5KS2A

Rawv_ctd (helix form) of 16s/23s 2'-o-methyltransferase tlya
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
209
structure length
209
Chain Sequence
RAWVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYFLWLRTQTDRALSAKGLEDAVHRAISEGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Motif for S-Adenosyl-l-methionine Binding by the Ribosomal RNA Methyltransferase TlyA from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
total genus 64
structure length 209
sequence length 209
ec nomenclature ec 2.1.1.226: 23S rRNA (cytidine(1920)-2'-O)-methyltransferase.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ks2A00
3PVCA 3KQMA 3CC8A 1Q0SA 3B3JA 4IV0A 3CJRA 3HVHA 5FHRA 4BY9E 2QRVB 3GRUA 3EEYA 3BXOA 3PX2A 1XCLA 3UJDA 1DL5A 1VQ1A 3MCZA 4A6EA 3EEOA 5KQRA 2HR1A 3NMUF 3KPVA 3QOWA 3BWMA 4PIMA 4E30A 1RJEA 5E1MA 4YUZA 2BR4A 2I62A 4RTLA 1F38A 2H1RA 3GXOA 3KU1A 5H02A 2P35A 3LKDA 3MAGA 3SSMA 4YUXA 4GOND 1MJFA 2GAFA 3G2MA 5EOVA 5GIOE 3R24A 4QQNA 3FPJA 1KR5A 3MERA 5EMLA 3G2QA 5EPEA 3FTCA 3NVMB 1P1BA 4G56A 5K03A 4A6DA 3G8BA 2HMYB 1L3IA 1JQ3A 1X1DA 3UJAA 4MQ4A 5M5BA 1NKVA 4YV2A 1D2CA 4GC9A 1JG1A 3O4FA 3PS9A 2H00A 5F2NA 3JWJA 4QVKA 2PX5A 3DR5A 3MQ2A 3HCBA 2ZLBA 1JTFA 2P7IA 5FQOA 2GA9A 2P7HA 2HV9A 4C03A 5DM0A 3UZUA 4EKGA 3DH0A 3TKYA 1JG3A 2I7CA 1M6YA 2IH5A 4PONA 3X0DA 2HWKA 3ANXA 3DTNA 3G2PA 4BLUA 2EG5A 1KPIA 1WG8A 3C6KA 3AXSA 2DPMA 3I5UA 3KKZA 4PGHA 1ZQ9A 4EMSA 1R8YA 2ZZNA 1ZKDA 3C6MA 3CJTA 3BWCA 4AZTA 1B42A 3R6TA 3LECA 2FCAA 2PWYA 4ZTBA 2PX2A 2CMHA 3FUWA 5CUQA 2AOWA 2YUIA 3FPHA 1EJ0A 2G72A 5K0GA 2JJQA 1NE2A 3OU2A 4BP1A 3S68A 4V0RA 2IDKA 3B7PA 2PX8A 3F4KA 2Q41A 1QAOA 5LSAA 2WA1A 4M37A 5ICCA 2ZBRA 3LGAA 2UYHA 3NWBA 5GWXA 3BKXA 5GOZA 2B78A 3P2KA 5D1NA 5DSTA 3BWYA 4E33A 3LSTA 3ELYA 2FHPA 3AXTA 3LDGA 5BXYA 4AZVA 3ELWA 3HTXA 4GBED 1R8XA 1RI2A 2PVCA 5K0JA 5K0BA 2OKCA 3MGGA 5FHQA 3GRRA 3HVIA 3LBFA 4FS8A 1JSXA 5DM2A 2B25A 3OZTA 2P8JA 4LWPA 3UFBA 2AOUB 1KHHA 3H2BA 2ZIEA 5EGSA 3KQSA 3LL7A 2BM9A 1DCTA 2IBSA 1IXKA 4E70A 2JHAA 3Q87B 1VLMA 1L3CA 5FWDA 5C0OE 3DOUA 3I53A 4R6WA 5HIJA 3PFHA 2NXJA 3PFGA 4X63A 2GS9A 4PIPA 5FQNA 1G8SA 4EVIA 2PGXA 2QE6A 2G1PA 3TM4A 4GOOD 1YFJA 2XYVA 4YUWA 1Y8CA 2EX4A 3IHTA 3BGIA 3IEIA 4PCAA 2A14A 2PBFA 2R6ZA 4E2ZA 3ME5A 2CL5A 3OE4A 3C0KA 4DA4A 3NTVA 3B3FA 5CVJA 4YUVA 3AJDA 3T7SA 2E5WA 2PXCA 3JWGA 1RI1A 4OA5A 1JQEA 1AV6A 2VP3A 4GOMD 4K6MA 3LPMA 5T64A 2B9EA 1R6AA 1AF7A 2BR5A 5ICFA 2QRVA 4HG2A 3E8SA 3FZGA 1JQDA 4P7KA 4QTUB 3VYWA 4R05A 4P7GA 3NDJA 3A27A 2UYOA 5KVAA 1DUSA 5DTRA 3BGVA 4RTJA 5GIPE 2JHPA 3VSEA 2IIPA 2IP2A 3A26A 3AY0A 3HA7A 3DULA 4GUAA 4X60A 2V7EA 4AUKA 5DPMA 2AOTB 1ORIA 2AOTA 2OZVA 5KYGA 1QAQA 4EQZA 3V97A 3SMQA 4CXMA 4PYNA 4OA8A 4KIGA 4PGGA 3RODA 4RSRA 1YFLA 1ZGJA 4GOLD 3GWZA 4FGZA 3T0IA 4HGYA 4ER6A 2I9KA 3NVKI 1Z3CA 3HVKA 1G60A 3LKZA 1I4WA 3EVDA 3T7TA 2ZCJA 5CCBA 1NBIA 3B5IA 3KR1A 9MHTA 1TW3A 3REOA 4M38A 2FRXA 2CKDA 4MIKA 4BP3A 1YZ3A 1RI5A 1YUBA 4XUEA 5EKXA 5C9ZA 5LR6A 1SVUA 2ZWAA 4OBXA 3OU6A 1OR8A 3G88A 1KYZA 1N2XA 4MWZA 3CBGA 3ER8A 1U2ZA 4R8SA 3SSNA 3GIWA 3I9FA 3P9CA 4DKJA 3LCCA 3VC1A 4DZRA 5E8JA 3TOSA 3K0BA 1QYRA 2ZTHA 1FPQA 2LD4A 5HZMA 4KRGA 4OQDA 4V0QA 4HSGA 1ZHFA 5DM1A 3GRYA 4FSDA 2ZIFA 1AQIA 1JR4A 1F3LA 5CVEA 1VL5A 1O9HA 3M70A 3UWPA 4ER0A 5DRTA 2UYQA 2JH9A 5LQJA 1MHTA 1FP1D 2GLUA 4QVGA 5DLYA 5EMMA 3KPYA 3HCCA 1NBHA 2OPBA 3ER9A 2ZULA 2PY6A 3M6VA 4P7FA 5CM2Z 4B17A 1P91A 2AOXA 3SSOA 3DLIA 3UJCA 2O57A 1SUIA 3GGDA 3UJ8A 3IV6A 1RJGA 3FUXA 4PCLA 1ZGAA 3G89A 3EVGA 4E2YA 4QDKA 2OO3A 3KQPA 4RVFA 1NV8A 3G8AA 2IGTA 1O54A 4OX9Y 5E1OA 4QPNA 2K4MA 3EGIA 5CIYA 3G5TA 1ORHA 3UA4A 5IKMA 2P40A 1XVAA 3MB5A 4JXJA 5DXAA 1RI3A 3A25A 5MHTA 3TRKA 2FYTA 3HA3A 5FTWA 3LHDA 4RVDA 4O29A 5HEKA 2NXCA 2PXXA 3HM2A 4M36A 1D2GA 4QQKA 5FA8A 4YV1A 4F85A 2ERCA 5K0FA 3UJ7A 2OY0A 2ZBQA 3NJRA 3KQTA 2Y1WA 1BKYA 4XUCA 4BLVA 4R6XA 2ONZA 4DCMA 3CVOA 3SXJA 5E9WA 1XDSA 3MTIA 3EVFA 3M6WA 4LG1A 2VZ9A 3KQOA 5E2AA 5F2OA 3OFJA 4GEKA 3G5LA 3R9XB 4Y2HA 4DCGA 1QZZA 4HRAA 3EVBA 3IYLW 4E31A 4FR0A 3WSTA 3R0QA 4CKCA 3KQYA 3FUTA 1YF3A 3BT7A 4M7RA 5EC8A 2AR0A 3D2LA 4F84A 2VDVE 3KQQA 3LBYA 5DWQA 7MHTA 1FP2A 4H0NA 2IH4A 3FTFA 2ZW9A 3BZBA 4C4AA 5IH3A 3GRVA 1JTEA 2VDWA 5K01A 5K8VA 3RIEA 1H1DA 1KXZA 2JG3A 3HCAA 2EJTA 1VBFA 4CTJA 2C7QA 1VP3A 2B2CA 3A4TA 1BC5A 1P39A 1TPYA 3EMBA 4RYLA 1L9KA 1XCJA 2FPOA 1VP9A 2QYOA 1VIDA 4LWOA 3GRZA 2F8LA 3EMDA 4WVLA 4KW7A 3THSA 5BP7A 1KIAA 5FA5A 5GP1A 5HIIA 2NP7A 1X1AA 3TKAA 3AWIA 4ISCA 5U4XA 4GF5A 3L8DA 3DXYA 2Z6QA 2ZFUA 4R8RA 5FCDA 4C05A 2GB4A 4GC5A 2YQZA 4PYMA 4IV8A 1KP9A 3RW9A 3EVEA 4XCXA 1QAMA 3KQWA 3MHTA 3GDHA 4FSXA 2OBFA 2PT6A 4BLWA 2KW5A 5EHGA 4CKEA 4DQ0A 5KQSA 4FP9A 3KHKA 3P9KA 5HIKA 1UFKA 3BUSA 3KR0A 1IY9A 4RTOA 5EIFA 4F86A 2IH2A 3ERCA 2O0LA 2AOVA 2YTZA 3K6RA 3OE5A 1X1BA 3DUWA 3PX3A 4PYIA 5CVVA 5DX1A 1N7JA 2EJUA 5EEHA 5FULA 4RWZA 1L1EA 3GJYA 3EGEA 3JWHA 3NWEA 4DM3A 5LQRA 4NECA 4OQEA 4PYJA 3UJBA 5FWAA 4HTFA 5E1DA 4RTSA 2GPYA 3A7DA 4ER3A 4RTPA 4HC4A 1YZHA 4QTTB 2HNKA 5E8RA 5E1BA 4QDJA 3P71T 2PXAA 3NDIA 5HOQA 2V74B 1VPTA 4GQBA 3B3GA 5DX8A 2BH2A 3G7UA 1EAMA 2O06A 2BM8A 4UOEA 2UZ4A 2Z6UA 5KS2A 2YXLA 3HA5A 1JSZA 2AN4A 2PJDA 3HNRA 3I64A 4L7VA 4C04A 1NW3A 5GM2A 5K0CA 5CCXA 2C7RA 2BZGA 5EZSA 4C06A 3EVAA 5B1SA 3PT9A 3U81A 1NW6A 2P41A 3DMFA 2ORED 3TLJA 3FUUA 1T43A 1KYWA 2OB2A 2IDJA 1WY7A 3DXZA 4WXHA 5E2BA 3G2OA 3BKWA 4E2WA 2ZZKA 2OXTA 1O9GA 3BWBA 3CJQA 4PYLA 4KDCA 4E32A 1R00A 2OYRA 5JR3A 3T7RA 2P1DA 2PT9A 3DMHA 4YUYA 4PYKA 1KPGA 3CCFA 3GO4A 1INLA 3P8ZA 2IPXA 2YVLA 3HCEA 2I6GA 4KVZA 5C1IA 3V8VA 4AZWA 4IKPA 5LQKA 3KR2A 5DSXA 4RVHA 5GM1A 1SKMA 1WS6A 1FJXA 2ZWVA 5D1HA 2IBTA 4YV0A 1JG2A 1FBNA 5EKUA 5P8WA 3CGGA 1X1CA 4PYQA 5T6BA 4RTNA 4E2XA 4LECA 4EKIA 1EQAA 3LX6A 1BHJA 2CMGA 1D2HA 5DTMA 5EEGA 5K05A 1PRYA 3EPPA 4RX1A 4PWYA 2AN3A 5E9JA 3JWIA 2G71A 3CKKA 5DRYA 4ER5A 5ICEA 3O7WA 3ID6C 1EG2A 1ZG3A 2XVMA 3E23A 2H11A 4C07A 2P3QA 1X19A 3M4XA 4P58A 2B3TA 2PX4A 3I58A 3QOXA 2PLWA 4CKBA 5K09A 3LCUA 3TR6A 3FPFA 3P2IA 4IWNA 1L3BA 2Y1XA 3E7PA 4X1OA 1RJDA 1EJ6A 5K0NA 3HP7A 1Q0TA 1HNNA 5EZQA 1VE3A 2NYUA 4DMGA 4KIFA 3TQSA 2Z6AA 2JHCA 1UWVA 2NXNA 1M6EX 2P3OA 2XYQA 5EMJA 1WZNA 5EQJB 2PSSA 2XYRA 3OZRA 5CVDA 1NW8A 3MCTA 3R3HA 3TPZA 1RI4A 3OZSA 1R18A 2FK7A 3DLCA 2BR3A 1HMYA 4Z2YA 3SVZA 2ONYA 3ELDA 2C7OA 3FRHA 4QPPA 4RTQA 2O07A 3UBTA 3M33A 2EFJA 1SQFA 2NXEA 4AZSA 2ZZMA 1NW5A 3FRIA 1IM8A 2JH8A 4Y30A 5DT2A 4ATNA 1NV9A 3LDFA 5FUBA 2IFTA 2FK8A 2YR0A 1EIZA 5LQAA 2YXEA 2VS1A 5EMKA 4YMHA 1BOOA 2AVNA 3M6UA 3C3YA 3P2EA 2DULA 4MTLA 1R74A 2OB1A 1I1NA 3ELUA 4OBWA 5CVUA 2AZTA 3P97A 5LQNA 4RTRA 4EK9A 4FT4A 5HILA 2ZBPA 4PYOA 1XDZA 5BW5A 3ORHA 1RJFA 3LCVB 3C3PA 5G02A 3GU3A 1KPHA 3GCZA 2ZIGA 5DX0A 3UJ9A 4FT2A 4X41A 3GNLA 3DMGA 4U7PB 2YXDA 1QANA 5F2KA 1N7IA 2G8NA 2UYCA 5ICGA 5DXJA 3KPJA 3NW9A 3SGLA 3EGVA 3KR9A 3THRA 3TMAA 3BGDA 1PJZA 4CTKA 4RTKA 2WA2A 2ZVJA 5EHIA 2QY6A 1G38A 3HEMA 2NNWB 3KPUA 3VC2A 2C7PA 2NP6A 2ZSUA 1SG9A 2AOUA 2AS0A 5DTQA 5T67A 3P9NA 2ESRA 5EG5A 3EVCA 1XJ5A 2WK1A 3HVJA 2AVDA 1XTPA 3TFWA 2XBMA 5E9QA 1WXXA 4RVGA 2G70A 8MHTA 3TM5A 5EIWA 1TW2A 3EVZA 5FADA 3KPWA 1V39A 4ER7A 3FTDA 3PTAA 3FYCA 5LQUA 4YMGA 1SQGA 1M0EA 5EVJA 3PLAE 2ADMA 5K0EA 1JG4A 4AX8A 2XVAA 1NW7A 5GINE 3M6XA 2GH1A 1G8AA 3OCJA 1XXLA 2PKWA 1P1CA 3FYDA 4U7TB 3FUVA 3A7EA 1SUSA 2P3LA 2CWWA 5K0LA 3FPGA 2O05A 2VDUE 4PNEA 3UJ6A 3PB3A 1WXWA 3MTEA 4HGZA 3SX0A 4RV9A 5CD1A 2R3SA 4CWAA 2YX1A 3FTEA 4KDRA 5JUWA 2QM3A 4HH4A 3SR4A 5LQCA 4RTMA 1XDUA 5HIMA 4XUDA 2PV0A 2N47A 4X61A 4HTFB 3DP7A 3P9IA 3OPNA 5HFJA 2PWPA 1G55A 3FPEA 4PINA 3SM3A 4DF3A 3QV2A 3B89A 1G6Q1 3HCDA 4FZVA 4POOA 1I9GA 1AQJA 3HCFA 4C08A 3O31A 5BW4A 2HTEA 10MHA 5DM4A 3UA3A 3E05A 4P7JA 4MHTA 3KQVA 3Q7EA 3OFKA 3DXXA 3LDUA 1NT2A 4KWCA 3OU7A 1YB2A 2AN5A 1UIRA 5ERGB
chains in the Genus database with same CATH superfamily
4WTOA 4OQLA 1IL0A 5D84A 2DBRA 1N3BA 4MA4A 1S2MA 5HJ2A 3ZGNA 1KBQA 3C3BA 2O3TA 1ACJA 3WOHA 3GRUA 5IH7A 1GSOA 2RHOA 5JANA 4QEKA 1UP7A 2CGEA 1SBQA 2FUG1 5A4KA 1P19A 3WO0A 1DL5A 4EM6A 5JI3E 3NETA 4X1KA 2HEGA 3KPVA 4NQRA 4X85A 3RC3A 3U9TA 4CG0A 2IVZA 5A5FA 1V5WA 2DUNA 4XCQA 1JMKC 4DANA 4JP2A 2WSBA 4JC8A 3SSMA 4DQDA 1K6JA 1Z4LA 3D7RA 5DISB 3LQRA 4MS3B 4N12A 3ND8A 4ZOEA 5NLLA 3DV0A 5B57C 2PGLA 4TS1A 2YIJA 4IDNA 3DJYA 3QTBA 4YO8A 3MUFA 3RC9A 2D6FA 2EGGA 3CPHA 2J3QA 2OQIA 3W8EA 1X1DA 2CE2X 3BRWA 1QLWA 2YCLA 3FY4A 5EE5B 5EUMA 1G42A 3T3EA 1NE7A 1J0DA 4RIHA 2IEYA 4B09A 2H51A 2GN8A 3ADPA 3SM9A 3BWVA 1UXOA 1XFAA 2W6JD 3CNLA 3V3KA 3I0NA 4YWHA 2ZYUX 1Y9ZA 2GYWA 3I1FA 1GG8A 1KETA 1UDXA 1NDUA 3GUCA 1MVLA 2B82A 2GBIA 2ZYHA 3KALA 1YJ8A 3W0LB 1LPBB 1Y1SA 3KCNA 2QRJA 4BLUA 5B3LA 5TLSA 4YPVA 2VRCD 5DCYA 3X1YA 4AY3A 3CT4A 3JQFC 5FF9A 3AUAA 4HWTA 4EF6A 2GCPA 4OI1A 2ZRMA 2ZZNA 1E2MA 4J7UA 3GDFA 5TGZA 1LRJA 2VTDA 4EARA 3T3MB 5ECGC 4NJMA 2OYSA 4DSTA 1MC1A 3AHJA 3COZA 3DWFA 3G17A 1IUPA 4L7QA 4UTXA 3TPCA 1WX1A 2XECA 2IXEA 3SC6A 4AYXA 4RZIA 3RADC 4GH5A 5LMUB 2ZSJA 2Q2WA 2Q6OA 1GZ5A 2HQRA 1RCUA 2WP0A 4YO7A 4ZWNA 4P2BA 3LGAA 2K7FA 1FDSA 3DNPA 4Z4HA 4O59O 4MUXA 3X1KA 3V5NA 4ZT4A 4BVBA 1IU9A 4LNHA 2WKQA 3CHYA 1JAXA 4PAOA 2CVPA 2QP9X 4Q7KA 4J1TA 1ZUIA 3WV5A 4MUNA 1A27A 2W6CX 4OHVA 2QDXA 4MKZA 2RBEA 3T5DA 5IHPA 4ZCMA 3BMOB 3UH1A 1OW3B 3HSSA 3KVVA 2F55A 3U16A 5FOXA 5ITWA 1U4SA 4LNAA 2QI9F 4MUYA 3IBGA 4O5OA 4UMFA 1AKNA 4DSNA 1T4GA 3EWAA 5FWYA 3JQ9C 1GTG1 1OWLA 4RQBA 3M49A 4EUEA 3IQIX 2Q4TA 4TVSA 2IBSA 1VI2A 2QLBA 3WQHA 3DL0A 4G1UC 3DOUA 4IUCS 1TJ5A 4R98A 5G4KB 1HRKA 1OKKA 1MC8A 2YOGA 1NKSA 2WINI 5BWCA 1FU8A 3P94A 5HUHA 5JQGA 1ZR4A 1ZK4A 4MZDA 3NHSA 1WMBA 2FOXA 2YV3A 1N32B 3GT0A 5JPDA 1YFJA 1XLTC 2I22A 4LCJA 4P32A 2B6HA 3M5WA 3U3MA 3F97A 4EG4A 5TT1A 5JOQA 1IWPB 1EDBA 1Z5UA 2AUNA 2R6ZA 3D0OA 3IEIA 3RT9A 5B53A 3ZQUA 3IESA 5JTUA 3OE4A 5LN1A 4S35A 2F3TA 3PDIA 2E5WA 2I65A 4FDTA 2IHYA 2ZJ2A 1NVWQ 4DIKA 4K6MA 3PUIA 4XYMA 1UC5B 3LVQE 3TLGA 3U44B 2B9EA 4PU0A 1IATA 3S1SA 3PJRA 1TI7A 1YQTA 1S89A 2EQBA 4Q82A 3PNMA 4OP3A 5IVPA 2VHZA 3AESA 1DUSA 3QPAA 2BF7A 1A8QA 4Q15A 3KUXA 3LP8A 4KV9A 1I6MA 2BZ0A 2P3SA 3MZ0A 4MICA 4UDYX 2Y0PA 5LLSA 1L5HB 5HIAA 1SEVA 2WIBA 3ZWMA 4DJEC 2OE2A 3OFND 1DAHA 3E61A 2V9CA 1ORIA 2ZRGA 3BRSA 4EUSA 1VXOA 3SC3A 1D1TA 2DGDA 4MRMA 3L77A 5I45A 3KKKA 5K1ZA 2Q29A 4DDHA 2DPXA 5A1JA 2HJHA 1GKYA 3OZDA 2YVQA 2V0CA 1Q7GA 4JWTA 2PO7A 4OHZA 2AGVA 1YQQA 3QU5A 3LUJA 1N1DA 4QPDA 4ZOLA 2H2IA 4GX1A 2W8BB 2ZTLA 1U2DC 2X77A 2YN0A 4DJTA 2PBZA 3KR1A 2F1KA 3GZNA 4I5IA 4CIVA 2FUNB 3FROA 2BDUA 3OKFA 2PFSA 1QP0A 4RLQA 3CLSC 3UAYA 5DGIA 1COWD 4MV4A 3ZX4A 3KQUA 1WAMA 4NCHA 4QGBA 1EP1B 1NVBA 1S3SA 2GF0A 2BFFA 3DVRX 3NVAA 5CFQA 2X6TA 4KLRA 1E2HA 4OXIA 2HCRA 5TPZD 4ANFA 1CUGA 4JQZA 1BU8A 4GD3Q 4ZVQA 3QLVC 3WL8A 1GZ3A 1X7WB 3IMFA 3QYJA 1A1VA 1L1QA 1EE9A 1L5OA 2A9JA 2NTVA 3BE4A 3ECCA 4LWZA 4BVAA 3I52A 3AIMA 3QOYA 5H4GA 2HCTA 2Z08A 4KH0A 2V5VA 1YB7A 1E1QD 1E58A 2QJOA 3Q10A 4HGPA 4JBHA 4BRZA 2OPBA 2XCOA 1TUIA 4O8CA 5BR4A 1P91A 2BWJA 5F3WB 1V9SA 4HVTA 5KVCA 1M67A 3QX3A 3UJ8A 3LX8A 3N8GA 4HATA 1XFDA 2O8BA 3X1WA 2W71A 3NO4A 1N6OA 3RRYA 1EBBA 2XZLA 1XRNA 2FQQA 4GQAA 2ZJFA 3IDSA 2X8JA 3OEYA 4IIVA 4JR0A 3NKFA 3K1JA 3L0DA 1RAGA 4X94A 2C5AA 3IAFA 4Q34A 2VDKB 4PZYA 3Q2KA 3O9ZA 5AI9A 1DTWA 3FNQA 1UBMS 1ENZA 3S8MA 3LHDA 4MW1A 5DT9A 3WS7A 5FPSA 1YI1A 2J87A 3W05A 5KTPA 4CEJB 4C0BA 2QDKA 3BMXA 2YZ7A 3JQPA 1E20A 3GAAA 5IF9A 3WBKA 1TDJA 3ZD9A 3I6IA 3AQ4A 1R4NB 3DOCA 3H1TA 4U7FA 2IXTA 3ROFA 3ZHCA 1MB0A 3EVFA 4IFBA 4O2RA 1RXEA 2YC2C 5K9ZA 4ZZIA 1YUNA 4C4ZA 4A7PA 1Z0SA 4ZA2A 4G0UA 4A8JB 1CB7A 3FMPB 1SBTA 1SBNE 4LY9A 2H63A 1LH0A 4AF8A 3BSSA 3R7SA 3UT5A 4K0KB 4WDRA 3VSBA 1Q14A 4M9UA 3JD3A 2HIMA 2NMVA 1JG7A 2R87A 2X8AA 5DYYA 2XMCA 1C41A 1JTEA 2VDWA 2WILA 3CCCA 4U6NA 5FOSA 1QRTA 2V54A 5L3ZA 5C1BA 1KDOA 2IZZA 3O4JA 1GLGA 2EJTA 1HNZB 2C7QA 2JEZA 4OHOA 4UNSA 1G7RA 4D5GA 1H2FA 1HDGO 5FBHA 3N8HA 3DO8A 4UASA 1XO1A 2Q4RA 1XCJA 1I3NA 1I4OA 2J3MA 2QYOA 3PLRA 4LPKA 3EMDA 1PCXA 1TZ2A 2PR7A 2GARA 4LRTB 5EA2A 2UKDA 4MKXA 5BP7A 1FYFA 4M1MA 4WZ6A 1U9IA 1GTMA 1HE4A 1JSLA 1WXEA 2VP6A 3H13A 5CTJA 3AWIA 4OBBA 3LPAA 1XKTA 1KAQA 5FPPA 1XTRA 4C05A 4ZICA 4QKQA 5FTLA 1WBJB 4IUBS 5BOSA 3Q5GA 5HXAA 3C7CB 3JRXA 5K3EA 5I8WA 2BGTA 4AJ4A 4M1EA 5JQGB 4ILEA 5F51A 2VTBA 4OQPA 1DWQA 3IPCA 3MHTA 4BMZA 4RMJA 3WYBA 3DBHB 3RANA 4II7A 3D6VA 1KI3A 3ZJTA 5FAXA 4JLSA 4RU1A 4CKEA 4YFYA 3ZTYA 1SD1A 1YI8A 3LLCA 2H4ZA 2JCVA 1NOJA 3PQ2A 2ECPA 2C0QA 3D8BA 5ALNA 1C4XA 1OFTA 3K6RA 5CYFA 3VI4B 4C87A 1DKPA 2B8WA 5KC8A 1N1GA 2BE7A 2TMGA 4LGCA 5EIEA 3NWEA 4CMEA 5G0TA 5LQRA 4HZGA 4KN9S 4RS4A 4Q1EA 4BWYA 1YZTA 4AKIA 3NQ41 1E3DA 4QE3A 4URHA 4P4UA 4WD3A 5E8RA 4KR2A 1UM8A 5CM8B 3ZXXA 2I6UA 1Z0ZA 2ADOA 3LUDA 1I3CA 1WO8A 2BM8A 1GAXA 4S3MA 1KYQA 1Z18A 4GEGA 5AVKA 2OT3B 1JSZA 2AN4A 2PCJA 3AOEC 4M1YA 3RS0A 3C1OA 1IN5A 1V4BA 2O5CA 2Z1MA 1H2AS 3MLEA 3PXBA 3N74A 5I7HA 5JU6A 4C06A 1JQBA 4YLGA 2JS7A 4TS9A 1N3IA 2ZI6A 4M99A 4JZKA 3H9CA 3OQOA 1LLDA 2CBZA 1KARA 4LYYA 4YGYA 3ENNA 3VTKA 3AJRA 1KYWA 4QECA 4HWPA 1ZM7A 3H8WA 2QIOA 4PY2A 3KAPA 3V80A 2AFVA 4E32A 1NKTA 2VTEA 5FUMA 4BDTA 1V37A 3UKDA 4IHKA 3GEHA 4YEDA 1I30A 2NUTB 4J6EA 3LU1A 4QAQA 3GDGA 3V8VA 1RABA 3A1DA 4J43A 1FJXA 4JQOA 1JI0A 1JWLA 2OBMA 5EKUA 3CGGA 1X1CA 3EXHC 4TTQA 1KH2A 3PNPA 4MUEA 3AEKA 2PQ6A 2C59A 4H3KB 2A35A 3VO1A 2IHUA 2WZCA 3FX2A 1PRYA 1CIJA 4BKQA 4EJFA 3G5UA 5CCDA 4R40A 2GN0A 3V1YA 5TQJA 1Y8RA 1T4CB 2EEPA 3ID6C 4BEBA 2WKSA 2F8MA 1U11A 4CDMA 1DELA 2H1CA 1Z2CA 2CHQA 2ZQ5A 1P9OA 5AVVA 1HLDA 2IV7A 4RM3A 1JLLB 1QYVA 2IHVA 3V33A 2GPJA 4D0RA 2UUCB 1JB1A 1F20A 3H16A 3S0JA 4R1SA 4X20B 2ZRCA 1WIWA 1M1NA 4HDOB 1O5TA 4M55A 1X7GA 4CM7A 3P52A 3FPFA 4CEHA 3E7PA 3HR8A 1M54A 1Q0TA 3RC1A 1HX7A 1U8XX 2GWRA 4DMGA 3HB9A 1TCAA 1MQ8B 3K3PA 4OHWA 5A4JA 1H4SA 2PZAA 4TN1A 2J5KA 2AR9A 4KZPA 4ESVA 1P17A 2BE9A 3G23A 2ECFA 1AKWA 3HSYA 3P2MA 3GZ4A 3ILSA 1Q7RA 3PT5A 4I8DA 4FKMA 1V9LA 4JJGA 3D6AA 5IAJA 2ZEJA 3CZ9A 1SCQA 5IZCA 2DBVO 5B1HA 1TEXA 3KQNA 1GITA 2GVNA 3L9WA 5HQTA 2EFJA 1K7XB 1KI4A 1W6RA 3K09C 4Z7QB 4ONEA 2JH8A 2ODPA 4CG2A 3UMSA 1XF9A 3ADCA 1P1RA 3B1KA 5C34B 4UATA 3EIUA 3NLLA 5TMPA 3L07A 2QVBA 3H8JA 4M53A 4YMHA 4R2KA 1T91A 4DUPA 2OG2A 3GVHA 4OBWA 1AS2A 3D2AA 2AQHA 4FONA 5H70A 2DX7A 4FT4A 2AFIE 5ALRA 3ZWAA 4OK3A 4MWCA 4PRYA 3IPAA 3TGLA 3LCVB 2GZ1A 2ZI3A 4EFMA 1P5JA 1JMVA 1T4CA 4TVKA 3BA1A 1KK0A 1TU0A 4US1R 4J7CA 3H8SA 3LWDA 1R4ZA 1DKLA 2PNFA 3O82A 4KGZA 4B0OA 2WTNA 4H7IA 3GLIE 1KJ8A 4EVQA 2CFSA 3MGCA 3F6CA 4KQFA 3VA7A 4QQ8A 3I2FA 3U3DA 3TTTA 4P4GA 3IPXA 4YT8A 4G5SA 3ONVA 4ABYA 3P19A 1GNTA 1A9XA 3GRFA 5JNVA 2GEFA 4KIUA 2FUCA 3RQSA 3A4VA 4N01A 5AM1A 4B3HA 4K03A 3ZVNA 1T5HX 1GGMA 1J90A 4U2FA 4YRBA 5LL6P 1IULA 4XVUA 5JCXA 5JNSA 1GTSA 3UMGA 2I9PA 3AERB 1E1CA 2JDIA 4X0EA 5FADA 4CL3A 4YMUA 3ZXIA 1E3SA 2BHSA 2DHDA 1V3UA 3AILA 4TOIA 4ZAYA 3KVOA 1VSQA 1Q17A 3H0CA 1XVVA 1COWA 2HT6A 1UC8A 2IYXA 3TTUA 1GA6A 1VPEA 3L02A 4OJMX 2ST1A 5H59A 4AU1A 5EKSA 2IYWA 4EUKA 4DQUA 5GINE 4J0QA 3WKAA 4I1PA 3O1IC 2HMUA 2PKWA 4CFYA 2J5XA 5D6OA 2WHYA 5JHGB 4I8IA 4QYIA 3T8YA 2PWZA 1AHIA 1AK2A 1Y37A 1W29A 2FFQA 1NMZA 1WXWA 2RHRA 1NQTA 2XA1A 3CY6A 4M8SA 4QNNA 4F1JA 3C8ZA 3L8EA 1U0SY 4HPJB 1G16A 2A9KA 3SR4A 3TMKA 2ZR7A 4EHDA 1G4UR 1X39A 3OOHA 4A03A 1U7WA 2HA7A 1I9CA 221PA 3BF7A 3EWIA 5ALPA 4BWVA 3G6WA 3HJUA 3IAAA 4BYMA 4CLOB 5JD6A 4BECA 4DF3A 4GRIA 2H59A 5BVHB 3H2GA 3VZRA 3QXXA 10MHA 1DRKA 2ATIA 2AYXA 3EODA 2XA2A 1IUKA 3C3WA 1JLSA 4GPZA 5JZBA 3OFKA 1NBOA 2FZWA 5J4VA 3O94A 3AH8A 2EKZA 3B3JA 3PWTA 1FOEB 4KK3A 5D3QA 4NJEB 2XOKA 5JS1A 2JFHA 2RB5A 3DVAB 3OZFA 2BKAA 1VQ1A 5IAKA 4D45A 2HFJA 5EHNA 5BOSB 4KQ9A 1EEHA 2I7TA 4MQBA 4O08A 1JLLA 1MNAA 1W48A 1EUZA 4LDNA 2BR4A 4FFBB 1LGYA 4REQA 3GXOA 3KSDO 4GSYA 1JEAA 4FX2A 1OHHD 2I4OA 1KMQA 1WHTB 3ESDA 5LC1A 2WY2D 2GAFA 2MIIA 2G40A 4QASA 3WK5A 4G3XA 2YIDA 4B31A 5L4NA 5BPFA 1PJSA 2IX9A 4PBRA 3G8BA 1P45A 1ADFA 3MXOA 2GLXA 4X00A 2IQIA 1CR6A 3ZU5A 1M9NA 1OAKA 2C2YA 4HAXA 1NKVA 4XCVA 2EHDA 4V1CA 1R2QA 1QHSA 4X3OA 2XJ9A 4HDKB 3TAXA 3TZCA 1H69A 4AJJA 4HWOA 1JL3A 1ML4A 4F1WA 3LJKA 4FD3A 5T8KA 5TMDA 3T7KA 2KSQA 1NPYA 1U0GA 4J4HA 3IDOA 4EKGA 1TLTA 5DM0A 4JMLA 1IBMB 4OHKA 1KYTA 3UJNA 2XYPA 4H27A 3I01M 2D0OB 5CK4A 4EMUA 4ESOA 2X3YA 1QS0B 2WJZB 1MTOA 1BE8A 3CNOA 2G63A 4FWBA 3HH8A 3R6TA 1FX0A 3ZBTA 2VHQA 4WADA 3IXLA 4IR7A 4LX0A 1D03A 1RJ9A 2B4AA 3P4UA 3VSDA 3B51X 2X9VA 1N6KA 4MGEA 2IOHA 2PGAA 3LYUA 2PX8A 3D2BA 2GD0A 4FPXA 2Q41A 2ZR0A 4IEFB 4WJZA 1CQJB 3H7IA 3UMFA 1KMCA 3MTJA 2WTAA 4YV0A 1JHMA 3AETB 3LBHA 1YZVA 2MTBA 1KE2A 1Z5WA 5FTJA 2LKDA 3GN1A 1QZ3A 5CLJA 4RPLA 3CRQA 5EQTA 2C4HA 4HDMA 1W5FA 4RMHA 5H5JA 3VJKA 4CFSA 4COOA 5IVDA 3RT7A 2BEJA 2XE7A 2V7QD 4L85A 5DM2A 4EELA 1CE8B 1WUKS 2FN7A 3E1KA 3F3SA 3IQWA 2C2ZA 2BEWA 1SVOA 2MDTA 1IXKA 2PH3A 4JOCA 1MT3A 3UEOA 3CLVA 5J43A 4LOJA 1L3CA 1W35A 3GPBA 4TRMA 3I53A 1T3GA 4YJ3B 5DBGA 3JZMA 3RYIA 5JS6A 2COEA 3PFGA 3ISTA 1W59A 3QFHA 4V0KA 3E81A 2VWQA 4AI6A 3TSYA 3SLRA 1U8CB 4DLXA 2F1RA 2X5XA 3TM4A 1YVPA 3B1XA 1UWCA 3C85A 2VA9A 1Q91A 3MG9A 3ZN2A 3CEPB 2EX4A 3NBXX 3RCBA 4EA6A 1MEOA 1NA5A 3KLMX 2QE7D 4IWXA 1W85B 4TL6A 2NVUB 1UJ2A 3A9WA 3BE5A 4JJKA 1KS9A 1EP9A 3ZW8A 4COKA 2C29D 1J2YA 4ZEVA 4AMGA 1G2OA 3TCNA 5FIUA 1JBQA 5FBRB 4YUAA 4JP5A 4LWQA 3G0GA 2OPHA 1V16A 3E70C 821PA 3O03A 2Y68A 2ZUWA 3S2FA 1KRHA 3NV9A 4BMPB 1DJOA 2FW0A 1QO0A 1E4EB 1SAYA 1T1IA 5DTRA 5H80A 2G1AA 1LSSA 1QHNA 1N0HA 1UJ4A 2AF4C 3HN2A 3GGJA 4HFNA 4UBOA 4GUDA 1NUPA 1E94E 2HADA 1YR6A 4RZHA 1RM4A 2OZVA 2XWQA 4D7AA 5M2QA 4D9BA 1Z0IA 4NY1A 4JL6A 2ZSAA 3R3UA 4IHJB 4YMIA 5B2ZA 4QNMA 1ZM2A 2FQ1A 4PYNA 5HCNA 4V02A 4KIGA 3W4KA 3R7BA 5CLHA 3IAXA 4M4SA 3E9DA 4N7MA 1N2JA 3K09A 5T3UA 3AF6A 5HQJA 5EJ7A 1EAYA 2AZXA 3STTA 2VF2A 3SK0A 2TRSB 3BFKA 2P65A 2ZPAA 5A2QA 3KSBC 4UQPA 3WRWA 4BP3A 1RYHA 5DHAA 5IAOA 4XUEA 2OFFA 5J4KA 1PFUA 3IBSA 3IXMA 3KYBA 2WE8A 2OXCA 2OHJA 4OUDA 1C7EA 5J1SB 1M2FA 1M1YB 4JYMA 1U2ZA 2WJIA 2XUAA 4DT1B 3DB2A 2YRFA 1LBQA 2I3DA 3UUFA 1V8ZA 4R5HA 4J1NA 4OFBA 3FDXA 3MFQA 4P7BA 4RHYA 1WSAA 1JJ7A 2UVDA 1P6UA 3L01A 2CLDX 4YAKA 4EW2A 2JEYA 3GRYA 5BSEA 1JR4A 5TF0A 4YP5A 5KNDH 4WKPA 4WSOA 2WTBA 4H7FA 1E7WA 4KO4S 1MXHA 4HDQB 3UWPA 2HA0A 5BNIA 2P2DA 3CXRA 3M5PA 3GWGA 3RVOA 4B3JA 4XR4A 5D85A 4B5LA 3H1FA 3K6SB 5JBNA 1OE0A 3LT4A 4QIHA 1U9ZA 4LJSA 4NZPA 5AMXA 5BUCA 1K06A 1L7NA 4IIJA 2GEDA 3QI2A 3X1MA 4J8PA 3H2HA 3QBTA 1X14A 3UMYA 4EO7A 4QUBA 3AJEA 2ERXA 2QR5A 2PM8A 4RA6B 4TSRA 4ENPA 5A3RA 1WOMA 4IILA 721PA 1H0RA 2NIPA 1UFVA 2WWFA 5DM70 2IKQA 2N42A 5EHZA 3K0EA 3UA4A 2V6JA 1O95A 2PX3A 1F0YA 2LTAA 3AM4A 2FFAA 4MEJA 4YPFA 1QHHB 5HF9A 3MD0A 2IS4A 1ZBQA 1CQJA 1LLCA 4YT2A 4HZUB 3PL1A 4OOFA 5MN4A 1M2GA 3IE2A 3OZVA 4KIWA 1I24A 1OSNA 4AYTA 1E2BA 3DAFA 3KLOA 1TXGA 5CB4F 1VGRA 3NJRA 5TNXA 4BAUA 5DYGA 1IOLA 1W44A 4ZZ3A 1GEEA 3SXJA 2QTZA 1OAOA 5HZMA 1EVZA 4KAJA 3U1BA 1NVAA 1BN7A 3FDJA 4CQLB 4R1NA 4I9GA 4X7RA 2GGSA 1C2TA 3EVBA 5FI0B 1OJ7A 2GXAA 3RROA 2CMFA 2DWOA 3HEBA 4JLVA 1NDHA 4L27A 1KY2A 2B4YA 3AFOA 5F98A 2EG9A 2V7PA 4BP8A 2DM6A 4L5YA 4JI4B 1LNQA 4A0HA 2DFNA 5A7HA 1NJSA 3WRXA 4KWIA 5BN1A 3AF5A 1Q3HA 2E49A 2ZYGA 3LHSA 2AQKA 3CUEF 3K70C 2F9MA 4J91A 2KB0A 4X92A 3HCAA 5GY7A 3HYLA 4Q4HB 1OZGA 1PS8A 2WHRA 1DI0A 5JD3A 3DWEX 4MVJM 1BKDR 2CJFA 1KC3A 5KX5B 2DH6A 1YFZA 4RF4A 1CRWG 3HZRA 4KW7A 3SHOA 2VQ6A 4UUOA 5A3SA 1JQLB 1KIAA 2R97A 2WU1A 3UWOA 5GJBA 2ZYDA 3TL2A 1CHDA 1VZ3A 2WYVA 3CRVA 4RKRA 3V4FA 3WLEA 4GF5A 3G85A 2Q07A 4E7OA 4HX5A 2VWPA 4MV9A 4PYMA 4C0LA 4BX3A 4HTAA 3TNDA 1N6PA 2XCRB 3D4IA 1IQPA 4E5DA 1IMOA 1OILA 1C7IA 3WLRA 1LVUA 1QFYA 1CG6A 2PL5A 3HADA 3HKEA 4B4OA 1RPAA 5CX4A 1P5RA 1MFZA 3S8YA 4F0JA 4MGHA 1GQOA 4Y18A 3PGMA 3R8XA 3GJTA 3WGNA 2HRQA 4EI2A 4JT9A 2PWBA 1T0BA 1TO1E 4ZPJA 5LQMA 3KHKA 1EFAA 1G21B 3SDSA 3THWA 2JFFA 3PVSA 4FYMA 2JAWA 2V6GA 4OH1A 5F76A 2F67A 2W4QA 4UNNA 1N7JA 4HN2A 2JLYA 4F72A 4LFAB 2QMEA 2FZGA 1IHXA 2EKLA 1TQ2A 2WYHA 1NRXA 2IY9A 3VH2A 1TCVA 5BSKA 2GI4A 1AGPA 2YS7A 2ZCVA 5IXSA 1SUPA 4RTSA 2RH5A 4IEEA 1G18A 2JJ2A 3CH7A 3VM6A 2VQDA 5A0VA 4IBOA 2JGMA 2R62A 3AFGA 3JZIA 4GOXA 2KHZA 3FCYA 1H3EA 3UCFA 1H2YA 1MV5A 1XTZA 2IYSA 3SBOA 1FTNA 3PI6A 1G19A 1YQEA 3W8NA 2MMCA 4ZDWA 5TMBA 2QRQA 3D5EA 4BNDA 4JI8B 4KRYA 4LYFA 4PHFA 4C04A 1XD2B 4RKEA 3C7DB 5B6PA 3VPFA 2X41A 5EZSA 3PD0A 2ECOA 2IW1A 3ZCVA 4A36A 4O4HF 1MIOB 1N2GA 2NU7B 2JNWA 1SC9A 1AMNA 4XWGA 3AU8A 4HFJA 1NW6A 3HJRA 3NWPA 4QGSA 4Q16A 1N5OX 1T43A 3HYCA 1Y6RA 4ZJZA 3KWMA 1YR8A 4DWJA 2JF0A 2QXTA 1RWBA 4BMXA 1T0IA 1R00A 3CSDA 3KSZO 2CNNA 1QCYA 2SNIE 3LXXA 1GYPA 1KPGA 3P8ZA 4H08A 2J5QA 4IMRA 4NE9A 3R3WA 4JUFA 2Q5EA 1V8FA 4Q01A 2QLTA 1ZC3A 5AM3A 5KMGA 1WS6A 2OHVA 2Z0MA 5FDFA 3TDMA 3WICA 3P9QA 1UMCB 1MU0A 1WXIA 3B2EA 2FP3A 3G8CA 3HYSA 3QF7A 3LY9A 3ZYZA 1F8YA 3PDUA 2H92A 3LK6A 3BHMA 3DOOA 5KYKA 1QFZA 1O94A 2ID9A 2E3JA 3QE9Y 3FYUA 4C20A 4LHWA 1THZA 3FRJA 2G71A 4IVQA 5AI6A 5EJGA 4BC0A 5F7OA 2UZ4A 2PV7A 4UAGA 1WL8A 2VPYA 2Y1GA 1K7SN 5FPKA 2YQ4A 1TNDA 4ZMRA 1UBTS 1C1HA 5F5NA 5D5QA 2KYRA 4TT3A 1U1DA 2JVJA 1KE1A 3ZCQA 2XCIA 1MNQA 3TLCA 1EDZA 1PZFA 4P3NA 1V43A 4C3UA 4FSHA 2Z98A 3PRYA 3USES 5J4LA 3AR5A 4MQMA 1L3BA 1QTIA 4MW0A 3WK4A 2QORA 2WG1A 1HNNA 4F93B 5EZQA 2ORYA 4MMZB 3DJFA 4P36A 3MHPA 3RVMA 3ZHRA 3IC5A 1LK5A 2ZR9A 5DIFA 2VAPA 4C2UA 3OJOA 3NWJA 4Y2JA 1TQ4A 2OQVA 1SXJA 1ZVKA 4RSHA 3ST7A 1YMQA 5JQWA 4Y98A 2BZSA 2F00A 2FK7A 4I1VA 4BFWA 4H4EA 4GMKA 5FNVF 1RSZA 2Z2XA 4Y9SA 3ZS8A 2GNAA 1EA5A 2K7ZA 2ZPTX 4LE0A 4RJLA 4WH0A 2QAJA 1FDTA 3ORSA 3NTRA 5GPBA 3ZK9A 1DXYA 1LDBA 2H8KA 1EYZA 3M33A 4GX5A 1YU9A 3T4UA 1UXKA 5KBYA 1WW2A 1JU3A 1OOEA 2WPNA 3ENZA 5EAIA 1ZC4A 2JGAA 1NXWA 3F71A 4QFMA 1KI6B 4MPDA 4RXTA 2XXJA 1O8BA 3CA8A 2V97A 3HFGA 5FUBA 2ZQZA 1KNXA 1EE1A 1TAHA 2H2FA 2W6JA 4J76A 2GEBA 2GMWA 1D1QA 2C2BA 2YMMA 3B5EA 4UHDA 3R7WA 4DCOA 4D9CA 5IABA 4MYTA 1ZH2A 5DCUA 2CDNA 4Y2QA 1DG9A 1E32A 1E6EA 1YNSA 1PGNA 2VXCA 1ES9A 1LCIA 2QMYA 3CM0A 3PQ6A 3QX9A 4GW3A 1DCFA 1N8NA 1JX6A 2C4UA 2C0PA 2KM1A 4PVCA 2A1TR 5AVOA 2Q8PA 3R3ZA 1GSIA 4B2PA 3WFJA 1FDWA 5FAKA 1APBA 3WZLA 3ZY3A 1T8PA 5GGYA 2PMDA 4IH9A 4MDFA 4XIFA 3C3CA 3OF5A 3SQLA 2QEQA 3VTFA 1H8HD 5KINB 3M83A 1GKLA 1KERA 2VPZA 2ZM6B 2F8SA 3LRPA 4ZRNA 1AA9A 3IT3A 2JHGA 3ZY5A 1W0CA 3ABIA 2IA5A 3WMGA 1GXSA 1EM6A 1RXUA 2FI1A 3U9SA 4EJ6A 3IDZA 2K2WA 1TKBA 3IEUA 3EQ9A 3F5FA 3R3VA 4MWDA 3WJAA 1VJ5A 1CIPA 1W46A 3HJNA 2XEXA 4KQWA 4NBVA 3ZU4A 1NNEA 2AVDA 2ZBGA 3HI6A 1WCYA 3E9NA 1BTOA 5E7IA 3TFWA 2XBMA 2AC7A 2AC4A 1Y3DE 1UH5A 2KQUA 2C4MA 2YYAA 3EVZA 4GR9A 1RWPA 5AICA 3RUHA 2O2IA 2O1EA 3M4YA 1BHQ1 3T6KA 1ESDA 3FI9A 1DOZA 2IE0A 3UICA 2O5VA 2NSLA 1AHPA 3D9QX 4X64B 3PLAE 1G8MA 1J21A 5DLEA 2A4KA 2JD2A 4C3OB 3Q98A 3TN7A 1G8AA 3J7TA 2OD2A 1WZ2A 5C4IA 2N1MA 1W8IA 3E5NA 4GI2A 3UUEA 3IELA 4RV9A 4UBJA 2XUFA 3JS5A 1WMAA 2Q3BA 3FTEA 1CERA 2J33A 5DMXA 1IHYA 1XDUA 2PK3A 3MUEA 1JE1A 1UQRA 1RVDA 4WT7A 1AN0A 3L05A 2YNMC 4BE7B 3PU6A 4EA7A 1XZIA 1TO2E 3IQFA 5MGNA 1W7AA 2AX4A 4KTVE 3WP1B 2FPPA 2VSFA 5FRDA 3RUDA 1JB9A 3CN9A 2BM0A 4Q18A 3V00A 1UBJS 5CHYA 2Y1DA 1PX0A 4L9AA 4QBIA 2Q5HA 1ZSYA 3LDUA 1C0EA 3FPJA 2Z9DA 2H1SA 2A5FA 3LQ2A 3PI7A 5C18A 3AF0A 4JJEA 2HF2A 1LTHR 1HEYA 2XWSA 2BAGA 5EP1A 1LB1B 2NQ2C 1HKHA 3VR1A 3F5DA 3JAWA 3JQBA 3ZIUA 4AMBA 1XD8A 2HR1A 3SIRA 2WTUA 1DFHA 2XWBF 2QW0X 4CCSA 3IB3A 3EIOA 5K8LA 1QTQA 1THMA 1UBKS 1UP6A 5GAJA 2I33A 2I62A 1G64A 3INGA 3N28A 421PA 2FE1A 3Q72A 1UZUA 2QV0A 3FMFA 2X1HA 2NV6A 4OP1A 4R9RA 1M2VB 2C04A 4MW4A 2WSLA 1W5BA 2QRPA 2QT1A 3H5TA 4F71A 1JZSA 3N0VA 1BX1A 4LIPD 1BYIA 3LK7A 4HGQA 5G0VA 5BSWA 3SBEA 1JQ3A 2WM3A 1S7GA 5IBPA 1CUFA 1DAOA 5I4KA 1JG1A 1TK2A 3P96A 5EJMA 2REOA 1OZHA 3C6BA 5A9TA 3A6DA 4N5DA 4DSUA 5IDXA 1VBNA 4WNAA 5FQOA 1GUAA 1X86B 3VNRA 3IEMA 5AKZA 4JIMA 1U7UA 2HSEA 2X2FA 4JL5A 1VMEA 4PS0A 4KYIB 1W4LA 2FKNA 4I46A 5DHUA 3V7YA 1RRCA 5F9HA 1FA9A 1E2IA 1JJIA 1L5MA 3PR2B 4MAMA 4ZPXA 1RMYA 2J07A 3B60A 1P2BA 1L6IA 3AXSA 4MUKA 4KPEC 4M6WB 1WW8A 3KXKA 5BNFA 4BO2A 1IK4A 4AZTA 4BN5A 3QY0A 3MMPA 1T3HA 3JRNA 3MWKA 4MI9A 1ZGHA 5C4GB 2PWYA 4ZTBA 5TARA 3TJRA 1N34B 5BQ5A 1WPGA 4OKIA 5CUQA 1U3DA 3CKYA 4MWSA 4A2WA 3ND6A 1LSJA 3RAPR 1G9TA 1XR3A 3DNFA 3OU2A 4RTRA 5HP4A 2WI8A 1E1QA 4LXHA 2QD1A 4WXRA 3RRJA 2GZ2A 4URFA 5ICCA 1W96A 1PQUA 3DDCA 2GUWA 5ARCA 5GWXA 1SBIA 4BQEA 3JR3A 1Z0KA 3OJEA 5GOZA 4D02A 4UXIA 3NGXA 1YCDA 3RKSA 5BWOA 5D1NA 3JAMA 2H48A 3MCUA 4JK3A 1XJCA 2AN9A 4OHRA 1PJAA 5BSMA 3TMYA 4UAUA 4E33A 4NOMA 4JXXA 4R2JA 3VPSA 4LY0A 3GHHA 4Y2YA 3T7IA 4DLKA 5C5EA 4N5IX 4LJRA 5JSYA 3MW8A 4E07A 3D6NB 1CUSA 1B7GO 5CDUA 1AQNA 3L1UA 1ETHA 1GGKA 3IXQA 4F2DA 2BM9A 1C7QA 1I2DA 1MGOA 1OX5A 2HK7A 4U2GA 2OXIA 5FB3A 4B8YA 3HV0A 1KC1A 1KI1A 2DFKB 3A6LA 2ASVA 4PRLA 5I8ZA 3USZA 1Z17A 2DJ5A 3B6ZA 4ZHQF 3C1AA 3RVDA 3OPMA 1KTIA 1XU7A 3L7CA 3R5FA 3PNSA 4A8JC 1GL7A 3LUKA 2G1JA 4JKOA 3LTEA 4RQUA 1IPHA 3IIIA 4AY4A 2QPOA 1FXWA 4KKVA 2VCEA 4IFTA 3VR6D 3OVMA 3HLYA 2YV4A 2R1UA 1KJJA 2BSAA 1XP5A 5GVRA 1M66A 4IDCA 2OK7A 1Z5NA 2B1IA 1S2NA 3RU2A 2PXCA 1CDOA 3JWGA 1WUTA 4OA5A 1VE1A 1RZRA 1AV6A 2D2VA 1FRVA 1Q74A 2AA3A 1TUEA 2MYTA 2WLTA 3GZNB 3T5MA 3ZD7A 2JLSA 1J5XA 2HA2A 3SFVA 1T5TA 1X74A 1QLHA 3M8KA 1FMTA 1NRWA 1JQDA 5HRUA 3H4TA 3GLSA 3L5OA 4P7GA 2GYVA 2ZYVX 5REQA 4ZYZA 2K5UA 3GLFA 4TYWA 3G0DA 3BXFA 4I4CA 1K27A 2X42A 1M2WA 2G9QA 2Q9BA 1CP2A 2W58A 1UOPA 1T6NA 4ZI7A 1KYIA 5BMVB 3DCIA 3TVTA 1PNTA 1V7QA 4EG0A 3Q3GE 3ZVRA 1UBGA 3CO0S 4U7HA 4BJ3A 3T9DA 1C9KA 2OBYA 5ALWA 2PQ0A 5DBIA 5FL3A 3ABSB 5DV9A 1K3UB 1O5OA 4FNAA 4MVJE 4Q9IA 1XQ6A 4QM6A 3ZE8A 1G60A 3L41A 3NTQA 4ZVOA 3T7TA 2RGRA 3IVGA 5L45A 4Q7LA 3BMQB 4HDNB 1M1NB 1CS0B 3IUSA 1L5KA 1UFOA 4HT3B 1VDZA 1Z8NA 1P73A 1R9MA 2R11A 5ALUA 5LOVA 1IIBA 2YHUA 2QJTA 1QFSA 3K9NA 3WRYC 1VFNA 4OBXA 1OR8A 4R81A 2Q9UA 1YAJA 3D8UA 2CWDA 1PWHA 3H0EA 2IIVA 4L0MA 3GC6A 3QJGA 1BU5A 4XM2A 1FFCA 1Y8RB 2ARKA 3AGPA 4TQAA 4JLAA 5CJPA 4ND4A 1GO2A 3FF1A 4V0QA 2GRUA 3N7AA 5EYPA 5DM1A 3EC7A 3NBQA 4K7JA 1GQSA 1F3LA 5JV5A 2SECE 2ANBA 4ITRC 4CMCA 5KOHB 1P2FA 2PIAA 4D5EA 1J7KA 4QLOA 3CNEA 4OD0A 3ROGA 1M6HA 1JYSA 2EEZA 3KPYA 1TVMA 1HYBA 3ER9A 1V0JA 2ZULA 3JQFA 1MR3F 4MCAA 2UVPB 2XKAA 2NUTA 1W4CA 3K5HA 1PZNA 2DB3A 2Q3DA 2DFLA 1P44A 1VLJA 2O57A 1DQRA 5IK2A 3A3OA 3SJAA 4WNYA 3FUXA 1W88B 3E2MA 1PHPA 2FEXA 2V7GA 4CQMD 4CKWB 4BGVA 2X6QA 3PLNA 4R3NA 1K2VN 1J2EA 1ZK2A 1K4KA 4TSFD 5BT9A 4QPNA 5K8UA 3AKZA 3M5DA 3RFCA 3SEAA 2IX3A 3EGIA 1DX4A 2F3RA 4TRRA 3VKFA 2KLHA 4ZJPA 1QQBA 1RYZA 1X1EA 4N7RA 3A25A 4W9MC 1IOWA 2FYTA 3MGBA 1L5VA 4ZKDA 5JNLA 5LIRA 3OIFA 3BSFA 4GKBA 4R1PA 1JEDA 4PFKA 4DNOA 1QHEA 2BJWA 1ZVMA 2ZS7A 4OYHA 3IAS1 2WWVD 3DXFA 1VJRA 1VJTA 3THXB 1S02A 3QENA 1VG8A 3BMQA 5M29A 1BFUA 4URWR 3OLCX 2QI9C 2G5CA 5EERA 4IZIA 2HQ1A 4BLVA 1LSUA 4PO9A 2IBMA 3UVEA 3JYQA 1CDZA 3AFHA 4RKYA 4W9RA 5AT1A 2HO4A 2R6JA 5L51A 1P2VA 5F2OA 1U2GA 2ZBVA 3KQOA 4RQTA 5E2AA 4GEKA 1AMOA 2QN3A 2V6MA 3D8NA 2VYNA 4X6XA 1WSWA 4E31A 1FL9A 4KSBA 1FS5A 1G5FA 5GJCA 1P8AA 3BH6A 5C8VA 1G8HA 4BFVA 4B6RA 4YP0A 4WKOA 3QE3A 3NC1C 3ZI0A 1O96A 3GLGE 3CV3A 3HKDB 3KX2A 4ZVKA 4DLRA 2PA3A 2DETA 5IDVA 1HO3A 1URPA 1YIDA 3IKMB 1JEJA 2EBFX 2O2HA 1L7QA 3JYLA 3HP4A 4KIJA 2JKZA 2F4VB 3ENWA 3E4DA 3S7ZA 2XW6A 2WD7B 3OT5A 2DRIA 2IKSA 2RH8A 2QTTA 4LMRA 4NRDA 1I6KA 1I5EA 1OLSB 4CEHB 4ETNA 3QGMA 2MU1A 1OFGA 2WKWA 5C3UA 3UW1A 3N2GB 4RKQA 4NP6A 1M5RA 5ILGA 3SSAA 1MOSA 3SZ3A 2CV1A 1XKQA 4ZMBA 2ID8A 3UCXA 2FOLA 2VRNA 3RRZA 4C2BA 4NFYA 1US8B 1E3WB 5KPDA 2HA6A 1W8DA 3WNDA 1FXUA 1Q0PA 1ANKA 3ZHBA 2WSSD 4PR3A 4N03A 4KU4A 4FHFA 2IEGA 2ZB7A 1ECBA 4PNZA 3MRXA 3QG5A 5FA6A 5HKLA 1XI2A 1V1JA 3FYSA 3BDVA 4NZNA 1MHPA 1OPXA 1QSGA 1X70A 2OM6A 1OT3A 4GMFA 4BBPA 5MN6A 1EXNA 4EG1A 3B20A 4DYVA 3FTNA 3GLQA 3L4BC 5D00A 5G0UA 1T9GR 1XDWA 4EFLA 3ZHZA 2QTWB 2R7LA 4IJ6A 4KQHA 4P53A 3GA7A 5EPUA 3ROTA 1D6NA 4X6UA 4D99A 3OFSA 3P26A 4CL8A 2OSVA 4G81A 1B2LA 4RWZA 4YASA 2XRMA 1CZRA 1ZM3A 3EGEA 1YOVA 4MP3A 5JYDA 1A8HA 3GGSA 1Q5PA 1XQWA 3DBVO 2RIPA 1PYDA 2IYPA 3G0OA 3RU9A 2WT4A 1NI4B 2ZI9A 1JR3E 4M8LA 4A0RA 5E1BA 1P7PA 3FZEA 1DIRA 3SYNA 1DC4A 1GILA 5H3LA 1OUMA 1RHRA 3LXMA 3JD0A 4HFMA 1WQ3A 1XK6A 4M1ZA 5U1PA 3SEFA 4UOEA 1T8YA 4D3ZA 5KS2A 3U4MA 5J4YA 3PE6A 1JHPA 2GKGA 1G0OA 2Q1XA 5CCXA 1CY0A 4H1TA 3L9XA 1DTWB 1NGSA 1XZFA 3FSRA 5CT8A 5ADHA 1Q0QA 5ELXA 3N8KA 5DIZA 1TD1A 3BULA 3STVA 3DTYA 3OMWA 1RQPA 3ZU2A 1P6XA 1NBMA 4GYJA 1PFGA 3WISA 2O8FB 4QT4A 5LQUA 2RONA 3S55A 5BR8B 4KGVA 3KKLA 2P1DA 3C3JA 2QD5A 4B6SA 2OOKA 3I8SA 3Q7PA 5JHHB 2WYWA 5BV0A 2Q1SA 4AZWA 3RSGA 4Z4QA 1YDGA 2GKSA 1BVRA 1RTKA 1S2DA 2WKRA 3EAFA 3S1LA 1VSBA 2GFQA 4G24A 2NG1A 3AEUB 4H3HB 3KZNA 2GUGA 3L5KA 3RTAA 1X9HA 4UM9B 1J06A 4RIEA 2JJYA 3QUBA 2VAXA 1TE2A 4ID3A 2VBGA 5DTMA 3EPPA 1VRWA 3PPWA 1K86A 1NNI1 2FEAA 2OGUA 3VBEA 2CUKA 1JQJC 2RKWA 1BOFA 2QM8A 4KNWA 3W2EA 4EH1A 4N48A 2JI4A 3T9BA 1OMOA 3BH7A 1P9RA 5F3RA 3RSSA 4F5ZA 3W04A 2YFKA 3TBKA 2H11A 1A82A 1LPMA 1PR2A 2P3QA 1O3YA 3DDOA 4PC1A 3RBZA 1Z8DA 5A05A 1PR0A 2IHJA 2CBXA 4OJQA 3P4XA 4HQNA 4KBYA 1MJGA 2XLCA 4J2OA 1VJ0A 2QQ5A 3ZC3A 3ZY6A 4LDAA 1WXGA 2BZ1A 1NL3A 5EMNA 3OBIA 2BCJQ 1RJDA 1HQYE 3I34X 3RRNA 2X14A 3WNZA 2QNRA 1OAAA 1P29A 1R9JA 4ZOLB 1UBRS 2O4UX 1NVFA 3CLUC 4A8PA 2D2FA 4HPWA 4ARZA 2H1FA 4AXBA 4EO9A 5F1KA 2XYRA 4XDYA 3OZSA 1XQXA 4Q4AB 1SCAA 3FZNA 5CLLA 1RKXA 3B9RA 2BISA 3Q6NA 2W5UA 1WZUA 4RVOA 1Q0UA 1ITZA 2L2QA 2RH9B 2DFVA 1O58A 3KJHA 4TKVB 4GSLA 2CDAA 1U0BB 4IVNA 3FGOA 3V32A 1XMXA 3V3TA 1TEVA 1NV9A 4RY2A 1NTRA 2C9BA 2FXIA 1GAJA 2PSFA 3O8QA 1D09A 2R85A 2VT3A 2JGLA 2I54A 4JI5B 3W1EA 2EP7A 4RPCA 4QM7A 2R6R1 2QRZA 3P2JA 3C39A 4FM9A 4BO5A 1SEPA 3B9BA 1QZUA 4Q3LA 3CPSA 2BFNA 1XVIA 2IHTA 4DPKA 2FZ5A 2VF4X 1MORA 4GI3A 4KYVA 5H16A 1CJMA 4E03A 3V1LA 2AZMA 2BFBB 3S2IA 2DHRA 2QTLA 1KRXA 5D01A 4MGIR 3RLIA 3A6KA 4CIDA 1S1MA 5H1YA 2X0IA 1SKBA 1Z34A 3ROZA 2YXDA 1FTSA 4PS1A 4JBWA 4YJHB 1V6SA 2XZTA 3UOAB 2JGNA 4MRRA 2MSKA 1QQ6A 3C8DA 2FR8C 5JZVA 4UE3S 3T7EA 5G4KA 3JPWA 3NYWA 4I50F 4NICA 2RJ3A 2ZE7A 3L8FA 1UEXC 1XC7A 1G38A 4UVGA 1UAYA 4RFVA 1ID8A 4OB6A 2PT5A 4Q6BA 1DG3A 1MAWA 4URXR 1XZJA 3PXGA 4NCKA 2O1WA 4UC0A 1CQPA 1XZCA 2FGJA 2ZSDA 1NZFA 2NT3A 1ADYA 4PFSA 3QU7A 1EX9A 2Y1LA 3TAHA 4CF6A 5EIBC 3QEMA 4XFKA 1A72A 1LW6E 3BBLA 2GCIA 2PH5A 3A1EA 5KX5A 2O8CA 4RDHA 2Y0BA 1G4AE 7ADHA 4P2GA 4L0CA 1I8TA 4PW0A 3VYTB 4KSYA 1KOGA 1E6LA 4RIIA 4Z8YA 3A9SA 4P6VF 5FFNA 3LUHA 2OORA 1ZD3A 2ADMA 4GM0A 1II9A 5BRAA 1Y8ZA 3OQVA 5SYAA 3A31A 4WESA 5IN4A 2NLOA 4PHTA 3COWA 1M8PA 4NU0A 5FORA 3H18A 3HXTA 1VRCA 1TB4A 4G5QA 2WT9A 5KQPA 2YC4C 3ANLA 3H2JA 3HB7A 3MTEA 5CYOA 3UJ6A 3DDZX 1N5IA 3B1FA 5KJ1A 1PR1A 2J9GA 3CZQA 5FWXA 2RHCA 1NI4A 2FPMA 3K1YA 2BMJA 4EVSA 4UNPA 4DV6B 1Z73A 2Q0HA 3NRCA 3WWOA 1R8JA 3URKA 5CG2A 3ORFA 4F11A 2MINA 5JUWA 2D2XA 2VHJA 1UKYA 3B70A 1W94A 4NBWA 1I9GA 2W93A 1QYXA 4BZWA 1TQHA 4C08A 1JFTA 3UB3A 4GVLA 3TZEA 5B3KA 4JI7B 2RGBA 4LZZA 2X58A 1CIVA 1SGWA 4U3JA 4E15A 1XF1A 2XY4A 2P2CA 3MJTA 3DAPA 3ONDA 1MRZA 1W6UA 2ATVA 1ZMBA 5CTAA 5ALVA 2X7XA 4PAMA 5ALYA 1LPNA 3SC4A 2VHVA 5JVDB 5EJ2A 3V1NA 1UJCA 1O57A 5C8YF 4C0SA 1G9SA 2WNHA 4Z51A 3HEAA 1E2KA 5J58A 1F60A 3CTMA 1DLJA 2D54A 3NANA 4LGYA 4CQJA 3PHBE 4LYGA 3LDHA 4BNIA 3IUNA 1KL7A 1EJBA 1K8YB 4KDFA 3TW8B 2H1RA 5H02A 1C8VB 1J9EA 2BBTA 3LAWA 4GOND 2CZGA 5IEBA 3VR2A 3F5QA 3L0YA 2PZEA 4U63A 4AJHA 4WK6A 4G0OA 3AUKA 3UHJA 4KOAA 3V46A 4WX2B 5LLTA 3I3SR 3N8DA 1KDYA 2B7BA 2CHVA 2VG8A 2RAFA 1DRVA 2O0KA 2IXGA 2VAVA 1JUDA 1VCOA 2DLNA 1DBVO 4ND3A 2C31A 4O2BB 4YMTA 3ZHTA 2AJCA 4YXFA 1CVRA 1X6VA 4HB3A 1EKXA 2FPIA 2BGRA 2I66A 3N76A 5KYXA 5IJAA 4DN6A 2QN7A 4DG8A 1VPDA 1UCFA 3N2YA 3PK0A 3PP8A 3REGA 4C14A 5IBCA 1P6QA 4XIIA 3O4RA 1KSHA 2I7CA 1M6YA 1KAOA 5HDQA 1KZ4A 3GLHA 1H2ZA 2HWKA 3CZAA 3HUFA 4DSOA 5ITVA 1DGQA 1S9DA 3KJFA 4I4NA 2IV2X 3WK7A 3W06A 4DQLA 4TZ0A 4G84A 4EMSA 1H65A 1ZQ9A 3C6MA 5JS8A 2I67A 5H82A 1ZESA 1CWUA 1JDVA 1Y4SA 3I8OA 4P82A 3PWKA 1P2UA 3QZUA 3JZFA 5DI3B 2OD7A 4QPZA 1RRFA 5LWQA 1J9ZA 4E14A 3ITNA 1SA0B 2GTIA 2DT5A 1MRNA 1OIXA 1E7RA 2ZQYA 3QVOA 4NFSA 4BP1A 1A8IA 4A73A 2ZDGA 3KKNA 1QG4A 5B64A 3CF6R 1BCSA 1FC0A 2XKBA 3DVSX 1E6KA 2IW3A 2HMVA 3F98A 3FTQA 3I1YA 4JB0A 2LW7A 4AL4A 1J6UA 2GPSA 4AY6A 1P61B 1L1FA 1USVA 1GGHA 2Z04A 4M1SA 3ZZUA 1ISIA 1XQYA 2FHPA 4NYMR 4RSGA 2G1KA 2XB4A 3HU2A 4J6FA 5K0JA 2VH2A 3ETDA 3AX6A 5BRNA 1F0NA 4RPIA 4NI5A 2FXVA 4IQFA 1SBHA 2Q1YA 3LBFA 4TXJA 4G9GA 4TV8B 3VBCA 1BXGA 2WVGA 2Y2VA 3I04M 3EDRA 3E5RA 4BQSA 3D6HA 4L5IA 3Q9NA 1USWA 3MT9A 1NUTA 1GCGA 2YCBA 3BORA 3PFFA 1RQLA 1EFDN 1R9NA 1RHUA 1KU6A 2A2ZA 2RK6A 1HLGA 1IZ7A 4BB5A 1J5EB 5C0OE 2DWUA 4QICA 2BGJA 5L4SA 1ZIOA 2D74A 4LSGA 4JQSA 5FBKA 1WD7A 5ESWA 1F4PA 1D2EA 4P35A 3RVKA 1BJKA 1NJ8A 4P3YA 3BJEA 2QTVA 1UWLA 3AG6A 3CKLA 1GEGA 3E15A 1PV4A 1GWNA 2PBFA 5K2OA 1ZRSA 3K35A 2ZP1A 5G0SA 3LFUA 5HA5A 4D56A 1YR3A 2CUTA 2GJKA 1MX9A 1S5PA 2PRZA 1YJ5A 2JBWA 3EGOA 3KVNA 5CB4B 2NPFA 4DRYA 5L40A 5INTA 3T9AA 2QD2A 3ZIDA 1MVNA 5BVGA 2E4VA 5AHKA 3B8EA 4DB2A 4Y6GB 4A82A 4HH1A 2QYHA 4NEGA 1EGMB 2G9ZA 3A8TA 1PSWA 2C4KA 3NDJA 3NHAA 3KKPA 3S2SA 2GM4A 1EWKA 1QH8A 1Y4DE 2XDYA 3BREA 3GFRA 2P5UA 3O3CA 2BTQB 2ISCA 1M1YE 1XNJA 1U2DA 1PL6A 1YBAA 3MGKA 2R8BA 3ZDAA 1ND6A 3DBLA 1AMUA 3SBDA 4P33A 4YCCA 1JHOA 4WUTA 3KV1A 1BVHA 4J0HA 3CH4B 4J90A 3D81A 4YRGA 4EGQA 1IBLB 4WE3A 1U99A 1UM9B 3ZWPA 5KSWB 1ZGJA 4GOLD 1UK7A 1GZSA 3WHKA 1MABB 3EZFA 1MO5A 3ESAA 2O2SA 4Y67A 3R7NA 3O83A 4YXWD 4R0NA 2HA5A 5EFZA 2V7WA 3VR5H 1E79D 2HQOA 2ZU0C 1EVJA 2V96A 1U8EA 3H5OA 3EARA 1IC6A 3OM8A 2FSVC 3NOXA 1Z9BA 2XDQB 2NV0A 1EXWA 2G82A 2WAAA 4ML3A 1M83A 1D1SA 1KYZA 1TUBA 1X7YA 3N2IA 5FTMA 3OF3A 1HNWB 2HUPA 2JIBA 3MCWA 3K0BA 1XRMA 1N2CE 2J0EA 1Y3HA 1FPQA 3N2EA 3OIDA 4DXHA 2HHHB 3TL3A 1ZHFA 1DBSA 2MSEB 1IUOA 2A5DA 2QQFA 1DJLA 2XMRA 3EQ2A 3RS7A 4EFDA 3UO8B 1MKYA 4RY0A 2XMBA 3DB1A 2DPLA 2UYQA 3M0EA 5CBKA 1A7JA 3MJSA 3RIMA 4YR7A 1NMSA 1NYLA 2HYDA 5HGJA 4YAGA 3AB7A 4P7FA 4QELA 1H6CA 1S6YA 2VJQA 3UKJA 4C3VA 5D87A 4JP8A 5DOZA 1O95D 2OFOA 5F1OA 1J24A 1PX2A 1RQRA 2CFOA 3BIXA 3DPSA 1ND5A 4RVFA 4LJAA 2JASA 3C15C 4EG7A 4HNQA 4C78A 5E1OA 1O89A 1CQIB 4EFKA 2K4MA 4CM4B 1XMIA 1RQXA 1OFUA 4ARIA 3LVRE 4NXNB 2B5OA 1K6EA 4ND8A 4HR7A 1C7FA 4XH9B 5E6RA 3F67A 4Y2RA 1JKXA 4LN1A 5FO1A 3BMNB 4DSZA 2EGUA 1CJKC 2I2BA 4CBVA 1NXSA 3JY6A 4JBXA 1VZ2A 4AKGA 3HM2A 5FA8A 1FF9A 4IH4A 5JRJA 1NQOA 3IP9A 1PR9A 2ERCA 1MW8X 2HK8A 3VU1A 1BKYA 4XB2A 5FL7A 1I2ZA 2D1TA 2H85A 3JQ8B 4RPGA 4ZCSA 2QSUA 1BAPA 2XAUA 2DMRA 2J1LA 4TM8A 2BF4A 3WADA 1NY6A 3IYLW 5E4TA 4FYJA 1F2UB 1RR6A 2P68A 1UXIA 4I81A 4MQUA 2FPGB 4D97A 3EG9B 2IH4A 4R2HA 3PUZA 1YBFA 2I03A 4I4TA 4PPYA 1ZI6A 2QN1A 2N46A 3F7OA 4MJ3A 3LO5A 4NBUA 4TUYB 3GEEA 4IIFA 1N6IA 1YL7A 3FA2A 2GASA 4HVAA 4DIBA 3F5MA 1TKAA 4NOLA 3T1YB 4B6GA 1FQJA 1V2HE 1YQXA 1L9KA 5JD4A 2HL6A 4AD8A 2Y6VA 4HYTA 4I55B 2BRUC 1GCAA 4GRDA 5K99A 5LD2C 3OA2A 3LF2A 1N0WA 1NYTA 2BHNA 2GA8A 1H5UA 2HRRA 1X80A 2J85A 3B1ZA 4GLFA 1H05A 4GXRA 1BIFA 2VDMB 5AOAA 4BKRA 3BGWA 1DDOA 4G37A 1RWVA 2IU4A 3E9ZA 3O4GA 1QKKA 3QHQA 4BNNA 2EQ5A 1MAAA 1VE6A 2XV1A 2XT6A 3T52A 1MRSA 4YH1A 5EXEA 1K5HA 3GFFA 4MVJI 1YASA 2P75A 3R5TA 5EZYA 1P1JA 2J8ZA 4IF6A 4WZAE 1QAMA 2OV4A 2R1TB 2VYND 5KYWA 3L0SA 5CH5A 1NXTA 1A9PA 3I83A 2O48X 4TM7A 1NJ1A 3OUUA 3QVGA 5KQSA 2P6PA 4CMAA 2R6FA 4P5EA 3OKAA 1U2EA 3TOXA 3BUSA 3I8XA 1Z26A 1GFZA 1NWCA 3L4JA 2CXPA 1A88A 4ALIA 1GGJA 2FUKA 1EU1A 2DBZA 5HDBB 3MCAA 1RAIA 3L8GA 4PYJA 1FIUA 2C3PA 4HDRB 4KCGA 5FTKA 2WSYB 4ER3A 3B2NA 1MPTA 3I5AA 4Z9AA 4PX5A 2LCQA 4M1KA 3IURA 2OD9A 1AUVA 2ODEA 2FAXA 2RHBA 4QDJA 1P18A 4E5YA 1E0KA 1MN6A 1JA1A 2W6ZA 1E18A 1BHSA 3MLAA 4GQBA 5KOJB 1EAMA 1YVEI 3TNFA 4LC0A 1LV8A 5IM4A 3DCNA 1PEAA 3FFTA 3HNRA 3QV1A 3PEFA 4UOQA 3UAOA 3L0PA 4HUTA 2CLHB 2X0DA 2CD7A 2ZUUA 1Q84A 3F3YA 3PC3A 3GY0A 2P9TA 5B1SA 5IT9A 1TMOA 4EYEA 1P0PA 4F4JA 2FWIA 4LISA 4QSHA 1PJCA 1DX9A 3P9YA 1R4MB 4TMZA 4F38A 4C2TA 2IDJA 3DFZA 1QS0A 4JX8A 5AUOB 3FOEC 4QO7A 1ULTA 4EPTA 2R48A 5JR3A 3ANTA 2OYRA 4XD2A 1TK9A 2PT9A 4NDNE 2QUBA 2Y66A 1M0SA 4KVZA 3IAHA 3GQBA 1FJHA 3AEQA 1CUEA 3INNA 1SCJA 3FLMA 4M22A 1GPBA 1MEJA 3EPRA 1UWKA 4IQGA 4MAFA 2OESA 3OZWA 3LW8A 3Q3CA 5DULA 3ZEAA 2V45A 4IIYA 1VPVA 4YRZA 1VBMA 3NT2A 3ZS9A 4P5DA 1TAQA 2CHFA 2H16A 3QITA 3AGQA 1GFIA 4G5FA 4KO3S 4MV8A 4RX1A 3KWFA 3TLBA 4ER5A 3CKKA 3ICWA 1MJGM 5ICEA 4NS4A 4LE2A 4DLPA 1DMRA 4MAAA 4N18A 5K4AA 4L3WA 1Y6GA 1KORA 1CX9B 1KHTA 3GEBA 4JS0A 3N0WA 3KDPA 3TSCA 2B3TA 1MVOA 3HRKA 3CTPA 3G9UA 4E88A 4MITA 4D0SA 4JB2A 1AVTA 1A8SA 1GFSA 3LCUA 4FX5A 1E0AA 4N9WA 1EVQA 1Z6ZA 4NDAA 3TLYA 2P9ZA 4IJMA 1H3FA 2BCEA 2VJLA 4IWNA 1KWGA 3CR3C 3M6MD 5AI4A 3VYSB 1TVCA 2NYUA 4W1RA 4PLTA 1EGAA 3RS4A 2W2QA 4OGKA 4ENSA 5FWNA 2QVYX 2HBZA 2SBTA 4KQJA 1DDGA 1T6BY 2VZ0A 3HFJA 5AHXA 4QXMA 3KQKA 4PEVA 4KHPB 1WZNA 1AIPA 1KYXA 2VXBA 1II8A 3L04A 1DLIA 3MCTA 4F2WA 4ZU3A 4PZ0A 4Z99A 4Q4LA 5AM4A 3GN2A 3ZWWA 1DV2A 4C1NA 3L6CA 1SXHA 1DRJA 2QT0A 4G0XA 3W6UA 4L72A 4OMDA 4KG7A 4L3OA 4RTQA 4H4DA 1ZZGA 3C4QA 3ETHA 1KJQA 1DB3A 3X3HA 3GFQA 3VKVA 4DREA 1NR7A 5IT4A 3IILA 2R6GA 1NU8A 4D42A 4WXEA 2HGSA 3NX4A 5D86A 5LP6C 3TW0A 2FK8A 4LZLA 3QU2A 4Q1AA 3JYPA 1OWPA 3M6UA 2QLJA 5DNEA 1FFBA 2OL4A 4Z4FA 4YRIA 3OSZA 5F9FA 4F60A 1P77A 4Q03A 4IIDA 2WB2A 3TO5A 1Q92A 2MYNA 2X9NA 4NCNA 1C81A 1E1RD 3ZDZB 3VR3D 4FKBA 2FPSA 1DS6A 2Y76A 4KLAA 1E3IA 1H1LB 3OI7A 4FJ2A 4WN9B 2XTAA 1UJNA 2B5WA 1T13A 3JYHA 5L8VA 4DTCA 3DOIA 2OZEA 4U7PB 1V8OA 3CEAA 3KB1A 3WI7A 2EWVA 1E92A 1WUJS 2ET6A 4YQYA 4YIKA 1FE8A 2C83A 2RHJA 3KR9A 4G8BA 4H18A 1FRFS 2EF0A 3PC2A 4OSOA 3EISA 4XIGS 3LF1A 1RAHA 1VMKA 2ZVJA 4BFTA 5EKDA 3S2UA 4FE3A 2C9MA 2J3JA 1QRDA 1F7UA 3ETJA 4UVDA 1SVNA 2PXHA 2G77B 3Q85A 3N87A 3T3NA 3D59A 3EFBA 3KE9A 4W5NA 4Q1VA 1AHHA 1E7MA 1IMJA 3QKWA 1XTPA 3E84A 3I1JA 4MR8A 3JTEA 2XE8A 4RLSA 5A6SA 1C9DB 2C5EA 3RYTC 4OSEA 2IUYA 3QNMA 3A70A 3LY5A 5TQ0B 1ZN8A 2XX3A 3KZ1E 1U3GA 4N6NA 3W78A 4R9UC 3G3EA 1WDLA 2YYSA 1QGUB 1Y1PA 2LIPA 1V4VA 1XJ0A 2XNHA 3JQAB 3U60B 3AYZB 2W4IA 3MC1A 1SUSA 1Z4QA 3QF4B 4R9SA 2O05A 1E5QA 1H1TA 5IUKC 3EH2A 3AOEA 3O8LA 3KHUA 4ROTA 5KSZA 1FTGA 3NWOA 3ZV6A 2O1SA 3LZ6A 1GNVA 4FGUA 4FHDA 4MGYR 3T15A 2WICA 4U0KA 1A8PA 1VC2A 5JEEA 4B32A 2Q3JA 3OPNA 3EXEB 3QFCA 5H7XA 3SMVA 3QLUC 3FKSD 1IXRC 1UJBA 2JFPA 3DR3A 2Z3VA 2BKUA 3V8EA 4POOA 5DK6A 5D3ZA 3GJ5A 3MN1A 2WOJA 1EVLA 3R3YA 3UA3A 3T35A 5KB3A 1RYDA 4LCBA 4CCYB 2ID7A 1DAPA 2LCFA 1UIRA 1NVMB 2NZVG 4WN3A 4BX0A 1M76A 3TVYA 4O2BA 4EW6A 1XAIA 1MB4A 1WPQA 3OOWA 5FHRA 3HE3A 3PFIA 2FFRA 3HKEB 4NHEA 1RYBA 4ZMSA 1LI4A 3ZGVA 1XKLA 4PSVA 1BXRA 1P60A 1NONA 1NXOA 2CCKA 1SZPA 3HI4A 3QYFA 1YGPA 4K8OA 1BD4A 3LNTA 1RJEA 4GBJA 2P1RA 1G291 3NTOA 2VBCA 1Y6FA 1RCFA 1QCZA 3O8DA 2GEKA 4CIXA 3K20A 2E9SA 2IS6A 3T7AA 1H3NA 1YE3A 3UV6A 5GIOE 3GGPA 1UIMA 5JT1A 4ARCA 4LMBA 2P9HA 1B0UA 1DQPA 2R25B 4YV7A 1BJTA 3OE7A 4L8VA 1GTRA 2F3QA 2DJIA 4ZODA 3F90A 1EQUA 2ZBDA 4W5TA 4PYRA 2H9AA 4ZT7A 3VI3B 1QGDA 1KOFA 3PS9A 4HWGA 2LWIA 3IVMA 3T5AA 1P4JA 3EIFA 4Y1FA 4DNQA 3W8FA 2ZSBA 4WZAA 2P9QA 1XZMA 2RHLA 4K6GA 1REQB 1Q0RA 3W3AH 2IY7A 3H2IA 4OFZA 4JODA 3UZUA 1L7PA 3PXEA 2A5JA 4ZGGA 3ICVA 3E8XA 3EC1A 2QUJA 3OJLA 2G8LA 3OTHA 3JRWA 4DYHA 3UANA 1I7LA 2BMVA 2OENG 2QGZA 3I5UA 4M49A 3ZUGA 3PFWO 3GJ7A 3S81A 4WDQA 5LYJF 2GDJA 5K8TA 4NU6A 1P2GA 2IOFK 3O47A 3H04A 5IK2D 2REXB 3IVCA 3IR5A 3B2QA 1ZJ4A 2IYVA 2PX2A 2X8LA 3C3KA 3HQ4O 3MAJA 1YBVA 1ZUWA 2YJ4A 5FBZA 3TWOA 3VV3A 4EDFA 2V0GA 2R6AA 5DKFA 1P4HA 2Q5LA 3BB3A 1G8JA 4CQMA 2YYYA 3BXXA 1DAKA 4WCDA 1RZRD 3KSRA 2EFEB 4Y6RA 3I37X 5AJTA 4Z7NB 1U3CA 2R44A 3OD5A 4RK4A 4Q4JA 4C4TA 4CUJA 3N5CA 5BQ3A 1BGWA 1O2DA 3KC2A 4D6XA 4HEHA 5IDQA 3SYMA 1OH8A 4AZ0B 1IZ8A 1YFKA 3SDZA 1SHUX 3DSRA 3MOGA 4YBRA 5TC4A 1VA4A 1T4MA 2R7NA 1YOBA 2G25A 2VJNA 2WAYA 5IZCC 1Z7BA 1X87A 3MGGA 3HN7A 4EJSA 2EZ8A 4KDEA 5JJIA 2X5OA 3IERA 1ZAYA 2UZAA 5GONF 2DUJA 5ALKA 2E82A 2VK4A 2FSPA 4M0CA 5CAEB 1AU9A 3H2BA 3GDWA 3UFBA 3ZE7A 4ZREA 4L74A 1KO7A 1EP2B 3HBMA 3NHMA 4FVTA 4BZQA 3J80A 2Z58A 1NPTO 4IMIB 3ZZNA 2ZDHA 4GICA 3QIAA 1IK6A 2C78A 4D57A 4JI0B 3AFIA 3NBKA 1AZLA 1NW9B 3C45A 4KR6A 1I3OA 1Q83A 4HEJA 4X63A 1DMSA 1WE2A 3P20A 4LKOA 4IGKA 4YRCA 2XUHA 2BGMA 3MPUA 4XSHA 2Q7OE 4C7OB 1FPMA 4YJHA 4JC4A 2GBLC 4UVEA 2VP4A 2CE7A 1DU4A 5J9FA 1L5NA 1G20B 1GV1A 4GOOD 5LJIA 1FSZA 3LX4A 3NAQA 4PCAA 2ZTUA 4DV3B 4G1EB 1L5FA 4MCJA 2C94A 3ENVA 4FEYA 3CEHA 3T7SA 4UZEA 4BUZA 2DR2A 2C2MA 1SVMA 3G7SA 5DN6D 1O87A 5FFFA 1HI9A 2GPAA 2VJPA 1YQDA 3VFDA 1YA6A 1I4LD 1VKRA 2HNBA 3HB4X 5F77A 1G5HA 2QL6A 3T34A 3WGKA 5ICSA 1W52X 3Q4GA 2HKIA 5FI3A 5IS2A 1NJGA 3EY9A 3WOVA 3OICA 3H1PA 3Q3VA 1UPXA 2HJRA 1T9AA 2M6RA 3PPVA 4ITVA 4PLVA 2H2WA 1M0EA 4HB2A 1M6VA 4RMGA 3SLGA 5CA1B 2YZ2A 1H2BA 3IUMA 1H23A 1EFHA 1L5GB 1WQ1R 1Q0HA 4AUKA 5C53B 4B3CA 3B36A 2QK4A 3IKLA 1UOEA 1T9DA 2QTAA 1YV9A 1N6NA 3OPYB 4ZI2A 4F92B 3UUGA 1AXRA 2GHTA 5CFLA 3VHXA 2WAXA 3PKJA 4LS3A 1HC7A 1F6DA 1Q1ZA 3PZBA 1OU0A 2C7VA 3GRAA 1PTJC 3MA0A 5DYIA 3RYFB 3T0IA 1C29B 1CKEA 3IULA 3UJAA 3G0BA 3ICEA 4AS2A 3EDCA 2AJBA 3ZNNA 1WBBA 1PT6A 2H7YA 1TPZA 4PGFA 4MW9A 5EUQB 5IYZF 3RARA 4GLOA 3QXCA 1PKEA 3IUPA 1JAHA 2I2CA 3R9IA 1QOPB 2WM9B 2C2GA 4WY8A 5I7OA 2QPAA 2ZWAA 3UTDA 1XDGA 3QJYA 1FMFA 5DNYB 1NZDA 1WF6A 2XUKA 1YH3A 1KZ6A 1CQIA 2L69A 2VTVA