5KRSA

Hiv-1 integrase catalytic core domain in complex with an allosteric inhibitor, 3-(1h-pyrrol-1-yl)-2-thiophenecarboxylic acid
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
153
structure length
146
Chain Sequence
DSSPGIWQLDTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAAWWAGIKQEFGIPYNPGVIESMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNKKRKGGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Integrase
publication title A New Class of Allosteric HIV-1 Integrase Inhibitors Identified by Crystallographic Fragment Screening of the Catalytic Core Domain.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Hydrolase, transferase/inhibitor
total genus 49
structure length 146
sequence length 153
ec nomenclature
pdb deposition date 2016-07-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 5krsA00
3DLEA 4DU3A 3VQPA 4FJHA 3HSTB 2ZE2A 3ZSOA 5DK5A 1Z25A 1JLQA 1LWFA 3PO4A 3IG1A 1HYVA 3CM5A 4O44A 3HO1A 1CZ9A 1TK5A 4FLVA 2PYLA 4M3WA 4CJKA 2YNFA 2G8FA 4B8CA 4CEDA 5E41A 2QKBA 3DOLA 3RWUA 1NK5A 4IG0A 3O4NA 3UIQA 3TABA 4PWDA 1UWBA 5EU7A 4HUEA 4KAZA 4CCHA 4E7LA 2XY5A 3ZT2A 3KLEA 1VSHA 4KTQA 4FXDA 4HTUA 3SCXA 3K2PA 3HVRA 1S1XA 3ZT0A 4FJ8A 4W5RA 2BGGA 2DFEA 2XRIA 2VWKA 1HJRA 2W42A 4JRQA 3LZJA 4ELVA 5C25A 3LALA 3QINA 1HNVA 1KVCA 2Z1GA 1RT2A 3ITHA 4CGFA 4YFUA 3HXMA 1JL2A 1EP4A 3LAMA 4NCGA 4W5QA 1Z26A 5T7BA 3LZIA 4ZTFA 2FBXA 4JRPA 1L3TA 1IG9A 1U4BA 1MU2A 4O55A 4EZ6A 3WNFA 2YHAA 4GW6A 1CXUA 3RMAA 4DLGA 4F2SA 3WNHA 3SUPA 1T8EA 3KLIA 4FJ9A 4KHYA 2G8UA 1HYSA 1GOAA 4YNQA 3ZSXA 1NKBA 2D0BA 2GV9A 4K8ZA 5HLFA 3AVGA 1VSKA 4L8RB 4RW9A 2D5RA 1TV6A 1QS4A 5KI6A 4CESA 4FJ5A 4H4OA 4AHVA 4DQIA 4OLBA 4FK4A 5HROA 3LPTA 4BE2A 5FRNA 2O4GA 2BE2A 3HP6A 3WNGA 4CJ3A 1R0AA 1B92A 3TAQA 4KHWA 3ISNC 4FCYA 2VG7A 3EY1A 5KGWA 1FXXA 4IBNA 1NKEA 1Q9YA 4MQ3A 3KKSA 4RG8A 3LWMA 4FM2A 4ZHRA 2E6MA 3ZSYA 4DSFA 3QEIA 2DTUA 4DTMA 5K14A 2F8TA 2XY8A 3DRPA 4FK2A 1XHXA 4JLHA 3JYTA 4NYNA 3V1OA 1LV5A 4IFVA 3HPHA 4CEOA 4F3OA 1RT1A 4FJGA 4TSXA 4MFBA 4F2RA 4Z4CA 3KJVA 1JLAA 3IAYA 4I2QA 3AVMA 2HMIA 4B8AB 1BIUA 1Q8IA 4CERA 4KI6A 2YNGA 2QXFA 3C6TA 4CGJA 4CJ5A 3IS9A 4Y1DA 4BDZA 1RTDA 1YTAA 1B9DA 1YVUA 5I3UA 3K5LA 1FKOA 2GUIA 3SV4A 3B6PA 3KK1A 4E1MA 2YV0X 4F3TA 3VQAA 1TL3A 2IS3A 2XHBA 4FJNA 1ZBIA 1VSLA 2IDOA 3H08A 3PV8A 5KRSA 1KLMA 3ALYA 4CIEA 1U49A 2OZSA 4NYFA 4Z4GA 1LAVA 3OYJA 3QNOA 1LW2A 4KHQA 1SKSA 4NCAA 1NK7A 4PUOA 3P83D 4O0JA 2YNIA 4CGIA 1SUQA 3V9WA 1DLOA 4KPYA 3ZT4A 1EETA 1I39A 3TAGA 1QTMA 4CHOA 1U04A 3D45A 1NJXA 4RW7A 4Q5VA 1NK8A 3RMBA 3CQ8A 4CJVA 1TVRA 4BE1A 4KO0A 3NH1A 3OYDA 4FJ7A 5C42A 2GBZA 2A1SA 3OVNA 3S3NA 4N76A 2IAJA 3LAKA 4JS5A 4CF2A 2DY4A 4WE1A 4DWIA 1SKRA 1GOBA 3DRSA 3SUNA 3K5OA 4CHPA 1IKYA 3AV9A 4J2AA 3AO5A 1XWLA 3OYLA 4DTRA 1SL0A 4BWJA 3DI6A 3OS1A 4GMJB 4I2PA 3M8QA 3MXMA 2YKNA 3RTVA 3VQ8A 1Q9XA 1VSFA 5KTQA 2ZD1A 3CYMA 3LP1A 1ASWA 3NE6A 3PX6A 4FJXA 1S5JA 2P5GA 3O3FA 4FVMA 4CJFA 4G1QA 3V9SA 4Z0UA 2EX3A 4HCCA 3V9ZA 4CK1A 1NJWA 3MAQA 2G8IA 2B4JA 4E7HA 5CYQA 3OJUA 4DSLA 4CE9A 1RT3A 3AVCA 4DFMA 2XY6A 3C6UA 1J53A 4QOZB 3NBPA 3TARA 4DQQA 3NF8A 5J1EA 1L5UA 4FZYA 1JLGA 3V9XA 4C8KA 1JLBA 2RPIA 2P1JA 3AVNA 3OYKA 4CJTA 2Z1HA 3ZSQA 3QIOA 1IH7A 3ZT3A 2Q3SA 1YTUA 2KW4A 5FRMA 3HYFA 4O0IA 1C1BA 4BDPA 4DTXA 3DM2A 3KK2A 3RR8A 3HM9A 3O4QA 3MEGA 4CJ4A 3WNEA 2G8VA 1RT6A 3SUOA 1TL1A 2HHXA 1A5VA 5FDLA 4M41A 3NH2A 4E7IA 3E01A 3PX0A 3ULDA 2WONA 2OYQA 4I9LA 4DS4A 4B9TA 2OPQA 2Y1IA 3AVHA 4DQSA 1KVBA 3SNNA 2PYJA 1JLFA 1X1PA 3L2QA 1UOCA 1FK9A 1S9EA 4QAGA 4EP4A 3C95A 3U3YA 1UA0A 1ZBLA 2X6SA 1NK0A 3NF9A 4F4KA 3SV3A 3OJSA 1IKWA 2OPPA 1WLJA 3AO4A 3AVLA 1A5WA 3NGIA 3SPYA 2HHWA 2JGUA 4Z4FA 4O5BA 1IO2A 1WSJA 3VQ9A 4OGEA 3TAPA 1VRTA 4KHSA 3ZSZA 1C1AA 4EP5A 3TI0A 4KRFA 4IDKA 4OVLA 2IOCA 1D5AA 1KFDA 4CEEA 3LWLA 1S1TA 4B9NA 2QK9A 4K8XA 3QERA 2HNYA 4B08A 2HHSA 3HP9A 1T03A 4FK0A 4UQGA 3RMDA 4PQUA 4BWMA 1VSIA 1S9GA 3LP3A 3AVAA 3NGZA 4DLEA 2NUBA 3LANA 4M3RA 1S1UA 4CGDA 4J2DA 1QQCA 4B3OA 3ZSVA 1CZBA 3K5MA 4DTSA 1L3UA 1SKWA 5JS1A 1EXQA 4OKKA 4CJEA 3I0RA 4CIGA 4LY7A 1A5XA 3AVKA 1X9WA 2DFHA 1BISA 4KTZA 2FBVA 2OPSA 2KFZA 3QEWA 3NHGA 1RDDA 3VA0A 1J5OA 1YT3A 3VQBA 4KHUA 5JS2A 4JS4A 1I3AA 1RDBA 3OY9A 2Y1JA 4M3ZA 2FBYA 4RW6A 1RT7A 4AHTA 3I0SA 1RNHA 3NCIA 4PY5A 2YNHA 4CK2A 4LD0A 3DLKA 1RT4A 3AVIA 5SWMA 1N5YA 4C8OA 4NCBA 1KRPA 1TK0A 1XC9A 4I9QA 3TR8A 1XI1A 3HPOA 2OZMA 3HT3A 4M3TA 1JL1A 1LW0A 4E0DA 3VQ6A 3L2RA 4CGHA 3RRHA 1TGOA 5J2QA 2VWJA 1RTHA 2RKIA 3KKRA 4LSNA 4CJSA 1S6QA 4DQRA 1D9DA 3KD5E 4KHNA 2F8SA 1JXBA 2BANA 2Z1JA 3M8RA 1T7PA 4EZ9A 4FM1A 4FJMA 2E4LA 3DLGA 3FFIA 2RN2A 4CIFA 3OS0A 5J2MA 3NFAA 1W0HA 4OJRA 4BACA 5CZ1A 2IGIA 4H4MA 1L3SA 4CHYA 3OYCA 1NOZA 4LSLA 4BE0A 4KREA 3S3MA 1BQMA 3LP0A 1CLQA 4AHRA 3AA2A 4CF0A 1NK4A 1BI4B 3QIPA 5HRRA 3DMJA 1KFSA 1KTQA 3F73A 1ZYQA 3NGYA 2JLEA 2YHBA 3HL8A 1WSHA 1UAXA 2HNDA 2XO7A 4FJIA 2P5OA 1D9FA 3NH0A 4CHNA 4ID1A 1GOCA 3PX4A 2G8KA 4FLWA 4KB1A 4W5NA 1S6PA 2X74A 1RBRA 3T3FA 4FLTA 4CK3A 1RILA 1J9AA 4CHZA 1NKCA 4IFYA 1HMVA 3V1RA 1J54A 1JLEA 4W5TA 3OYFA 3CFPA 1BQNA 4DF8A 3MXJA 3SQ4A 2G8HA 3A2FA 3C94A 4E19A 4W5OA 2VG6A 1JXEA 3B6OA 2PZSA 1NJZA 2X6NA 4CFBA 1U48A 3QO9A 4Z4HA 2E6LA 3AVFA 2B5JA 4CJPA 1BCOA 1HNIA 1VSMA 1SV5A 1EX4A 1ZBHA 2G8WA 1BL3A 4OPJA 4DSEA 4FJLA 1QE1A 3IRXA 3PUFA 1TKZA 1ASVA 3HPGA 4IG3A 3VN5A 4E7KA 5HP1A 4RW8A 3SQ0A 4ELUA 3CG7A 4CEBA 1O1WA 4F8RA 4IKFA 4Z4IA 4FYDA 5DMRA 4R5PA 3D0PA 3DRRA 3PY8A 1RBUA 4ELTA 2HVIA 1C0UA 3LPUA 1RTJA 3QETA 3QEPA 1JKHA 4KKOA 4OPKA 2HW3A 3L3VA 3VA3A 3L8BA 2F96A 1BIZA 3S9HA 4OKEA 2VG5A 3MXIA 4AH9A 3O3GA 2OA8A 3M8PA 3MEEA 2YKMA 4E1NA 1BCMA 1DTQA 4DSJA 4AHCA 2RF2A 3DLRA 4N56A 3TWHA 3VQQA 4C8MA 4DS5A 4QCLA 3TAEA 4HUGA 4DFPA 4FW1A 3T19A 4CECA 4DFJA 1K6YA 2R7YA 3U3GA 2EHGA 1LWEA 4AHUA 3AA3A 4FZXC 1LWCA 1WAJA 4E3SA 1X9MA 2BDPA 3VQEA 1LAWA 3K59A 4E89A 4J2BA 4FLZA 3SYZA 2Z1IA 2DFFA 1QSSA 1RDCA 3HK2A 4DFKA 4H8KA 3V4IA 4Z4EA 1NK6A 2ZQBA 1L3VA 4CFCA 5CY4A 4M3XA 4CGGA 1RCHA 4XIUA 2PY5A 1RDAA 4M3YA 1KVAA 3OYEA 3EYZA 1TKDA 3I8DA 4DMNA 4M45A 1U45A 1HQEA 3EZ5A 4Y1CA 3BGRA 3SJJA 3ZT1A 4DTOA 4M3UA 2D0AA 2KZMA 4Q0BA 5SZTA 2IC3A 1Y97A 3KIOA 3SPZA 1REVA 3AVJA 3AO1A 4DTNA 1QSLA 3OYIA 4HUFA 1C0TA 5CZ2A 1IKXA 3OYAA 1CXQA 3KK3A 2O4IA 4J2EA 1G15A 4KTWA 5I42A 4CJWA 4LH4A 3AA5X 3JSMA 1TKTA 1B9FA 2ATQA 4KB0A 3K57A 1KLNA 1VSEA 3NF7A 3QLHA 4DSKA 3AO3A 1KSPA 3NDKA 3NF6A 3G10A 4HVJA 1NJYA 2FC0A 3CM6A 4FW2A 1VSDA 1BI4A 3ZCMA 3TANA 4FJJA 2WOMA 4CEAA 4I7FA 3KLHA 1EKEA 4AILC 3S3OA 5FROA 1XHZA 4GVMA 1SL1A 1HPZA 4O4GA 3DLHA 3LP2A 1TAUA 1C1CA 1NOYA 1F21A 4CJUA 4C8NA 3L3UA 1QHTA 2HHVA 3KTQA 3M8SA 2ETJA 2LSNA 3L2VA 4E7JA 5J2NA 3KLFA 3F9KA 3VQCA 3QEXA 2D0CA 4B9SA 2KFNA 1BHLA 1C0MA 1TAQA 1ZBFA 4CJQA 4CF1A 4N5SA 3V9UA 1DTTA 1U47A 4B9MA 4B9LA 3DOKA 3TAMA 3RR7A 2FBTA 4N47A 5C24A 1C6VA 4OKJA 4CEQA 4CHQA 2HHQA 3BDPA 3RRGA 1WN7A 3SQ1A 4B9VA 4C8LA 2AJQA 3ASMA 2HVHA 3QESA 3VQ5A 4DTJA 3AO2A 1WSFA 4OLAA 4PA1A 5CYMA 3VQDA 4FJKA 3AVBA 3L2WA 4ICLA 4KV8A 1RTIA 4FZZA 4DTUA 3HJFA 4CEZA 1JLCA 4FLXA 4DSIA 1N6QA 3HVTA 3PO5A 1FKPA 1BGXT 1SL2A 1ASUA 1KCFA 3OYHA 3VQ4A 1HQUA 3QEVA 4DF4A 4DQPA 2HHTA 3OYGA 3OYMA 3SZ2A 1ITGA 3SUQA 1TK8A 1T05A 3V1QA 4CF9A 2KZZA 1X9SA 5HRSA 3VQ7A 1VRUA 3SQ2A 1VSJA 3OS2A 5KRTA 1NK9A 3L2UA 3DYAA 2KTQA 1IKVA 2B6AA 4HCBA 1RBTA 1RBSA 4CFAA 3U6FA 3V6DA 4LH5A 4B9UA 4AHSA 3P1GA 1TKXA 2A1RA 1HRHA 4CJRA 2OPRA 1WSGA 2X78A 4KFBA 3OYBA 4DU1A 4FLYA 3KLGA 5HRPA 3NAEA 3MECA 4OGCA 3T1AA 3TAFA 1D8YA 1RT5A 3RMCA 4CFDA 3O3HA 3G0ZA 3SI6A 4N41A 3CFOA 1WNSA 3K58A 3DLBA 2XY7A 2HNZA 2HHUA 1HYZA 1WSEA 4RW4A 4CJLA 5KGXA 3P5JA 3QNNA 1S1VA 1S1WA 2I5JA 5J2PA 4DU4A 3THVA 4DTPA 4DG1A 4ZTJA 1RBVA 5HRNA 4FM0A 2HB5A 3K5NA 4CF8A 3ZSWA 2P51A 3ZSRA 4CEFA 3OYNA 1UA1A 3LDSA 4KI4A 4BDYA 3KD1E 2ITGA 1VK0A 4ID5A 3AA4A 5HBMA 1ZBUA 3V81A 1W9HA 4FLUA 2KQ2A 3MEDA 4HHTA 1WAFA 3CFRA 2QKKA 1WSIA 5D3GA 1QSYA 4M42A
chains in the Genus database with same CATH superfamily
4BRGA 4DU3A 5JMVA 2ZM6K 1VQ7N 3VERA 5DK5A 1JLQA 1LWFA 3CJBA 3PO4A 1HYVA 4O44A 1TK5A 4GVEA 5FPEA 1NK5A 4MO5A 2E20A 1UWBA 2JWKA 4HUEA 4DCHA 3T7ZA 3KLEA 2V7ZA 4KTQA 3MDQA 2P9IB 4HTUA 5EY4A 5AQZA 3HOTA 1J6ZA 1HJRA 2W42A 4ELVA 4YFUA 2VQFK 1L3TA 4GV3A 4JNEA 4IEIA 1U4BA 4O55A 3WNHA 1T8EA 5AQUA 2D0OA 1HYSA 1N34K 1GOAA 1NKBA 2GV9A 4K8ZA 4BGAA 5HLFA 1SZ2A 4FJ5A 2BUPA 3LPTA 1S22A 3HP6A 4CJ3A 1R0AA 3TAQA 3LDLA 1JCFA 2VG7A 3EY1A 1OH5A 5KGWA 3KKSA 3D2EA 4JKCA 3MMVA 3QEIA 4OO1J 4Y0WA 4NYNA 5TKYA 1LV5A 3QDKA 1RT1A 2BH1A 4F2RA 4Z4CA 4GKKK 1JLAA 4YOVA 3IAYA 1Q8IA 3WXJA 3C6TA 4CJ5A 3TTFA 5AQWA 1KD1O 4IFEA 4BDZA 2QM1A 1YVUA 4FL9A 5I3UA 1OH8A 3K5LA 3SV4A 3KK1A 4E1MA 3CCQN 1ZBIA 2NLXA 2VGNA 2UU9K 3ALYA 2O8CB 4ISFA 2NRWA 2P9KA 2UXDK 1DEJA 4KHQA 1SKSA 2WFBA 3P83D 3QBWA 1SUQA 1I39A 3TAGA 4CHOA 1U04A 4RW7A 4WQ4A 4Q5VA 5JVGL 3NVMA 3CQ8A 2HBKA 4FJ7A 3ID8A 2A1SA 1IG8A 4JS5A 3HSCA 4CF2A 4E1JA 1GOBA 3DRSA 3K5OA 4J2AA 2A42A 1XWLA 4DR6K 4AQYK 5BR8K 4B1YB 5EOYA 2UUCK 3M8QA 2YKNA 5C2DA 3WEEA 2ZD1A 2P5GA 4CJFA 1E4FT 3V9SA 2F7TA 1TYQB 3V9ZA 3MAQA 2CH5A 5LMNK 2B4JA 5CYQA 1VQ6N 1BO5O 3MX2A 1LOTB 4DQQA 4BC3A 1QVGM 3HOSA 2RPIA 2Q1NA 2ASMA 2P1JA 4DV2K 2Z1HA 3QIOA 1IH7A 2Q3SA 3U4LA 1C1BA 1DGKN 1BA0A 1TUYA 4CJ4A 2G8VA 1A5VA 5FDLA 2GEMA 3A5OC 2Y1IA 3AVHA 3P31A 1S9EA 3C95A 1NK0A 2X6SA 2NRTA 3NF9A 5LMUK 4BRPA 2QEXN 2AP1A 2GWKA 3VQ9A 4OGEA 1VRTA 1C1AA 4OVLA 2IOCA 3LWLA 5H1SQ 3QERA 4IO9L 1Q82O 3IMXA 4BWMA 3AVAA 3C65A 3M6GA 3OBYA 1CZBA 4DTSA 1L3UA 2ZJRL 3L4IA 1SKWA 4OKKA 4U67L 4CIGA 5F1XA 1X9WA 3CQYA 3ULEA 3G4SN 1YT3A 4JKHA 5LJVA 4IXCA 4JS4A 5BPLA 3OY9A 2Y1JA 3L6QA 4AHTA 2ZJQL 1RNHA 4PY5A 4CZHA 1RT4A 1WBBA 5SWMA 3CXCM 4C8OA 1XC9A 3A5MC 3TR8A 1XI1A 3HZ6A 3HPOA 3HT3A 2AA4A 3L2RA 3RSEA 2RKIA 1D9DA 1S6QA 3VF2A 1JXBA 4EFHA 3T1YK 1T7PA 3M8RA 4FJMA 3DLGA 2RN2A 3AGKA 2IVPA 1W0HA 4OJRA 3VEWA 3O9QA 4LSLA 3S3MA 4CF0A 1BI4B 2HOEA 1KTQA 2UUBK 3NGYA 2JLEA 3A8YA 4BR9A 2XO7A 1WSHA 1UAXA 2HNDA 1D9FA 3CPWM 4CHNA 2A3ZA 3PX4A 4KHPK 4KB1A 1S6PA 1RBRA 4FLTA 2YX6A 4CK3A 1RILA 1J9AA 3QFPA 1J54A 3O5BA 4JEPA 2G8HA 1BQNA 3MXJA 3SBTA 4AM6A 3SQ4A 2PZSA 2NRZA 1NJZA 3CMEN 4AF1A 3RSEB 3SAFA 1ZBHA 1EX4A 2G8WA 1E4GT 3IRXA 1ASVA 4WFAL 4CEBA 2Q0RA 4PL8A 5DMRA 3DRRA 1C0UA 3LPUA 3QETA 3J7ZO 1JKHA 2HW3A 1OH7A 4X66K 3L8BA 2HF3A 3FFKB 3A5LC 1OH6A 3J81O 2VG5A 4AH9A 1WOQA 3M8PA 4NLCA 1DTQA 2RF2A 2CGLA 1HUXA 4DS5A 2CH6A 5BR9A 3FR0A 2P9UB 2YI1A 3AA3A 1LWCA 5AQNA 2BDPA 3W3DA 5GAEP 3K59A 1T6DA 4C23A 3SYZA 3HK2A 3V4IA 1YITN 3CCJN 2J4RA 3N4QA 1NGJA 2F9WA 4JI3K 4XH4A 1TKDA 3O1WA 1OVYA 4DTOA 2V51B 2D0AA 4JN4A 4Q0BA 1Y97A 1REVA 3AVJA 3AO1A 4DTNA 3OYAA 1CXQA 4JI0K 1EWQA 5I42A 1K8AO 2VGMA 5FPMA 3AA5X 1NM1A 3K57A 1VSEA 3NF7A 1S3XA 4QS7A 3AO3A 3NDKA 3GL1A 2FC0A 4FW2A 3TANA 1VSDA 4A5AA 4JHDA 3KLHA 1EKEA 3S3OA 1SL1A 4O4GA 2D0PA 4R79A 3EE8A 3MCAB 3ATUA 3L3UA 4RTFD 3F9KA 4IOXA 3VQCA 3QEXA 4B9SA 1BHLA 1C0MA 1TAQA 4EZ9A 4JKGA 4CJQA 4N5SA 1W2BM 1DTTA 4DHYA 4CZLA 4GKJK 1KAZA 1C6VA 4LF4K 4JI5K 2AJQA 4B9VA 5AQVA 4L3QA 3QESA 4OLAA 4CBXA 1X3NA 4H5VA 4ICLA 4FZZA 3HJFA 4CEZA 4DSIA 3PO5A 1FKPA 1SL2A 3VQ4A 3QEVA 1Q86O 1TK8A 1X9SA 5HRSA 3MN7A 1NK9A 5KRTA 2ZWHA 1IKVA 1RBSA 4BQZA 4B9UA 4ILHA 3P1GA 3EO3A 2PAVA 2A1RA 2P9PA 4CJRA 1WSGA 2X78A 3LDQA 3OYBA 4EHTA 4FO0A 5B8HA 2WTUA 5EX5A 5AQTA 3NAEA 4B1VA 4BRIA 1D8YA 1RT5A 3SI6A 4CFDA 3O3HA 2RHKA 3D2FB 3O8MA 3DLBA 3GBTA 5ELZA 3CPEA 4H03B 4MLEA 3P5JA 1W7AA 5J2PA 4ZTJA 4DTPA 1RBVA 2HB5A 2FXUA 1UA1A 4XH5A 3OYNA 3O9TA 3LDSA 4ID5A 4BC5A 4LF9K 4FLUA 1N8RO 3A0IX 4M42A 3DLEA 4DR5K 2E2OA 4CW7B 4BY9C 2ZE2A 4CZJA 2IIRA 1MWKA 1BA1A 1YXQA 4FLVA 2PYLA 4CJKA 1XUPO 4CEDA 4OX9K 3DOLA 3J7YP 4JI6K 3VESA 4PWDA 4CCHA 4E7LA 3SJHA 4FXDA 3M1FA 1P8ZA 3QMLA 3SCXA 3HVRA 1WBDA 1JCEA 2D4WA 4FJ8A 2BGGA 3R9PA 2VWKA 2HMPA 4JRQA 3LZJA 4JKAA 2O8FB 1HNVA 2Z1GA 1RT2A 3ITHA 1JL2A 5JVHL 4W5QA 1Z26A 3O9SA 1CXUA 4DLGA 3SUPA 5GIPA 4O5FA 3ZSXA 2D0BA 4CZMA 4RW9A 2D5RA 1TV6A 1QS4A 5KI6A 4OLBA 1HNXK 4AHVA 5HROA 4YOUA 5FRNA 3BF3A 1ILYA 2O4GA 3CI5A 4BRMA 5JLHA 4H5TA 3ISNC 2KLAA 1VQ8N 4BG8A 1Q9YA 4IBNA 3ENOA 3KK7A 4MQ3A 3G71N 1NKEA 1NJIO 2E6MA 4DSFA 1QHAA 3DRPA 4FK2A 1XHXA 5AR0A 4CEOA 4CD1A 3ZEUB 2BTFA 1U6ZA 5M1NA 3MX5A 1I94K 2QXFA 2QWOA 4DV1K 3LL3A 4B1ZA 5KPRA 1B9DA 2YV0X 1QVFM 1TL3A 2XHBA 4YHHK 2NRHA 3ZX2A 1NG9A 4DKWA 3EEQA 2QA4N 4Z4GA 3QNOA 1NK7A 1TUUA 4O0JA 3V9WA 1DLOA 2VYPA 1K9MO 2WUSA 4GY2B 1QTMA 3CQXA 2HBJA 1NJXA 4IOAL 4BC4A 3O9RA 3HRGA 4LC9B 4BE1A 3OYDA 5AQMA 5C42A 2GBZA 3S3NA 4N76A 3E9PA 1T6CA 1SKRA 1N36K 2ZJPL 4CHPA 1IKYA 3AV9A 2YCHA 1SL0A 4BWJA 3DI6A 1GLCG 3OS1A 4I2PA 3RTVA 5TKWA 1Q9XA 5AQSA 5AQQA 2ASPA 5KTQA 3CYMA 1NU0A 3D7EO 4GV6A 3O3FA 4G1QA 3JAMO 2EX3A 4HCCA 1NJWA 1GLFO 1HX1A 4DSLA 4CE9A 1H1VA 4K42A 3AVCA 3M3ZA 3TSPA 4QOZB 3WQTA 3NBPA 3FZLA 3J7AP 2ITMA 4BREA 2PFUA 1JLGA 2Q31A 4DR2K 1KAYA 1JLBA 4WF9L 2A40A 4CJTA 3ZSQA 3AY9A 3HYFA 3E9OA 4BDPA 3DM2A 3WNEA 3CIPA 3G6EN 1RT6A 1TL1A 1XNRK 3E01A 5CE3A 3THYB 4DS4A 4A2AA 2QW9A 2HBLA 4CZEA 4J8FA 3L2QA 1X1PA 3SNNA 4EP4A 3DLLL 1NBWA 3DJCA 1GLEG 1IKWA 2OPPA 3AVLA 3OJSA 3SPYA 4O5BA 3VGKA 3TAPA 4KH4A 4WFNL 2QK9A 2E2QA 5AQYA 4WCEL 1ATSA 2HNYA 2O8CA 4BRQA 2HHSA 4X62K 3LM9A 4UQGA 4FWQA 1GLBG 4PQUA 1S9GA 2NUBA 4CGDA 1QQCA 4B3OA 3SBGA 4IEEA 2E8AA 3I0RA 1A5XA 3AVKA 4F9OA 1BISA 4KTZA 4JK9A 5AZIA 3VA0A 5JS2A 4BROA 1RDBA 4H0PA 3U8XA 4M3ZA 4RW6A 2Q97A 2F4VK 3O08A 4CK2A 3AVIA 1N33K 2EWSA 4I9QA 3OHRA 1MDUB 3UE5A 4BRLA 1LW0A 3CJCA 2VWJA 1RTHA 4CJSA 4KHNA 1DT9A 4FM1A 1TYQA 4V19S 2Q2RA 5J2MA 4H4MA 1L3SA 1IBMK 3OW2M 2ZGYA 4KREA 1BQMA 1CLQA 5AZIB 1NK4A 4FSVA 2D1KA 5AQJA 3DMJA 1KFSA 3F73A 1NLVA 4DV4K 2YHBA 4BGBA 4KH5A 5C10A 4FJIA 3H45C 5AQKA 3CCEN 2GWJA 1GOCA 5AQIA 1NKCA 3KHYA 4CHZA 1QZ6A 3V1RA 4W5TA 3C94A 2VG6A 1JXEA 2ZGZA 4A62A 4Z4HA 4CJPA 1HNIA 3AGRA 3PUFA 5HP1A 4E7KA 4Z4IA 4IKFA 4F8RA 1O1WA 4DR1K 3VPZA 3D0PA 4JD2B 1NGEA 3QEPA 4KKOA 4OPKA 3DAWA 1C0GA 4BR7A 5DM6L 2NRVA 3O3GA 3KWIA 1M1KO 3DLRA 4N56A 1FW6A 3VQQA 1VHXA 4QCLA 4DFPA 3PLAA 1Q18A 3GE1A 4CECA 3U3GA 5LY3A 1LWEA 4AHUA 1LAWA 2NNWA 4FLZA 1HR0K 4DFKA 5C15A 3GG4A 4OPAA 4XH1A 3CCRN 5KQ8A 4M3XA 1ESVA 5CY4A 1P90A 2YJFA 1RDAA 4B3SK 3OYEA 2WBNA 1NNEA 3EYZA 1ZC6A 3I8DA 4DMNA 4A59A 1V4TA 1HQEA 5BRHA 1NGCA 5SZTA 1J5EK 3SPZA 1QSLA 3FGUA 3OYIA 4HUFA 1C0TA 4FWNA 5CZ2A 2O4IA 3KK3A 2KKZA 1NGDA 3CERA 5MLCQ 4CJWA 3CCUN 4LH4A 3JSMA 1TKTA 3THWB 3O4WA 5BPMA 3AARA 4PKGA 3O9UA 1NJYA 3SAGA 3ZCMA 1BI4A 3FZHA 3MCPA 2WOMA 3DXKB 1HPZA 1GLAG 3LP2A 1C1CA 2YJEA 4A5BA 4DR7K 4QS9A 1QHTA 2ETJA 3L2VA 4YOYA 4C1NI 4BVOA 2KFNA 4B1WB 5F2RA 4B9MA 1U47A 3C7NB 4H5WA 3DOKA 2FBTA 4N47A 5C24A 4CEQA 4CHQA 4C8LA 5BRDA 4JK8A 3VQ5A 3VQDA 5CYMA 3K9KA 3AVBA 5FPNA 4EHUA 4DTUA 2A41A 2CGKA 5C2FA 1N6QA 1BGXT 3QB0A 5AQRA 1ASUA 1KCFA 3OYHA 2HHTA 1QZ5A 4ILGB 4B9QA 3OYGA 2O8EB 1T05A 4CF9A 3UKUA 3VQ7A 4CD3A 1NMNA 1VSJA 2P9UA 2FF6A 5AQHA 3DYAA 3DXMB 2KTQA 2B6AA 4CBWA 4HCBA 1RBTA 3VTIA 5LJWA 4CFAA 4LH5A 3Q7CA 5AQXA 4AHSA 3TU5A 1X9JA 4BRDA 4DU1A 3H46O 3KLGA 4DR3K 2OTJN 3T1AA 1WNSA 3K58A 1IBLK 3K9JA 5BREA 2HHUA 1WUAA 3CETA 5KGXA 2F9TA 4CZKA 1S1VA 1S1WA 1HJOA 3VEZA 5HRNA 4FM0A 3P38A 4CF8A 3ZSWA 4CEFA 3AAPA 3UKUB 2Q36A 1ZBUA 3V81A 1RDWX 1W9HA 3QICA 3CMAN 4U7BA 2QKKA 3CFRA 3KWGA 3FZMA 1HKCA 1QSYA 5GINA 3CF5L 5HL7L 4FJHA 4H0VB 4YOTA 3ZSOA 1Z25A 3CM5A 3MN9A 5BN9A 1CZ9A 4JI2K 4M3WA 2YNFA 2G8FA 5E41A 3BUZB 3CJ7A 3LDPA 4IG0A 3O4NA 3LDNA 3TABA 2UXCK 4BRFA 5EU7A 2XY5A 3K2PA 1S1XA 4W5RA 3SMPA 2DFEA 3MN5A 1M90O 2XRIA 3CC7N 3ZETB 4CGFA 1EP4A 4ZTFA 3LZIA 1IG9A 4JRPA 4JAXA 1MU2A 5GAGP 4F2SA 2YHAA 4GW6A 2VQEK 3I56N 3HM8A 3KLIA 4FJ9A 4KHYA 3CCLN 4YNQA 3EE9A 3BF1A 3IDHA 5BRFA 3SAHA 4FWKA 3AVGA 4L8RB 3UB5A 4MDBA 4CESA 3H6EA 4B3TK 4BE2A 2OCEA 5AQFA 2P9SB 4Z94A 5AQLA 1SAZA 4EIAA 1HLUA 4RG8A 3LWMA 4ZHRA 3OTOK 1BG3A 2XY8A 1Q7YO 4JLHA 3V1OA 1YJ9N 3R3LA 3VTHA 3D2FA 2HMIA 4B8AB 4IWVA 2YNGA 3VOVA 4M7XA 4LFBK 1NGAA 3IS9A 4Y1DA 1RTDA 4F3TA 3B6PA 1YIJN 4B3RK 2W6KA 2IDOA 3PV8A 1KLMA 3PIOL 1U49A 1NGGA 4NYFA 1LAVA 3OYJA 1LW2A 1S72N 4CGIA 2YNIA 4KPYA 3MWTA 1NMDA 1EETA 2QTDA 3D45A 3RMBA 4CJVA 3F2KA 1YUWA 4KO0A 1HKBA 1EQYA 4RWTA 2NZTA 3EKSA 2DY4A 4DV3K 4DWIA 3SUNA 1EO1A 3OYLA 3SK3A 4DTRA 2E2NA 4UY8O 3CHWA 3MXMA 3JS6A 3VQ8A 3LP1A 3NE6A 3PX6A 1Q81O 4FJXA 4ISGA 3VETA 2O8FA 3C6AA 5AQGA 4Z0UA 5EVZA 3ZX3A 4CK1A 4DUZK 1YVNA 3TTDA 2G8IA 4E7HA 1RGIA 2O8BB 1RT3A 4DFMA 2XY6A 3C6UA 1J53A 3G25A 3TARA 1XNQK 3V9XA 2FF3B 1G99A 3AVNA 1YAGA 1YJNN 3B8AX 4DTXA 3RR8A 3O4QA 3MEGA 2HHXA 4M41A 3NH2A 4E7IA 1K8KB 3CC4N 2VCPA 3PX0A 4FWOA 1WB9A 1XMOK 2VWBA 2OPQA 1CZAN 5M1QA 2PYJA 1JLFA 3U3YA 1UOCA 4QAGA 3ZEUA 2E5LK 4F4KA 4H0TB 2DPNA 4XEIA 1U2VB 1WLJA 1A5WA 2JGUA 2JWLA 4Z4FA 1IO2A 1WSJA 1QQOA 4JKBA 4EP5A 3TI0A 5CHIA 1KFDA 4CEEA 5GAHP 4B9NA 1VQNN 1C0FA 3BEXA 2ZF5O 2KHOA 5BN8A 1BUPA 3RMDA 1VSIA 1KAXA 3LP3A 3NGZA 3LANA 4M3RA 1S1UA 4CZGA 1K73O 3K5MA 3T1HK 4LY7A 1VAZA 1Z6RA 3IFRA 3H3OB 2KFZA 2FBVA 1KXPA 1RDDA 3NHGA 5AZJB 1J5OA 3VQBA 4KHUA 3QFUA 4I6MB 2YNHA 3DLKA 3WXIA 1N5YA 4NCBA 4CJ7A 3OA9A 5M1PA 2IVNA 4JI1K 1E3MA 4E0DA 4ILJA 2HBMA 1KC8O 3RRHA 3KKRA 4LSNA 2I7NA 2BANA 4CIFA 4KH6A 3NFAA 4BR5A 5GADP 4BACA 2IGIA 3OYCA 4EAHD 4BE0A 1X3MA 3LP0A 4AHRA 5E26A 3QIPA 5DM7L 3T69A 1ZYQA 4A2BA 2P5OA 4FLWA 3PSIA 4BQLA 4IFYA 1HMVA 1JLEA 3OYFA 3CFPA 4DF8A 4E19A 3THYA 1QQMA 2X6NA 3D6RA 1BCOA 2ASOA 1BL3A 4OPJA 1TKZA 4IG3A 3HPGA 4A57A 4ELUA 4KAZA 3CG7A 4FYDA 4R5PA 3PY8A 4ELTA 5BPNA 1RTJA 3ENBA 4FPAA 2GELA 3L3VA 3VA3A 3S9HA 4OKEA 4ISEA 2OA8A 1Y64A 3MEEA 2YKMA 4E1NA 4DSJA 1VQMN 3Q7BA 3TWHA 4CI6A 4C8MA 3TAEA 1FJGK 1VQ9N 4FW1A 4IJAA 3KVGA 4B3MK 4DFJA 1T3VA 1K6YA 3UKRB 2EHGA 4FZXC 4JK7A 1WAJA 4BR0A 1X9MA 3VQEA 4J2BA 2DFFA 1RDCA 3E1YA 1NGIA 1IJJA 4Z4EA 1NK6A 2ZQBA 1HNWK 3HTVA 1JJ2M 5I9EB 1RCHA 4XIUA 3THXB 3ATVA 4M3YA 1KVAA 3ZX0A 1OKJA 4M45A 3SJJA 3EZ5A 3BGRA 2A5XA 4YOXA 2V7YA 3QBXA 1G15A 4KTWA 5HOOA 3EN9A 4IJNA 4KB0A 3SMSA 1KLNA 3QLHA 2W41A 3NF6A 3CCVN 5FPDA 4FJJA 4WQ5C 4AILC 4JI7K 1TAUA 2YHWA 1NOYA 4CJUA 1VQLN 3I8BA 4C8NA 4M63C 1HPMA 3KTQA 2LSNA 5J2NA 4E7JA 5JLFA 3SLCA 3A5NC 4B9LA 3TAMA 1MA9B 3AAQA 2HHQA 3BDPA 3RRGA 3SQ1A 2HVHA 4FWSA 4JD2A 4BRAA 3AO2A 2QWNA 4PHTX 4FJKA 3L2WA 4KV8A 1RTIA 4MDAA 3S41A 5ADXA 4FPBA 4LF5K 3RVCA 1HQUA 4DQPA 1ITGA 5M1OA 2Q0UA 2KZZA 2E1ZA 1VRUA 3MWPA 3OS2A 3L2UA 4DUYK 1BWFO 3P4IA 3V6DA 1RFQA 2W40A 1TKXA 1HRHA 3D2EB 3GDQA 5HRPA 3LM2A 1ZBSA 3RMCA 3G0ZA 3CFOA 3VEVA 3ZYYX 4B1UB 1HYZA 4RW4A 4CJLA 1ZXOA 3QNNA 2I5JA 3N4PA 3THVA 1YHQN 3VEXA 5LL6Z 3ZSRA 3FE1A 4BDYA 2W6LA 1VK0A 2P9KB 3CC2N 5HBMA 2HF4A 3THWA 1Z05A 1WAFA 1O13A 1WSIA 3VGLA 2QWLA 5M1KA 1SS6A 3CJ9A 3VQPA 3HSTB 3DXKA 3L4QA 3VEOA 3IG1A 4YDUC 5ADXH 3HO1A 1LCUA 5C12A 4B8CA 5JICA 3H3NO 2QKBA 4PKIA 3RWUA 3UIQA 3ZT2A 1VSHA 3C7NA 5M1FA 3WEEB 3ZT0A 1V4SA 4A61A 3E9LA 5C25A 3LALA 3QINA 1KVCA 3HXMA 4NXNK 4NCGA 3LAMA 3BZCA 5T7BA 2FBXA 4EZ6A 3ID6A 3WNFA 3RMAA 5AQPA 1VQ5N 3R8EA 2G8UA 1R59O 4LF8K 4K0KK 4H0XB 2O8EA 4DV0K 1BDGA 1VSKA 4LF7K 3IUCA 4FK4A 4H4OA 4DQIA 3BY5A 4WFBL 3DXMA 2BE2A 3WNGA 1B92A 4KHWA 4FCYA 3K0SA 4FWRA 1FXXA 4FM2A 3ZSYA 2DTUA 4JI4K 4DTMA 5K14A 2F8TA 2GTDA 3WQUA 4GNIA 3JYTA 4IFVA 3HPHA 4F3OA 4FJGA 4TSXA 1W97L 4MFBA 3KJVA 4I2QA 3AVMA 2UXBK 1BIUA 4CERA 4KI6A 4CGJA 3EZWA 3P39A 4MLHA 4QS8A 3I55N 4LF6K 1YTAA 1NWKA 1ATRA 1FKOA 2GUIA 3VQAA 2IS3A 4FJNA 5C0YA 1VSLA 3H08A 1YI2N 5KRSA 4CIEA 2OZSA 5EXWA 2P9LA 3GOIA 4NCAA 4PUOA 3DWLA 3C6HA 3ZT4A 4BC2A 4G9ZA 3VF6A 3E66A 1NK8A 3ULEB 1TVRA 3NH1A 4HTLA 3OVNA 4YY3K 3NMUA 2IAJA 3LAKA 4BVPA 2OANA 3J80O 4WE1A 2NRXA 3AO5A 3F5TA 2FLOA 3VF4A 4AM7A 1VQPN 4GMJB 1VSFA 4NXMK 1ASWA 4WQ5A 3F9MA 1S5JA 1MWMA 1GLDG 3ZETA 4FVMA 2P9LB 5A2QO 5F0XA 2GX9A 4FWMA 4JKDA 1QQNA 3OJUA 4BG9A 4H0OA 3NF8A 1JCGA 5J1EA 2YHXA 1L5UA 4FZYA 4C8KA 2O8DA 3OYKA 1YTUA 3ZT3A 2I7PA 2KW4A 5FRMA 4O0IA 2P9SA 3KK2A 3HM9A 3SUOA 3ULDA 2WONA 2OYQA 1GLLO 4I9LA 4B9TA 5GIOA 4DQSA 1KVBA 1FK9A 2QWRA 1UA0A 4BRNA 1ZBLA 3BZKA 3TTCA 3SV3A 4DR4K 2HHWA 3NGIA 3AO4A 3CJAA 2H3GX 2PBDA 4KHSA 3ZSZA 4RCHA 4KRFA 4IDKA 1YF5L 1D5AA 1S1TA 5E84A 3O6WA 4K8XA 3FZKA 4BRKA 1XC3A 4B08A 3PIPL 4M7YA 3HP9A 1T03A 4FK0A 3NVKA 2O8DB 3MN6A 4DLEA 4J2DA 4K43A 3ZSVA 1VQKN 5JS1A 1EXQA 4CJEA 1DKGD 3O1BA 2DFHA 2OPSA 3QEWA 1I3AA 2FBYA 1RT7A 5KQDA 3I0SA 3NCIA 4LD0A 1GLJO 3TSUA 2QWQA 1KRPA 1TK0A 1IBKK 1BOTO 3U9ZA 4PKHA 2OZMA 4M3TA 1JL1A 4JYAK 4JI8K 3VQ6A 4CGHA 5J2QA 1TGOA 2QWPA 4BR2A 4LFAK 4W5NA 2F8SA 4DQRA 3KD5E 3O80A 4YDUA 2Z1JA 2E4LA 3FFIA 3JXUA 3OS0A 5CZ1A 3VENA 3WUHA 2O8BA 4CHYA 1NOZA 3AA2A 4JV5K 1ATNA 3W0LA 4JHDB 4CVNE 3R1XA 5HRRA 4O8UA 4DQ8A 4WYBA 2A6AA 3HL8A 4CZFA 4B1XB 3NH0A 4ID1A 2G8KA 2RE2A 4FVUA 5KPTA 5AFUA 2X74A 1YJWN 3T3FA 2OTLN 1RDUA 3OBWA 1K8KA 3A2FA 3J8AA 4W5OA 3B6OA 4CFBA 4JKGB 1U48A 3QO9A 4IDHA 2E6LA 3AVFA 4NLBA 2B5JA 1VSMA 1SV5A 1T44A 4DSEA 4FJLA 4LFCK 1QE1A 3VN5A 3SQ0A 1HNZK 4RW8A 3CCSN 3TSQA 1U2VA 1RBUA 2HVIA 3VGMA 2F96A 1BIZA 3MXIA 4H0YB 2CGJA 3KZBA 1BCMA 2UUAK 4AHCA 2FSJA 3EKUA 4HUGA 3T19A 2YHYA 5AJ3K 2R7YA 4BRCA 4E3SA 4FOEA 4K25A 4O8KA 4E89A 2FSNA 2Z1IA 1QSSA 3ZLJA 4H8KA 3WXMB 1NGBA 2NRRA 5AZJA 2P9PB 1L3VA 4CFCA 4IO8A 4CGGA 2PY5A 2GUPA 4I6MA 4FOIA 3C0BA 5AQOA 4PL7A 1NGFA 3H1VX 2QWMA 1U45A 1XQSC 4WQ4C 1N32K 4Y1CA 3PSFA 3ZT1A 4M3UA 5AFUH 2KZMA 4K41A 4NB4A 3WXLA 2IC3A 3KIOA 1VQ4N 1IKXA 2WC9A 1D4XA 4J2EA 4H5RA 3WT0A 5KPZA 4FWPA 1B9FA 2ATQA 4CBUA 4DV7K 4DSKA 1XMQK 4JKFA 1KSPA 1IV0A 3G10A 4HVJA 3CM6A 4BRHA 4X65K 4CEAA 4I7FA 4DB3A 4KBOA 5FROA 4GVMA 1XHZA 4C1NK 3FZFA 2P9NA 3DLHA 4HWIA 3WXKA 3H1QA 2HHHK 1F21A 3HI0A 2HHVA 4IOCL 3M8SA 3I33A 4FWLA 3KLFA 3M5RA 4CZIA 2D0CA 1ZBFA 3V9UA 4CF1A 3RR7A 4OKJA 3CD6N 4JKEA 1WN7A 3ASMA 4DTJA 1WSFA 4PA1A 3LDOA 2QI2A 1HKGA 3ENHA 1JLCA 2IVOA 4FLXA 3L0QA 3HVTA 2E1YA 4GV9A 4DF4A 3SUQA 3OYMA 4OPHA 3SZ2A 3V1QA 2P9NB 4MO4A 3SQ2A 3R6MA 2UYTA 3UKRA 1EWRA 1BU6O 4X64K 4DV6K 3CJ1A 2E88A 3U6FA 1NGHA 4H5NA 3CCMN 2OPRA 4KFBA 4FLYA 1SQKA 2V52B 3THXA 3MECA 4OGCA 3TPQA 3TAFA 4NO7A 4N41A 5CR4A 2E2PA 1OVQA 2XY7A 2HNZA 4BR4A 3MK6A 1WSEA 5FLXO 1KQSM 1VQON 5IT9O 3U9DA 4DU4A 5IWAK 4DG1A 2P9IA 2FSKA 3K5NA 4DV5K 3VEYA 3FLCO 2P51A 4YORA 4YOWA 4KI4A 3KD1E 2ITGA 3BP8A 3IKMA 4IZ9A 3VMFB 2HSTA 3AA4A 3EL2A 2KQ2A 3MEDA 4HHTA 5D3GA 2QXLA 3HBTA
chains in the Genus database with same CATH topology
3DLEA 4DU3A 3VQPA 4FJHA 3HSTB 2ZE2A 3ZSOA 5DK5A 1Z25A 1JLQA 1LWFA 3PO4A 3IG1A 1HYVA 3CM5A 4O44A 3HO1A 1CZ9A 1TK5A 4FLVA 2PYLA 4M3WA 4CJKA 2YNFA 2G8FA 4B8CA 4CEDA 5E41A 2QKBA 3DOLA 3RWUA 1NK5A 4IG0A 3O4NA 3UIQA 3TABA 4PWDA 1UWBA 5EU7A 4HUEA 4KAZA 4CCHA 4E7LA 2XY5A 3ZT2A 3KLEA 1VSHA 4KTQA 4FXDA 4HTUA 3SCXA 3K2PA 3HVRA 1S1XA 3ZT0A 4FJ8A 4W5RA 2BGGA 2DFEA 2XRIA 2VWKA 1HJRA 2W42A 4JRQA 3LZJA 4ELVA 5C25A 3LALA 3QINA 1HNVA 1KVCA 2Z1GA 1RT2A 3ITHA 4CGFA 4YFUA 3HXMA 1JL2A 1EP4A 3LAMA 4NCGA 4W5QA 1Z26A 5T7BA 3LZIA 4ZTFA 2FBXA 4JRPA 1L3TA 1IG9A 1U4BA 1MU2A 4O55A 4EZ6A 3WNFA 2YHAA 4GW6A 1CXUA 3RMAA 4DLGA 4F2SA 3WNHA 3SUPA 1T8EA 3KLIA 4FJ9A 4KHYA 2G8UA 1HYSA 1GOAA 4YNQA 3ZSXA 1NKBA 2D0BA 2GV9A 4K8ZA 5HLFA 3AVGA 1VSKA 4L8RB 4RW9A 2D5RA 1TV6A 1QS4A 5KI6A 4CESA 4FJ5A 4H4OA 4AHVA 4DQIA 4OLBA 4FK4A 5HROA 3LPTA 4BE2A 5FRNA 2O4GA 2BE2A 3HP6A 3WNGA 4CJ3A 1R0AA 1B92A 3TAQA 4KHWA 3ISNC 4FCYA 2VG7A 3EY1A 5KGWA 1FXXA 4IBNA 1NKEA 1Q9YA 4MQ3A 3KKSA 4RG8A 3LWMA 4FM2A 4ZHRA 2E6MA 3ZSYA 4DSFA 3QEIA 2DTUA 4DTMA 5K14A 2F8TA 2XY8A 3DRPA 4FK2A 1XHXA 4JLHA 3JYTA 4NYNA 3V1OA 1LV5A 4IFVA 3HPHA 4CEOA 4F3OA 1RT1A 4FJGA 4TSXA 4MFBA 4F2RA 4Z4CA 3KJVA 1JLAA 3IAYA 4I2QA 3AVMA 2HMIA 4B8AB 1BIUA 1Q8IA 4CERA 4KI6A 2YNGA 2QXFA 3C6TA 4CGJA 4CJ5A 3IS9A 4Y1DA 4BDZA 1RTDA 1YTAA 1B9DA 1YVUA 5I3UA 3K5LA 1FKOA 2GUIA 3SV4A 3B6PA 3KK1A 4E1MA 2YV0X 4F3TA 3VQAA 1TL3A 2IS3A 2XHBA 4FJNA 1ZBIA 1VSLA 2IDOA 3H08A 3PV8A 5KRSA 1KLMA 3ALYA 4CIEA 1U49A 2OZSA 4NYFA 4Z4GA 1LAVA 3OYJA 3QNOA 1LW2A 4KHQA 1SKSA 4NCAA 1NK7A 4PUOA 3P83D 4O0JA 2YNIA 4CGIA 1SUQA 3V9WA 1DLOA 4KPYA 3ZT4A 1EETA 1I39A 3TAGA 1QTMA 4CHOA 1U04A 3D45A 1NJXA 4RW7A 4Q5VA 1NK8A 3RMBA 3CQ8A 4CJVA 1TVRA 4BE1A 4KO0A 3NH1A 3OYDA 4FJ7A 5C42A 2GBZA 2A1SA 3OVNA 3S3NA 4N76A 2IAJA 3LAKA 4JS5A 4CF2A 2DY4A 4WE1A 4DWIA 1SKRA 1GOBA 3DRSA 3SUNA 3K5OA 4CHPA 1IKYA 3AV9A 4J2AA 3AO5A 1XWLA 3OYLA 4DTRA 1SL0A 4BWJA 3DI6A 3OS1A 4GMJB 4I2PA 3M8QA 3MXMA 2YKNA 3RTVA 3VQ8A 1Q9XA 1VSFA 5KTQA 2ZD1A 3CYMA 3LP1A 1ASWA 3NE6A 3PX6A 4FJXA 1S5JA 2P5GA 3O3FA 4FVMA 4CJFA 4G1QA 3V9SA 4Z0UA 2EX3A 4HCCA 3V9ZA 4CK1A 1NJWA 3MAQA 2G8IA 2B4JA 4E7HA 5CYQA 3OJUA 4DSLA 4CE9A 1RT3A 3AVCA 4DFMA 2XY6A 3C6UA 1J53A 4QOZB 3NBPA 3TARA 4DQQA 3NF8A 5J1EA 1L5UA 4FZYA 1JLGA 3V9XA 4C8KA 1JLBA 2RPIA 2P1JA 3AVNA 3OYKA 4CJTA 2Z1HA 3ZSQA 3QIOA 1IH7A 3ZT3A 2Q3SA 1YTUA 2KW4A 5FRMA 3HYFA 4O0IA 1C1BA 4BDPA 4DTXA 3DM2A 3KK2A 3RR8A 3HM9A 3O4QA 3MEGA 4CJ4A 3WNEA 2G8VA 1RT6A 3SUOA 1TL1A 2HHXA 1A5VA 5FDLA 4M41A 3NH2A 4E7IA 3E01A 3PX0A 3ULDA 2WONA 2OYQA 4I9LA 4DS4A 4B9TA 2OPQA 2Y1IA 3AVHA 4DQSA 1KVBA 3SNNA 2PYJA 1JLFA 1X1PA 3L2QA 1UOCA 1FK9A 1S9EA 4QAGA 4EP4A 3C95A 3U3YA 1UA0A 1ZBLA 2X6SA 1NK0A 3NF9A 4F4KA 3SV3A 3OJSA 1IKWA 2OPPA 1WLJA 3AO4A 3AVLA 1A5WA 3NGIA 3SPYA 2HHWA 2JGUA 4Z4FA 4O5BA 1IO2A 1WSJA 3VQ9A 4OGEA 3TAPA 1VRTA 4KHSA 3ZSZA 1C1AA 4EP5A 3TI0A 4KRFA 4IDKA 4OVLA 2IOCA 1D5AA 1KFDA 4CEEA 3LWLA 1S1TA 4B9NA 2QK9A 4K8XA 3QERA 2HNYA 4B08A 2HHSA 3HP9A 1T03A 4FK0A 4UQGA 3RMDA 4PQUA 4BWMA 1VSIA 1S9GA 3LP3A 3AVAA 3NGZA 4DLEA 2NUBA 3LANA 4M3RA 1S1UA 4CGDA 4J2DA 1QQCA 4B3OA 3ZSVA 1CZBA 3K5MA 4DTSA 1L3UA 1SKWA 5JS1A 1EXQA 4OKKA 4CJEA 3I0RA 4CIGA 4LY7A 1A5XA 3AVKA 1X9WA 2DFHA 1BISA 4KTZA 2FBVA 2OPSA 2KFZA 3QEWA 3NHGA 1RDDA 3VA0A 1J5OA 1YT3A 3VQBA 4KHUA 5JS2A 4JS4A 1I3AA 1RDBA 3OY9A 2Y1JA 4M3ZA 2FBYA 4RW6A 1RT7A 4AHTA 3I0SA 1RNHA 3NCIA 4PY5A 2YNHA 4CK2A 4LD0A 3DLKA 1RT4A 3AVIA 5SWMA 1N5YA 4C8OA 4NCBA 1KRPA 1TK0A 1XC9A 4I9QA 3TR8A 1XI1A 3HPOA 2OZMA 3HT3A 4M3TA 1JL1A 1LW0A 4E0DA 3VQ6A 3L2RA 4CGHA 3RRHA 1TGOA 5J2QA 2VWJA 1RTHA 2RKIA 3KKRA 4LSNA 4CJSA 1S6QA 4DQRA 1D9DA 3KD5E 4KHNA 2F8SA 1JXBA 2BANA 2Z1JA 3M8RA 1T7PA 4EZ9A 4FM1A 4FJMA 2E4LA 3DLGA 3FFIA 2RN2A 4CIFA 3OS0A 5J2MA 3NFAA 1W0HA 4OJRA 4BACA 5CZ1A 2IGIA 4H4MA 1L3SA 4CHYA 3OYCA 1NOZA 4LSLA 4BE0A 4KREA 3S3MA 1BQMA 3LP0A 1CLQA 4AHRA 3AA2A 4CF0A 1NK4A 1BI4B 3QIPA 5HRRA 3DMJA 1KFSA 1KTQA 3F73A 1ZYQA 3NGYA 2JLEA 2YHBA 3HL8A 1WSHA 1UAXA 2HNDA 2XO7A 4FJIA 2P5OA 1D9FA 3NH0A 4CHNA 4ID1A 1GOCA 3PX4A 2G8KA 4FLWA 4KB1A 4W5NA 1S6PA 2X74A 1RBRA 3T3FA 4FLTA 4CK3A 1RILA 1J9AA 4CHZA 1NKCA 4IFYA 1HMVA 3V1RA 1J54A 1JLEA 4W5TA 3OYFA 3CFPA 1BQNA 4DF8A 3MXJA 3SQ4A 2G8HA 3A2FA 3C94A 4E19A 4W5OA 2VG6A 1JXEA 3B6OA 2PZSA 1NJZA 2X6NA 4CFBA 1U48A 3QO9A 4Z4HA 2E6LA 3AVFA 2B5JA 4CJPA 1BCOA 1HNIA 1VSMA 1SV5A 1EX4A 1ZBHA 2G8WA 1BL3A 4OPJA 4DSEA 4FJLA 1QE1A 3IRXA 3PUFA 1TKZA 1ASVA 3HPGA 4IG3A 3VN5A 4E7KA 5HP1A 4RW8A 3SQ0A 4ELUA 3CG7A 4CEBA 1O1WA 4F8RA 4IKFA 4Z4IA 4FYDA 5DMRA 4R5PA 3D0PA 3DRRA 3PY8A 1RBUA 4ELTA 2HVIA 1C0UA 3LPUA 1RTJA 3QETA 3QEPA 1JKHA 4KKOA 4OPKA 2HW3A 3L3VA 3VA3A 3L8BA 2F96A 1BIZA 3S9HA 4OKEA 2VG5A 3MXIA 4AH9A 3O3GA 2OA8A 3M8PA 3MEEA 2YKMA 4E1NA 1BCMA 1DTQA 4DSJA 4AHCA 2RF2A 3DLRA 4N56A 3TWHA 3VQQA 4C8MA 4DS5A 4QCLA 3TAEA 4HUGA 4DFPA 4FW1A 3T19A 4CECA 4DFJA 1K6YA 2R7YA 3U3GA 2EHGA 1LWEA 4AHUA 3AA3A 4FZXC 1LWCA 1WAJA 4E3SA 1X9MA 2BDPA 3VQEA 1LAWA 3K59A 4E89A 4J2BA 4FLZA 3SYZA 2Z1IA 2DFFA 1QSSA 1RDCA 3HK2A 4DFKA 4H8KA 3V4IA 4Z4EA 1NK6A 2ZQBA 1L3VA 4CFCA 5CY4A 4M3XA 4CGGA 1RCHA 4XIUA 2PY5A 1RDAA 4M3YA 1KVAA 3OYEA 3EYZA 1TKDA 3I8DA 4DMNA 4M45A 1U45A 1HQEA 3EZ5A 4Y1CA 3BGRA 3SJJA 3ZT1A 4DTOA 4M3UA 2D0AA 2KZMA 4Q0BA 5SZTA 2IC3A 1Y97A 3KIOA 3SPZA 1REVA 3AVJA 3AO1A 4DTNA 1QSLA 3OYIA 4HUFA 1C0TA 5CZ2A 1IKXA 3OYAA 1CXQA 3KK3A 2O4IA 4J2EA 1G15A 4KTWA 5I42A 4CJWA 4LH4A 3AA5X 3JSMA 1TKTA 1B9FA 2ATQA 4KB0A 3K57A 1KLNA 1VSEA 3NF7A 3QLHA 4DSKA 3AO3A 1KSPA 3NDKA 3NF6A 3G10A 4HVJA 1NJYA 2FC0A 3CM6A 4FW2A 1VSDA 1BI4A 3ZCMA 3TANA 4FJJA 2WOMA 4CEAA 4I7FA 3KLHA 1EKEA 4AILC 3S3OA 5FROA 1XHZA 4GVMA 1SL1A 1HPZA 4O4GA 3DLHA 3LP2A 1TAUA 1C1CA 1NOYA 1F21A 4CJUA 4C8NA 3L3UA 1QHTA 2HHVA 3KTQA 3M8SA 2ETJA 2LSNA 3L2VA 4E7JA 5J2NA 3KLFA 3F9KA 3VQCA 3QEXA 2D0CA 4B9SA 2KFNA 1BHLA 1C0MA 1TAQA 1ZBFA 4CJQA 4CF1A 4N5SA 3V9UA 1DTTA 1U47A 4B9MA 4B9LA 3DOKA 3TAMA 3RR7A 2FBTA 4N47A 5C24A 1C6VA 4OKJA 4CEQA 4CHQA 2HHQA 3BDPA 3RRGA 1WN7A 3SQ1A 4B9VA 4C8LA 2AJQA 3ASMA 2HVHA 3QESA 3VQ5A 4DTJA 3AO2A 1WSFA 4OLAA 4PA1A 5CYMA 3VQDA 4FJKA 3AVBA 3L2WA 4ICLA 4KV8A 1RTIA 4FZZA 4DTUA 3HJFA 4CEZA 1JLCA 4FLXA 4DSIA 1N6QA 3HVTA 3PO5A 1FKPA 1BGXT 1SL2A 1ASUA 1KCFA 3OYHA 3VQ4A 1HQUA 3QEVA 4DF4A 4DQPA 2HHTA 3OYGA 3OYMA 3SZ2A 1ITGA 3SUQA 1TK8A 1T05A 3V1QA 4CF9A 2KZZA 1X9SA 5HRSA 3VQ7A 1VRUA 3SQ2A 1VSJA 3OS2A 5KRTA 1NK9A 3L2UA 3DYAA 2KTQA 1IKVA 2B6AA 4HCBA 1RBTA 1RBSA 4CFAA 3U6FA 3V6DA 4LH5A 4B9UA 4AHSA 3P1GA 1TKXA 2A1RA 1HRHA 4CJRA 2OPRA 1WSGA 2X78A 4KFBA 3OYBA 4DU1A 4FLYA 3KLGA 5HRPA 3NAEA 3MECA 4OGCA 3T1AA 3TAFA 1D8YA 1RT5A 3RMCA 4CFDA 3O3HA 3G0ZA 3SI6A 4N41A 3CFOA 1WNSA 3K58A 3DLBA 2XY7A 2HNZA 2HHUA 1HYZA 1WSEA 4RW4A 4CJLA 5KGXA 3P5JA 3QNNA 1S1VA 1S1WA 2I5JA 5J2PA 4DU4A 3THVA 4DTPA 4DG1A 4ZTJA 1RBVA 5HRNA 4FM0A 2HB5A 3K5NA 4CF8A 3ZSWA 2P51A 3ZSRA 4CEFA 3OYNA 1UA1A 3LDSA 4KI4A 4BDYA 3KD1E 2ITGA 1VK0A 4ID5A 3AA4A 5HBMA 1ZBUA 3V81A 1W9HA 4FLUA 2KQ2A 3MEDA 4HHTA 1WAFA 3CFRA 2QKKA 1WSIA 5D3GA 1QSYA 4M42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DLE A;  4DU3 A;  3VQP A;  4FJH A;  3HST B;  2ZE2 A;  3ZSO A;  5DK5 A;  1Z25 A;  1JLQ A;  1LWF A;  3PO4 A;  3IG1 A;  1HYV A;  3CM5 A;  4O44 A;  3HO1 A;  1CZ9 A;  1TK5 A;  4FLV A;  2PYL A;  4M3W A;  4CJK A;  2YNF A;  2G8F A;  4B8C A;  4CED A;  5E41 A;  2QKB A;  3DOL A;  3RWU A;  1NK5 A;  4IG0 A;  3O4N A;  3UIQ A;  3TAB A;  4PWD A;  1UWB A;  5EU7 A;  4HUE A;  4KAZ A;  4CCH A;  4E7L A;  2XY5 A;  3ZT2 A;  3KLE A;  1VSH A;  4KTQ A;  4FXD A;  4HTU A;  3SCX A;  3K2P A;  3HVR A;  1S1X A;  3ZT0 A;  4FJ8 A;  4W5R A;  2BGG A;  2DFE A;  2XRI A;  2VWK A;  1HJR A;  2W42 A;  4JRQ A;  3LZJ A;  4ELV A;  5C25 A;  3LAL A;  3QIN A;  1HNV A;  1KVC A;  2Z1G A;  1RT2 A;  3ITH A;  4CGF A;  4YFU A;  3HXM A;  1JL2 A;  1EP4 A;  3LAM A;  4NCG A;  4W5Q A;  1Z26 A;  5T7B A;  3LZI A;  4ZTF A;  2FBX A;  4JRP A;  1L3T A;  1IG9 A;  1U4B A;  1MU2 A;  4O55 A;  4EZ6 A;  3WNF A;  2YHA A;  4GW6 A;  1CXU A;  3RMA A;  4DLG A;  4F2S A;  3WNH A;  3SUP A;  1T8E A;  3KLI A;  4FJ9 A;  4KHY A;  2G8U A;  1HYS A;  1GOA A;  4YNQ A;  3ZSX A;  1NKB A;  2D0B A;  2GV9 A;  4K8Z A;  5HLF A;  3AVG A;  1VSK A;  4L8R B;  4RW9 A;  2D5R A;  1TV6 A;  1QS4 A;  5KI6 A;  4CES A;  4FJ5 A;  4H4O A;  4AHV A;  4DQI A;  4OLB A;  4FK4 A;  5HRO A;  3LPT A;  4BE2 A;  5FRN A;  2O4G A;  2BE2 A;  3HP6 A;  3WNG A;  4CJ3 A;  1R0A A;  1B92 A;  3TAQ A;  4KHW A;  3ISN C;  4FCY A;  2VG7 A;  3EY1 A;  5KGW A;  1FXX A;  4IBN A;  1NKE A;  1Q9Y A;  4MQ3 A;  3KKS A;  4RG8 A;  3LWM A;  4FM2 A;  4ZHR A;  2E6M A;  3ZSY A;  4DSF A;  3QEI A;  2DTU A;  4DTM A;  5K14 A;  2F8T A;  2XY8 A;  3DRP A;  4FK2 A;  1XHX A;  4JLH A;  3JYT A;  4NYN A;  3V1O A;  1LV5 A;  4IFV A;  3HPH A;  4CEO A;  4F3O A;  1RT1 A;  4FJG A;  4TSX A;  4MFB A;  4F2R A;  4Z4C A;  3KJV A;  1JLA A;  3IAY A;  4I2Q A;  3AVM A;  2HMI A;  4B8A B;  1BIU A;  1Q8I A;  4CER A;  4KI6 A;  2YNG A;  2QXF A;  3C6T A;  4CGJ A;  4CJ5 A;  3IS9 A;  4Y1D A;  4BDZ A;  1RTD A;  1YTA A;  1B9D A;  1YVU A;  5I3U A;  3K5L A;  1FKO A;  2GUI A;  3SV4 A;  3B6P A;  3KK1 A;  4E1M A;  2YV0 X;  4F3T A;  3VQA A;  1TL3 A;  2IS3 A;  2XHB A;  4FJN A;  1ZBI A;  1VSL A;  2IDO A;  3H08 A;  3PV8 A;  5KRS A;  1KLM A;  3ALY A;  4CIE A;  1U49 A;  2OZS A;  4NYF A;  4Z4G A;  1LAV A;  3OYJ A;  3QNO A;  1LW2 A;  4KHQ A;  1SKS A;  4NCA A;  1NK7 A;  4PUO A;  3P83 D;  4O0J A;  2YNI A;  4CGI A;  1SUQ A;  3V9W A;  1DLO A;  4KPY A;  3ZT4 A;  1EET A;  1I39 A;  3TAG A;  1QTM A;  4CHO A;  1U04 A;  3D45 A;  1NJX A;  4RW7 A;  4Q5V A;  1NK8 A;  3RMB A;  3CQ8 A;  4CJV A;  1TVR A;  4BE1 A;  4KO0 A;  3NH1 A;  3OYD A;  4FJ7 A;  5C42 A;  2GBZ A;  2A1S A;  3OVN A;  3S3N A;  4N76 A;  2IAJ A;  3LAK A;  4JS5 A;  4CF2 A;  2DY4 A;  4WE1 A;  4DWI A;  1SKR A;  1GOB A;  3DRS A;  3SUN A;  3K5O A;  4CHP A;  1IKY A;  3AV9 A;  4J2A A;  3AO5 A;  1XWL A;  3OYL A;  4DTR A;  1SL0 A;  4BWJ A;  3DI6 A;  3OS1 A;  4GMJ B;  4I2P A;  3M8Q A;  3MXM A;  2YKN A;  3RTV A;  3VQ8 A;  1Q9X A;  1VSF A;  5KTQ A;  2ZD1 A;  3CYM A;  3LP1 A;  1ASW A;  3NE6 A;  3PX6 A;  4FJX A;  1S5J A;  2P5G A;  3O3F A;  4FVM A;  4CJF A;  4G1Q A;  3V9S A;  4Z0U A;  2EX3 A;  4HCC A;  3V9Z A;  4CK1 A;  1NJW A;  3MAQ A;  2G8I A;  2B4J A;  4E7H A;  5CYQ A;  3OJU A;  4DSL A;  4CE9 A;  1RT3 A;  3AVC A;  4DFM A;  2XY6 A;  3C6U A;  1J53 A;  4QOZ B;  3NBP A;  3TAR A;  4DQQ A;  3NF8 A;  5J1E A;  1L5U A;  4FZY A;  1JLG A;  3V9X A;  4C8K A;  1JLB A;  2RPI A;  2P1J A;  3AVN A;  3OYK A;  4CJT A;  2Z1H A;  3ZSQ A;  3QIO A;  1IH7 A;  3ZT3 A;  2Q3S A;  1YTU A;  2KW4 A;  5FRM A;  3HYF A;  4O0I A;  1C1B A;  4BDP A;  4DTX A;  3DM2 A;  3KK2 A;  3RR8 A;  3HM9 A;  3O4Q A;  3MEG A;  4CJ4 A;  3WNE A;  2G8V A;  1RT6 A;  3SUO A;  1TL1 A;  2HHX A;  1A5V A;  5FDL A;  4M41 A;  3NH2 A;  4E7I A;  3E01 A;  3PX0 A;  3ULD A;  2WON A;  2OYQ A;  4I9L A;  4DS4 A;  4B9T A;  2OPQ A;  2Y1I A;  3AVH A;  4DQS A;  1KVB A;  3SNN A;  2PYJ A;  1JLF A;  1X1P A;  3L2Q A;  1UOC A;  1FK9 A;  1S9E A;  4QAG A;  4EP4 A;  3C95 A;  3U3Y A;  1UA0 A;  1ZBL A;  2X6S A;  1NK0 A;  3NF9 A;  4F4K A;  3SV3 A;  3OJS A;  1IKW A;  2OPP A;  1WLJ A;  3AO4 A;  3AVL A;  1A5W A;  3NGI A;  3SPY A;  2HHW A;  2JGU A;  4Z4F A;  4O5B A;  1IO2 A;  1WSJ A;  3VQ9 A;  4OGE A;  3TAP A;  1VRT A;  4KHS A;  3ZSZ A;  1C1A A;  4EP5 A;  3TI0 A;  4KRF A;  4IDK A;  4OVL A;  2IOC A;  1D5A A;  1KFD A;  4CEE A;  3LWL A;  1S1T A;  4B9N A;  2QK9 A;  4K8X A;  3QER A;  2HNY A;  4B08 A;  2HHS A;  3HP9 A;  1T03 A;  4FK0 A;  4UQG A;  3RMD A;  4PQU A;  4BWM A;  1VSI A;  1S9G A;  3LP3 A;  3AVA A;  3NGZ A;  4DLE A;  2NUB A;  3LAN A;  4M3R A;  1S1U A;  4CGD A;  4J2D A;  1QQC A;  4B3O A;  3ZSV A;  1CZB A;  3K5M A;  4DTS A;  1L3U A;  1SKW A;  5JS1 A;  1EXQ A;  4OKK A;  4CJE A;  3I0R A;  4CIG A;  4LY7 A;  1A5X A;  3AVK A;  1X9W A;  2DFH A;  1BIS A;  4KTZ A;  2FBV A;  2OPS A;  2KFZ A;  3QEW A;  3NHG A;  1RDD A;  3VA0 A;  1J5O A;  1YT3 A;  3VQB A;  4KHU A;  5JS2 A;  4JS4 A;  1I3A A;  1RDB A;  3OY9 A;  2Y1J A;  4M3Z A;  2FBY A;  4RW6 A;  1RT7 A;  4AHT A;  3I0S A;  1RNH A;  3NCI A;  4PY5 A;  2YNH A;  4CK2 A;  4LD0 A;  3DLK A;  1RT4 A;  3AVI A;  5SWM A;  1N5Y A;  4C8O A;  4NCB A;  1KRP A;  1TK0 A;  1XC9 A;  4I9Q A;  3TR8 A;  1XI1 A;  3HPO A;  2OZM A;  3HT3 A;  4M3T A;  1JL1 A;  1LW0 A;  4E0D A;  3VQ6 A;  3L2R A;  4CGH A;  3RRH A;  1TGO A;  5J2Q A;  2VWJ A;  1RTH A;  2RKI A;  3KKR A;  4LSN A;  4CJS A;  1S6Q A;  4DQR A;  1D9D A;  3KD5 E;  4KHN A;  2F8S A;  1JXB A;  2BAN A;  2Z1J A;  3M8R A;  1T7P A;  4EZ9 A;  4FM1 A;  4FJM A;  2E4L A;  3DLG A;  3FFI A;  2RN2 A;  4CIF A;  3OS0 A;  5J2M A;  3NFA A;  1W0H A;  4OJR A;  4BAC A;  5CZ1 A;  2IGI A;  4H4M A;  1L3S A;  4CHY A;  3OYC A;  1NOZ A;  4LSL A;  4BE0 A;  4KRE A;  3S3M A;  1BQM A;  3LP0 A;  1CLQ A;  4AHR A;  3AA2 A;  4CF0 A;  1NK4 A;  1BI4 B;  3QIP A;  5HRR A;  3DMJ A;  1KFS A;  1KTQ A;  3F73 A;  1ZYQ A;  3NGY A;  2JLE A;  2YHB A;  3HL8 A;  1WSH A;  1UAX A;  2HND A;  2XO7 A;  4FJI A;  2P5O A;  1D9F A;  3NH0 A;  4CHN A;  4ID1 A;  1GOC A;  3PX4 A;  2G8K A;  4FLW A;  4KB1 A;  4W5N A;  1S6P A;  2X74 A;  1RBR A;  3T3F A;  4FLT A;  4CK3 A;  1RIL A;  1J9A A;  4CHZ A;  1NKC A;  4IFY A;  1HMV A;  3V1R A;  1J54 A;  1JLE A;  4W5T A;  3OYF A;  3CFP A;  1BQN A;  4DF8 A;  3MXJ A;  3SQ4 A;  2G8H A;  3A2F A;  3C94 A;  4E19 A;  4W5O A;  2VG6 A;  1JXE A;  3B6O A;  2PZS A;  1NJZ A;  2X6N A;  4CFB A;  1U48 A;  3QO9 A;  4Z4H A;  2E6L A;  3AVF A;  2B5J A;  4CJP A;  1BCO A;  1HNI A;  1VSM A;  1SV5 A;  1EX4 A;  1ZBH A;  2G8W A;  1BL3 A;  4OPJ A;  4DSE A;  4FJL A;  1QE1 A;  3IRX A;  3PUF A;  1TKZ A;  1ASV A;  3HPG A;  4IG3 A;  3VN5 A;  4E7K A;  5HP1 A;  4RW8 A;  3SQ0 A;  4ELU A;  3CG7 A;  4CEB A;  1O1W A;  4F8R A;  4IKF A;  4Z4I A;  4FYD A;  5DMR A;  4R5P A;  3D0P A;  3DRR A;  3PY8 A;  1RBU A;  4ELT A;  2HVI A;  1C0U A;  3LPU A;  1RTJ A;  3QET A;  3QEP A;  1JKH A;  4KKO A;  4OPK A;  2HW3 A;  3L3V A;  3VA3 A;  3L8B A;  2F96 A;  1BIZ A;  3S9H A;  4OKE A;  2VG5 A;  3MXI A;  4AH9 A;  3O3G A;  2OA8 A;  3M8P A;  3MEE A;  2YKM A;  4E1N A;  1BCM A;  1DTQ A;  4DSJ A;  4AHC A;  2RF2 A;  3DLR A;  4N56 A;  3TWH A;  3VQQ A;  4C8M A;  4DS5 A;  4QCL A;  3TAE A;  4HUG A;  4DFP A;  4FW1 A;  3T19 A;  4CEC A;  4DFJ A;  1K6Y A;  2R7Y A;  3U3G A;  2EHG A;  1LWE A;  4AHU A;  3AA3 A;  4FZX C;  1LWC A;  1WAJ A;  4E3S A;  1X9M A;  2BDP A;  3VQE A;  1LAW A;  3K59 A;  4E89 A;  4J2B A;  4FLZ A;  3SYZ A;  2Z1I A;  2DFF A;  1QSS A;  1RDC A;  3HK2 A;  4DFK A;  4H8K A;  3V4I A;  4Z4E A;  1NK6 A;  2ZQB A;  1L3V A;  4CFC A;  5CY4 A;  4M3X A;  4CGG A;  1RCH A;  4XIU A;  2PY5 A;  1RDA A;  4M3Y A;  1KVA A;  3OYE A;  3EYZ A;  1TKD A;  3I8D A;  4DMN A;  4M45 A;  1U45 A;  1HQE A;  3EZ5 A;  4Y1C A;  3BGR A;  3SJJ A;  3ZT1 A;  4DTO A;  4M3U A;  2D0A A;  2KZM A;  4Q0B A;  5SZT A;  2IC3 A;  1Y97 A;  3KIO A;  3SPZ A;  1REV A;  3AVJ A;  3AO1 A;  4DTN A;  1QSL A;  3OYI A;  4HUF A;  1C0T A;  5CZ2 A;  1IKX A;  3OYA A;  1CXQ A;  3KK3 A;  2O4I A;  4J2E A;  1G15 A;  4KTW A;  5I42 A;  4CJW A;  4LH4 A;  3AA5 X;  3JSM A;  1TKT A;  1B9F A;  2ATQ A;  4KB0 A;  3K57 A;  1KLN A;  1VSE A;  3NF7 A;  3QLH A;  4DSK A;  3AO3 A;  1KSP A;  3NDK A;  3NF6 A;  3G10 A;  4HVJ A;  1NJY A;  2FC0 A;  3CM6 A;  4FW2 A;  1VSD A;  1BI4 A;  3ZCM A;  3TAN A;  4FJJ A;  2WOM A;  4CEA A;  4I7F A;  3KLH A;  1EKE A;  4AIL C;  3S3O A;  5FRO A;  1XHZ A;  4GVM A;  1SL1 A;  1HPZ A;  4O4G A;  3DLH A;  3LP2 A;  1TAU A;  1C1C A;  1NOY A;  1F21 A;  4CJU A;  4C8N A;  3L3U A;  1QHT A;  2HHV A;  3KTQ A;  3M8S A;  2ETJ A;  2LSN A;  3L2V A;  4E7J A;  5J2N A;  3KLF A;  3F9K A;  3VQC A;  3QEX A;  2D0C A;  4B9S A;  2KFN A;  1BHL A;  1C0M A;  1TAQ A;  1ZBF A;  4CJQ A;  4CF1 A;  4N5S A;  3V9U A;  1DTT A;  1U47 A;  4B9M A;  4B9L A;  3DOK A;  3TAM A;  3RR7 A;  2FBT A;  4N47 A;  5C24 A;  1C6V A;  4OKJ A;  4CEQ A;  4CHQ A;  2HHQ A;  3BDP A;  3RRG A;  1WN7 A;  3SQ1 A;  4B9V A;  4C8L A;  2AJQ A;  3ASM A;  2HVH A;  3QES A;  3VQ5 A;  4DTJ A;  3AO2 A;  1WSF A;  4OLA A;  4PA1 A;  5CYM A;  3VQD A;  4FJK A;  3AVB A;  3L2W A;  4ICL A;  4KV8 A;  1RTI A;  4FZZ A;  4DTU A;  3HJF A;  4CEZ A;  1JLC A;  4FLX A;  4DSI A;  1N6Q A;  3HVT A;  3PO5 A;  1FKP A;  1BGX T;  1SL2 A;  1ASU A;  1KCF A;  3OYH A;  3VQ4 A;  1HQU A;  3QEV A;  4DF4 A;  4DQP A;  2HHT A;  3OYG A;  3OYM A;  3SZ2 A;  1ITG A;  3SUQ A;  1TK8 A;  1T05 A;  3V1Q A;  4CF9 A;  2KZZ A;  1X9S A;  5HRS A;  3VQ7 A;  1VRU A;  3SQ2 A;  1VSJ A;  3OS2 A;  5KRT A;  1NK9 A;  3L2U A;  3DYA A;  2KTQ A;  1IKV A;  2B6A A;  4HCB A;  1RBT A;  1RBS A;  4CFA A;  3U6F A;  3V6D A;  4LH5 A;  4B9U A;  4AHS A;  3P1G A;  1TKX A;  2A1R A;  1HRH A;  4CJR A;  2OPR A;  1WSG A;  2X78 A;  4KFB A;  3OYB A;  4DU1 A;  4FLY A;  3KLG A;  5HRP A;  3NAE A;  3MEC A;  4OGC A;  3T1A A;  3TAF A;  1D8Y A;  1RT5 A;  3RMC A;  4CFD A;  3O3H A;  3G0Z A;  3SI6 A;  4N41 A;  3CFO A;  1WNS A;  3K58 A;  3DLB A;  2XY7 A;  2HNZ A;  2HHU A;  1HYZ A;  1WSE A;  4RW4 A;  4CJL A;  5KGX A;  3P5J A;  3QNN A;  1S1V A;  1S1W A;  2I5J A;  5J2P A;  4DU4 A;  3THV A;  4DTP A;  4DG1 A;  4ZTJ A;  1RBV A;  5HRN A;  4FM0 A;  2HB5 A;  3K5N A;  4CF8 A;  3ZSW A;  2P51 A;  3ZSR A;  4CEF A;  3OYN A;  1UA1 A;  3LDS A;  4KI4 A;  4BDY A;  3KD1 E;  2ITG A;  1VK0 A;  4ID5 A;  3AA4 A;  5HBM A;  1ZBU A;  3V81 A;  1W9H A;  4FLU A;  2KQ2 A;  3MED A;  4HHT A;  1WAF A;  3CFR A;  2QKK A;  1WSI A;  5D3G A;  1QSY A;  4M42 A; 
#chains in the Genus database with same CATH topology
 4BRG A;  4DU3 A;  5JMV A;  2ZM6 K;  1VQ7 N;  3VER A;  5DK5 A;  1JLQ A;  1LWF A;  3CJB A;  3PO4 A;  1HYV A;  4O44 A;  1TK5 A;  4GVE A;  5FPE A;  1NK5 A;  4MO5 A;  2E20 A;  1UWB A;  2JWK A;  4HUE A;  4DCH A;  3T7Z A;  3KLE A;  2V7Z A;  4KTQ A;  3MDQ A;  2P9I B;  4HTU A;  5EY4 A;  5AQZ A;  3HOT A;  1J6Z A;  1HJR A;  2W42 A;  4ELV A;  4YFU A;  2VQF K;  1L3T A;  4GV3 A;  4JNE A;  4IEI A;  1U4B A;  4O55 A;  3WNH A;  1T8E A;  5AQU A;  2D0O A;  1HYS A;  1N34 K;  1GOA A;  1NKB A;  2GV9 A;  4K8Z A;  4BGA A;  5HLF A;  1SZ2 A;  4FJ5 A;  2BUP A;  3LPT A;  1S22 A;  3HP6 A;  4CJ3 A;  1R0A A;  3TAQ A;  3LDL A;  1JCF A;  2VG7 A;  3EY1 A;  1OH5 A;  5KGW A;  3KKS A;  3D2E A;  4JKC A;  3MMV A;  3QEI A;  4OO1 J;  4Y0W A;  4NYN A;  5TKY A;  1LV5 A;  3QDK A;  1RT1 A;  2BH1 A;  4F2R A;  4Z4C A;  4GKK K;  1JLA A;  4YOV A;  3IAY A;  1Q8I A;  3WXJ A;  3C6T A;  4CJ5 A;  3TTF A;  5AQW A;  1KD1 O;  4IFE A;  4BDZ A;  2QM1 A;  1YVU A;  4FL9 A;  5I3U A;  1OH8 A;  3K5L A;  3SV4 A;  3KK1 A;  4E1M A;  3CCQ N;  1ZBI A;  2NLX A;  2VGN A;  2UU9 K;  3ALY A;  2O8C B;  4ISF A;  2NRW A;  2P9K A;  2UXD K;  1DEJ A;  4KHQ A;  1SKS A;  2WFB A;  3P83 D;  3QBW A;  1SUQ A;  1I39 A;  3TAG A;  4CHO A;  1U04 A;  4RW7 A;  4WQ4 A;  4Q5V A;  5JVG L;  3NVM A;  3CQ8 A;  2HBK A;  4FJ7 A;  3ID8 A;  2A1S A;  1IG8 A;  4JS5 A;  3HSC A;  4CF2 A;  4E1J A;  1GOB A;  3DRS A;  3K5O A;  4J2A A;  2A42 A;  1XWL A;  4DR6 K;  4AQY K;  5BR8 K;  4B1Y B;  5EOY A;  2UUC K;  3M8Q A;  2YKN A;  5C2D A;  3WEE A;  2ZD1 A;  2P5G A;  4CJF A;  1E4F T;  3V9S A;  2F7T A;  1TYQ B;  3V9Z A;  3MAQ A;  2CH5 A;  5LMN K;  2B4J A;  5CYQ A;  1VQ6 N;  1BO5 O;  3MX2 A;  1LOT B;  4DQQ A;  4BC3 A;  1QVG M;  3HOS A;  2RPI A;  2Q1N A;  2ASM A;  2P1J A;  4DV2 K;  2Z1H A;  3QIO A;  1IH7 A;  2Q3S A;  3U4L A;  1C1B A;  1DGK N;  1BA0 A;  1TUY A;  4CJ4 A;  2G8V A;  1A5V A;  5FDL A;  2GEM A;  3A5O C;  2Y1I A;  3AVH A;  3P31 A;  1S9E A;  3C95 A;  1NK0 A;  2X6S A;  2NRT A;  3NF9 A;  5LMU K;  4BRP A;  2QEX N;  2AP1 A;  2GWK A;  3VQ9 A;  4OGE A;  1VRT A;  1C1A A;  4OVL A;  2IOC A;  3LWL A;  5H1S Q;  3QER A;  4IO9 L;  1Q82 O;  3IMX A;  4BWM A;  3AVA A;  3C65 A;  3M6G A;  3OBY A;  1CZB A;  4DTS A;  1L3U A;  2ZJR L;  3L4I A;  1SKW A;  4OKK A;  4U67 L;  4CIG A;  5F1X A;  1X9W A;  3CQY A;  3ULE A;  3G4S N;  1YT3 A;  4JKH A;  5LJV A;  4IXC A;  4JS4 A;  5BPL A;  3OY9 A;  2Y1J A;  3L6Q A;  4AHT A;  2ZJQ L;  1RNH A;  4PY5 A;  4CZH A;  1RT4 A;  1WBB A;  5SWM A;  3CXC M;  4C8O A;  1XC9 A;  3A5M C;  3TR8 A;  1XI1 A;  3HZ6 A;  3HPO A;  3HT3 A;  2AA4 A;  3L2R A;  3RSE A;  2RKI A;  1D9D A;  1S6Q A;  3VF2 A;  1JXB A;  4EFH A;  3T1Y K;  1T7P A;  3M8R A;  4FJM A;  3DLG A;  2RN2 A;  3AGK A;  2IVP A;  1W0H A;  4OJR A;  3VEW A;  3O9Q A;  4LSL A;  3S3M A;  4CF0 A;  1BI4 B;  2HOE A;  1KTQ A;  2UUB K;  3NGY A;  2JLE A;  3A8Y A;  4BR9 A;  2XO7 A;  1WSH A;  1UAX A;  2HND A;  1D9F A;  3CPW M;  4CHN A;  2A3Z A;  3PX4 A;  4KHP K;  4KB1 A;  1S6P A;  1RBR A;  4FLT A;  2YX6 A;  4CK3 A;  1RIL A;  1J9A A;  3QFP A;  1J54 A;  3O5B A;  4JEP A;  2G8H A;  1BQN A;  3MXJ A;  3SBT A;  4AM6 A;  3SQ4 A;  2PZS A;  2NRZ A;  1NJZ A;  3CME N;  4AF1 A;  3RSE B;  3SAF A;  1ZBH A;  1EX4 A;  2G8W A;  1E4G T;  3IRX A;  1ASV A;  4WFA L;  4CEB A;  2Q0R A;  4PL8 A;  5DMR A;  3DRR A;  1C0U A;  3LPU A;  3QET A;  3J7Z O;  1JKH A;  2HW3 A;  1OH7 A;  4X66 K;  3L8B A;  2HF3 A;  3FFK B;  3A5L C;  1OH6 A;  3J81 O;  2VG5 A;  4AH9 A;  1WOQ A;  3M8P A;  4NLC A;  1DTQ A;  2RF2 A;  2CGL A;  1HUX A;  4DS5 A;  2CH6 A;  5BR9 A;  3FR0 A;  2P9U B;  2YI1 A;  3AA3 A;  1LWC A;  5AQN A;  2BDP A;  3W3D A;  5GAE P;  3K59 A;  1T6D A;  4C23 A;  3SYZ A;  3HK2 A;  3V4I A;  1YIT N;  3CCJ N;  2J4R A;  3N4Q A;  1NGJ A;  2F9W A;  4JI3 K;  4XH4 A;  1TKD A;  3O1W A;  1OVY A;  4DTO A;  2V51 B;  2D0A A;  4JN4 A;  4Q0B A;  1Y97 A;  1REV A;  3AVJ A;  3AO1 A;  4DTN A;  3OYA A;  1CXQ A;  4JI0 K;  1EWQ A;  5I42 A;  1K8A O;  2VGM A;  5FPM A;  3AA5 X;  1NM1 A;  3K57 A;  1VSE A;  3NF7 A;  1S3X A;  4QS7 A;  3AO3 A;  3NDK A;  3GL1 A;  2FC0 A;  4FW2 A;  3TAN A;  1VSD A;  4A5A A;  4JHD A;  3KLH A;  1EKE A;  3S3O A;  1SL1 A;  4O4G A;  2D0P A;  4R79 A;  3EE8 A;  3MCA B;  3ATU A;  3L3U A;  4RTF D;  3F9K A;  4IOX A;  3VQC A;  3QEX A;  4B9S A;  1BHL A;  1C0M A;  1TAQ A;  4EZ9 A;  4JKG A;  4CJQ A;  4N5S A;  1W2B M;  1DTT A;  4DHY A;  4CZL A;  4GKJ K;  1KAZ A;  1C6V A;  4LF4 K;  4JI5 K;  2AJQ A;  4B9V A;  5AQV A;  4L3Q A;  3QES A;  4OLA A;  4CBX A;  1X3N A;  4H5V A;  4ICL A;  4FZZ A;  3HJF A;  4CEZ A;  4DSI A;  3PO5 A;  1FKP A;  1SL2 A;  3VQ4 A;  3QEV A;  1Q86 O;  1TK8 A;  1X9S A;  5HRS A;  3MN7 A;  1NK9 A;  5KRT A;  2ZWH A;  1IKV A;  1RBS A;  4BQZ A;  4B9U A;  4ILH A;  3P1G A;  3EO3 A;  2PAV A;  2A1R A;  2P9P A;  4CJR A;  1WSG A;  2X78 A;  3LDQ A;  3OYB A;  4EHT A;  4FO0 A;  5B8H A;  2WTU A;  5EX5 A;  5AQT A;  3NAE A;  4B1V A;  4BRI A;  1D8Y A;  1RT5 A;  3SI6 A;  4CFD A;  3O3H A;  2RHK A;  3D2F B;  3O8M A;  3DLB A;  3GBT A;  5ELZ A;  3CPE A;  4H03 B;  4MLE A;  3P5J A;  1W7A A;  5J2P A;  4ZTJ A;  4DTP A;  1RBV A;  2HB5 A;  2FXU A;  1UA1 A;  4XH5 A;  3OYN A;  3O9T A;  3LDS A;  4ID5 A;  4BC5 A;  4LF9 K;  4FLU A;  1N8R O;  3A0I X;  4M42 A;  3DLE A;  4DR5 K;  2E2O A;  4CW7 B;  4BY9 C;  2ZE2 A;  4CZJ A;  2IIR A;  1MWK A;  1BA1 A;  1YXQ A;  4FLV A;  2PYL A;  4CJK A;  1XUP O;  4CED A;  4OX9 K;  3DOL A;  3J7Y P;  4JI6 K;  3VES A;  4PWD A;  4CCH A;  4E7L A;  3SJH A;  4FXD A;  3M1F A;  1P8Z A;  3QML A;  3SCX A;  3HVR A;  1WBD A;  1JCE A;  2D4W A;  4FJ8 A;  2BGG A;  3R9P A;  2VWK A;  2HMP A;  4JRQ A;  3LZJ A;  4JKA A;  2O8F B;  1HNV A;  2Z1G A;  1RT2 A;  3ITH A;  1JL2 A;  5JVH L;  4W5Q A;  1Z26 A;  3O9S A;  1CXU A;  4DLG A;  3SUP A;  5GIP A;  4O5F A;  3ZSX A;  2D0B A;  4CZM A;  4RW9 A;  2D5R A;  1TV6 A;  1QS4 A;  5KI6 A;  4OLB A;  1HNX K;  4AHV A;  5HRO A;  4YOU A;  5FRN A;  3BF3 A;  1ILY A;  2O4G A;  3CI5 A;  4BRM A;  5JLH A;  4H5T A;  3ISN C;  2KLA A;  1VQ8 N;  4BG8 A;  1Q9Y A;  4IBN A;  3ENO A;  3KK7 A;  4MQ3 A;  3G71 N;  1NKE A;  1NJI O;  2E6M A;  4DSF A;  1QHA A;  3DRP A;  4FK2 A;  1XHX A;  5AR0 A;  4CEO A;  4CD1 A;  3ZEU B;  2BTF A;  1U6Z A;  5M1N A;  3MX5 A;  1I94 K;  2QXF A;  2QWO A;  4DV1 K;  3LL3 A;  4B1Z A;  5KPR A;  1B9D A;  2YV0 X;  1QVF M;  1TL3 A;  2XHB A;  4YHH K;  2NRH A;  3ZX2 A;  1NG9 A;  4DKW A;  3EEQ A;  2QA4 N;  4Z4G A;  3QNO A;  1NK7 A;  1TUU A;  4O0J A;  3V9W A;  1DLO A;  2VYP A;  1K9M O;  2WUS A;  4GY2 B;  1QTM A;  3CQX A;  2HBJ A;  1NJX A;  4IOA L;  4BC4 A;  3O9R A;  3HRG A;  4LC9 B;  4BE1 A;  3OYD A;  5AQM A;  5C42 A;  2GBZ A;  3S3N A;  4N76 A;  3E9P A;  1T6C A;  1SKR A;  1N36 K;  2ZJP L;  4CHP A;  1IKY A;  3AV9 A;  2YCH A;  1SL0 A;  4BWJ A;  3DI6 A;  1GLC G;  3OS1 A;  4I2P A;  3RTV A;  5TKW A;  1Q9X A;  5AQS A;  5AQQ A;  2ASP A;  5KTQ A;  3CYM A;  1NU0 A;  3D7E O;  4GV6 A;  3O3F A;  4G1Q A;  3JAM O;  2EX3 A;  4HCC A;  1NJW A;  1GLF O;  1HX1 A;  4DSL A;  4CE9 A;  1H1V A;  4K42 A;  3AVC A;  3M3Z A;  3TSP A;  4QOZ B;  3WQT A;  3NBP A;  3FZL A;  3J7A P;  2ITM A;  4BRE A;  2PFU A;  1JLG A;  2Q31 A;  4DR2 K;  1KAY A;  1JLB A;  4WF9 L;  2A40 A;  4CJT A;  3ZSQ A;  3AY9 A;  3HYF A;  3E9O A;  4BDP A;  3DM2 A;  3WNE A;  3CIP A;  3G6E N;  1RT6 A;  1TL1 A;  1XNR K;  3E01 A;  5CE3 A;  3THY B;  4DS4 A;  4A2A A;  2QW9 A;  2HBL A;  4CZE A;  4J8F A;  3L2Q A;  1X1P A;  3SNN A;  4EP4 A;  3DLL L;  1NBW A;  3DJC A;  1GLE G;  1IKW A;  2OPP A;  3AVL A;  3OJS A;  3SPY A;  4O5B A;  3VGK A;  3TAP A;  4KH4 A;  4WFN L;  2QK9 A;  2E2Q A;  5AQY A;  4WCE L;  1ATS A;  2HNY A;  2O8C A;  4BRQ A;  2HHS A;  4X62 K;  3LM9 A;  4UQG A;  4FWQ A;  1GLB G;  4PQU A;  1S9G A;  2NUB A;  4CGD A;  1QQC A;  4B3O A;  3SBG A;  4IEE A;  2E8A A;  3I0R A;  1A5X A;  3AVK A;  4F9O A;  1BIS A;  4KTZ A;  4JK9 A;  5AZI A;  3VA0 A;  5JS2 A;  4BRO A;  1RDB A;  4H0P A;  3U8X A;  4M3Z A;  4RW6 A;  2Q97 A;  2F4V K;  3O08 A;  4CK2 A;  3AVI A;  1N33 K;  2EWS A;  4I9Q A;  3OHR A;  1MDU B;  3UE5 A;  4BRL A;  1LW0 A;  3CJC A;  2VWJ A;  1RTH A;  4CJS A;  4KHN A;  1DT9 A;  4FM1 A;  1TYQ A;  4V19 S;  2Q2R A;  5J2M A;  4H4M A;  1L3S A;  1IBM K;  3OW2 M;  2ZGY A;  4KRE A;  1BQM A;  1CLQ A;  5AZI B;  1NK4 A;  4FSV A;  2D1K A;  5AQJ A;  3DMJ A;  1KFS A;  3F73 A;  1NLV A;  4DV4 K;  2YHB A;  4BGB A;  4KH5 A;  5C10 A;  4FJI A;  3H45 C;  5AQK A;  3CCE N;  2GWJ A;  1GOC A;  5AQI A;  1NKC A;  3KHY A;  4CHZ A;  1QZ6 A;  3V1R A;  4W5T A;  3C94 A;  2VG6 A;  1JXE A;  2ZGZ A;  4A62 A;  4Z4H A;  4CJP A;  1HNI A;  3AGR A;  3PUF A;  5HP1 A;  4E7K A;  4Z4I A;  4IKF A;  4F8R A;  1O1W A;  4DR1 K;  3VPZ A;  3D0P A;  4JD2 B;  1NGE A;  3QEP A;  4KKO A;  4OPK A;  3DAW A;  1C0G A;  4BR7 A;  5DM6 L;  2NRV A;  3O3G A;  3KWI A;  1M1K O;  3DLR A;  4N56 A;  1FW6 A;  3VQQ A;  1VHX A;  4QCL A;  4DFP A;  3PLA A;  1Q18 A;  3GE1 A;  4CEC A;  3U3G A;  5LY3 A;  1LWE A;  4AHU A;  1LAW A;  2NNW A;  4FLZ A;  1HR0 K;  4DFK A;  5C15 A;  3GG4 A;  4OPA A;  4XH1 A;  3CCR N;  5KQ8 A;  4M3X A;  1ESV A;  5CY4 A;  1P90 A;  2YJF A;  1RDA A;  4B3S K;  3OYE A;  2WBN A;  1NNE A;  3EYZ A;  1ZC6 A;  3I8D A;  4DMN A;  4A59 A;  1V4T A;  1HQE A;  5BRH A;  1NGC A;  5SZT A;  1J5E K;  3SPZ A;  1QSL A;  3FGU A;  3OYI A;  4HUF A;  1C0T A;  4FWN A;  5CZ2 A;  2O4I A;  3KK3 A;  2KKZ A;  1NGD A;  3CER A;  5MLC Q;  4CJW A;  3CCU N;  4LH4 A;  3JSM A;  1TKT A;  3THW B;  3O4W A;  5BPM A;  3AAR A;  4PKG A;  3O9U A;  1NJY A;  3SAG A;  3ZCM A;  1BI4 A;  3FZH A;  3MCP A;  2WOM A;  3DXK B;  1HPZ A;  1GLA G;  3LP2 A;  1C1C A;  2YJE A;  4A5B A;  4DR7 K;  4QS9 A;  1QHT A;  2ETJ A;  3L2V A;  4YOY A;  4C1N I;  4BVO A;  2KFN A;  4B1W B;  5F2R A;  4B9M A;  1U47 A;  3C7N B;  4H5W A;  3DOK A;  2FBT A;  4N47 A;  5C24 A;  4CEQ A;  4CHQ A;  4C8L A;  5BRD A;  4JK8 A;  3VQ5 A;  3VQD A;  5CYM A;  3K9K A;  3AVB A;  5FPN A;  4EHU A;  4DTU A;  2A41 A;  2CGK A;  5C2F A;  1N6Q A;  1BGX T;  3QB0 A;  5AQR A;  1ASU A;  1KCF A;  3OYH A;  2HHT A;  1QZ5 A;  4ILG B;  4B9Q A;  3OYG A;  2O8E B;  1T05 A;  4CF9 A;  3UKU A;  3VQ7 A;  4CD3 A;  1NMN A;  1VSJ A;  2P9U A;  2FF6 A;  5AQH A;  3DYA A;  3DXM B;  2KTQ A;  2B6A A;  4CBW A;  4HCB A;  1RBT A;  3VTI A;  5LJW A;  4CFA A;  4LH5 A;  3Q7C A;  5AQX A;  4AHS A;  3TU5 A;  1X9J A;  4BRD A;  4DU1 A;  3H46 O;  3KLG A;  4DR3 K;  2OTJ N;  3T1A A;  1WNS A;  3K58 A;  1IBL K;  3K9J A;  5BRE A;  2HHU A;  1WUA A;  3CET A;  5KGX A;  2F9T A;  4CZK A;  1S1V A;  1S1W A;  1HJO A;  3VEZ A;  5HRN A;  4FM0 A;  3P38 A;  4CF8 A;  3ZSW A;  4CEF A;  3AAP A;  3UKU B;  2Q36 A;  1ZBU A;  3V81 A;  1RDW X;  1W9H A;  3QIC A;  3CMA N;  4U7B A;  2QKK A;  3CFR A;  3KWG A;  3FZM A;  1HKC A;  1QSY A;  5GIN A;  3CF5 L;  5HL7 L;  4FJH A;  4H0V B;  4YOT A;  3ZSO A;  1Z25 A;  3CM5 A;  3MN9 A;  5BN9 A;  1CZ9 A;  4JI2 K;  4M3W A;  2YNF A;  2G8F A;  5E41 A;  3BUZ B;  3CJ7 A;  3LDP A;  4IG0 A;  3O4N A;  3LDN A;  3TAB A;  2UXC K;  4BRF A;  5EU7 A;  2XY5 A;  3K2P A;  1S1X A;  4W5R A;  3SMP A;  2DFE A;  3MN5 A;  1M90 O;  2XRI A;  3CC7 N;  3ZET B;  4CGF A;  1EP4 A;  4ZTF A;  3LZI A;  1IG9 A;  4JRP A;  4JAX A;  1MU2 A;  5GAG P;  4F2S A;  2YHA A;  4GW6 A;  2VQE K;  3I56 N;  3HM8 A;  3KLI A;  4FJ9 A;  4KHY A;  3CCL N;  4YNQ A;  3EE9 A;  3BF1 A;  3IDH A;  5BRF A;  3SAH A;  4FWK A;  3AVG A;  4L8R B;  3UB5 A;  4MDB A;  4CES A;  3H6E A;  4B3T K;  4BE2 A;  2OCE A;  5AQF A;  2P9S B;  4Z94 A;  5AQL A;  1SAZ A;  4EIA A;  1HLU A;  4RG8 A;  3LWM A;  4ZHR A;  3OTO K;  1BG3 A;  2XY8 A;  1Q7Y O;  4JLH A;  3V1O A;  1YJ9 N;  3R3L A;  3VTH A;  3D2F A;  2HMI A;  4B8A B;  4IWV A;  2YNG A;  3VOV A;  4M7X A;  4LFB K;  1NGA A;  3IS9 A;  4Y1D A;  1RTD A;  4F3T A;  3B6P A;  1YIJ N;  4B3R K;  2W6K A;  2IDO A;  3PV8 A;  1KLM A;  3PIO L;  1U49 A;  1NGG A;  4NYF A;  1LAV A;  3OYJ A;  1LW2 A;  1S72 N;  4CGI A;  2YNI A;  4KPY A;  3MWT A;  1NMD A;  1EET A;  2QTD A;  3D45 A;  3RMB A;  4CJV A;  3F2K A;  1YUW A;  4KO0 A;  1HKB A;  1EQY A;  4RWT A;  2NZT A;  3EKS A;  2DY4 A;  4DV3 K;  4DWI A;  3SUN A;  1EO1 A;  3OYL A;  3SK3 A;  4DTR A;  2E2N A;  4UY8 O;  3CHW A;  3MXM A;  3JS6 A;  3VQ8 A;  3LP1 A;  3NE6 A;  3PX6 A;  1Q81 O;  4FJX A;  4ISG A;  3VET A;  2O8F A;  3C6A A;  5AQG A;  4Z0U A;  5EVZ A;  3ZX3 A;  4CK1 A;  4DUZ K;  1YVN A;  3TTD A;  2G8I A;  4E7H A;  1RGI A;  2O8B B;  1RT3 A;  4DFM A;  2XY6 A;  3C6U A;  1J53 A;  3G25 A;  3TAR A;  1XNQ K;  3V9X A;  2FF3 B;  1G99 A;  3AVN A;  1YAG A;  1YJN N;  3B8A X;  4DTX A;  3RR8 A;  3O4Q A;  3MEG A;  2HHX A;  4M41 A;  3NH2 A;  4E7I A;  1K8K B;  3CC4 N;  2VCP A;  3PX0 A;  4FWO A;  1WB9 A;  1XMO K;  2VWB A;  2OPQ A;  1CZA N;  5M1Q A;  2PYJ A;  1JLF A;  3U3Y A;  1UOC A;  4QAG A;  3ZEU A;  2E5L K;  4F4K A;  4H0T B;  2DPN A;  4XEI A;  1U2V B;  1WLJ A;  1A5W A;  2JGU A;  2JWL A;  4Z4F A;  1IO2 A;  1WSJ A;  1QQO A;  4JKB A;  4EP5 A;  3TI0 A;  5CHI A;  1KFD A;  4CEE A;  5GAH P;  4B9N A;  1VQN N;  1C0F A;  3BEX A;  2ZF5 O;  2KHO A;  5BN8 A;  1BUP A;  3RMD A;  1VSI A;  1KAX A;  3LP3 A;  3NGZ A;  3LAN A;  4M3R A;  1S1U A;  4CZG A;  1K73 O;  3K5M A;  3T1H K;  4LY7 A;  1VAZ A;  1Z6R A;  3IFR A;  3H3O B;  2KFZ A;  2FBV A;  1KXP A;  1RDD A;  3NHG A;  5AZJ B;  1J5O A;  3VQB A;  4KHU A;  3QFU A;  4I6M B;  2YNH A;  3DLK A;  3WXI A;  1N5Y A;  4NCB A;  4CJ7 A;  3OA9 A;  5M1P A;  2IVN A;  4JI1 K;  1E3M A;  4E0D A;  4ILJ A;  2HBM A;  1KC8 O;  3RRH A;  3KKR A;  4LSN A;  2I7N A;  2BAN A;  4CIF A;  4KH6 A;  3NFA A;  4BR5 A;  5GAD P;  4BAC A;  2IGI A;  3OYC A;  4EAH D;  4BE0 A;  1X3M A;  3LP0 A;  4AHR A;  5E26 A;  3QIP A;  5DM7 L;  3T69 A;  1ZYQ A;  4A2B A;  2P5O A;  4FLW A;  3PSI A;  4BQL A;  4IFY A;  1HMV A;  1JLE A;  3OYF A;  3CFP A;  4DF8 A;  4E19 A;  3THY A;  1QQM A;  2X6N A;  3D6R A;  1BCO A;  2ASO A;  1BL3 A;  4OPJ A;  1TKZ A;  4IG3 A;  3HPG A;  4A57 A;  4ELU A;  4KAZ A;  3CG7 A;  4FYD A;  4R5P A;  3PY8 A;  4ELT A;  5BPN A;  1RTJ A;  3ENB A;  4FPA A;  2GEL A;  3L3V A;  3VA3 A;  3S9H A;  4OKE A;  4ISE A;  2OA8 A;  1Y64 A;  3MEE A;  2YKM A;  4E1N A;  4DSJ A;  1VQM N;  3Q7B A;  3TWH A;  4CI6 A;  4C8M A;  3TAE A;  1FJG K;  1VQ9 N;  4FW1 A;  4IJA A;  3KVG A;  4B3M K;  4DFJ A;  1T3V A;  1K6Y A;  3UKR B;  2EHG A;  4FZX C;  4JK7 A;  1WAJ A;  4BR0 A;  1X9M A;  3VQE A;  4J2B A;  2DFF A;  1RDC A;  3E1Y A;  1NGI A;  1IJJ A;  4Z4E A;  1NK6 A;  2ZQB A;  1HNW K;  3HTV A;  1JJ2 M;  5I9E B;  1RCH A;  4XIU A;  3THX B;  3ATV A;  4M3Y A;  1KVA A;  3ZX0 A;  1OKJ A;  4M45 A;  3SJJ A;  3EZ5 A;  3BGR A;  2A5X A;  4YOX A;  2V7Y A;  3QBX A;  1G15 A;  4KTW A;  5HOO A;  3EN9 A;  4IJN A;  4KB0 A;  3SMS A;  1KLN A;  3QLH A;  2W41 A;  3NF6 A;  3CCV N;  5FPD A;  4FJJ A;  4WQ5 C;  4AIL C;  4JI7 K;  1TAU A;  2YHW A;  1NOY A;  4CJU A;  1VQL N;  3I8B A;  4C8N A;  4M63 C;  1HPM A;  3KTQ A;  2LSN A;  5J2N A;  4E7J A;  5JLF A;  3SLC A;  3A5N C;  4B9L A;  3TAM A;  1MA9 B;  3AAQ A;  2HHQ A;  3BDP A;  3RRG A;  3SQ1 A;  2HVH A;  4FWS A;  4JD2 A;  4BRA A;  3AO2 A;  2QWN A;  4PHT X;  4FJK A;  3L2W A;  4KV8 A;  1RTI A;  4MDA A;  3S41 A;  5ADX A;  4FPB A;  4LF5 K;  3RVC A;  1HQU A;  4DQP A;  1ITG A;  5M1O A;  2Q0U A;  2KZZ A;  2E1Z A;  1VRU A;  3MWP A;  3OS2 A;  3L2U A;  4DUY K;  1BWF O;  3P4I A;  3V6D A;  1RFQ A;  2W40 A;  1TKX A;  1HRH A;  3D2E B;  3GDQ A;  5HRP A;  3LM2 A;  1ZBS A;  3RMC A;  3G0Z A;  3CFO A;  3VEV A;  3ZYY X;  4B1U B;  1HYZ A;  4RW4 A;  4CJL A;  1ZXO A;  3QNN A;  2I5J A;  3N4P A;  3THV A;  1YHQ N;  3VEX A;  5LL6 Z;  3ZSR A;  3FE1 A;  4BDY A;  2W6L A;  1VK0 A;  2P9K B;  3CC2 N;  5HBM A;  2HF4 A;  3THW A;  1Z05 A;  1WAF A;  1O13 A;  1WSI A;  3VGL A;  2QWL A;  5M1K A;  1SS6 A;  3CJ9 A;  3VQP A;  3HST B;  3DXK A;  3L4Q A;  3VEO A;  3IG1 A;  4YDU C;  5ADX H;  3HO1 A;  1LCU A;  5C12 A;  4B8C A;  5JIC A;  3H3N O;  2QKB A;  4PKI A;  3RWU A;  3UIQ A;  3ZT2 A;  1VSH A;  3C7N A;  5M1F A;  3WEE B;  3ZT0 A;  1V4S A;  4A61 A;  3E9L A;  5C25 A;  3LAL A;  3QIN A;  1KVC A;  3HXM A;  4NXN K;  4NCG A;  3LAM A;  3BZC A;  5T7B A;  2FBX A;  4EZ6 A;  3ID6 A;  3WNF A;  3RMA A;  5AQP A;  1VQ5 N;  3R8E A;  2G8U A;  1R59 O;  4LF8 K;  4K0K K;  4H0X B;  2O8E A;  4DV0 K;  1BDG A;  1VSK A;  4LF7 K;  3IUC A;  4FK4 A;  4H4O A;  4DQI A;  3BY5 A;  4WFB L;  3DXM A;  2BE2 A;  3WNG A;  1B92 A;  4KHW A;  4FCY A;  3K0S A;  4FWR A;  1FXX A;  4FM2 A;  3ZSY A;  2DTU A;  4JI4 K;  4DTM A;  5K14 A;  2F8T A;  2GTD A;  3WQU A;  4GNI A;  3JYT A;  4IFV A;  3HPH A;  4F3O A;  4FJG A;  4TSX A;  1W97 L;  4MFB A;  3KJV A;  4I2Q A;  3AVM A;  2UXB K;  1BIU A;  4CER A;  4KI6 A;  4CGJ A;  3EZW A;  3P39 A;  4MLH A;  4QS8 A;  3I55 N;  4LF6 K;  1YTA A;  1NWK A;  1ATR A;  1FKO A;  2GUI A;  3VQA A;  2IS3 A;  4FJN A;  5C0Y A;  1VSL A;  3H08 A;  1YI2 N;  5KRS A;  4CIE A;  2OZS A;  5EXW A;  2P9L A;  3GOI A;  4NCA A;  4PUO A;  3DWL A;  3C6H A;  3ZT4 A;  4BC2 A;  4G9Z A;  3VF6 A;  3E66 A;  1NK8 A;  3ULE B;  1TVR A;  3NH1 A;  4HTL A;  3OVN A;  4YY3 K;  3NMU A;  2IAJ A;  3LAK A;  4BVP A;  2OAN A;  3J80 O;  4WE1 A;  2NRX A;  3AO5 A;  3F5T A;  2FLO A;  3VF4 A;  4AM7 A;  1VQP N;  4GMJ B;  1VSF A;  4NXM K;  1ASW A;  4WQ5 A;  3F9M A;  1S5J A;  1MWM A;  1GLD G;  3ZET A;  4FVM A;  2P9L B;  5A2Q O;  5F0X A;  2GX9 A;  4FWM A;  4JKD A;  1QQN A;  3OJU A;  4BG9 A;  4H0O A;  3NF8 A;  1JCG A;  5J1E A;  2YHX A;  1L5U A;  4FZY A;  4C8K A;  2O8D A;  3OYK A;  1YTU A;  3ZT3 A;  2I7P A;  2KW4 A;  5FRM A;  4O0I A;  2P9S A;  3KK2 A;  3HM9 A;  3SUO A;  3ULD A;  2WON A;  2OYQ A;  1GLL O;  4I9L A;  4B9T A;  5GIO A;  4DQS A;  1KVB A;  1FK9 A;  2QWR A;  1UA0 A;  4BRN A;  1ZBL A;  3BZK A;  3TTC A;  3SV3 A;  4DR4 K;  2HHW A;  3NGI A;  3AO4 A;  3CJA A;  2H3G X;  2PBD A;  4KHS A;  3ZSZ A;  4RCH A;  4KRF A;  4IDK A;  1YF5 L;  1D5A A;  1S1T A;  5E84 A;  3O6W A;  4K8X A;  3FZK A;  4BRK A;  1XC3 A;  4B08 A;  3PIP L;  4M7Y A;  3HP9 A;  1T03 A;  4FK0 A;  3NVK A;  2O8D B;  3MN6 A;  4DLE A;  4J2D A;  4K43 A;  3ZSV A;  1VQK N;  5JS1 A;  1EXQ A;  4CJE A;  1DKG D;  3O1B A;  2DFH A;  2OPS A;  3QEW A;  1I3A A;  2FBY A;  1RT7 A;  5KQD A;  3I0S A;  3NCI A;  4LD0 A;  1GLJ O;  3TSU A;  2QWQ A;  1KRP A;  1TK0 A;  1IBK K;  1BOT O;  3U9Z A;  4PKH A;  2OZM A;  4M3T A;  1JL1 A;  4JYA K;  4JI8 K;  3VQ6 A;  4CGH A;  5J2Q A;  1TGO A;  2QWP A;  4BR2 A;  4LFA K;  4W5N A;  2F8S A;  4DQR A;  3KD5 E;  3O80 A;  4YDU A;  2Z1J A;  2E4L A;  3FFI A;  3JXU A;  3OS0 A;  5CZ1 A;  3VEN A;  3WUH A;  2O8B A;  4CHY A;  1NOZ A;  3AA2 A;  4JV5 K;  1ATN A;  3W0L A;  4JHD B;  4CVN E;  3R1X A;  5HRR A;  4O8U A;  4DQ8 A;  4WYB A;  2A6A A;  3HL8 A;  4CZF A;  4B1X B;  3NH0 A;  4ID1 A;  2G8K A;  2RE2 A;  4FVU A;  5KPT A;  5AFU A;  2X74 A;  1YJW N;  3T3F A;  2OTL N;  1RDU A;  3OBW A;  1K8K A;  3A2F A;  3J8A A;  4W5O A;  3B6O A;  4CFB A;  4JKG B;  1U48 A;  3QO9 A;  4IDH A;  2E6L A;  3AVF A;  4NLB A;  2B5J A;  1VSM A;  1SV5 A;  1T44 A;  4DSE A;  4FJL A;  4LFC K;  1QE1 A;  3VN5 A;  3SQ0 A;  1HNZ K;  4RW8 A;  3CCS N;  3TSQ A;  1U2V A;  1RBU A;  2HVI A;  3VGM A;  2F96 A;  1BIZ A;  3MXI A;  4H0Y B;  2CGJ A;  3KZB A;  1BCM A;  2UUA K;  4AHC A;  2FSJ A;  3EKU A;  4HUG A;  3T19 A;  2YHY A;  5AJ3 K;  2R7Y A;  4BRC A;  4E3S A;  4FOE A;  4K25 A;  4O8K A;  4E89 A;  2FSN A;  2Z1I A;  1QSS A;  3ZLJ A;  4H8K A;  3WXM B;  1NGB A;  2NRR A;  5AZJ A;  2P9P B;  1L3V A;  4CFC A;  4IO8 A;  4CGG A;  2PY5 A;  2GUP A;  4I6M A;  4FOI A;  3C0B A;  5AQO A;  4PL7 A;  1NGF A;  3H1V X;  2QWM A;  1U45 A;  1XQS C;  4WQ4 C;  1N32 K;  4Y1C A;  3PSF A;  3ZT1 A;  4M3U A;  5AFU H;  2KZM A;  4K41 A;  4NB4 A;  3WXL A;  2IC3 A;  3KIO A;  1VQ4 N;  1IKX A;  2WC9 A;  1D4X A;  4J2E A;  4H5R A;  3WT0 A;  5KPZ A;  4FWP A;  1B9F A;  2ATQ A;  4CBU A;  4DV7 K;  4DSK A;  1XMQ K;  4JKF A;  1KSP A;  1IV0 A;  3G10 A;  4HVJ A;  3CM6 A;  4BRH A;  4X65 K;  4CEA A;  4I7F A;  4DB3 A;  4KBO A;  5FRO A;  4GVM A;  1XHZ A;  4C1N K;  3FZF A;  2P9N A;  3DLH A;  4HWI A;  3WXK A;  3H1Q A;  2HHH K;  1F21 A;  3HI0 A;  2HHV A;  4IOC L;  3M8S A;  3I33 A;  4FWL A;  3KLF A;  3M5R A;  4CZI A;  2D0C A;  1ZBF A;  3V9U A;  4CF1 A;  3RR7 A;  4OKJ A;  3CD6 N;  4JKE A;  1WN7 A;  3ASM A;  4DTJ A;  1WSF A;  4PA1 A;  3LDO A;  2QI2 A;  1HKG A;  3ENH A;  1JLC A;  2IVO A;  4FLX A;  3L0Q A;  3HVT A;  2E1Y A;  4GV9 A;  4DF4 A;  3SUQ A;  3OYM A;  4OPH A;  3SZ2 A;  3V1Q A;  2P9N B;  4MO4 A;  3SQ2 A;  3R6M A;  2UYT A;  3UKR A;  1EWR A;  1BU6 O;  4X64 K;  4DV6 K;  3CJ1 A;  2E88 A;  3U6F A;  1NGH A;  4H5N A;  3CCM N;  2OPR A;  4KFB A;  4FLY A;  1SQK A;  2V52 B;  3THX A;  3MEC A;  4OGC A;  3TPQ A;  3TAF A;  4NO7 A;  4N41 A;  5CR4 A;  2E2P A;  1OVQ A;  2XY7 A;  2HNZ A;  4BR4 A;  3MK6 A;  1WSE A;  5FLX O;  1KQS M;  1VQO N;  5IT9 O;  3U9D A;  4DU4 A;  5IWA K;  4DG1 A;  2P9I A;  2FSK A;  3K5N A;  4DV5 K;  3VEY A;  3FLC O;  2P51 A;  4YOR A;  4YOW A;  4KI4 A;  3KD1 E;  2ITG A;  3BP8 A;  3IKM A;  4IZ9 A;  3VMF B;  2HST A;  3AA4 A;  3EL2 A;  2KQ2 A;  3MED A;  4HHT A;  5D3G A;  2QXL A;  3HBT A; 
#chains in the Genus database with same CATH homology
 3DLE A;  4DU3 A;  3VQP A;  4FJH A;  3HST B;  2ZE2 A;  3ZSO A;  5DK5 A;  1Z25 A;  1JLQ A;  1LWF A;  3PO4 A;  3IG1 A;  1HYV A;  3CM5 A;  4O44 A;  3HO1 A;  1CZ9 A;  1TK5 A;  4FLV A;  2PYL A;  4M3W A;  4CJK A;  2YNF A;  2G8F A;  4B8C A;  4CED A;  5E41 A;  2QKB A;  3DOL A;  3RWU A;  1NK5 A;  4IG0 A;  3O4N A;  3UIQ A;  3TAB A;  4PWD A;  1UWB A;  5EU7 A;  4HUE A;  4KAZ A;  4CCH A;  4E7L A;  2XY5 A;  3ZT2 A;  3KLE A;  1VSH A;  4KTQ A;  4FXD A;  4HTU A;  3SCX A;  3K2P A;  3HVR A;  1S1X A;  3ZT0 A;  4FJ8 A;  4W5R A;  2BGG A;  2DFE A;  2XRI A;  2VWK A;  1HJR A;  2W42 A;  4JRQ A;  3LZJ A;  4ELV A;  5C25 A;  3LAL A;  3QIN A;  1HNV A;  1KVC A;  2Z1G A;  1RT2 A;  3ITH A;  4CGF A;  4YFU A;  3HXM A;  1JL2 A;  1EP4 A;  3LAM A;  4NCG A;  4W5Q A;  1Z26 A;  5T7B A;  3LZI A;  4ZTF A;  2FBX A;  4JRP A;  1L3T A;  1IG9 A;  1U4B A;  1MU2 A;  4O55 A;  4EZ6 A;  3WNF A;  2YHA A;  4GW6 A;  1CXU A;  3RMA A;  4DLG A;  4F2S A;  3WNH A;  3SUP A;  1T8E A;  3KLI A;  4FJ9 A;  4KHY A;  2G8U A;  1HYS A;  1GOA A;  4YNQ A;  3ZSX A;  1NKB A;  2D0B A;  2GV9 A;  4K8Z A;  5HLF A;  3AVG A;  1VSK A;  4L8R B;  4RW9 A;  2D5R A;  1TV6 A;  1QS4 A;  5KI6 A;  4CES A;  4FJ5 A;  4H4O A;  4AHV A;  4DQI A;  4OLB A;  4FK4 A;  5HRO A;  3LPT A;  4BE2 A;  5FRN A;  2O4G A;  2BE2 A;  3HP6 A;  3WNG A;  4CJ3 A;  1R0A A;  1B92 A;  3TAQ A;  4KHW A;  3ISN C;  4FCY A;  2VG7 A;  3EY1 A;  5KGW A;  1FXX A;  4IBN A;  1NKE A;  1Q9Y A;  4MQ3 A;  3KKS A;  4RG8 A;  3LWM A;  4FM2 A;  4ZHR A;  2E6M A;  3ZSY A;  4DSF A;  3QEI A;  2DTU A;  4DTM A;  5K14 A;  2F8T A;  2XY8 A;  3DRP A;  4FK2 A;  1XHX A;  4JLH A;  3JYT A;  4NYN A;  3V1O A;  1LV5 A;  4IFV A;  3HPH A;  4CEO A;  4F3O A;  1RT1 A;  4FJG A;  4TSX A;  4MFB A;  4F2R A;  4Z4C A;  3KJV A;  1JLA A;  3IAY A;  4I2Q A;  3AVM A;  2HMI A;  4B8A B;  1BIU A;  1Q8I A;  4CER A;  4KI6 A;  2YNG A;  2QXF A;  3C6T A;  4CGJ A;  4CJ5 A;  3IS9 A;  4Y1D A;  4BDZ A;  1RTD A;  1YTA A;  1B9D A;  1YVU A;  5I3U A;  3K5L A;  1FKO A;  2GUI A;  3SV4 A;  3B6P A;  3KK1 A;  4E1M A;  2YV0 X;  4F3T A;  3VQA A;  1TL3 A;  2IS3 A;  2XHB A;  4FJN A;  1ZBI A;  1VSL A;  2IDO A;  3H08 A;  3PV8 A;  5KRS A;  1KLM A;  3ALY A;  4CIE A;  1U49 A;  2OZS A;  4NYF A;  4Z4G A;  1LAV A;  3OYJ A;  3QNO A;  1LW2 A;  4KHQ A;  1SKS A;  4NCA A;  1NK7 A;  4PUO A;  3P83 D;  4O0J A;  2YNI A;  4CGI A;  1SUQ A;  3V9W A;  1DLO A;  4KPY A;  3ZT4 A;  1EET A;  1I39 A;  3TAG A;  1QTM A;  4CHO A;  1U04 A;  3D45 A;  1NJX A;  4RW7 A;  4Q5V A;  1NK8 A;  3RMB A;  3CQ8 A;  4CJV A;  1TVR A;  4BE1 A;  4KO0 A;  3NH1 A;  3OYD A;  4FJ7 A;  5C42 A;  2GBZ A;  2A1S A;  3OVN A;  3S3N A;  4N76 A;  2IAJ A;  3LAK A;  4JS5 A;  4CF2 A;  2DY4 A;  4WE1 A;  4DWI A;  1SKR A;  1GOB A;  3DRS A;  3SUN A;  3K5O A;  4CHP A;  1IKY A;  3AV9 A;  4J2A A;  3AO5 A;  1XWL A;  3OYL A;  4DTR A;  1SL0 A;  4BWJ A;  3DI6 A;  3OS1 A;  4GMJ B;  4I2P A;  3M8Q A;  3MXM A;  2YKN A;  3RTV A;  3VQ8 A;  1Q9X A;  1VSF A;  5KTQ A;  2ZD1 A;  3CYM A;  3LP1 A;  1ASW A;  3NE6 A;  3PX6 A;  4FJX A;  1S5J A;  2P5G A;  3O3F A;  4FVM A;  4CJF A;  4G1Q A;  3V9S A;  4Z0U A;  2EX3 A;  4HCC A;  3V9Z A;  4CK1 A;  1NJW A;  3MAQ A;  2G8I A;  2B4J A;  4E7H A;  5CYQ A;  3OJU A;  4DSL A;  4CE9 A;  1RT3 A;  3AVC A;  4DFM A;  2XY6 A;  3C6U A;  1J53 A;  4QOZ B;  3NBP A;  3TAR A;  4DQQ A;  3NF8 A;  5J1E A;  1L5U A;  4FZY A;  1JLG A;  3V9X A;  4C8K A;  1JLB A;  2RPI A;  2P1J A;  3AVN A;  3OYK A;  4CJT A;  2Z1H A;  3ZSQ A;  3QIO A;  1IH7 A;  3ZT3 A;  2Q3S A;  1YTU A;  2KW4 A;  5FRM A;  3HYF A;  4O0I A;  1C1B A;  4BDP A;  4DTX A;  3DM2 A;  3KK2 A;  3RR8 A;  3HM9 A;  3O4Q A;  3MEG A;  4CJ4 A;  3WNE A;  2G8V A;  1RT6 A;  3SUO A;  1TL1 A;  2HHX A;  1A5V A;  5FDL A;  4M41 A;  3NH2 A;  4E7I A;  3E01 A;  3PX0 A;  3ULD A;  2WON A;  2OYQ A;  4I9L A;  4DS4 A;  4B9T A;  2OPQ A;  2Y1I A;  3AVH A;  4DQS A;  1KVB A;  3SNN A;  2PYJ A;  1JLF A;  1X1P A;  3L2Q A;  1UOC A;  1FK9 A;  1S9E A;  4QAG A;  4EP4 A;  3C95 A;  3U3Y A;  1UA0 A;  1ZBL A;  2X6S A;  1NK0 A;  3NF9 A;  4F4K A;  3SV3 A;  3OJS A;  1IKW A;  2OPP A;  1WLJ A;  3AO4 A;  3AVL A;  1A5W A;  3NGI A;  3SPY A;  2HHW A;  2JGU A;  4Z4F A;  4O5B A;  1IO2 A;  1WSJ A;  3VQ9 A;  4OGE A;  3TAP A;  1VRT A;  4KHS A;  3ZSZ A;  1C1A A;  4EP5 A;  3TI0 A;  4KRF A;  4IDK A;  4OVL A;  2IOC A;  1D5A A;  1KFD A;  4CEE A;  3LWL A;  1S1T A;  4B9N A;  2QK9 A;  4K8X A;  3QER A;  2HNY A;  4B08 A;  2HHS A;  3HP9 A;  1T03 A;  4FK0 A;  4UQG A;  3RMD A;  4PQU A;  4BWM A;  1VSI A;  1S9G A;  3LP3 A;  3AVA A;  3NGZ A;  4DLE A;  2NUB A;  3LAN A;  4M3R A;  1S1U A;  4CGD A;  4J2D A;  1QQC A;  4B3O A;  3ZSV A;  1CZB A;  3K5M A;  4DTS A;  1L3U A;  1SKW A;  5JS1 A;  1EXQ A;  4OKK A;  4CJE A;  3I0R A;  4CIG A;  4LY7 A;  1A5X A;  3AVK A;  1X9W A;  2DFH A;  1BIS A;  4KTZ A;  2FBV A;  2OPS A;  2KFZ A;  3QEW A;  3NHG A;  1RDD A;  3VA0 A;  1J5O A;  1YT3 A;  3VQB A;  4KHU A;  5JS2 A;  4JS4 A;  1I3A A;  1RDB A;  3OY9 A;  2Y1J A;  4M3Z A;  2FBY A;  4RW6 A;  1RT7 A;  4AHT A;  3I0S A;  1RNH A;  3NCI A;  4PY5 A;  2YNH A;  4CK2 A;  4LD0 A;  3DLK A;  1RT4 A;  3AVI A;  5SWM A;  1N5Y A;  4C8O A;  4NCB A;  1KRP A;  1TK0 A;  1XC9 A;  4I9Q A;  3TR8 A;  1XI1 A;  3HPO A;  2OZM A;  3HT3 A;  4M3T A;  1JL1 A;  1LW0 A;  4E0D A;  3VQ6 A;  3L2R A;  4CGH A;  3RRH A;  1TGO A;  5J2Q A;  2VWJ A;  1RTH A;  2RKI A;  3KKR A;  4LSN A;  4CJS A;  1S6Q A;  4DQR A;  1D9D A;  3KD5 E;  4KHN A;  2F8S A;  1JXB A;  2BAN A;  2Z1J A;  3M8R A;  1T7P A;  4EZ9 A;  4FM1 A;  4FJM A;  2E4L A;  3DLG A;  3FFI A;  2RN2 A;  4CIF A;  3OS0 A;  5J2M A;  3NFA A;  1W0H A;  4OJR A;  4BAC A;  5CZ1 A;  2IGI A;  4H4M A;  1L3S A;  4CHY A;  3OYC A;  1NOZ A;  4LSL A;  4BE0 A;  4KRE A;  3S3M A;  1BQM A;  3LP0 A;  1CLQ A;  4AHR A;  3AA2 A;  4CF0 A;  1NK4 A;  1BI4 B;  3QIP A;  5HRR A;  3DMJ A;  1KFS A;  1KTQ A;  3F73 A;  1ZYQ A;  3NGY A;  2JLE A;  2YHB A;  3HL8 A;  1WSH A;  1UAX A;  2HND A;  2XO7 A;  4FJI A;  2P5O A;  1D9F A;  3NH0 A;  4CHN A;  4ID1 A;  1GOC A;  3PX4 A;  2G8K A;  4FLW A;  4KB1 A;  4W5N A;  1S6P A;  2X74 A;  1RBR A;  3T3F A;  4FLT A;  4CK3 A;  1RIL A;  1J9A A;  4CHZ A;  1NKC A;  4IFY A;  1HMV A;  3V1R A;  1J54 A;  1JLE A;  4W5T A;  3OYF A;  3CFP A;  1BQN A;  4DF8 A;  3MXJ A;  3SQ4 A;  2G8H A;  3A2F A;  3C94 A;  4E19 A;  4W5O A;  2VG6 A;  1JXE A;  3B6O A;  2PZS A;  1NJZ A;  2X6N A;  4CFB A;  1U48 A;  3QO9 A;  4Z4H A;  2E6L A;  3AVF A;  2B5J A;  4CJP A;  1BCO A;  1HNI A;  1VSM A;  1SV5 A;  1EX4 A;  1ZBH A;  2G8W A;  1BL3 A;  4OPJ A;  4DSE A;  4FJL A;  1QE1 A;  3IRX A;  3PUF A;  1TKZ A;  1ASV A;  3HPG A;  4IG3 A;  3VN5 A;  4E7K A;  5HP1 A;  4RW8 A;  3SQ0 A;  4ELU A;  3CG7 A;  4CEB A;  1O1W A;  4F8R A;  4IKF A;  4Z4I A;  4FYD A;  5DMR A;  4R5P A;  3D0P A;  3DRR A;  3PY8 A;  1RBU A;  4ELT A;  2HVI A;  1C0U A;  3LPU A;  1RTJ A;  3QET A;  3QEP A;  1JKH A;  4KKO A;  4OPK A;  2HW3 A;  3L3V A;  3VA3 A;  3L8B A;  2F96 A;  1BIZ A;  3S9H A;  4OKE A;  2VG5 A;  3MXI A;  4AH9 A;  3O3G A;  2OA8 A;  3M8P A;  3MEE A;  2YKM A;  4E1N A;  1BCM A;  1DTQ A;  4DSJ A;  4AHC A;  2RF2 A;  3DLR A;  4N56 A;  3TWH A;  3VQQ A;  4C8M A;  4DS5 A;  4QCL A;  3TAE A;  4HUG A;  4DFP A;  4FW1 A;  3T19 A;  4CEC A;  4DFJ A;  1K6Y A;  2R7Y A;  3U3G A;  2EHG A;  1LWE A;  4AHU A;  3AA3 A;  4FZX C;  1LWC A;  1WAJ A;  4E3S A;  1X9M A;  2BDP A;  3VQE A;  1LAW A;  3K59 A;  4E89 A;  4J2B A;  4FLZ A;  3SYZ A;  2Z1I A;  2DFF A;  1QSS A;  1RDC A;  3HK2 A;  4DFK A;  4H8K A;  3V4I A;  4Z4E A;  1NK6 A;  2ZQB A;  1L3V A;  4CFC A;  5CY4 A;  4M3X A;  4CGG A;  1RCH A;  4XIU A;  2PY5 A;  1RDA A;  4M3Y A;  1KVA A;  3OYE A;  3EYZ A;  1TKD A;  3I8D A;  4DMN A;  4M45 A;  1U45 A;  1HQE A;  3EZ5 A;  4Y1C A;  3BGR A;  3SJJ A;  3ZT1 A;  4DTO A;  4M3U A;  2D0A A;  2KZM A;  4Q0B A;  5SZT A;  2IC3 A;  1Y97 A;  3KIO A;  3SPZ A;  1REV A;  3AVJ A;  3AO1 A;  4DTN A;  1QSL A;  3OYI A;  4HUF A;  1C0T A;  5CZ2 A;  1IKX A;  3OYA A;  1CXQ A;  3KK3 A;  2O4I A;  4J2E A;  1G15 A;  4KTW A;  5I42 A;  4CJW A;  4LH4 A;  3AA5 X;  3JSM A;  1TKT A;  1B9F A;  2ATQ A;  4KB0 A;  3K57 A;  1KLN A;  1VSE A;  3NF7 A;  3QLH A;  4DSK A;  3AO3 A;  1KSP A;  3NDK A;  3NF6 A;  3G10 A;  4HVJ A;  1NJY A;  2FC0 A;  3CM6 A;  4FW2 A;  1VSD A;  1BI4 A;  3ZCM A;  3TAN A;  4FJJ A;  2WOM A;  4CEA A;  4I7F A;  3KLH A;  1EKE A;  4AIL C;  3S3O A;  5FRO A;  1XHZ A;  4GVM A;  1SL1 A;  1HPZ A;  4O4G A;  3DLH A;  3LP2 A;  1TAU A;  1C1C A;  1NOY A;  1F21 A;  4CJU A;  4C8N A;  3L3U A;  1QHT A;  2HHV A;  3KTQ A;  3M8S A;  2ETJ A;  2LSN A;  3L2V A;  4E7J A;  5J2N A;  3KLF A;  3F9K A;  3VQC A;  3QEX A;  2D0C A;  4B9S A;  2KFN A;  1BHL A;  1C0M A;  1TAQ A;  1ZBF A;  4CJQ A;  4CF1 A;  4N5S A;  3V9U A;  1DTT A;  1U47 A;  4B9M A;  4B9L A;  3DOK A;  3TAM A;  3RR7 A;  2FBT A;  4N47 A;  5C24 A;  1C6V A;  4OKJ A;  4CEQ A;  4CHQ A;  2HHQ A;  3BDP A;  3RRG A;  1WN7 A;  3SQ1 A;  4B9V A;  4C8L A;  2AJQ A;  3ASM A;  2HVH A;  3QES A;  3VQ5 A;  4DTJ A;  3AO2 A;  1WSF A;  4OLA A;  4PA1 A;  5CYM A;  3VQD A;  4FJK A;  3AVB A;  3L2W A;  4ICL A;  4KV8 A;  1RTI A;  4FZZ A;  4DTU A;  3HJF A;  4CEZ A;  1JLC A;  4FLX A;  4DSI A;  1N6Q A;  3HVT A;  3PO5 A;  1FKP A;  1BGX T;  1SL2 A;  1ASU A;  1KCF A;  3OYH A;  3VQ4 A;  1HQU A;  3QEV A;  4DF4 A;  4DQP A;  2HHT A;  3OYG A;  3OYM A;  3SZ2 A;  1ITG A;  3SUQ A;  1TK8 A;  1T05 A;  3V1Q A;  4CF9 A;  2KZZ A;  1X9S A;  5HRS A;  3VQ7 A;  1VRU A;  3SQ2 A;  1VSJ A;  3OS2 A;  5KRT A;  1NK9 A;  3L2U A;  3DYA A;  2KTQ A;  1IKV A;  2B6A A;  4HCB A;  1RBT A;  1RBS A;  4CFA A;  3U6F A;  3V6D A;  4LH5 A;  4B9U A;  4AHS A;  3P1G A;  1TKX A;  2A1R A;  1HRH A;  4CJR A;  2OPR A;  1WSG A;  2X78 A;  4KFB A;  3OYB A;  4DU1 A;  4FLY A;  3KLG A;  5HRP A;  3NAE A;  3MEC A;  4OGC A;  3T1A A;  3TAF A;  1D8Y A;  1RT5 A;  3RMC A;  4CFD A;  3O3H A;  3G0Z A;  3SI6 A;  4N41 A;  3CFO A;  1WNS A;  3K58 A;  3DLB A;  2XY7 A;  2HNZ A;  2HHU A;  1HYZ A;  1WSE A;  4RW4 A;  4CJL A;  5KGX A;  3P5J A;  3QNN A;  1S1V A;  1S1W A;  2I5J A;  5J2P A;  4DU4 A;  3THV A;  4DTP A;  4DG1 A;  4ZTJ A;  1RBV A;  5HRN A;  4FM0 A;  2HB5 A;  3K5N A;  4CF8 A;  3ZSW A;  2P51 A;  3ZSR A;  4CEF A;  3OYN A;  1UA1 A;  3LDS A;  4KI4 A;  4BDY A;  3KD1 E;  2ITG A;  1VK0 A;  4ID5 A;  3AA4 A;  5HBM A;  1ZBU A;  3V81 A;  1W9H A;  4FLU A;  2KQ2 A;  3MED A;  4HHT A;  1WAF A;  3CFR A;  2QKK A;  1WSI A;  5D3G A;  1QSY A;  4M42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...