRPA 4JLHA 4DF8A 3LAKA 3QIOA 3KIOA 3WNFA 2G8FA 1TKDA 1HYSA 5JS2A 5KGWA 3K5NA 3AVHA 4M3WA 3IAYA 5KTQA 3SQ1A 5K14A 2HW3A 1T03A 3CG7A 3IRXA 2Z1JA 3SQ0A 1N6QA 4HCBA 4QCLA 4HHTA 1TK8A 3DLEA 5C24A 4EP4A 3D0PA 4CEEA 1NK7A 3KD1E 1UA1A 3KLHA 1RT2A 3MAQA 2A1SA 3DRSA 3NF7A 4CIGA 3VQ6A 2G8IA 4CGGA 3TWHA 4DTPA 4B8AB 4ID5A 3V9ZA 4CJLA 3OJUA 4I2QA 4B9UA 3KLFA 1U04A 1LW2A 4I9QA 4CF9A 1BISA 3SUQA 3NCIA 3UIQA 1KFDA 5KRSA 2HHTA 3OYNA 4B08A 1U48A 3KD5E 4OPKA 5EU7A 1RT5A 3G10A 1RDAA 3RWUA 4PWDA 1Y97A 2OPSA 2X74A 1W9HA 4DFJA 4E1NA 2HVIA 4OKJA 4J2DA 2JLEA 3OJSA 3NAEA 4CHYA 2HB5A 2XY5A 1BHLA 2E6MA 1RTJA 2YV0X 2W42A 4R5PA 1LV5A 3DM2A 4IG3A 5T7BA 1GOAA 1RDBA 1REVA 3AVGA 3ISNC 4W5QA 4FW2A 5FDLA 4ZTJA 4PUOA 4XIUA 4CFBA 3VQ9A 4CJ4A 1A5VA 2IC3A 4FLVA 1IG9A 1NOYA 1DTQA 4KFBA 4CJ5A 3TANA 1IKWA 4O55A 4N76A 3S3MA 1SKRA 1U49A 4DLGA 2HNDA 3K58A 4BE2A 2Z1HA 2IOCA 3VQAA 2O4IA 1HPZA 4M3ZA 1TKXA 2ATQA 3V9UA 2YHAA 1SKSA 2YNHA 2GBZA 2VG7A 4CGFA 4C8KA 4DTJA 1LWFA 4N56A 4CECA 1RBRA 4FJKA 5J2NA 5J1EA 3QESA 3QEXA 4DU1A 3LP0A 3FFIA 3CFPA 4N41A 4FK4A 2F8TA 3ULDA 4OKEA 1NK0A 3AVCA 4NYFA 1B9FA 1SUQA 1IKYA 1TGOA 3MEDA 1JXBA 4KHWA 4M3TA 1S6PA 4RW9A 4CJVA 4Q5VA 1LAWA 1UWBA 5FRNA 4E7KA 3ZCMA 4KB1A 5CYMA 1RDDA 5J2PA 2HMIA 1BCMA 3PUFA 5CZ1A 1KSPA 2P5GA 2B4JA 4J2BA 1WLJA 1KVAA 2D0AA 4HUFA 3RTVA 4M42A 4JRQA 3F9KA 1JLAA 2QKBA 3QEPA 3OYKA 4FLXA 4CHQA 4CF1A 4NCBA 2BE2A 4JS4A 3KLIA 3LP2A 3QO9A 4G1QA 4FJ8A 5I42A 1TL3A 1WNSA 3S3NA 4C8NA 2B5JA 1XHZA 2X78A 4MFBA 1HMVA 3SUOA 3CM6A 1S5JA 3KKSA 4HVJA 3SCXA 1NKBA 2HHXA 2HNYA 1QSLA 4Z4GA 3VQBA 1VSLA 4YFUA 3OS2A 1VSMA 3A2FA 4FVMA 4AHSA 1ZBIA 3PV8A 4N5SA 3F73A 1T7PA 3RMAA 3LPTA 4FM1A 2E6LA 2KFZA 3OYAA 3LP1A 4FLUA 4DQIA 3OY9A 4CJPA 5J2MA 3QEWA 4CEZA 3VQEA 1BQMA 4OJRA 1HQEA 4E7LA 1NOZA 4DFPA 3TAGA 3DOKA 2RPIA 3VQ7A 1SKWA 4FK0A 4DSEA 3LANA 4I7FA 3S9HA 3MXIA 2BDPA 1FK9A 1NJZA 2IGIA 1Z26A 5J2QA 1LWCA 1S1WA 1Z25A 4LH4A 4B9MA 2WOMA 4FCYA 1HQUA 3LALA 3V9WA 4DFKA 4F2RA 1YT3A 3ZSRA 3EY1A 1RT3A 3V1QA 1FKOA 1FXXA 3AV9A 1D5AA 2XO7A 2YKMA 3AO5A 3C95A 4AHVA 4B9VA 4CJWA 2FBYA 1BGXT 3T19A 4UQGA 3PY8A 4OVLA 4FLTA 1A5XA 1SV5A 3B6OA 1JLEA 3D45A 3O3FA 1L5UA 4B9TA 1D9FA 4W5OA 4KTQA 5CY4A 3NF9A 3QNNA 3M8SA 3AA3A 1R0AA 4KPYA 3AA2A 4KKOA 4ICLA 4KV8A 4I2PA 3KJVA 4FJJA 3DMJA 4IG0A 3S3OA 4BACA 1SL1A 4CK2A 4M3XA 1BIZA 4FJXA 5JS1A 3NH1A 4KHYA 5D3GA 4FZXC 3K5OA 1TKTA 1VSJA 1ZBFA 3QLHA 1EETA 4LY7A 5HBMA 4O5BA 1L3TA 1XI1A 1KLNA 1S1UA 4TSXA 1NK4A 4DSLA 4J2AA 3V6DA 4FJ9A 2OPRA 4PQUA 3SPYA 3NFAA 3T3FA 4CJQA 3O3HA 3TAPA 1Q9XA 1JLCA 4DSFA 3RR8A 3TABA 3AVFA 4CGJA 1X9MA 4AHUA 3G0ZA 1DLOA 1QE1A 3SYZA 1J5OA 3LDSA 1ASVA 2BANA 4DLEA 3OYEA 4LD0A 1CXQA 4Z4IA 3C6UA 3CQ8A 2A1RA 1GOBA 4E1MA 3AVMA 2BGGA 3OYIA 3MXMA 2HHSA 3NGIA 3HL8A 1ZBLA 4F4KA 1VSKA 1DTTA 3MXJA 3JYTA 4CFAA 4KHSA 5HLFA 2B6AA 1JLBA 2P51A 2GV9A 3HPHA 3LWMA 2XY6A 3OYFA 1T8EA 4FJGA 1MU2A 4GW6A 4CHNA 5CYQA 2D0CA 4E3SA 1TK5A 2LSNA 1CZBA 4FXDA 1WSHA 1KVBA 1HRHA 3ZSOA 3NH2A 1JL1A 3QEVA 1KLMA 2XY7A 4CCHA 2HVHA 3AO3A 1QSSA 4ELTA 1C1AA 2OPQA 3ZT4A 4J2EA 3K57A 4CJEA 1K6YA 4BWJA 4CGDA 3HPOA 4CIEA 4DMNA 1JLFA 3OYHA 3TAQA 1X9SA 1TAUA 1RT7A 4C8OA 4FJLA 2KZZA 2ZQBA 2OZSA 4N47A 4CEAA 1TL1A 1TAQA 3NF8A 4I9LA 1NK8A 4QOZB 3ASMA 1HYZA 3VQCA 2QXFA 4CEOA 3KK3A 4E7HA 4DU4A 3IS9A 2I5JA 3HSTB 4CEDA 4HCCA 3EYZA 2G8WA 1IKXA 1BIUA 3CFOA 3M8PA 4Z4EA 2VG6A 3NHGA 1RBVA 3SV3A 4ID1A 4CEFA 3SUNA 4B9NA 3HO1A 4CGIA 4BDYA 4DFMA 3WNEA 3M8QA 3AVBA 3OYGA 4CJRA 4FJ7A 1B92A 3C6TA 4KRFA 1XWLA 3L3UA 3L2WA 4KI4A 4CJTA 2HHQA 1C1CA 2DFFA 4KHNA 1WSIA 3MECA 2X6NA 3OVNA 2PYLA 1L3VA 2D0BA 4IKFA 3VN5A 3ITHA 5SWMA 1EKEA 1A5WA 3AO2A 5HRPA 4EZ9A 1CLQA 1BQNA 4B8CA 3HJFA 4DQSA 3SPZA 1QTMA 2G8HA 3V1OA 3ZT1A 4B3OA 1YTAA 4Z0UA 4KB0A 4CF8A 1VRUA 4CJSA 2G8UA 4DG1A 3HM9A 3SZ2A 2ETJA 4DTXA 4CESA 3OYBA 4FM2A 3QINA 2KTQA 1BI4A 2KFNA 1NK5A 4ZHRA 5HRRA 1U45A 1WN7A 2KQ2A 4DS4A 1NKEA 4CEQA 4CHPA 1YVUA 4YNQA 1VRTA 4CHZA 4HUEA 4AILC 4CJKA 1S1TA 4O44A 3DOLA 3HT3A 3DLKA 3I0SA 2XHBA 4AHRA 4FLWA 4QAGA 1O1WA 3QIPA 1JLGA 2D5RA 4W5TA 3TAFA 3PX4A 1RBUA 3P5JA 1KCFA 4O0IA 1TVRA 2EX3A 1NKCA 3BDPA 5HROA 3PO4A 1HJRA 4H8KA 4KI6A 4CK1A 3AVLA 2P5OA 4KTZA 1UAXA 4DQQA 2YHBA 3QNOA 2IDOA 2DTUA 3KLGA 4CFCA 3KK1A 4OLBA 2Q3SA 4Y1DA 1NJXA 3HPGA 1RT1A 4FJHA 2OYQA 4B9SA 2RKIA 3PX6A 2Z1GA 5CZ2A 1X9WA 1KTQA 4LSNA 1JXEA 1RBTA 3DLRA 1X1PA 1VK0A 1JKHA 5FRMA 4CJUA 4F8RA 3ZSZA 3LZIA 4K8ZA 2HHWA 4O4GA 1RTHA 3IG1A 3VQ4A 3WNHA 2PYJA 3V81A 1JL2A 2EHGA 3V1RA 1CXUA 2VWJA 4E0DA 1UOCA 1C1BA 3KK2A 1NK9A 3NGZA 2F8SA 2G8KA 4KO0A 1ZBUA 4DQPA 2HHVA 3OYLA 3JSMA 2WONA 1XHXA 4AHCA 4Q0BA 3NE6A 4DTRA 1ZBHA 1VSFA 2YNIA 3T1AA 4IFYA 3SNNA 4FLZA 2ZD1A 1L3UA 1HNVA 4DTUA 3O4NA 1RBSA 2OZMA 1RNHA 3WNGA 2VWKA 4CJ3A 4OKKA 1D8YA 3DYAA 3P1GA 2YKNA 2DY4A 1TV6A 4WE1A 3QEIA 3SQ4A 4RW8A 4CJFA 4EP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EP4 A;  3HXM A;  4OPJ A;  3H08 A;  3HP9 A;  3ALY A;  4CFD A;  2NUB A;  4Z4H A;  4FM0 A;  4DTO A;  1KFS A;  4DSK A;  4EZ6 A;  3E01 A;  1BL3 A;  4IBN A;  3VQ8 A;  1RDC A;  3K59 A;  4NYN A;  4DQR A;  4DU3 A;  1RTI A;  4ELU A;  4W5R A;  1KVC A;  4H4M A;  4Z4C A;  3L2Q A;  2VG5 A;  1CZ9 A;  3ZSQ A;  2YNG A;  4CEB A;  1U4B A;  1WSJ A;  1B9D A;  4M41 A;  4GVM A;  1RIL A;  3AVK A;  3SQ2 A;  4M3U A;  3PX0 A;  2JGU A;  4RW7 A;  3LAM A;  1S1V A;  5KGX A;  3AVA A;  3AVN A;  3K5M A;  3V4I A;  1QSY A;  4K8X A;  1WAJ A;  2GUI A;  3AA5 X;  3RMB A;  4KHU A;  3SJJ A;  3DI6 A;  3TAR A;  1NJY A;  4DSI A;  3AO4 A;  4BWM A;  1GOC A;  1YTU A;  2XRI A;  3DRP A;  1G15 A;  4DS5 A;  3LZJ A;  1Q8I A;  1SL0 A;  1J53 A;  2PY5 A;  4DWI A;  2OA8 A;  4FZZ A;  3AA4 A;  2O4G A;  3SUP A;  3TI0 A;  1QS4 A;  4BE0 A;  1J9A A;  5DMR A;  1XC9 A;  4W5N A;  3ZT3 A;  2XY8 A;  3NBP A;  1LW0 A;  2FBT A;  1J54 A;  2F96 A;  2KW4 A;  3NF6 A;  3NH0 A;  1N5Y A;  2FBV A;  1HNI A;  4M3R A;  3V9X A;  1S6Q A;  2X6S A;  1EXQ A;  3QET A;  3V9S A;  3ZSW A;  1KRP A;  3I0R A;  4F3O A;  3ZSY A;  3AVJ A;  1RTD A;  1LWE A;  3KKR A;  4E7J A;  1WAF A;  4NCA A;  3SV4 A;  3M8R A;  4GMJ B;  4FJN A;  3TAM A;  4M45 A;  1RT4 A;  3DLH A;  4O0J A;  3VQ5 A;  3KTQ A;  4C8M A;  1UA0 A;  3L3V A;  5HRN A;  1U47 A;  2PZS A;  2AJQ A;  3NDK A;  1C0U A;  1VSI A;  3MEE A;  3B6P A;  3RMD A;  2Z1I A;  3ZT0 A;  3KLE A;  4ELV A;  4DTN A;  1I3A A;  3AO1 A;  2Y1I A;  1EX4 A;  3PO5 A;  5FRO A;  1BCO A;  3U6F A;  1TKZ A;  1BI4 B;  2HNZ A;  4PY5 A;  2IS3 A;  4E19 A;  5SZT A;  4BDP A;  3O3G A;  1W0H A;  4KTW A;  4HTU A;  1S9E A;  4C8L A;  5KRT A;  4KHQ A;  1TK0 A;  2ITG A;  2RF2 A;  3CFR A;  4E89 A;  2DFE A;  5I3U A;  1SL2 A;  2KZM A;  4RG8 A;  1QHT A;  4M3Y A;  2P1J A;  4BDZ A;  3OYC A;  3OS1 A;  4OLA A;  3L2V A;  2Y1J A;  4CF0 A;  4L8R B;  1C6V A;  4CIF A;  5C42 A;  2IAJ A;  4OGC A;  4IFV A;  3CYM A;  3EZ5 A;  4HUG A;  4AH9 A;  5HP1 A;  3TAE A;  3LPU A;  1IKV A;  4LH5 A;  2QK9 A;  4NCG A;  4FJ5 A;  1ZYQ A;  3HVT A;  3U3Y A;  4FYD A;  1IH7 A;  4RW6 A;  4BE1 A;  1Q9Y A;  1T05 A;  1RCH A;  3VQQ A;  1I39 A;  3RMC A;  1C0T A;  4CK3 A;  3OYM A;  1F21 A;  3RRH A;  1L3S A;  1WSG A;  5E41 A;  4E7I A;  3O4Q A;  2HHU A;  4F3T A;  2RN2 A;  2ZE2 A;  1S1X A;  3DLG A;  1C0M A;  3VQP A;  2DFH A;  4DTM A;  4ZTF A;  3L2R A;  3I8D A;  1ASU A;  3L2U A;  3SI6 A;  2OPP A;  1QQC A;  4F2S A;  1VSE A;  3ZSV A;  4JS5 A;  3AVI A;  1JLQ A;  3DRR A;  3OS0 A;  5KI6 A;  4CER A;  3NGY A;  3C94 A;  4FLY A;  1ASW A;  4PA1 A;  3HP6 A;  3L8B A;  3VA0 A;  1WSE A;  4KAZ A;  2YNF A;  3CM5 A;  3ZSX A;  1NJW A;  4FJI A;  1HYV A;  4RW4 A;  3U3G A;  5DK5 A;  4DF4 A;  3DLB A;  4FZY A;  1D9D A;  3HK2 A;  3RRG A;  4IDK A;  3LWL A;  3RR7 A;  3HVR A;  4KRE A;  4FK2 A;  1VSD A;  4CE9 A;  3HYF A;  3MEG A;  4CF2 A;  3THV A;  3OYD A;  4H4O A;  4Y1C A;  3ZT2 A;  2QKK A;  1S9G A;  4B9L A;  4DSJ A;  3VQD A;  1WSF A;  4DTS A;  3VA3 A;  3QER A;  1IO2 A;  2E4L A;  4CGH A;  1NK6 A;  4LSL A;  4AHT A;  3LP3 A;  5HRS A;  1ITG A;  3P83 D;  3K5L A;  3OYJ A;  2FC0 A;  1RT6 A;  1FKP A;  4FW1 A;  4MQ3 A;  4CHO A;  4FJM A;  2FBX A;  1LAV A;  1VSH A;  3BGR A;  3K2P A;  3TR8 A;  2R7Y A;  5C25 A;  4Z4F A;  2G8V A;  4OGE A;  4JRP A;  4JLH A;  4DF8 A;  3LAK A;  3QIO A;  3KIO A;  3WNF A;  2G8F A;  1TKD A;  1HYS A;  5JS2 A;  5KGW A;  3K5N A;  3AVH A;  4M3W A;  3IAY A;  5KTQ A;  3SQ1 A;  5K14 A;  2HW3 A;  1T03 A;  3CG7 A;  3IRX A;  2Z1J A;  3SQ0 A;  1N6Q A;  4HCB A;  4QCL A;  4HHT A;  1TK8 A;  3DLE A;  5C24 A;  4EP4 A;  3D0P A;  4CEE A;  1NK7 A;  3KD1 E;  1UA1 A;  3KLH A;  1RT2 A;  3MAQ A;  2A1S A;  3DRS A;  3NF7 A;  4CIG A;  3VQ6 A;  2G8I A;  4CGG A;  3TWH A;  4DTP A;  4B8A B;  4ID5 A;  3V9Z A;  4CJL A;  3OJU A;  4I2Q A;  4B9U A;  3KLF A;  1U04 A;  1LW2 A;  4I9Q A;  4CF9 A;  1BIS A;  3SUQ A;  3NCI A;  3UIQ A;  1KFD A;  5KRS A;  2HHT A;  3OYN A;  4B08 A;  1U48 A;  3KD5 E;  4OPK A;  5EU7 A;  1RT5 A;  3G10 A;  1RDA A;  3RWU A;  4PWD A;  1Y97 A;  2OPS A;  2X74 A;  1W9H A;  4DFJ A;  4E1N A;  2HVI A;  4OKJ A;  4J2D A;  2JLE A;  3OJS A;  3NAE A;  4CHY A;  2HB5 A;  2XY5 A;  1BHL A;  2E6M A;  1RTJ A;  2YV0 X;  2W42 A;  4R5P A;  1LV5 A;  3DM2 A;  4IG3 A;  5T7B A;  1GOA A;  1RDB A;  1REV A;  3AVG A;  3ISN C;  4W5Q A;  4FW2 A;  5FDL A;  4ZTJ A;  4PUO A;  4XIU A;  4CFB A;  3VQ9 A;  4CJ4 A;  1A5V A;  2IC3 A;  4FLV A;  1IG9 A;  1NOY A;  1DTQ A;  4KFB A;  4CJ5 A;  3TAN A;  1IKW A;  4O55 A;  4N76 A;  3S3M A;  1SKR A;  1U49 A;  4DLG A;  2HND A;  3K58 A;  4BE2 A;  2Z1H A;  2IOC A;  3VQA A;  2O4I A;  1HPZ A;  4M3Z A;  1TKX A;  2ATQ A;  3V9U A;  2YHA A;  1SKS A;  2YNH A;  2GBZ A;  2VG7 A;  4CGF A;  4C8K A;  4DTJ A;  1LWF A;  4N56 A;  4CEC A;  1RBR A;  4FJK A;  5J2N A;  5J1E A;  3QES A;  3QEX A;  4DU1 A;  3LP0 A;  3FFI A;  3CFP A;  4N41 A;  4FK4 A;  2F8T A;  3ULD A;  4OKE A;  1NK0 A;  3AVC A;  4NYF A;  1B9F A;  1SUQ A;  1IKY A;  1TGO A;  3MED A;  1JXB A;  4KHW A;  4M3T A;  1S6P A;  4RW9 A;  4CJV A;  4Q5V A;  1LAW A;  1UWB A;  5FRN A;  4E7K A;  3ZCM A;  4KB1 A;  5CYM A;  1RDD A;  5J2P A;  2HMI A;  1BCM A;  3PUF A;  5CZ1 A;  1KSP A;  2P5G A;  2B4J A;  4J2B A;  1WLJ A;  1KVA A;  2D0A A;  4HUF A;  3RTV A;  4M42 A;  4JRQ A;  3F9K A;  1JLA A;  2QKB A;  3QEP A;  3OYK A;  4FLX A;  4CHQ A;  4CF1 A;  4NCB A;  2BE2 A;  4JS4 A;  3KLI A;  3LP2 A;  3QO9 A;  4G1Q A;  4FJ8 A;  5I42 A;  1TL3 A;  1WNS A;  3S3N A;  4C8N A;  2B5J A;  1XHZ A;  2X78 A;  4MFB A;  1HMV A;  3SUO A;  3CM6 A;  1S5J A;  3KKS A;  4HVJ A;  3SCX A;  1NKB A;  2HHX A;  2HNY A;  1QSL A;  4Z4G A;  3VQB A;  1VSL A;  4YFU A;  3OS2 A;  1VSM A;  3A2F A;  4FVM A;  4AHS A;  1ZBI A;  3PV8 A;  4N5S A;  3F73 A;  1T7P A;  3RMA A;  3LPT A;  4FM1 A;  2E6L A;  2KFZ A;  3OYA A;  3LP1 A;  4FLU A;  4DQI A;  3OY9 A;  4CJP A;  5J2M A;  3QEW A;  4CEZ A;  3VQE A;  1BQM A;  4OJR A;  1HQE A;  4E7L A;  1NOZ A;  4DFP A;  3TAG A;  3DOK A;  2RPI A;  3VQ7 A;  1SKW A;  4FK0 A;  4DSE A;  3LAN A;  4I7F A;  3S9H A;  3MXI A;  2BDP A;  1FK9 A;  1NJZ A;  2IGI A;  1Z26 A;  5J2Q A;  1LWC A;  1S1W A;  1Z25 A;  4LH4 A;  4B9M A;  2WOM A;  4FCY A;  1HQU A;  3LAL A;  3V9W A;  4DFK A;  4F2R A;  1YT3 A;  3ZSR A;  3EY1 A;  1RT3 A;  3V1Q A;  1FKO A;  1FXX A;  3AV9 A;  1D5A A;  2XO7 A;  2YKM A;  3AO5 A;  3C95 A;  4AHV A;  4B9V A;  4CJW A;  2FBY A;  1BGX T;  3T19 A;  4UQG A;  3PY8 A;  4OVL A;  4FLT A;  1A5X A;  1SV5 A;  3B6O A;  1JLE A;  3D45 A;  3O3F A;  1L5U A;  4B9T A;  1D9F A;  4W5O A;  4KTQ A;  5CY4 A;  3NF9 A;  3QNN A;  3M8S A;  3AA3 A;  1R0A A;  4KPY A;  3AA2 A;  4KKO A;  4ICL A;  4KV8 A;  4I2P A;  3KJV A;  4FJJ A;  3DMJ A;  4IG0 A;  3S3O A;  4BAC A;  1SL1 A;  4CK2 A;  4M3X A;  1BIZ A;  4FJX A;  5JS1 A;  3NH1 A;  4KHY A;  5D3G A;  4FZX C;  3K5O A;  1TKT A;  1VSJ A;  1ZBF A;  3QLH A;  1EET A;  4LY7 A;  5HBM A;  4O5B A;  1L3T A;  1XI1 A;  1KLN A;  1S1U A;  4TSX A;  1NK4 A;  4DSL A;  4J2A A;  3V6D A;  4FJ9 A;  2OPR A;  4PQU A;  3SPY A;  3NFA A;  3T3F A;  4CJQ A;  3O3H A;  3TAP A;  1Q9X A;  1JLC A;  4DSF A;  3RR8 A;  3TAB A;  3AVF A;  4CGJ A;  1X9M A;  4AHU A;  3G0Z A;  1DLO A;  1QE1 A;  3SYZ A;  1J5O A;  3LDS A;  1ASV A;  2BAN A;  4DLE A;  3OYE A;  4LD0 A;  1CXQ A;  4Z4I A;  3C6U A;  3CQ8 A;  2A1R A;  1GOB A;  4E1M A;  3AVM A;  2BGG A;  3OYI A;  3MXM A;  2HHS A;  3NGI A;  3HL8 A;  1ZBL A;  4F4K A;  1VSK A;  1DTT A;  3MXJ A;  3JYT A;  4CFA A;  4KHS A;  5HLF A;  2B6A A;  1JLB A;  2P51 A;  2GV9 A;  3HPH A;  3LWM A;  2XY6 A;  3OYF A;  1T8E A;  4FJG A;  1MU2 A;  4GW6 A;  4CHN A;  5CYQ A;  2D0C A;  4E3S A;  1TK5 A;  2LSN A;  1CZB A;  4FXD A;  1WSH A;  1KVB A;  1HRH A;  3ZSO A;  3NH2 A;  1JL1 A;  3QEV A;  1KLM A;  2XY7 A;  4CCH A;  2HVH A;  3AO3 A;  1QSS A;  4ELT A;  1C1A A;  2OPQ A;  3ZT4 A;  4J2E A;  3K57 A;  4CJE A;  1K6Y A;  4BWJ A;  4CGD A;  3HPO A;  4CIE A;  4DMN A;  1JLF A;  3OYH A;  3TAQ A;  1X9S A;  1TAU A;  1RT7 A;  4C8O A;  4FJL A;  2KZZ A;  2ZQB A;  2OZS A;  4N47 A;  4CEA A;  1TL1 A;  1TAQ A;  3NF8 A;  4I9L A;  1NK8 A;  4QOZ B;  3ASM A;  1HYZ A;  3VQC A;  2QXF A;  4CEO A;  3KK3 A;  4E7H A;  4DU4 A;  3IS9 A;  2I5J A;  3HST B;  4CED A;  4HCC A;  3EYZ A;  2G8W A;  1IKX A;  1BIU A;  3CFO A;  3M8P A;  4Z4E A;  2VG6 A;  3NHG A;  1RBV A;  3SV3 A;  4ID1 A;  4CEF A;  3SUN A;  4B9N A;  3HO1 A;  4CGI A;  4BDY A;  4DFM A;  3WNE A;  3M8Q A;  3AVB A;  3OYG A;  4CJR A;  4FJ7 A;  1B92 A;  3C6T A;  4KRF A;  1XWL A;  3L3U A;  3L2W A;  4KI4 A;  4CJT A;  2HHQ A;  1C1C A;  2DFF A;  4KHN A;  1WSI A;  3MEC A;  2X6N A;  3OVN A;  2PYL A;  1L3V A;  2D0B A;  4IKF A;  3VN5 A;  3ITH A;  5SWM A;  1EKE A;  1A5W A;  3AO2 A;  5HRP A;  4EZ9 A;  1CLQ A;  1BQN A;  4B8C A;  3HJF A;  4DQS A;  3SPZ A;  1QTM A;  2G8H A;  3V1O A;  3ZT1 A;  4B3O A;  1YTA A;  4Z0U A;  4KB0 A;  4CF8 A;  1VRU A;  4CJS A;  2G8U A;  4DG1 A;  3HM9 A;  3SZ2 A;  2ETJ A;  4DTX A;  4CES A;  3OYB A;  4FM2 A;  3QIN A;  2KTQ A;  1BI4 A;  2KFN A;  1NK5 A;  4ZHR A;  5HRR A;  1U45 A;  1WN7 A;  2KQ2 A;  4DS4 A;  1NKE A;  4CEQ A;  4CHP A;  1YVU A;  4YNQ A;  1VRT A;  4CHZ A;  4HUE A;  4AIL C;  4CJK A;  1S1T A;  4O44 A;  3DOL A;  3HT3 A;  3DLK A;  3I0S A;  2XHB A;  4AHR A;  4FLW A;  4QAG A;  1O1W A;  3QIP A;  1JLG A;  2D5R A;  4W5T A;  3TAF A;  3PX4 A;  1RBU A;  3P5J A;  1KCF A;  4O0I A;  1TVR A;  2EX3 A;  1NKC A;  3BDP A;  5HRO A;  3PO4 A;  1HJR A;  4H8K A;  4KI6 A;  4CK1 A;  3AVL A;  2P5O A;  4KTZ A;  1UAX A;  4DQQ A;  2YHB A;  3QNO A;  2IDO A;  2DTU A;  3KLG A;  4CFC A;  3KK1 A;  4OLB A;  2Q3S A;  4Y1D A;  1NJX A;  3HPG A;  1RT1 A;  4FJH A;  2OYQ A;  4B9S A;  2RKI A;  3PX6 A;  2Z1G A;  5CZ2 A;  1X9W A;  1KTQ A;  4LSN A;  1JXE A;  1RBT A;  3DLR A;  1X1P A;  1VK0 A;  1JKH A;  5FRM A;  4CJU A;  4F8R A;  3ZSZ A;  3LZI A;  4K8Z A;  2HHW A;  4O4G A;  1RTH A;  3IG1 A;  3VQ4 A;  3WNH A;  2PYJ A;  3V81 A;  1JL2 A;  2EHG A;  3V1R A;  1CXU A;  2VWJ A;  4E0D A;  1UOC A;  1C1B A;  3KK2 A;  1NK9 A;  3NGZ A;  2F8S A;  2G8K A;  4KO0 A;  1ZBU A;  4DQP A;  2HHV A;  3OYL A;  3JSM A;  2WON A;  1XHX A;  4AHC A;  4Q0B A;  3NE6 A;  4DTR A;  1ZBH A;  1VSF A;  2YNI A;  3T1A A;  4IFY A;  3SNN A;  4FLZ A;  2ZD1 A;  1L3U A;  1HNV A;  4DTU A;  3O4N A;  1RBS A;  2OZM A;  1RNH A;  3WNG A;  2VWK A;  4CJ3 A;  4OKK A;  1D8Y A;  3DYA A;  3P1G A;  2YKN A;  2DY4 A;  1TV6 A;  4WE1 A;  3QEI A;  3SQ4 A;  4RW8 A;  4CJF A;  4EP5 A; 
#chains in the Genus database with same CATH topology
 3ALY A;  3D6R A;  3L4Q A;  4ILH A;  1KFS A;  3A8Y A;  3VQ8 A;  3K59 A;  4ELU A;  4O8K A;  1KVC A;  4OPA A;  1XMQ K;  2VG5 A;  1IBL K;  1U4B A;  2H3G X;  4H0X B;  3UE5 A;  1YJN N;  4BRK A;  3AVN A;  5AZI A;  3SAF A;  2OTJ N;  2GUI A;  3LDO A;  5M1N A;  3SJJ A;  3DI6 A;  3TAR A;  4BWM A;  3DRP A;  3JXU A;  1Q8I A;  4DWI A;  3QML A;  5IT9 O;  4HWI A;  2Q97 A;  3CCE N;  4GV9 A;  2F96 A;  1N5Y A;  3VET A;  3VF4 A;  1QQO A;  3CJ9 A;  1EXQ A;  3ZSW A;  1RTD A;  3M8R A;  1WB9 A;  4B1X B;  3TAM A;  3KTQ A;  5LL6 Z;  3L3V A;  5M1P A;  2PZS A;  2AJQ A;  3R6M A;  3KWG A;  3RMD A;  3MMV A;  4LFB K;  4C23 A;  4YOW A;  5F2R A;  3VEY A;  2P9U A;  2D4W A;  3AO1 A;  4JNE A;  1SQK A;  3E9P A;  1N8R O;  2NLX A;  5BR8 K;  4PY5 A;  4E19 A;  4BC2 A;  4CBU A;  4KTW A;  4HTU A;  1S9E A;  3O9R A;  4E89 A;  2KZM A;  4M3Y A;  4JN4 A;  3L2V A;  4FWN A;  4ISF A;  5HP1 A;  3TAE A;  1QZ6 A;  2JWL A;  4NCG A;  4EAH D;  4ISE A;  4RW6 A;  4Z94 A;  4JKA A;  3C6H A;  4BE1 A;  1Q9Y A;  3VQQ A;  1I39 A;  3RMC A;  4BRD A;  2O8B A;  5F0X A;  2O8B B;  1L3S A;  4H5V A;  4F3T A;  1VQ8 N;  1S1X A;  2P9K B;  3I8D A;  4WFN L;  1GLJ O;  3SI6 A;  1IG8 A;  2QM1 A;  3A5L C;  1NGI A;  3SAH A;  4JS5 A;  4IO8 A;  3OS0 A;  4CER A;  4FLY A;  2QWR A;  1S72 N;  4Y0W A;  3VA0 A;  3WXM B;  1WSE A;  4YHH K;  2FSK A;  3CMA N;  1WOQ A;  4MO5 A;  4FZY A;  3HK2 A;  3HVR A;  4K43 A;  3UKR B;  2IIR A;  4BY9 C;  3THV A;  2GTD A;  3I8B A;  1S9G A;  3ULE A;  1NGF A;  1OH6 A;  3PSF A;  4DTS A;  4GV3 A;  3VA3 A;  3U4L A;  1NK6 A;  4LSL A;  4QS9 A;  3P83 D;  3CI5 A;  5AFU A;  1RT6 A;  2P9U B;  4FJM A;  2FBX A;  4Z4F A;  1JCG A;  4EFH A;  4CZJ A;  3WNF A;  1TKD A;  3MWP A;  2YHY A;  3IDH A;  5JS2 A;  5AQV A;  3T7Z A;  3O6W A;  4HHT A;  3DLE A;  3D0P A;  3KD1 E;  4WQ4 C;  5AQU A;  3KLH A;  4FOE A;  4BVP A;  1NGB A;  3VQ6 A;  2G8I A;  4DTP A;  5EX5 A;  4CJL A;  3GDQ A;  4B9U A;  4I9Q A;  3O80 A;  3KWI A;  1HNW K;  5KQD A;  2KHO A;  3E9L A;  4BRI A;  1YJW N;  4BG9 A;  3CJ7 A;  3C6A A;  2ZM6 K;  2JLE A;  2RE2 A;  1RTJ A;  4B9Q A;  2JWK A;  1REV A;  4ZTJ A;  2ZF5 O;  4PUO A;  1NOY A;  2HF3 A;  4N76 A;  4PKH A;  4DLG A;  2QWN A;  3VQA A;  1TKX A;  4H5W A;  1QZ5 A;  1SKS A;  4DR4 K;  3O9Q A;  1X3N A;  4FJK A;  5J2N A;  3VEX A;  5J1E A;  3LP0 A;  3UKR A;  1NK0 A;  5EVZ A;  1JXB A;  1S6P A;  3W3D A;  4Q5V A;  1LAW A;  3KZB A;  4E7K A;  3ZCM A;  4FO0 A;  1BCM A;  1KSP A;  1KVA A;  4NB4 A;  3HTV A;  4HUF A;  3L4I A;  4M42 A;  3TU5 A;  4YOR A;  4CHQ A;  3QO9 A;  3LP2 A;  3N4Q A;  5I42 A;  1VHX A;  1WNS A;  1FJG K;  4C8N A;  4MFB A;  2A3Z A;  3I56 N;  1YF5 L;  1NKB A;  2W6L A;  5ADX A;  5LMU K;  4K25 A;  1VSL A;  4YFU A;  1VSM A;  4JK9 A;  2F9T A;  4NXM K;  4N5S A;  3RMA A;  3LP1 A;  3J7A P;  4DQI A;  3OY9 A;  5J2M A;  4K41 A;  4CEZ A;  3CF5 L;  2A42 A;  4OJR A;  1HQE A;  4JK8 A;  4IEE A;  2QWP A;  4DFP A;  3DOK A;  3BY5 A;  4B3T K;  4BR0 A;  3LAN A;  4I7F A;  4LF9 K;  5AQF A;  1QVF M;  2WBN A;  2IGI A;  1LWC A;  1Z25 A;  2WOM A;  1C0G A;  1YT3 A;  5CR4 A;  2XO7 A;  2YKM A;  5AQT A;  4BRG A;  2FBY A;  1BGX T;  3UKU B;  4CZF A;  2GX9 A;  1A5X A;  1SV5 A;  3D45 A;  1JLE A;  4B9T A;  3QNN A;  4BG8 A;  3AA2 A;  4K0K K;  4CZG A;  4FJJ A;  4IG0 A;  4BRE A;  4BAC A;  4CK2 A;  1BIZ A;  3NH1 A;  3MWT A;  1ZBF A;  3D7E O;  3D2E B;  4U7B A;  4TSX A;  2ZJQ L;  3SPY A;  4QS8 A;  3AVF A;  4CGJ A;  3CCJ N;  3PSI A;  1J5O A;  1BOT O;  4DLE A;  1NGD A;  1P90 A;  2BGG A;  5GAE P;  2HHS A;  1ZBL A;  3KHY A;  4H0P A;  3MXJ A;  3ENB A;  5I9E B;  4IEI A;  5E84 A;  2XY6 A;  4GW6 A;  4CHN A;  2D0C A;  2VQF K;  2UU9 K;  1KVB A;  2HMP A;  1HRH A;  2HVH A;  1KLM A;  1C1A A;  3OA9 A;  3K57 A;  4NLB A;  4CGD A;  3OYH A;  3TAQ A;  1TAU A;  4FJL A;  2KZZ A;  2ZQB A;  4B1Y B;  4CEA A;  3OTO K;  1TAQ A;  4BRP A;  1NK8 A;  4YOY A;  3ASM A;  1HYZ A;  2IVO A;  3KK3 A;  3IS9 A;  2I5J A;  4JD2 B;  3K0S A;  2HBM A;  3U9D A;  4ID1 A;  3HO1 A;  4B3S K;  4JI6 K;  3ZLJ A;  4CJR A;  3MCP A;  4KRF A;  3SBT A;  4CJT A;  2HHQ A;  4R79 A;  3AGR A;  3OVN A;  4YDU A;  3M3Z A;  1A5W A;  1BUP A;  1BQN A;  1QTM A;  3C0B A;  3V1O A;  4KB0 A;  4EIA A;  4JI0 K;  5LMN K;  5F1X A;  4G9Z A;  3EEQ A;  3CQY A;  3SZ2 A;  4YOU A;  3FZH A;  4FM2 A;  1NK5 A;  5HRR A;  1NKE A;  4BGB A;  4CEQ A;  3ZEU B;  4YNQ A;  1Z6R A;  1S1T A;  3TAF A;  1O1W A;  3P5J A;  1NKC A;  2EX3 A;  3RSE B;  5HRO A;  3RSE A;  3CQX A;  4CK1 A;  3AVL A;  2P9P B;  3VPZ A;  4KTZ A;  4DQQ A;  2DTU A;  1KAY A;  3KLG A;  4CFC A;  4FJH A;  4GKJ K;  4B9S A;  3PX6 A;  5CZ2 A;  2UXB K;  2GEL A;  4LSN A;  3SAG A;  2GUP A;  1VK0 A;  1JKH A;  5FRM A;  4L3Q A;  3LZI A;  4FOI A;  4E0D A;  2VWJ A;  1NK9 A;  3UKU A;  1Q81 O;  2G8K A;  3JSM A;  2WON A;  2AA4 A;  3T1A A;  4IFY A;  1HNV A;  2E5L K;  1NU0 A;  1RNH A;  3MK6 A;  2VWK A;  4ILJ A;  1HKC A;  4CJ3 A;  3D2E A;  1K73 O;  3P1G A;  1IJJ A;  2DY4 A;  3QEI A;  3SQ4 A;  4DHY A;  4IWV A;  1EP4 A;  1XNR K;  1YTU A;  4Z4H A;  4DTO A;  4DSK A;  3H6E A;  3E01 A;  4IBN A;  3J7Z O;  1NNE A;  4DQR A;  4NYN A;  1NJI O;  2O8E A;  2NRT A;  3NVM A;  3LDN A;  2VCP A;  4Z4C A;  5CE3 A;  3P38 A;  1R59 O;  1YIT N;  1CZ9 A;  2YNG A;  1WSJ A;  1B9D A;  4M41 A;  3T1H K;  3AVK A;  1MA9 B;  2JGU A;  3LAM A;  1S1V A;  3FZL A;  4WQ5 A;  3ZEU A;  4UY8 O;  4JYA K;  3AA5 X;  3AAR A;  1OVQ A;  3EKU A;  1NJY A;  3AO4 A;  1GOC A;  5EY4 A;  5GAD P;  2KLA A;  1G15 A;  1NGH A;  4WYB A;  3LZJ A;  5EOY A;  1S22 A;  2OA8 A;  4FZZ A;  2WFB A;  1XC9 A;  3ZT3 A;  4A5B A;  2XY8 A;  3BEX A;  3NBP A;  1LW0 A;  4PKG A;  2X6S A;  4XH5 A;  4F3O A;  3VER A;  1LWE A;  1KAZ A;  4E7J A;  1WAF A;  3P31 A;  3SV4 A;  5LJW A;  4GMJ B;  4H5N A;  4M45 A;  4JV5 K;  1MWM A;  4C8M A;  1UA0 A;  3MEE A;  3B6P A;  3KLE A;  3PO5 A;  5FRO A;  1BI4 B;  2HNZ A;  4U67 L;  1HR0 K;  5KQ8 A;  2HBK A;  5C12 A;  2VYP A;  2J4R A;  1TK0 A;  2ITG A;  2DFE A;  4H5R A;  2NRX A;  4RG8 A;  1QQN A;  3OYC A;  4IO9 L;  2QW9 A;  2Y1J A;  3H46 O;  1C6V A;  5C42 A;  4OGC A;  3CJ1 A;  4BRC A;  3EZ5 A;  4HUG A;  4AH9 A;  1IKV A;  4LH5 A;  3SMP A;  2QK9 A;  3HVT A;  1Q86 O;  3CJC A;  3MN5 A;  5AQQ A;  4FWP A;  4A5A A;  1RCH A;  2VGM A;  3CJB A;  2RN2 A;  5AQH A;  5AQM A;  1C0M A;  3VQP A;  4DTM A;  1ASU A;  3O9U A;  1VSE A;  3ZSV A;  5DM6 L;  3ATU A;  1D4X A;  1JLQ A;  3DRR A;  3C94 A;  4PA1 A;  3L8B A;  3CM5 A;  4FL9 A;  2O8C B;  4BR9 A;  2CH6 A;  1WBD A;  3U3G A;  5DK5 A;  4FWL A;  3ID6 A;  4FK2 A;  1SS6 A;  3FLC O;  1VSD A;  1N32 K;  3MEG A;  4CF2 A;  3OYD A;  2NNW A;  5BN9 A;  2QWL A;  3U8X A;  4JKF A;  3QER A;  1RFQ A;  4FWM A;  4AHT A;  3LP3 A;  1ITG A;  1NMN A;  3J80 O;  3OYJ A;  4I6M A;  4FW1 A;  1FKP A;  1VSH A;  2E1Y A;  5LY3 A;  3KIO A;  2FSJ A;  3W0L A;  3AVH A;  5E26 A;  2FF6 A;  3IAY A;  5K14 A;  2ASO A;  2Z1J A;  3O9T A;  1TK8 A;  3QDK A;  4CEE A;  1TUU A;  1UA1 A;  1ZXO A;  3DRS A;  3NF7 A;  1BWF O;  3TTC A;  4JK7 A;  3OJU A;  4I2Q A;  3CXC M;  1W97 L;  3KLF A;  4XEI A;  4BRQ A;  1U2V B;  1XUP O;  3ATV A;  5KRS A;  3O1B A;  3OYN A;  4H03 B;  3RWU A;  5EU7 A;  1W7A A;  1RDA A;  4DFJ A;  4J2D A;  4CHY A;  2XY5 A;  1BHL A;  2E6M A;  2YV0 X;  5GIP A;  2W42 A;  1LV5 A;  3DM2 A;  4IG3 A;  4FWO A;  5TKW A;  4XIU A;  1T44 A;  3KVG A;  3ZX0 A;  4CJ5 A;  4HTL A;  3SJH A;  3S3M A;  1SKR A;  2HND A;  3K58 A;  1Q7Y O;  2O8C A;  4GKK K;  1HPZ A;  2YHA A;  4DR1 K;  2YNH A;  5BPL A;  2HBJ A;  4FPB A;  4CGF A;  4DTJ A;  4C8K A;  4N56 A;  4WFA L;  5AQR A;  4DU1 A;  3FFI A;  2OAN A;  2F8T A;  1KD1 O;  4OKE A;  1BA1 A;  3AVC A;  1B9F A;  2I7N A;  1IKY A;  4M3T A;  4RW9 A;  3JAM O;  5FRN A;  5J2P A;  2HMI A;  3PUF A;  4DR7 K;  2BUP A;  2O8F B;  4DCH A;  5BR9 A;  4JRQ A;  4CF1 A;  3G6E N;  2BE2 A;  2W6K A;  2O8D A;  4G1Q A;  3S41 A;  4PL8 A;  1GLD G;  3S3N A;  1TUY A;  2B5J A;  2X78 A;  3CM6 A;  3SCX A;  4HVJ A;  3D2F A;  2HNY A;  5HOO A;  3UB5 A;  3SLC A;  5BRE A;  1YUW A;  3OS2 A;  3A2F A;  4WFB L;  2QWO A;  4AHS A;  1ZBI A;  3F73 A;  4FM1 A;  3TSQ A;  1MDU B;  3QEW A;  4WQ5 C;  4QOZ B;  4E7L A;  1NOZ A;  2RPI A;  4DSE A;  3S9H A;  1NJZ A;  3U9Z A;  3LAL A;  4DFK A;  3EY1 A;  3IFR A;  2P9N B;  1YVN A;  4OVL A;  4WCE L;  3B6O A;  4FLT A;  3O3F A;  1EO1 A;  3DXM B;  4KTQ A;  1ATN A;  1R0A A;  4KV8 A;  4LFC K;  4I2P A;  3KJV A;  3DMJ A;  3S3O A;  4M3X A;  4M7Y A;  5FLX O;  1XI1 A;  1KLN A;  4DSL A;  3V6D A;  4GY2 B;  3T3F A;  3TAP A;  4CW7 B;  4DSF A;  3J7Y P;  3RR8 A;  3R8E A;  4X62 K;  1X9M A;  4AHU A;  4DV3 K;  4YOV A;  4BRO A;  5BPM A;  1EQY A;  4LD0 A;  2KKZ A;  1OH7 A;  4Z4I A;  5EXW A;  3NGI A;  3JYT A;  4A57 A;  2UXC K;  2B6A A;  2GV9 A;  4ILG B;  2V51 B;  3OYF A;  1T8E A;  4IZ9 A;  5CYQ A;  4DV6 K;  4E3S A;  4FVU A;  3MDQ A;  4CZK A;  3ZSO A;  2XY7 A;  1JL1 A;  2ITM A;  1MWK A;  2OPQ A;  4J2E A;  1U6Z A;  1K6Y A;  5AQG A;  5BRD A;  3LDL A;  4C1N K;  4DU4 A;  4H0T B;  3J8A A;  3CD6 N;  3HST B;  1EWR A;  3O5B A;  2G8W A;  1IKX A;  4Z4E A;  3CFO A;  3ZET A;  2VG6 A;  3FFK B;  4YDU C;  3SUN A;  4JKH A;  5AZJ B;  2P9I B;  5AQX A;  3WNE A;  3M8Q A;  3AVB A;  3WQU A;  2ZJP L;  1XWL A;  3L2W A;  3O08 A;  4KI4 A;  4O8U A;  1L3V A;  3LM9 A;  5ADX H;  4IKF A;  3ITH A;  5SWM A;  1EKE A;  2WUS A;  3HJF A;  3THX A;  3ZT1 A;  3DJC A;  5LJV A;  4DG1 A;  2D0O A;  3HM9 A;  2ETJ A;  3CC2 N;  3OYB A;  4ZHR A;  4DS4 A;  3M5R A;  1JCE A;  5AZI B;  1NGG A;  4H5T A;  3D2F B;  4CJK A;  3DOL A;  1LOT B;  1GLB G;  1RDW X;  4QAG A;  1QSY A;  5BRF A;  2HHX A;  3PX4 A;  1KCF A;  1SAZ A;  2FSN A;  3PO4 A;  4H8K A;  1IBK K;  4JEP A;  4LF5 K;  4DB3 A;  1S3X A;  4OO1 J;  1V4T A;  2Q3S A;  4Y1D A;  1RT1 A;  2OYQ A;  2RKI A;  4FWS A;  3AAP A;  4CI6 A;  1RBT A;  3DLR A;  1X1P A;  4IXC A;  4CJU A;  4F8R A;  1RTH A;  2E2O A;  4H0Y B;  1E3M A;  1JL2 A;  1CXU A;  2UUB K;  4KO0 A;  1ZBU A;  1K8K A;  3OYL A;  4MLH A;  5AQL A;  3VMF B;  3SNN A;  4C1N I;  4CZM A;  5IWA K;  4DTU A;  3O4N A;  1RBS A;  3SBG A;  3SMS A;  3WT0 A;  4OKK A;  4DUY K;  4BQL A;  3EKS A;  1DKG D;  4EP5 A;  2HBL A;  3THW A;  4OPJ A;  3HP9 A;  3HRG A;  1Q82 O;  4CFD A;  2NUB A;  4FM0 A;  4EZ6 A;  3HI0 A;  1RDC A;  4DU3 A;  1RTI A;  4JI8 K;  4W5R A;  4H4M A;  2F4V K;  2V7Y A;  4JI4 K;  1M90 O;  3HBT A;  3THX B;  4BRN A;  3ZSQ A;  1LCU A;  3CCR N;  4BR2 A;  4GVM A;  1RIL A;  4GV6 A;  4RW7 A;  3T1Y K;  4BC3 A;  3K5M A;  3V4I A;  4K8X A;  1GLL O;  3RMB A;  4BR4 A;  4DS5 A;  2UXD K;  1J53 A;  2PY5 A;  3C7N B;  4BQZ A;  4YY3 K;  4JI7 K;  1NLV A;  3C7N A;  3DLL L;  1QS4 A;  5AQW A;  1J9A A;  5DMR A;  4W5N A;  2KW4 A;  3NF6 A;  1HNI A;  4AF1 A;  4M3R A;  3V9X A;  1S6Q A;  3QET A;  3V9S A;  1KRP A;  3I0R A;  3ZSY A;  3FGU A;  3KKR A;  2NRR A;  4NCA A;  1RT4 A;  4FPA A;  1U47 A;  5M1K A;  4KH6 A;  5JVG L;  2Z1I A;  4ELV A;  1VAZ A;  2YJE A;  2Y1I A;  3CCM N;  5BN8 A;  1TKZ A;  2IS3 A;  3O3G A;  1W0H A;  4C8L A;  5KRT A;  2EWS A;  1G99 A;  2P1J A;  4BDZ A;  3OS1 A;  3AAQ A;  2QI2 A;  1GLC G;  4L8R B;  4CD3 A;  4CIF A;  2IAJ A;  4IFV A;  2BTF A;  3ZYY X;  5AQZ A;  1C0F A;  1K8A O;  4CZE A;  4YOT A;  2E1Z A;  1ZYQ A;  3H3O B;  4K42 A;  5AQJ A;  1YHQ N;  4FYD A;  1T05 A;  1C0T A;  4CK3 A;  4LF6 K;  2W40 A;  3OYM A;  1F21 A;  3RRH A;  2NRZ A;  3RVC A;  5E41 A;  4E7I A;  1XQS C;  4X65 K;  2HHU A;  2ZE2 A;  3DLG A;  2DFH A;  4MDB A;  3L2U A;  2P9K A;  3MX2 A;  1QQC A;  1BDG A;  3IUC A;  2E2P A;  1BA0 A;  5FPN A;  5KI6 A;  3NGY A;  1ASW A;  4IFE A;  4KAZ A;  2YNF A;  4FJI A;  2QA4 N;  2WTU A;  4MDA A;  3EL2 A;  1HYV A;  4RW4 A;  4DF4 A;  3DLB A;  5B8H A;  5AZJ A;  3RRG A;  4IDK A;  3LWL A;  4QS7 A;  1HX1 A;  4FWK A;  4CE9 A;  3HYF A;  3CCV N;  3ZT2 A;  4Y1C A;  3ULE B;  2QKK A;  1CZA N;  4B9L A;  5GIO A;  3VQD A;  3M1F A;  4WQ4 A;  2QXL A;  4CGH A;  4CJ7 A;  3FZF A;  3E66 A;  1OKJ A;  2FC0 A;  4AM6 A;  4MQ3 A;  4BVO A;  2GWK A;  4CHO A;  3K2P A;  5C25 A;  2G8V A;  4OGE A;  4JRP A;  4DF8 A;  3LAK A;  2NRH A;  3QIO A;  2G8F A;  3QFU A;  5JLH A;  1T03 A;  3CG7 A;  3SQ0 A;  4HCB A;  1Q18 A;  2AP1 A;  4EP4 A;  5C24 A;  4XH1 A;  4BRH A;  2V52 B;  3GE1 A;  3MAQ A;  3L6Q A;  4CIG A;  5AQS A;  5AQI A;  4CGG A;  3TWH A;  3V9Z A;  4RTF D;  1U04 A;  2A5X A;  3NCI A;  1YJ9 N;  1KFD A;  4E1J A;  1FW6 A;  4B08 A;  1U48 A;  4OPK A;  3G10 A;  2ZGZ A;  4A62 A;  5C2F A;  4E1N A;  2HVI A;  4OKJ A;  3OJS A;  1HNZ K;  2HB5 A;  3MCA B;  1KQS M;  1Y64 A;  1HJO A;  4AQY K;  3GOI A;  1O13 A;  3H1V X;  2V7Z A;  4BRF A;  4KBO A;  5T7B A;  3CCS N;  3AVG A;  4FW2 A;  5FDL A;  4JKB A;  4JKD A;  4CFB A;  3VQ9 A;  3EZW A;  1A5V A;  3TAN A;  1IKW A;  4O55 A;  1KAX A;  3FR0 A;  3ZX2 A;  4KH4 A;  1U49 A;  1VQK N;  2A40 A;  4BE2 A;  2Z1H A;  2IOC A;  2O4I A;  2NRW A;  4CBX A;  5KPZ A;  3V9U A;  4CEC A;  3QES A;  3ULD A;  3PIO L;  3MED A;  4PHT X;  4KB1 A;  4BGA A;  1RDD A;  2A6A A;  4J2B A;  5CZ1 A;  3HOT A;  3VF2 A;  2OCE A;  1WLJ A;  3F9K A;  1JLA A;  5FPM A;  4OPH A;  3EE9 A;  1ZC6 A;  3LM2 A;  4NCB A;  3KLI A;  4FJ8 A;  1HKG A;  1KXP A;  3H45 C;  1TL3 A;  3VTH A;  5KPR A;  3TTF A;  2OTL N;  3Q7C A;  4FWR A;  1QSL A;  3VQB A;  1X3M A;  4FVM A;  3PV8 A;  4KH5 A;  2KFZ A;  1NGA A;  1YIJ N;  4FLU A;  1VQN N;  1BQM A;  4BRA A;  4JD2 A;  3VQ7 A;  4CZL A;  1SKW A;  4H0V B;  3MXI A;  1DEJ A;  4IOA L;  4CVN E;  3TTD A;  3DXK A;  3QIC A;  4LH4 A;  3DAW A;  3WXK A;  4B9M A;  3VTI A;  1HQU A;  3V9W A;  1RT3 A;  1FXX A;  3AO5 A;  4MO4 A;  3ZX3 A;  4B9V A;  4CJW A;  1VQ6 N;  1XMO K;  4BRM A;  2I7P A;  5DM7 L;  4UQG A;  3QBX A;  1L5U A;  5JIC A;  5JLF A;  1D9F A;  5CY4 A;  3NF9 A;  3M8S A;  3AA3 A;  4KPY A;  4KKO A;  3VES A;  1P8Z A;  1QQM A;  1GLF O;  5JS1 A;  3TSU A;  2Q2R A;  1E4F T;  3R9P A;  3K5O A;  1TKT A;  3QLH A;  1L3T A;  1S1U A;  4J2A A;  4PQU A;  3NFA A;  4CJQ A;  3CET A;  4GNI A;  3O3H A;  1DLO A;  3SYZ A;  1T6D A;  1ASV A;  3LDS A;  3OYE A;  1CXQ A;  3G25 A;  3C6U A;  2IVN A;  3CQ8 A;  2A1R A;  1GOB A;  3OYI A;  3MXM A;  4F4K A;  1VSK A;  3P4I A;  1H1V A;  4KHS A;  5AQP A;  1VQM N;  3DWL A;  3VF6 A;  1WBB A;  3HPH A;  3LWM A;  3R3L A;  1TK5 A;  5FPD A;  4JI5 K;  4FXD A;  1OH5 A;  1WSH A;  2HOE A;  2HHH K;  3AO3 A;  3ZT4 A;  1NGE A;  4BWJ A;  3HPO A;  3HSC A;  4CIE A;  4DMN A;  4GVE A;  1JLF A;  1X9S A;  3WXI A;  4C8O A;  3KK7 A;  3NF8 A;  4I9L A;  4IOX A;  4CEO A;  3VQC A;  4E7H A;  4HCC A;  1BIU A;  1RBV A;  3SV3 A;  3DXK B;  4CEF A;  4LF8 K;  3QB0 A;  4CZH A;  3OYG A;  3BZC A;  2E20 A;  4FJ7 A;  3WEE B;  3WXJ A;  2DFF A;  3WEE A;  4KHN A;  2PYL A;  3VN5 A;  5GIN A;  1CLQ A;  4EZ9 A;  1X9J A;  4M7X A;  4DQS A;  3SPZ A;  2YHX A;  2G8H A;  4CZI A;  4Z0U A;  4RCH A;  4CJS A;  2G8U A;  3VEV A;  4CES A;  3QIN A;  2KTQ A;  3CPW M;  1BI4 A;  2KFN A;  3O1W A;  1K9M O;  1U45 A;  1WN7 A;  4CHZ A;  3HT3 A;  3I0S A;  2XHB A;  4AHR A;  4Q0B A;  1JLG A;  2A41 A;  2D5R A;  2BH1 A;  1TVR A;  3BDP A;  4B1U B;  2Q0U A;  2D0P A;  2P9P A;  2P5O A;  1UAX A;  2E2N A;  2IDO A;  3BUZ B;  3KK1 A;  1VQP N;  4OLB A;  2VQE K;  3EE8 A;  3IKM A;  2Z1G A;  1JXE A;  1YXQ A;  1VQO N;  3CC4 N;  2YI1 A;  3ZSZ A;  4A2B A;  1J6Z A;  3VQ4 A;  3V81 A;  4B3R K;  2EHG A;  3SK3 A;  3CME N;  3KK2 A;  1YI2 N;  2F8S A;  2IVP A;  1IV0 A;  5C0Y A;  2CGJ A;  4DQP A;  5ELZ A;  4JAX A;  2HHV A;  4O5F A;  4AHC A;  4B1W B;  2RHK A;  4DTR A;  1VSF A;  1M1K O;  2ZD1 A;  1GLA G;  4JHD A;  3WNG A;  4JHD B;  3A0I X;  3DYA A;  4PL7 A;  2YKN A;  1TV6 A;  4WE1 A;  4RW8 A;  5AQY A;  4BC5 A;  5HRP A;  3HXM A;  3MN6 A;  3H08 A;  3HZ6 A;  1TYQ A;  3PLA A;  1BL3 A;  3PIP L;  2O8E B;  1RDU A;  3I55 N;  3L2Q A;  1NGC A;  4NO7 A;  2O8F A;  4DV2 K;  3BP8 A;  3LDQ A;  4CEB A;  4CD1 A;  3SQ2 A;  3H1Q A;  4M3U A;  3F2K A;  1T6C A;  2FXU A;  3PX0 A;  1OVY A;  5KGX A;  3AVA A;  3JS6 A;  1WAJ A;  3CCU N;  3I33 A;  3G4S N;  4KHP K;  4KHU A;  4DSI A;  1NGJ A;  2XRI A;  2PAV A;  4A59 A;  1SL0 A;  3AA4 A;  2O4G A;  5C15 A;  4DV5 K;  3SUP A;  3TI0 A;  4BE0 A;  1NWK A;  3NH0 A;  2FBT A;  1J54 A;  3FE1 A;  3J81 O;  4J8F A;  5TKY A;  2ZJR L;  1J5E K;  2FBV A;  4DR5 K;  1HNX K;  3QFP A;  3AVJ A;  2QWM A;  2W41 A;  4DR6 K;  4RWT A;  4AM7 A;  4JI1 K;  2FF3 B;  1N36 K;  4FJN A;  3DLH A;  4O0J A;  3VQ5 A;  5HRN A;  2DPN A;  3NDK A;  1C0U A;  1VSI A;  3WQT A;  2VWB A;  3AGK A;  3ENH A;  3ZT0 A;  4DTN A;  1I3A A;  2GEM A;  1EX4 A;  1Z05 A;  1XC3 A;  4FWQ A;  1BCO A;  3U6F A;  2ZGY A;  5SZT A;  4BDP A;  2NZT A;  5KPT A;  2GWJ A;  3FZK A;  4KHQ A;  2RF2 A;  3CFR A;  1SL2 A;  5I3U A;  4B3M K;  3THY A;  1QHT A;  2YJF A;  2PBD A;  4OLA A;  1JCF A;  4CF0 A;  2CGK A;  4F9O A;  3R1X A;  5AQO A;  3CYM A;  5M1Q A;  3LPU A;  3E9O A;  4PKI A;  4FJ5 A;  4DR2 K;  1BU6 O;  3U3Y A;  2Q0R A;  3VGL A;  1IH7 A;  1HPM A;  1DT9 A;  4BRL A;  3ID8 A;  4IDH A;  1WSG A;  3E1Y A;  3O4Q A;  5GAG P;  4ZTF A;  1N33 K;  3L2R A;  2OPP A;  4F2S A;  3ENO A;  4MLE A;  2D1K A;  2PFU A;  3AVI A;  3EN9 A;  5AFU H;  3HP6 A;  2YHW A;  3ZSX A;  3GL1 A;  1NJW A;  3CC7 N;  3OW2 M;  3RR7 A;  2E88 A;  1NM1 A;  2P9I A;  2CGL A;  3OHR A;  4KRE A;  1VQ9 N;  2P9L A;  3MN9 A;  3O8M A;  4H4O A;  2P9N A;  3A5O C;  1TYQ B;  4DSJ A;  1WSF A;  3VOV A;  1IO2 A;  1HKB A;  2ZWH A;  1E4G T;  2E4L A;  5HRS A;  3K5L A;  3L0Q A;  1LAV A;  3BGR A;  3TR8 A;  2R7Y A;  2F9W A;  4JLH A;  1EWQ A;  1HYS A;  4X64 K;  3K5N A;  5KGW A;  4M3W A;  5KTQ A;  4EHU A;  4DR3 K;  3SQ1 A;  2HW3 A;  3IRX A;  1N6Q A;  4QCL A;  1WUA A;  3HM8 A;  4JI2 K;  4A61 A;  3OBY A;  3THY B;  1NK7 A;  1RT2 A;  1NBW A;  2A1S A;  2UUA K;  2UYT A;  2QTD A;  4DV7 K;  4B8A B;  4ID5 A;  3WUH A;  3F5T A;  1LW2 A;  4CF9 A;  1BIS A;  5HL7 L;  3SUQ A;  3Q7B A;  4BC4 A;  3UIQ A;  5AR0 A;  2HHT A;  5AQK A;  3KD5 E;  1RT5 A;  5C2D A;  4JI3 K;  4PWD A;  1Y97 A;  2OPS A;  2X74 A;  1W9H A;  1SZ2 A;  3LL3 A;  3NAE A;  4B1Z A;  4R5P A;  3H3N O;  2Q36 A;  1GOA A;  1RDB A;  3NMU A;  4W5Q A;  3ISN C;  5C10 A;  1N34 K;  4LF7 K;  4CJ4 A;  2IC3 A;  4FLV A;  1IG9 A;  1DTQ A;  4KFB A;  3CCQ N;  3MN7 A;  4IJN A;  4WF9 L;  1NG9 A;  4M3Z A;  2ATQ A;  2GBZ A;  2VG7 A;  1LWF A;  1RBR A;  1DGK N;  3FZM A;  3TSP A;  5MLC Q;  3O4W A;  3CFP A;  3QEX A;  4FK4 A;  2P9L B;  4NYF A;  1SUQ A;  1TGO A;  4KHW A;  4CJV A;  3P39 A;  3OBW A;  1UWB A;  5CYM A;  2P5G A;  4JKC A;  2B4J A;  4DKW A;  1KC8 O;  1V4S A;  2D0A A;  3RTV A;  3QBW A;  1HUX A;  2QKB A;  3QEP A;  3OYK A;  4FLX A;  4BR7 A;  4JS4 A;  4JKG A;  2O8D B;  1T3V A;  2Q1N A;  4DV1 K;  4NXN K;  1XHZ A;  1GLE G;  1HMV A;  3SUO A;  4OX9 K;  1S5J A;  3KKS A;  3NVK A;  5AQN A;  1ATS A;  2FLO A;  2VGN A;  4Z4G A;  3GBT A;  1VQ5 N;  3CCL N;  1T7P A;  3LPT A;  2E6L A;  3OYA A;  4CJP A;  3VGM A;  3VQE A;  4DQ8 A;  3AY9 A;  4EHT A;  4FSV A;  3TAG A;  4FK0 A;  3T69 A;  3HOS A;  2BDP A;  5BRH A;  4DV4 K;  1FK9 A;  2P9S A;  2QEX N;  1XNQ K;  2HF4 A;  1Z26 A;  1RGI A;  5J2Q A;  1S1W A;  4FCY A;  4H0O A;  4F2R A;  3ZSR A;  3V1Q A;  1FKO A;  3AV9 A;  1D5A A;  2UUC K;  3C95 A;  3BZK A;  4AHV A;  4V19 S;  3T19 A;  3K9J A;  3PY8 A;  4LFA K;  4A2A A;  4W5O A;  1VQ4 N;  1NMD A;  2Q31 A;  4ICL A;  4XH4 A;  5FPE A;  3F9M A;  3EO3 A;  1SL1 A;  4FJX A;  4KHY A;  3CJA A;  5D3G A;  4FZX C;  1VSJ A;  5HBM A;  4LY7 A;  1EET A;  4M63 C;  4O5B A;  1VQL N;  1NK4 A;  4FJ9 A;  3CER A;  4B1V A;  2OPR A;  5A2Q O;  4NLC A;  4IJA A;  1QHA A;  5BPN A;  2HST A;  5AJ3 K;  1Q9X A;  1JLC A;  3THW B;  3TAB A;  2NRV A;  3G0Z A;  1QE1 A;  3A5M C;  2BAN A;  5M1O A;  1OH8 A;  1ESV A;  5M1F A;  1YAG A;  3VEN A;  4E1M A;  3AVM A;  2ASM A;  3HL8 A;  1DTT A;  4X66 K;  4CFA A;  2E8A A;  5HLF A;  1JLB A;  3CIP A;  4CBW A;  2P51 A;  4FJG A;  1MU2 A;  2LSN A;  1CZB A;  4CCH A;  3QEV A;  3NH2 A;  4LF4 K;  2CH5 A;  1QSS A;  4ELT A;  1IBM K;  4CJE A;  1K8K B;  1RT7 A;  3GG4 A;  2OZS A;  4N47 A;  1TL1 A;  1HLU A;  3VEW A;  2QXF A;  4CED A;  3EYZ A;  3M8P A;  3NHG A;  2P9S B;  1ILY A;  4B9N A;  4CGI A;  1W2B M;  4BDY A;  4DFM A;  1QVG M;  3CHW A;  3M6G A;  1B92 A;  3C6T A;  3L3U A;  4LC9 B;  4JKE A;  1C1C A;  1ATR A;  1WSI A;  3MEC A;  2ASP A;  2X6N A;  2D0B A;  3AO2 A;  4B8C A;  3DXM A;  5JMV A;  4I6M B;  4B3O A;  1YTA A;  3N4P A;  1VRU A;  4CF8 A;  4IOC L;  3TPQ A;  3G71 N;  4DTX A;  4JKG B;  1BG3 A;  3B8A X;  5JVH L;  2KQ2 A;  1D9D A;  4CHP A;  1YVU A;  4AIL C;  1VRT A;  4HUE A;  3BF1 A;  4O44 A;  3DLK A;  4FLW A;  3LDP A;  3QIP A;  3CPE A;  4YOX A;  4W5T A;  4N41 A;  1RBU A;  3IMX A;  4O0I A;  3C65 A;  1BO5 O;  1HJR A;  2YX6 A;  4KI6 A;  3BF3 A;  1VQ7 N;  2YHB A;  3QNO A;  2E2Q A;  3MX5 A;  1NJX A;  3HPG A;  3WXL A;  3VEO A;  1X9W A;  1U2V A;  1KTQ A;  3VGK A;  4ISG A;  3K9K A;  2QWQ A;  5CHI A;  5H1S Q;  2WC9 A;  4DUZ K;  4K8Z A;  2HHW A;  4O4G A;  4DV0 K;  3IG1 A;  3WNH A;  2PYJ A;  2YCH A;  3V1R A;  1UOC A;  1C1B A;  5GAH P;  3NGZ A;  1I94 K;  1XHX A;  3NE6 A;  1ZBH A;  4BR5 A;  2YNI A;  3O9S A;  4FLZ A;  1JJ2 M;  1L3U A;  2OZM A;  3VEZ A;  3ZET B;  1D8Y A;  1ZBS A;  2F7T A;  3A5N C;  4CJF A; 
#chains in the Genus database with same CATH homology
 1EP4 A;  3HXM A;  4OPJ A;  3H08 A;  3HP9 A;  3ALY A;  4CFD A;  2NUB A;  4Z4H A;  4FM0 A;  4DTO A;  1KFS A;  4DSK A;  4EZ6 A;  3E01 A;  1BL3 A;  4IBN A;  3VQ8 A;  1RDC A;  3K59 A;  4NYN A;  4DQR A;  4DU3 A;  1RTI A;  4ELU A;  4W5R A;  1KVC A;  4H4M A;  4Z4C A;  3L2Q A;  2VG5 A;  1CZ9 A;  3ZSQ A;  2YNG A;  4CEB A;  1U4B A;  1WSJ A;  1B9D A;  4M41 A;  4GVM A;  1RIL A;  3AVK A;  3SQ2 A;  4M3U A;  3PX0 A;  2JGU A;  4RW7 A;  3LAM A;  1S1V A;  5KGX A;  3AVA A;  3AVN A;  3K5M A;  3V4I A;  1QSY A;  4K8X A;  1WAJ A;  2GUI A;  3AA5 X;  3RMB A;  4KHU A;  3SJJ A;  3DI6 A;  3TAR A;  1NJY A;  4DSI A;  3AO4 A;  4BWM A;  1GOC A;  1YTU A;  2XRI A;  3DRP A;  1G15 A;  4DS5 A;  3LZJ A;  1Q8I A;  1SL0 A;  1J53 A;  2PY5 A;  4DWI A;  2OA8 A;  4FZZ A;  3AA4 A;  2O4G A;  3SUP A;  3TI0 A;  1QS4 A;  4BE0 A;  1J9A A;  5DMR A;  1XC9 A;  4W5N A;  3ZT3 A;  2XY8 A;  3NBP A;  1LW0 A;  2FBT A;  1J54 A;  2F96 A;  2KW4 A;  3NF6 A;  3NH0 A;  1N5Y A;  2FBV A;  1HNI A;  4M3R A;  3V9X A;  1S6Q A;  2X6S A;  1EXQ A;  3QET A;  3V9S A;  3ZSW A;  1KRP A;  3I0R A;  4F3O A;  3ZSY A;  3AVJ A;  1RTD A;  1LWE A;  3KKR A;  4E7J A;  1WAF A;  4NCA A;  3SV4 A;  3M8R A;  4GMJ B;  4FJN A;  3TAM A;  4M45 A;  1RT4 A;  3DLH A;  4O0J A;  3VQ5 A;  3KTQ A;  4C8M A;  1UA0 A;  3L3V A;  5HRN A;  1U47 A;  2PZS A;  2AJQ A;  3NDK A;  1C0U A;  1VSI A;  3MEE A;  3B6P A;  3RMD A;  2Z1I A;  3ZT0 A;  3KLE A;  4ELV A;  4DTN A;  1I3A A;  3AO1 A;  2Y1I A;  1EX4 A;  3PO5 A;  5FRO A;  1BCO A;  3U6F A;  1TKZ A;  1BI4 B;  2HNZ A;  4PY5 A;  2IS3 A;  4E19 A;  5SZT A;  4BDP A;  3O3G A;  1W0H A;  4KTW A;  4HTU A;  1S9E A;  4C8L A;  5KRT A;  4KHQ A;  1TK0 A;  2ITG A;  2RF2 A;  3CFR A;  4E89 A;  2DFE A;  5I3U A;  1SL2 A;  2KZM A;  4RG8 A;  1QHT A;  4M3Y A;  2P1J A;  4BDZ A;  3OYC A;  3OS1 A;  4OLA A;  3L2V A;  2Y1J A;  4CF0 A;  4L8R B;  1C6V A;  4CIF A;  5C42 A;  2IAJ A;  4OGC A;  4IFV A;  3CYM A;  3EZ5 A;  4HUG A;  4AH9 A;  5HP1 A;  3TAE A;  3LPU A;  1IKV A;  4LH5 A;  2QK9 A;  4NCG A;  4FJ5 A;  1ZYQ A;  3HVT A;  3U3Y A;  4FYD A;  1IH7 A;  4RW6 A;  4BE1 A;  1Q9Y A;  1T05 A;  1RCH A;  3VQQ A;  1I39 A;  3RMC A;  1C0T A;  4CK3 A;  3OYM A;  1F21 A;  3RRH A;  1L3S A;  1WSG A;  5E41 A;  4E7I A;  3O4Q A;  2HHU A;  4F3T A;  2RN2 A;  2ZE2 A;  1S1X A;  3DLG A;  1C0M A;  3VQP A;  2DFH A;  4DTM A;  4ZTF A;  3L2R A;  3I8D A;  1ASU A;  3L2U A;  3SI6 A;  2OPP A;  1QQC A;  4F2S A;  1VSE A;  3ZSV A;  4JS5 A;  3AVI A;  1JLQ A;  3DRR A;  3OS0 A;  5KI6 A;  4CER A;  3NGY A;  3C94 A;  4FLY A;  1ASW A;  4PA1 A;  3HP6 A;  3L8B A;  3VA0 A;  1WSE A;  4KAZ A;  2YNF A;  3CM5 A;  3ZSX A;  1NJW A;  4FJI A;  1HYV A;  4RW4 A;  3U3G A;  5DK5 A;  4DF4 A;  3DLB A;  4FZY A;  1D9D A;  3HK2 A;  3RRG A;  4IDK A;  3LWL A;  3RR7 A;  3HVR A;  4KRE A;  4FK2 A;  1VSD A;  4CE9 A;  3HYF A;  3MEG A;  4CF2 A;  3THV A;  3OYD A;  4H4O A;  4Y1C A;  3ZT2 A;  2QKK A;  1S9G A;  4B9L A;  4DSJ A;  3VQD A;  1WSF A;  4DTS A;  3VA3 A;  3QER A;  1IO2 A;  2E4L A;  4CGH A;  1NK6 A;  4LSL A;  4AHT A;  3LP3 A;  5HRS A;  1ITG A;  3P83 D;  3K5L A;  3OYJ A;  2FC0 A;  1RT6 A;  1FKP A;  4FW1 A;  4MQ3 A;  4CHO A;  4FJM A;  2FBX A;  1LAV A;  1VSH A;  3BGR A;  3K2P A;  3TR8 A;  2R7Y A;  5C25 A;  4Z4F A;  2G8V A;  4OGE A;  4JRP A;  4JLH A;  4DF8 A;  3LAK A;  3QIO A;  3KIO A;  3WNF A;  2G8F A;  1TKD A;  1HYS A;  5JS2 A;  5KGW A;  3K5N A;  3AVH A;  4M3W A;  3IAY A;  5KTQ A;  3SQ1 A;  5K14 A;  2HW3 A;  1T03 A;  3CG7 A;  3IRX A;  2Z1J A;  3SQ0 A;  1N6Q A;  4HCB A;  4QCL A;  4HHT A;  1TK8 A;  3DLE A;  5C24 A;  4EP4 A;  3D0P A;  4CEE A;  1NK7 A;  3KD1 E;  1UA1 A;  3KLH A;  1RT2 A;  3MAQ A;  2A1S A;  3DRS A;  3NF7 A;  4CIG A;  3VQ6 A;  2G8I A;  4CGG A;  3TWH A;  4DTP A;  4B8A B;  4ID5 A;  3V9Z A;  4CJL A;  3OJU A;  4I2Q A;  4B9U A;  3KLF A;  1U04 A;  1LW2 A;  4I9Q A;  4CF9 A;  1BIS A;  3SUQ A;  3NCI A;  3UIQ A;  1KFD A;  5KRS A;  2HHT A;  3OYN A;  4B08 A;  1U48 A;  3KD5 E;  4OPK A;  5EU7 A;  1RT5 A;  3G10 A;  1RDA A;  3RWU A;  4PWD A;  1Y97 A;  2OPS A;  2X74 A;  1W9H A;  4DFJ A;  4E1N A;  2HVI A;  4OKJ A;  4J2D A;  2JLE A;  3OJS A;  3NAE A;  4CHY A;  2HB5 A;  2XY5 A;  1BHL A;  2E6M A;  1RTJ A;  2YV0 X;  2W42 A;  4R5P A;  1LV5 A;  3DM2 A;  4IG3 A;  5T7B A;  1GOA A;  1RDB A;  1REV A;  3AVG A;  3ISN C;  4W5Q A;  4FW2 A;  5FDL A;  4ZTJ A;  4PUO A;  4XIU A;  4CFB A;  3VQ9 A;  4CJ4 A;  1A5V A;  2IC3 A;  4FLV A;  1IG9 A;  1NOY A;  1DTQ A;  4KFB A;  4CJ5 A;  3TAN A;  1IKW A;  4O55 A;  4N76 A;  3S3M A;  1SKR A;  1U49 A;  4DLG A;  2HND A;  3K58 A;  4BE2 A;  2Z1H A;  2IOC A;  3VQA A;  2O4I A;  1HPZ A;  4M3Z A;  1TKX A;  2ATQ A;  3V9U A;  2YHA A;  1SKS A;  2YNH A;  2GBZ A;  2VG7 A;  4CGF A;  4C8K A;  4DTJ A;  1LWF A;  4N56 A;  4CEC A;  1RBR A;  4FJK A;  5J2N A;  5J1E A;  3QES A;  3QEX A;  4DU1 A;  3LP0 A;  3FFI A;  3CFP A;  4N41 A;  4FK4 A;  2F8T A;  3ULD A;  4OKE A;  1NK0 A;  3AVC A;  4NYF A;  1B9F A;  1SUQ A;  1IKY A;  1TGO A;  3MED A;  1JXB A;  4KHW A;  4M3T A;  1S6P A;  4RW9 A;  4CJV A;  4Q5V A;  1LAW A;  1UWB A;  5FRN A;  4E7K A;  3ZCM A;  4KB1 A;  5CYM A;  1RDD A;  5J2P A;  2HMI A;  1BCM A;  3PUF A;  5CZ1 A;  1KSP A;  2P5G A;  2B4J A;  4J2B A;  1WLJ A;  1KVA A;  2D0A A;  4HUF A;  3RTV A;  4M42 A;  4JRQ A;  3F9K A;  1JLA A;  2QKB A;  3QEP A;  3OYK A;  4FLX A;  4CHQ A;  4CF1 A;  4NCB A;  2BE2 A;  4JS4 A;  3KLI A;  3LP2 A;  3QO9 A;  4G1Q A;  4FJ8 A;  5I42 A;  1TL3 A;  1WNS A;  3S3N A;  4C8N A;  2B5J A;  1XHZ A;  2X78 A;  4MFB A;  1HMV A;  3SUO A;  3CM6 A;  1S5J A;  3KKS A;  4HVJ A;  3SCX A;  1NKB A;  2HHX A;  2HNY A;  1QSL A;  4Z4G A;  3VQB A;  1VSL A;  4YFU A;  3OS2 A;  1VSM A;  3A2F A;  4FVM A;  4AHS A;  1ZBI A;  3PV8 A;  4N5S A;  3F73 A;  1T7P A;  3RMA A;  3LPT A;  4FM1 A;  2E6L A;  2KFZ A;  3OYA A;  3LP1 A;  4FLU A;  4DQI A;  3OY9 A;  4CJP A;  5J2M A;  3QEW A;  4CEZ A;  3VQE A;  1BQM A;  4OJR A;  1HQE A;  4E7L A;  1NOZ A;  4DFP A;  3TAG A;  3DOK A;  2RPI A;  3VQ7 A;  1SKW A;  4FK0 A;  4DSE A;  3LAN A;  4I7F A;  3S9H A;  3MXI A;  2BDP A;  1FK9 A;  1NJZ A;  2IGI A;  1Z26 A;  5J2Q A;  1LWC A;  1S1W A;  1Z25 A;  4LH4 A;  4B9M A;  2WOM A;  4FCY A;  1HQU A;  3LAL A;  3V9W A;  4DFK A;  4F2R A;  1YT3 A;  3ZSR A;  3EY1 A;  1RT3 A;  3V1Q A;  1FKO A;  1FXX A;  3AV9 A;  1D5A A;  2XO7 A;  2YKM A;  3AO5 A;  3C95 A;  4AHV A;  4B9V A;  4CJW A;  2FBY A;  1BGX T;  3T19 A;  4UQG A;  3PY8 A;  4OVL A;  4FLT A;  1A5X A;  1SV5 A;  3B6O A;  1JLE A;  3D45 A;  3O3F A;  1L5U A;  4B9T A;  1D9F A;  4W5O A;  4KTQ A;  5CY4 A;  3NF9 A;  3QNN A;  3M8S A;  3AA3 A;  1R0A A;  4KPY A;  3AA2 A;  4KKO A;  4ICL A;  4KV8 A;  4I2P A;  3KJV A;  4FJJ A;  3DMJ A;  4IG0 A;  3S3O A;  4BAC A;  1SL1 A;  4CK2 A;  4M3X A;  1BIZ A;  4FJX A;  5JS1 A;  3NH1 A;  4KHY A;  5D3G A;  4FZX C;  3K5O A;  1TKT A;  1VSJ A;  1ZBF A;  3QLH A;  1EET A;  4LY7 A;  5HBM A;  4O5B A;  1L3T A;  1XI1 A;  1KLN A;  1S1U A;  4TSX A;  1NK4 A;  4DSL A;  4J2A A;  3V6D A;  4FJ9 A;  2OPR A;  4PQU A;  3SPY A;  3NFA A;  3T3F A;  4CJQ A;  3O3H A;  3TAP A;  1Q9X A;  1JLC A;  4DSF A;  3RR8 A;  3TAB A;  3AVF A;  4CGJ A;  1X9M A;  4AHU A;  3G0Z A;  1DLO A;  1QE1 A;  3SYZ A;  1J5O A;  3LDS A;  1ASV A;  2BAN A;  4DLE A;  3OYE A;  4LD0 A;  1CXQ A;  4Z4I A;  3C6U A;  3CQ8 A;  2A1R A;  1GOB A;  4E1M A;  3AVM A;  2BGG A;  3OYI A;  3MXM A;  2HHS A;  3NGI A;  3HL8 A;  1ZBL A;  4F4K A;  1VSK A;  1DTT A;  3MXJ A;  3JYT A;  4CFA A;  4KHS A;  5HLF A;  2B6A A;  1JLB A;  2P51 A;  2GV9 A;  3HPH A;  3LWM A;  2XY6 A;  3OYF A;  1T8E A;  4FJG A;  1MU2 A;  4GW6 A;  4CHN A;  5CYQ A;  2D0C A;  4E3S A;  1TK5 A;  2LSN A;  1CZB A;  4FXD A;  1WSH A;  1KVB A;  1HRH A;  3ZSO A;  3NH2 A;  1JL1 A;  3QEV A;  1KLM A;  2XY7 A;  4CCH A;  2HVH A;  3AO3 A;  1QSS A;  4ELT A;  1C1A A;  2OPQ A;  3ZT4 A;  4J2E A;  3K57 A;  4CJE A;  1K6Y A;  4BWJ A;  4CGD A;  3HPO A;  4CIE A;  4DMN A;  1JLF A;  3OYH A;  3TAQ A;  1X9S A;  1TAU A;  1RT7 A;  4C8O A;  4FJL A;  2KZZ A;  2ZQB A;  2OZS A;  4N47 A;  4CEA A;  1TL1 A;  1TAQ A;  3NF8 A;  4I9L A;  1NK8 A;  4QOZ B;  3ASM A;  1HYZ A;  3VQC A;  2QXF A;  4CEO A;  3KK3 A;  4E7H A;  4DU4 A;  3IS9 A;  2I5J A;  3HST B;  4CED A;  4HCC A;  3EYZ A;  2G8W A;  1IKX A;  1BIU A;  3CFO A;  3M8P A;  4Z4E A;  2VG6 A;  3NHG A;  1RBV A;  3SV3 A;  4ID1 A;  4CEF A;  3SUN A;  4B9N A;  3HO1 A;  4CGI A;  4BDY A;  4DFM A;  3WNE A;  3M8Q A;  3AVB A;  3OYG A;  4CJR A;  4FJ7 A;  1B92 A;  3C6T A;  4KRF A;  1XWL A;  3L3U A;  3L2W A;  4KI4 A;  4CJT A;  2HHQ A;  1C1C A;  2DFF A;  4KHN A;  1WSI A;  3MEC A;  2X6N A;  3OVN A;  2PYL A;  1L3V A;  2D0B A;  4IKF A;  3VN5 A;  3ITH A;  5SWM A;  1EKE A;  1A5W A;  3AO2 A;  5HRP A;  4EZ9 A;  1CLQ A;  1BQN A;  4B8C A;  3HJF A;  4DQS A;  3SPZ A;  1QTM A;  2G8H A;  3V1O A;  3ZT1 A;  4B3O A;  1YTA A;  4Z0U A;  4KB0 A;  4CF8 A;  1VRU A;  4CJS A;  2G8U A;  4DG1 A;  3HM9 A;  3SZ2 A;  2ETJ A;  4DTX A;  4CES A;  3OYB A;  4FM2 A;  3QIN A;  2KTQ A;  1BI4 A;  2KFN A;  1NK5 A;  4ZHR A;  5HRR A;  1U45 A;  1WN7 A;  2KQ2 A;  4DS4 A;  1NKE A;  4CEQ A;  4CHP A;  1YVU A;  4YNQ A;  1VRT A;  4CHZ A;  4HUE A;  4AIL C;  4CJK A;  1S1T A;  4O44 A;  3DOL A;  3HT3 A;  3DLK A;  3I0S A;  2XHB A;  4AHR A;  4FLW A;  4QAG A;  1O1W A;  3QIP A;  1JLG A;  2D5R A;  4W5T A;  3TAF A;  3PX4 A;  1RBU A;  3P5J A;  1KCF A;  4O0I A;  1TVR A;  2EX3 A;  1NKC A;  3BDP A;  5HRO A;  3PO4 A;  1HJR A;  4H8K A;  4KI6 A;  4CK1 A;  3AVL A;  2P5O A;  4KTZ A;  1UAX A;  4DQQ A;  2YHB A;  3QNO A;  2IDO A;  2DTU A;  3KLG A;  4CFC A;  3KK1 A;  4OLB A;  2Q3S A;  4Y1D A;  1NJX A;  3HPG A;  1RT1 A;  4FJH A;  2OYQ A;  4B9S A;  2RKI A;  3PX6 A;  2Z1G A;  5CZ2 A;  1X9W A;  1KTQ A;  4LSN A;  1JXE A;  1RBT A;  3DLR A;  1X1P A;  1VK0 A;  1JKH A;  5FRM A;  4CJU A;  4F8R A;  3ZSZ A;  3LZI A;  4K8Z A;  2HHW A;  4O4G A;  1RTH A;  3IG1 A;  3VQ4 A;  3WNH A;  2PYJ A;  3V81 A;  1JL2 A;  2EHG A;  3V1R A;  1CXU A;  2VWJ A;  4E0D A;  1UOC A;  1C1B A;  3KK2 A;  1NK9 A;  3NGZ A;  2F8S A;  2G8K A;  4KO0 A;  1ZBU A;  4DQP A;  2HHV A;  3OYL A;  3JSM A;  2WON A;  1XHX A;  4AHC A;  4Q0B A;  3NE6 A;  4DTR A;  1ZBH A;  1VSF A;  2YNI A;  3T1A A;  4IFY A;  3SNN A;  4FLZ A;  2ZD1 A;  1L3U A;  1HNV A;  4DTU A;  3O4N A;  1RBS A;  2OZM A;  1RNH A;  3WNG A;  2VWK A;  4CJ3 A;  4OKK A;  1D8Y A;  3DYA A;  3P1G A;  2YKN A;  2DY4 A;  1TV6 A;  4WE1 A;  3QEI A;  3SQ4 A;  4RW8 A;  4CJF A;  4EP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...