5KS2A

Rawv_ctd (helix form) of 16s/23s 2'-o-methyltransferase tlya
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
209
structure length
209
Chain Sequence
b'RAWVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYFLWLRTQTDRALSAKGLEDAVHRAISEGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Motif for S-Adenosyl-l-methionine Binding by the Ribosomal RNA Methyltransferase TlyA from Mycobacterium tuberculosis.
pubmed doi rcsb
molecule keywords 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 64
structure length 209
sequence length 209
ec nomenclature ec 2.1.1.226: 23S rRNA (cytidine(1920)-2'-O)-methyltransferase.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ks2A00
1JTEA 3M6VA 4CTKA 5LQRA 1TW2A 3D2LA 4OQEA 8MHTA 5DTQA 3FTEA 1MJFA 2ONYA 2AOTA 1JG3A 4AZSA 4P58A 3HA5A 5EMMA 3V8VA 3C0KA 4QQKA 5GIOE 3DLIA 5DM4A 1WXXA 3AWIA 1L3BA 4GF5A 5HIIA 3HVJA 4WVLA 3SSOA 4CXMA 2FK7A 2G1PA 3FTDA 5DPMA 3BKXA 2PXXA 3R24A 3PX3A 2YQZA 4C08A 2O05A 3ID6C 4RYLA 3WSTA 4RTLA 4CKCA 3T7RA 3BT7A 2ZVJA 2QM3A 7MHTA 1VLMA 4HRAA 1P91A 3BWMA 1JSZA 4PCAA 5EHGA 3FYCA 3OPNA 4X1OA 3LX6A 5CD1A 5GOZA 3KPYA 4KWCA 3BZBA 4BLVA 3R3HA 4LWOA 4DCGA 5T6BA 5BW5A 1Q0TA 3E8SA 2NYUA 3KQYA 2Z6QA 4A6DA 5C0OE 2ZW9A 4HH4A 1BC5A 3P9KA 2NP7A 1D2GA 1UFKA 1OR8A 1L1EA 3G2PA 3IV6A 3UJ7A 1O9GA 3LGAA 4PGHA 5U4XA 5LQJA 3EVDA 4H0NA 2CKDA 1F3LA 1IXKA 2AOUB 1XJ5A 3R6TA 4DZRA 2PX2A 1R18A 2P41A 2QY6A 3DMFA 2G71A 3KQQA 3OU2A 1L3IA 2Y1XA 5FCDA 5K01A 3FRHA 3KR9A 4DKJA 5DM1A 3UA3A 1JTFA 1NV8A 4YUVA 1WS6A 3UJDA 2CMGA 4E32A 4HG2A 4X41A 3GRVA 3T7TA 3TQSA 5K0FA 1HNNA 3KQMA 4GOMD 4EK9A 3OE4A 4X63A 5E8RA 4BY9E 5CCBA 2ZFUA 2F8LA 4MTLA 1RI4A 3I5UA 5JR3A 3A7EA 1VIDA 3A4TA 1X1CA 3RIEA 3SSNA 5LQUA 1MHTA 1EQAA 2O07A 3P8ZA 4FS8A 5D1NA 5M5BA 5HOQA 1G6Q1 3GXOA 2AVDA 1Q0SA 3MTIA 5EEHA 4OQDA 2O0LA 3P71T 1IM8A 4OBXA 4P7KA 3BUSA 1BOOA 4XCXA 2ZLBA 2PSSA 3MHTA 1YZ3A 2NXEA 3MCTA 4U7PB 4PYJA 2C7QA 3BKWA 3DXZA 4CKBA 2P35A 3ANXA 2UZ4A 1QZZA 3DOUA 3LKDA 4PCLA 1TW3A 5EMKA 5FHRA 2C7PA 3CJRA 5FA8A 1YF3A 4EKGA 5IKMA 4R05A 2I62A 2BZGA 2PWYA 1Z3CA 1EJ0A 1XDSA 3HVIA 3EVEA 4ER3A 3ME5A 2GA9A 3LSTA 1NKVA 3BWYA 3HM2A 4E30A 3DMGA 3R9XB 5FWAA 3LCCA 2BH2A 3KR0A 3OFKA 3VSEA 2OB1A 3M70A 4HGYA 1TPYA 2XYQA 2OO3A 4PWYA 2NXCA 1JQEA 2B3TA 3G8AA 1X1AA 3HTXA 3UJ8A 2ZBRA 3HVHA 3K0BA 4EQZA 3A25A 3PT9A 5K09A 1YFJA 4POOA 5EMLA 4DA4A 1QAOA 2IFTA 1FJXA 2EJTA 4YUZA 3G88A 5LQNA 3HEMA 3OZTA 3P9CA 5DRYA 1I4WA 2PKWA 4XUEA 5DTRA 4B17A 3TM4A 2IP2A 3GWZA 5E1MA 5EC8A 3SSMA 2I9KA 4IV0A 2AS0A 1SUSA 5HIMA 4RTQA 2IDJA 3OU7A 2PXAA 4QVGA 2ZZKA 4MIKA 4HC4A 3EGVA 5DM0A 2FRXA 2QRVA 3MB5A 1I9GA 5DX8A 1FP2A 3JWHA 3O31A 4X60A 4QQNA 5KS2A 3UJ6A 3PTAA 1VL5A 3ELDA 4C04A 4YUXA 2ZIFA 4KW7A 5HIKA 1KPHA 2V74B 3ER8A 2P7HA 3SVZA 2FK8A 5K0BA 4AX8A 3LBYA 2AN5A 3BGVA 4ER7A 3KR2A 1I1NA 5DX1A 1JR4A 1M6EX 1RI2A 1VP9A 4CKEA 3DMHA 5K0EA 3FPHA 4G56A 5D1HA 2PXCA 5BXYA 3B3GA 1RJGA 3HVKA 3FTCA 3HCCA 2HNKA 4FT4A 2IPXA 1XCLA 3CJQA 3EGEA 3LCUA 4YV2A 2IBSA 1XDUA 2ERCA 3AXTA 3GDHA 3BGDA 3LKZA 3P9NA 1X1BA 1AV6A 4IV8A 3ER9A 2ADMA 3GIWA 3ELUA 2C7RA 4QPPA 3DXYA 1KP9A 2DPMA 3C6KA 1RI1A 4KIFA 3EVBA 4KRGA 5EMJA 3QOWA 2NP6A 4AUKA 2JG3A 2OB2A 4ISCA 5GP1A 2ZWAA 3E23A 2P1DA 2FPOA 1NW5A 2ZIGA 3JWJA 4EMSA 1ORIA 4PINA 3L8DA 5HIJA 2KW5A 1INLA 2G70A 4FR0A 1KXZA 3EEYA 2YX1A 5EG5A 1YFLA 4O29A 5K0NA 1XTPA 3FUUA 2PX5A 3LPMA 3GRRA 3PB3A 3K6RA 5DTMA 3VYWA 3OZRA 3TM5A 3NJRA 3M6UA 5EQJB 2EG5A 5EVJA 5EIFA 2BR4A 2UYQA 2IDKA 4ATNA 2B25A 1R8YA 3H2BA 2ZZMA 3IYLW 3U81A 3TKAA 1VBFA 4PYLA 3LBFA 2ZCJA 4F84A 5LQAA 2AOWA 1X19A 1M0EA 1XVAA 4DQ0A 4KVZA 2PLWA 3KHKA 4KDRA 5E1BA 4Y30A 3X0DA 4NECA 1JSXA 4X61A 2ESRA 3Q7EA 4FSDA 5ICCA 3TKYA 1XXLA 3AY0A 1B42A 2IGTA 3I64A 5CVVA 5F2KA 3NDJA 5K05A 2FYTA 4E70A 3OCJA 1SVUA 1NW7A 4BLUA 3EEOA 5IH3A 3F4KA 3GGDA 3UBTA 4FP9A 2QE6A 4OX9Y 9MHTA 4MHTA 3LDUA 1JG4A 2ONZA 2NNWB 1NW6A 1YUBA 4FGZA 4PYKA 3GCZA 5G02A 4ER0A 2Z6UA 3ORHA 2YTZA 2IH5A 4QDKA 3HCBA 3M33A 5FA5A 3THRA 1VP3A 4C03A 2PX8A 1WY7A 3KQTA 2O57A 1WG8A 2PY6A 3EMDA 3MCZA 1R8XA 2WA1A 3NWEA 3P97A 1JG1A 4YMGA 3FUTA 1EG2A 3UZUA 1G8AA 2K4MA 4RVFA 4IWNA 1ORHA 3C3YA 2NXJA 2P40A 3CCFA 1ZKDA 3GRUA 1QYRA 3TOSA 1X1DA 1G60A 5KVAA 2R6ZA 1G55A 3Q87B 4M37A 5E1OA 1RI3A 3C6MA 3FZGA 5ICEA 4RSRA 3CBGA 1VQ1A 3FYDA 2AZTA 3B89A 2I7CA 3LDFA 4GEKA 3UJAA 3EVZA 4P7GA 4CWAA 3KU1A 1M6YA 3PFGA 3VC1A 3FUWA 4RTRA 2IH4A 2AOUA 3EVCA 3KPJA 10MHA 2HTEA 4QTTB 3ERCA 3HA3A 5FHQA 4RTOA 2HMYB 3HCFA 5GWXA 4GBED 3OU6A 4RTKA 2UYCA 4R6WA 4FZVA 5DSTA 3ELWA 3KR1A 5E9WA 1ZGAA 3P2IA 2UYHA 4LWPA 2JJQA 2PGXA 5MHTA 2AOTB 3O4FA 4RTPA 3REOA 2VP3A 1H1DA 3DTNA 3UJ9A 3NW9A 4M7RA 2B78A 4BP1A 3C3PA 4RVGA 5E8JA 3TRKA 5E9QA 1RJDA 1N2XA 5K0JA 5K0GA 5ERGB 3BWCA 3NTVA 4HTFA 3MGGA 5KQRA 5CCXA 1R6AA 3KPUA 1UIRA 1L9KA 4AZTA 3GRZA 3SXJA 4XUCA 2GPYA 3B3FA 5CVDA 5CIYA 1AQJA 2R3SA 4AZWA 2HWKA 2B9EA 2OY0A 3NDIA 1SUIA 5FQOA 4Z2YA 3UA4A 3BXOA 5HEKA 1U2ZA 4MWZA 3UWPA 4Y2HA 3E05A 3LCVB 2OPBA 2FCAA 2GH1A 3FPGA 4YV0A 1YZHA 5DM2A 2CMHA 2H1RA 3LECA 2YUIA 5P8WA 2FHPA 2GLUA 2JHCA 2YVLA 2ZBPA 2N47A 3OE5A 1G38A 2PVCA 3EVFA 5DLYA 2P3LA 1NBHA 4PNEA 4GC5A 2PT9A 4GUAA 1D2HA 4RTJA 2H11A 2OYRA 5CVJA 5EOVA 2AOVA 3AJDA 3DP7A 4YV1A 5ICFA 4BLWA 1FP1D 3MAGA 5E2BA 5EHIA 4LG1A 2G72A 5K0CA 3LDGA 5DXAA 2HR1A 3GJYA 5F2NA 3B7PA 4HSGA 4PIMA 5K0LA 4RV9A 2LD4A 3B5IA 4RX1A 4XUDA 1VE3A 4RTMA 4PONA 3THSA 3DUWA 3KPVA 2IH2A 2P8JA 2ZTHA 1R00A 3G5TA 4M38A 4FSXA 1WXWA 3TFWA 5F2OA 1SG9A 4YUWA 3DH0A 2EX4A 1DL5A 2B2CA 4WXHA 5EGSA 5H02A 3TLJA 3PVCA 4HGZA 3DULA 5LQCA 3KPWA 4OA5A 5EPEA 2VS1A 4YUYA 4BP3A 3T0IA 1KPGA 1NT2A 2OZVA 4FT2A 1D2CA 4KIGA 4PYQA 4E2XA 2NXNA 5E2AA 3I58A 4DF3A 4RVHA 2Z6AA 4PYMA 3NMUF 3DR5A 5BW4A 1EAMA 3FRIA 3PFHA 4RWZA 4E31A 2ZWVA 3JWGA 1P1CA 2YXDA 4R8SA 5LQKA 3CVOA 1L3CA 2WK1A 3M6XA 3HP7A 2AN3A 3GO4A 3DLCA 3SM3A 3LL7A 5E1DA 4QPNA 1P1BA 2GB4A 3GNLA 5FUBA 3G2OA 2H00A 2Y1WA 1VPTA 1BKYA 2ZBQA 3SX0A 4ZTBA 5GIPE 2Q41A 2BR3A 2VDWA 3BWBA 4PYIA 5GM1A 3PS9A 3V97A 1EIZA 1O9HA 4C05A 2P3QA 3KQVA 2UYOA 1F38A 3KKZA 4KDCA 3OZSA 3EPPA 4QDJA 3G5LA 5GM2A 1HMYA 4QTUB 1RJFA 2CWWA 2HV9A 3B3JA 5EKUA 3G8BA 3UJBA 4R8RA 2GS9A 1O54A 3G2MA 1QAQA 3P2EA 2ZIEA 4LECA 3G7UA 2P7IA 5FQNA 4RTSA 3O7WA 3SGLA 1WZNA 1DUSA 1NBIA 1PRYA 4DM3A 5JUWA 5LSAA 2PWPA 2GAFA 3A7DA 4GOLD 4PYOA 5HFJA 3E7PA 5EKXA 1DCTA 1KHHA 2OKCA 3KQPA 2I6GA 4OA8A 3NVKI 1XDZA 3CC8A 4PIPA 3M6WA 3GU3A 4F85A 2QRVB 2PJDA 2EJUA 2V7EA 4GOOD 4HTFB 4MQ4A 4CTJA 1NE2A 5DSXA 3FTFA 1EJ6A 1YB2A 2AN4A 3EMBA 3BGIA 5CUQA 2ZSUA 4GC9A 5FWDA 3ELYA 1G8SA 2ORED 1KPIA 3AXSA 3PX2A 3EGIA 2CL5A 3DXXA 3TR6A 4C4AA 2OXTA 2ZZNA 2DULA 3KQWA 4GQBA 5T67A 1KIAA 2PBFA 2IBTA 4L7VA 4RTNA 1SKMA 1JQ3A 4P7JA 3HNRA 3EVAA 3UFBA 1RJEA 2BR5A 2G8NA 1NW8A 3A26A 4U7TB 3VC2A 4C07A 3FUVA 3KQOA 2ZULA 3IEIA 3HCEA 4K6MA 4F86A 2XBMA 1NW3A 3RW9A 1AQIA 2IIPA 2AOXA 1XCJA 2PX4A 1BHJA 3G89A 4OBWA 1RI5A 5DT2A 3NWBA 5KYGA 3EVGA 3NVMB 3CJTA 5FADA 2XVMA 5FULA 5LR6A 4M36A 2AR0A 3CGGA 4E2YA 3QOXA 1Y8CA 1ZGJA 2WA2A 3OFJA 5ICGA 3PLAE 2JHAA 4E2ZA 2XVAA 1T43A 4P7FA 5CVEA 3FPJA 5CM2Z 2QYOA 1IY9A 4PYNA 2A14A 2VDUE 2C7OA 4E2WA 3P9IA 3M4XA 3MQ2A 4GOND 4ER5A 4JXJA 2AVNA 1AF7A 2P3OA 2YXLA 4UOEA 5HZMA 4RVDA 5K8VA 5KQSA 1UWVA 2JH9A 2PV0A 4IKPA 1QANA 3KQSA 4V0RA 5DRTA 5FTWA 1ZHFA 3T7SA 5GINE 3FUXA 4QVKA 2YXEA 3R0QA 1SQGA 3A27A 1P39A 1NV9A 2EFJA 2O06A 3P2KA 5CVUA 1KR5A 1N7IA 5EEGA 5DWQA 5E9JA 1V39A 1FPQA 2YR0A 2BM9A 4C06A 5DX0A 5C1IA 2XYVA 1FBNA 5C9ZA 5HILA 1ZG3A 3GRYA 1JG2A 3HA7A 3FPFA 2JHPA 4R6XA 5DXJA 5B1SA 3RODA 3SMQA 3SR4A 2VDVE 4A6EA 3TPZA 4YMHA 1R74A 4DCMA 5K03A 1KYZA 3CKKA 3IHTA 2XYRA 2VZ9A 3TMAA 4EVIA 2OBFA 4EKIA 1PJZA 3S68A 1SQFA 4V0QA 5EZQA 5EZSA 3MERA 1JQDA 3QV2A 3I53A 2JH8A 3I9FA 5EIWA 3G2QA 4PGGA 1KYWA 3HCAA 4AZVA 1N7JA 3HCDA 2BM8A 3LHDA 2E5WA 3FPEA 5T64A 2PT6A 3JWIA 3UJCA 4DMGA 1ZQ9A 3MTEA 4E33A 4ER6A 5BP7A 1QAMA
chains in the Genus database with same CATH superfamily
2GERA 4PICA 4NCBA 1TW2A 1U3DA 2X4DA 1HC7A 3QKSA 4ZU1X 3NEPX 1U7TA 1U94A 5JWOA 4JLBA 3LRTA 2C5FA 4KNYA 1CQJA 2EL9A 3QXXA 4NY1A 4QBTA 4FKZA 3WC4A 5DM60 3DZIA 1L1RA 1R16A 4YHBA 5FI0B 1WLSA 3I23A 4DQLA 3BKXA 2C1ZA 3HPRA 4D0NA 2A9VA 4LNUB 1KGDA 4RTLA 1H2FA 1E0SA 4XX1A 4K9KA 5HBGA 5HS4A 3QUAA 1A9TA 3OPVA 1C3LA 5K6AA 1NXOA 3AM4A 2BCJQ 2EJCA 2H2DA 2JF0A 2NAPA 3EY9A 3IESA 4A10A 4GEGA 1NR5A 4HUQB 4NJEA 2FPPB 5K20A 4LWOA 4B1FA 1MV5A 2BIFA 4QOEA 4GXQA 3INYA 3VBEA 2EGGA 4AWAA 3ZGNA 4S1OA 2YL2A 3PNBA 4IL5A 1WUIS 3KJXA 1Z0DA 3WL5A 5I7EA 4FEYA 2CMDA 3JXEA 3L43A 2HK6A 3W5DA 1XJCA 2I29A 2A7XA 3K0SA 3N1UA 4KO4S 3UOGA 4GSLA 4YQYA 1RZ3A 4TMFA 3QOYA 1KK0A 1OLSB 2OILA 3R6TA 1I3OA 1N5KA 2I65A 4ZXPA 3LK6A 4OUDB 1YZTA 4EFDA 4GO1A 3O3OB 2Z5LA 1T8TA 5JADA 1Z74A 2NUAA 4AUMA 2FUKA 2LCQA 2AE2A 1RLMA 1H6DA 7AT1A 1VRVA 3PF8A 3AR6A 1BEZA 2FPLA 1ZN8A 3ORSA 2XCLA 1JDPA 2O2ZA 1DIAA 1Y1KE 1JF8A 2B8TA 3J7TA 4JKIA 4FFDA 5JYEA 2PH3A 4OYRA 1M0TA 3LZ6A 3TL6A 3W6ZA 5CCBA 1N7GA 4TSKA 1TADA 4G5RA 4HQ0A 4DCSA 2C94A 2O07A 4BU1A 5A7FA 1FTNA 3KTFA 3S0JA 2ODNA 1GWNA 5B3LA 5KTKA 1DFIA 4NZMA 1D1PA 4CG1A 1YB6A 5CLGA 5M04A 4FFRA 1Z5WA 3LFHA 5CEJA 1K6XA 2B8NA 2PX6A 5DLPA 1YL6A 1YULA 2BI4A 4OHOA 1A5BB 2FPUA 4UUMA 3WWCA 4AF6A 2WHYA 5CNJA 4XGRA 2PCJA 2PL9A 2C03A 1DADA 3S2IA 3I1JA 2D1YA 1EM8A 5JRDS 4XWWA 3UIEA 2J5RA 3IMGA 3D6FA 3DB2A 3H2KA 3WRXC 2ORWA 3BSWA 2HDNB 4B7CA 3EX7C 4R1NA 1BROA 1XVVA 2H7CA 4LYYA 4C6HA 3LOUA 2P0EA 2GTPA 4DC1A 3EHEA 3WYBA 1PFKA 2PZKA 5JZMA 4TWAA 1JLLB 1YGYA 1STOA 3IHKA 1ZIOA 5I9BA 1IYZA 2PBRA 3C7KA 3E3LA 3RTCA 4EJ0A 1T5IA 1U0HC 1VSQA 3Q3CA 1U98A 4G8DA 1IHPA 1P9LA 4HGYA 2OGZA 4ZVTA 1RT9A 4KO3S 3ZV3A 1QRSA 4JLOA 4LRYA 4KO2S 1EA5A 1TO2E 1X7DA 4YRTA 3DEKA 5FOXA 3K8ZA 1SKAA 2IFTA 2QAIA 1XLWA 2TRSB 4DARA 4YUZA 3QW4B 2ZR8A 5A2GA 1KI2A 2V7VA 3KYIB 4ZFNA 3F1KA 3FPSA 1XMVA 5ADUS 1EDEA 3VDNB 2W11A 4WN3A 1OLUB 4MIYA 2ZWMA 1JJVA 4OGFA 5A4JA 1EDDA 1M8GA 4O2AB 2YVAA 1MFPA 2FSHA 1T2DA 1QO0D 5IUNC 1XXHE 2ZI3A 3N86A 3CF4A 1DI0A 3QYAA 4QSMA 3PHBE 2R7LA 1S3FA 4X7MA 3ZNPA 4PC6A 5B7PA 4XQ0A 2ATVA 4Q1BA 3OFNA 3TLMA 2I3AA 1DAOA 4BGIA 2AI1A 3PTAA 4MYHA 4B3CA 1NVWQ 1VPLA 2J9XB 4D0RA 4P4UA 1FYXA 4CTOA 5LJIA 4R2MA 4W5TA 3MK31 2ZQ5A 3ZJ5A 3PCTA 4RIFA 5DNDA 4FW9A 4K5QA 3QIAA 5E6SB 2N1MA 1UBEA 3G9QA 3HXPA 3N3BC 1ADJA 3HC7A 4ZK6A 5EUBA 3TSYA 1G1MA 3D3NA 1RI2A 1XCOA 2XB6A 3GLIB 3DMHA 2EWVA 2AMYA 2FB9A 2PMBA 1WTCA 1NM5A 2Z83A 3B3GA 1Y5LA 3EBOA 4JCCA 1OROA 3E1SA 4DRYA 3T1OA 4EGAA 2Y0BA 5JROA 1M2NA 1SCJA 2QN1A 1XA0A 3ONVA 3GEGA 1BMTA 5JYCA 5A7HA 2FH5B 4R7ZA 4ZZ2A 2W83A 1YC2A 2HQSA 3GT7A 4OI0A 4HKTA 3J7AC 3PTLA 1CRLA 3BGDA 1FJGB 1C0PA 5HP4A 2P30A 3ER9A 4MUBA 2C7RA 2XUIA 4UPEA 4KRGA 1DJLA 1PEKE 3IVGA 4PW0A 1L5RA 1B74A 1MXHA 4XFJA 2JG3A 1DKQA 1TM3E 2JPDA 4LJ7A 4HYTA 2P2YA 4LCBA 1RLTA 4Q03A 4W63A 3T3IA 3WLEA 4BB5A 1N3IA 1U2DA 3IA2A 4ZHQF 1SD1A 2BGRA 2DWCA 2RHWA 2A67A 2WUVA 1XRNA 4EGJA 3KSRA 3LH5A 4FFLA 4CL3A 2BTQB 1CCWA 2PX5A 1QLWA 3FUUA 3IXMA 4KL8S 4PRYA 1T3ZA 4F1WA 2VJYA 3E81A 1RPJA 4HEA1 4B3DA 1FIUA 1XYYA 2O1WA 3EG9A 1E9FA 2QM0A 4EO4A 4LOAA 3ETNA 2JFVA 4P1ZA 4ATNA 2FR1A 3JSAA 3TUZC 1Z13A 1NULA 3W9SA 3EFOA 1GNRA 4RJLA 3RVQA 1IBRA 4KQIA 1J8FA 3KT3A 4IH1A 3AZOA 4MKGA 3U3JA 4QC2A 4GQIA 2XGOA 2HV8A 2QDXA 2PKCA 4ETIA 1XKXA 2NADA 1J1IA 2R751 4BB9A 1A88A 4EDHA 3ORFA 1Y42X 3W1WA 1XAJA 1KVQA 2E4VA 3OURA 2PYZA 3DMRA 2EFCB 3BS4A 4ZVOA 5IH3A 4HY3A 4U8GA 4B3MB 1JG4A 1QGOA 5G02A 3MRSA 1Y81A 2WICA 3GCZA 1DEKA 2QMOA 3KUKA 4PQGA 4C20A 3DL0A 3BORA 3DAHA 1CUYA 1W5TA 1FQWA 1K6MA 2JAPA 2PSJA 1RKBA 4C03A 4ARUA 1LBTA 1N3YA 2O57A 4UBOA 5LCXA 1V9LA 2OP1A 4C3UA 2X9NA 1GPJA 4RF4A 1ZD2P 3VNQA 3HU2A 3A10A 3QPWA 2CD9A 2HZ7A 3LXMA 5TQ2B 4COOA 4ENSA 1E2NA 2G9RA 4JT4A 5BWLA 1JG7A 4KR9A 2BSXA 3B1VA 5JIBA 1BWPA 3QZUA 1CUHA 1Y1LA 5AIBA 4WEQA 1NW9B 1P5ZB 1QG4A 4H7DA 1AUVA 1BMQA 2R8ZA 4F4HA 1JGTA 2CB9A 3FYDA 3HDHA 4ALMA 2HI0A 3EGWA 3VC1A 4M1TA 2BBTA 3HJBA 2NT4A 3K6JA 1JJ7A 1QH8A 2HTFA 4H7EA 3VKGA 3TOXA 4ROSA 5DM70 3WRVA 1FFEA 4FCTA 3FYHA 5BMOA 3KLNA 1C14A 4H7JA 1OX6A 1WXEA 2IWHA 4DEXA 3ZBPA 4C29A 1QH9A 1UXOA 2DJIA 3ZK7A 2JLVA 3UGTA 2RKOA 5K8TA 1KDZA 4FFVA 2O3RA 2W0SA 1USWA 1I2BA 2GHIA 3M2TA 2EEZA 1AUXA 1YRYE 1GZ6A 2WJ6A 4UTPA 2WUGA 2XQJA 1NR7A 2AUNA 5ILGA 2OKGA 4AVYA 3LE8A 4Q7JB 4Z0TA 3PNLA 4O3MA 3W5CA 2BRUA 5K0GA 3K53A 4O1MA 3BWCA 1RMQA 1T8PA 2IIBA 2ONCA 4I7EA 4IEEA 1VJGA 4NDAA 4X92A 4C4RA 5ED4A 2OZEA 4GZ6A 4FI3C 1EG7A 2GM5A 4JODA 4PRZA 5EP4A 3RC9A 4B3RB 4JELA 4KMOA 2R8BA 3COZA 4Q4JA 3RRNA 1SUIA 1AKUA 3X3HA 4EYKA 3AX6A 2I67A 1LW6E 5A3SA 4RGBA 1HNXB 4TYYA 3LUAA 1GGMA 4ZJZA 2ASEA 2OPBA 3K05A 4HNSA 3R7DA 3TD6A 1NP6A 1KH2A 1R0CA 1P7WA 1V3UA 1Z18A 3LOQA 3T15A 5J2UB 1TYEB 3ETHA 3WB0A 3I0MA 1W1WA 3SIRA 3I2JA 5JS2A 3DDCA 4LMBA 1U0LA 1GAXA 3O95A 2GPTA 3WDSA 3VPAA 1SBTA 2X5KO 3O47A 2RGNC 4AP9A 3PVZA 4MGIR 3IBTA 1NPYA 4KWEA 2AN1A 3C6ZA 3TTYA 3WGJA 3GGPA 2J8ZA 3UMRA 1BH2A 1FFDA 4YV1A 1SKUA 3U44B 4U2CA 4JP2A 1OHHA 9ABPA 1RNLA 5AKLA 1DJQA 2VSOA 5K0CA 4IUYA 2IEZA 3HYTA 4FMCB 2ZIXA 4MR7B 3VHXA 1L1QA 4YCNA 2RHGB 4RX1A 4RDCA 1RYNA 1VB5A 2QQGA 2RHOA 4NENA 2BHNA 3ZWCA 4KWTA 5CB4F 4US0R 1MAHA 1SIOA 4UXJA 4ZAWA 4A1FA 2PJRA 3ZD6A 4B6SA 4FSXA 4BNWA 5A0FA 2MYNA 2H8GA 2RB4A 3EVNA 4N5LA 4Y1RA 3ESCA 3NRJA 4BBJA 4LZNA 2EYUA 4TWRA 4I55A 1UPBA 2PRKA 1VI2A 5KYYA 1YQTA 3FTPA 1OXKB 4R71A 3DULA 1CW2B 4YJHB 5DOVA 4D26A 3LW7A 4HGRA 3WISA 5C8YF 3ZHOA 2LVBA 1ODJA 4CV0A 3LKVA 1PZHA 4JLDA 4LNHA 1ZGGA 5BV2P 5IYZA 1NF3A 1PGQA 1NWHA 3OT4A 4IGEA 1SIWA 2AEEA 3RYHA 4ASUA 4F6LA 3J80A 3F73A 1FPMA 3DBOB 2IUYA 5ECWA 5TLSA 1FLVA 2LV8A 3D3KA 4WXPA 5G53C 1NY5A 2O59A 4G1EB 1JQLB 4WN9A 4JC4A 4WW0A 4E31A 1P1CA 4JJ4A 1RM5A 1OXTA 1VJ5A 4BLPA 4LRUA 1BEUB 2JD0A 4XVRA 1PT6A 4LY0A 4Y67A 4ZOBA 5IS2A 4EB3A 4RM3A 4YRDA 4AJPA 3WZ2A 1WBDA 1SHTX 4PPYA 3V4LA 3C3KA 2J7PD 4CF6A 5IDWA 4LE0A 3L02A 2YIDA 2P3QA 3ZXSA 1Y6GA 3V48A 4FJ0A 1MQSA 4YJ3B 4ZAVA 3RVRA 3JQRA 4QDJA 2BGLA 2NZ2A 4HHEA 3NOOA 4JR0A 4L75A 3M5PA 1E4EB 4OSEA 4XKJA 4EEXA 4B6JA 3NM4A 1K5GA 2EZUA 2ZIEA 3H5IA 4IF4A 4OI4A 5L6MB 2CBZA 1CZHA 1NJ8A 4HFMA 4US2R 4KYUA 2XTAA 3STYA 1EX7A 1ODSA 3DKRA 1E99A 2PWPA 5KTYA 2XZOA 4AWXA 5LZ8A 5EKXA 3HO6A 1N2IA 2UKDA 1Y1PA 1AKYA 1CS0B 1MR3F 1A98A 1IG3A 3C48A 4G4IA 3Q2OA 4YGXB 1CY2A 1VHJA 1W0JA 4ZVRA 4D43A 2BUAA 2H2WA 3D2AA 2VLIA 4BCBA 3GLIE 4U2EA 4ANFA 2WYUA 3I28A 3TZCA 4LF5B 1QHIA 4BZZA 2WJZB 2ZSUA 2VAMA 1NT4A 1EVJA 2O7VA 3EGIA 3FLMA 1Z56C 2CLCX 4AP5A 3HI6A 5I9NA 2MTBA 4FGJA 4GQBA 1KJQA 5K45A 2V7QA 3UV3A 5FX2A 2PBFA 2XNCA 1RYBA 3B8HA 1JP7A 1CX9B 3GQVA 3I1YA 4IQFA 4P35A 1SKMA 1KDYA 1B0PA 2EQ5A 2JCXA 1NW8A 4ILEA 2VQEB 5CXUA 1ZWLA 4BDTA 4MPPA 4D92A 4BNZA 3D81A 4K6MA 2HWUA 3S2EA 4MR9B 2VA8A 2X3FA 4N6NA 3RRFA 3UF0A 5FDFA 2PUDA 1VL8A 3DOJA 2PX4A 1NVTA 3BBLA 4W1QA 2C5AA 5AKJA 3VI4B 4OK5A 1AQYA 2GWRA 3WRWA 4QNRA 2XBUA 1KQPA 1LPAB 1MVOA 2BFCB 2RIRA 2ZJ0A 4YACA 1E0JA 4DXAA 3S55A 2PDAA 4CM4B 4JWKA 4M55A 4P7FA 2JI9A 3UT6A 5TC4A 4O5AA 1X86B 3SOPA 4MRNA 4W5RA 3QF7A 4BKPA 2GK4A 4KXLA 1OBVA 2X3UA 1ZR2A 2B83A 2P3OA 5DXFA 3KSMA 2FQWA 1OX5A 3I3OA 4M60A 4YB8A 3UW1A 4OSOA 3AH8A 4YAKA 3WO0A 4MQ5A 5L7WA 2V6GA 1GQOA 5GINE 4H08A 1N6HA 1VG1A 1Y5IA 3DDSA 3ZNQA 2V7TA 1RQLA 2P6RA 1J56A 3FNHA 3O91A 1T1IA 2J7KA 4UCWA 5C1IA 1C7ZA 3ZIAA 1FBNA 4W9NA 4FE7A 5T3YA 4BNUA 3SR4A 4CM6A 4LDZA 4Z49A 2V5UA 1E94E 1AK1A 1L7OA 4R8LA 2X6RA 3R9XA 3M1IA 1ABFA 1DRVA 2C9YA 2C3MA 1VCIA 4BVEA 4TLDA 1Q1NA 4CCYA 3ICEA 2HK8A 4PGAA 4YAGA 1FNBA 4XVUA 4NOJA 1CUSA 2AQ8A 2F3QA 2ZI4A 1TLTA 2VH1A 3AESA 3FVWA 2NW6A 3HCAA 3HXTA 1IEVA 3IAAA 5H0IA 1D09A 1ENYA 2UVQA 3OF3A 4WFIA 4TGLA 5T64A 2IHUA 3AP2A 3EYWA 4R1UA 3ZJUA 3E4DA 4IAOA 2FX3A 4MRAA 4P38A 2BJWA 3RTEA 3DLHA 5GY7A 1TVCA 2EFDB 2VPIA 2PVSA 1RFLA 1WBJB 2WSBA 4M8LA 5DTQA 5EMNA 1Z2CA 3BILA 1HXHA 3E70C 1GYRA 2B1IA 1CVRA 3DLIA 1TTPB 2HRRA 5C31A 1L3BA 4MO2A 4D81A 5DW3A 2FHSA 4S35A 5K3FA 3U31A 4N54A 3AR3A 3G8DA 3IPCA 1BRTA 1X9IA 4Y2PA 3K0EA 4ZQEA 4RD2A 4DLXA 4E15A 1IAVA 2QM3A 4R1LA 4HRAA 2B4AA 2IXDA 2YMPA 2BDTA 1G16A 4TQAA 3TUJC 1X1TA 3OE7A 4IXWA 2ZRGA 5JSQA 1E5QA 5BQXA 1P5JA 1V2HE 2GJ4A 2JCVA 3A3OA 1OJLA 1DJOA 1EPUA 1Z37A 4TL8A 1NDQA 4TROA 1S0UA 1U9ZA 5TQVA 3CLVA 3K0HA 1O0BA 1C8LA 4XDHA 4BWYA 3P9KA 3LXRA 4O4IA 5I51A 3DDUA 1J49A 1TFUA 5BQ3A 4NF2A 5LQJA 2GYUA 1A4IA 4H0NA 5K6RA 1YZUA 3LY9A 1O97C 4IIVA 1IXKA 2OGSA 4EBFA 5C5EA 3FOFC 3CVYA 2ZRPA 2HHAA 3F9CA 3AR9A 2VRCA 3R77A 4HB2A 3DEZA 2NVUB 1YS9A 5BUCA 5TGDA 2PD3A 1CS4C 4TLLB 1D8TA 1EVIA 5FCDA 4A23A 3DBLB 1X8LA 1YR3A 2M2IA 3A28A 3CRNA 1NV8A 3MVEA 1KVSA 1JTFA 3IAHA 3RAJA 3KDSE 5B64A 5JEDA 4X1IA 3AVWA 1E4YA 2HFJA 4TN1A 2IHJA 1IBLB 3NCTA 3ONDA 2WG0A 4Z7JA 1I1HA 4ODIA 2PMDA 4NG5A 1MBZA 3PDCA 4X63A 5BN4B 2ZAMA 5TQ0B 1G20B 1THMA 2HX1A 4A73A 1QFJA 1M9NA 8AT1A 5LQUA 1CF9A 2ZE5A 3IEVA 1LJUA 1CC1S 1JVSA 4N0QA 1KBZA 4TTRA 1VBKA 4HLDA 4EPTA 4HB3A 4H4CA 2WTNA 3TB4A 5HJ5A 1I2MA 3SLKA 3E7XA 4HQLA 3TECE 1IG0A 3U7IA 5KWSA 1QPZA 2YWCA 3X1XA 1ZL0A 2GD2A 4Y1EA 4YFVA 1TUGA 1V7PC 1XAHA 2QG9A 2CT8A 4ZK2A 2WWIA 4TSRA 2QBYA 1ORVA 1Q95A 4BMNA 4HVCA 2JVJA 2HT6A 5LB2A 3IUPA 5IAEA 1QZTA 2ZUDA 4WBSA 4Q19A 1IBKB 3ESQA 1C1HA 3F5FA 2VPQA 3NGMA 4LDPA 3ME5A 3FHJA 3TZ6A 1GSAA 3RSCA 2WWFA 4WGFA 4ZHQB 3ZE8A 3O74A 4R8MA 1XNJA 2ATCA 1Y8QB 3AVPA 2VUSA 3SIWA 4BJ6A 3BE5A 1XD9A 4Q9DA 1RACA 3TSCA 2KI5A 1A9QA 1XRMA 5FT9A 5DYGA 4UUOA 5HK8A 5JDIA 1FU7A 1XMIA 1ZXLA 2VYNA 1XL0A 5JJ5A 4FFBA 1AO0A 1KAGA 2BEUB 2Y93A 4KSCA 1O6CA 1YR1A 1FJXA 1T36A 1QKJA 4OLFA 1V16A 2E5FA 3I4LA 1TD9A 4U9HS 3ZWAA 3OAAA 1XTZA 2UXDB 3TQIA 2Z2ZA 4B17A 3DBHB 1QC5B 4WY8A 3ZKWA 5JFTA 3OPYB 3ECAA 5J9FA 1H4TA 5EJ8A 1Y3BE 3TK1A 4B75A 4B83A 2XAAA 5FV4A 3CG0A 3AUKA 3F3YA 4DLRA 4GMXA 3CRMA 3L9XA 1NBWB 1DLJA 1MA0A 3NNSA 3PHIA 1GQQA 3EGVA 1C9YA 3STUA 1DAPA 1JALA 4JZKA 2HQBA 4OM8A 2FWMX 3EWIA 3TQTA 4AY4A 4XM1A 2TS1A 3D3WB 2WQ6A 4BLQA 4DNOA 1LPPA 3EEBA 3KAPA 4DJJA 2GXSA 2AL7A 1XMQB 4C04A 5EXPA 3FHOA 2XZPA 3C3WA 4LTNA 2QL9A 5UKDA 4CV2A 1LZKA 5EP2A 4GZMA 1QGUA 3EA0A 3LF2A 4AX8A 3W9YA 4HX9A 1L7BA 2RCYA 3KAQA 4ND7A 3ADKA 4M0MA 4MWGA 4EG3A 4MYTA 3G0BA 5TS3A 1M5TA 2V97A 1JL3A 5BN5B 4EYSA 3PXGA 5LYJA 4JJKA 3GUCA 4YRGA 3SJCA 3O1JC 4EY5A 1GNQA 4ZCQA 4GNRA 1D4FA 1NDHA 3CUEF 3TJZA 1A0OA 3DMNA 3V7YA 2C4UA 4E7PA 1HQYE 1YJ8A 1GFIA 3WKEA 2I3DA 1TCVA 4J0IA 3LIIA 4R8VA 2IITA 5IT4A 9LDTA 3CJQA 2FSIA 5A4MS 1EE9A 2XBLA 4YV2A 2L18A 5TPZA 1S3GA 4DL9A 3K96A 4JBLA 5KYXA 3ESBA 3K4HA 1GDDA 4UUNA 2A88A 1AOXA 4IV8A 1QDEA 4S2UA 3GIWA 1IRIA 2YWBA 3CRW1 5EZ6B 1BO6A 1TAQA 2GZ3A 1O0CA 3FPKA 3L6OO 3K4PA 3WJAA 2DPMA 5C3MA 1C81A 4MJ3A 2DUJA 1IQ0A 3JWPA 2BMAA 1BXGB 4QULA 2Z2JA 4NMLA 1W49A 2IF0A 1P4SA 1CJMA 1MX1A 2VYFA 4MGKR 4MV9A 4YMWA 2GD1O 4EMSA 3GQBA 1K7CA 3AUYA 4ZA2A 1NF8A 4ACAA 1BX0A 1N8NA 2XYPA 3ROFA 2VF5X 2R65A 4F91B 4LFAB 5BNIA 3SQDA 4OKIA 1MMFB 2DR0A 3MJRA 3QEMA 5EQJB 5EVJA 3JQGA 5IP5A 3U1BA 1H4QA 1KARA 2VT2A 1E7RA 1VLQA 2FFJA 2WVAA 1EJBA 1SU8A 4M98A 4DWOA 2ZJBA 3L7BA 2XE4A 4WASA 4LOIA 5AJUA 3TEJA 3TKAA 2WJVA 4CIWA 3K0KA 5JU6A 4J0FA 4JA2A 4CFYA 2ZYVX 2OV4A 1JH9A 3W90A 1ZH0A 2VNIA 3P2JA 2PLWA 3KHKA 5TMEA 4D99A 2VP6A 2H7YA 1Z5GA 5CAEB 2RAUA 2ZSAA 1R0LA 1F9EA 1SUWA 4RPIA 4Y98A 3CO5A 4P81A 1SXJA 5ARBA 2OCPA 2VOEA 4GM0A 5B4VA 3H5NA 4BUZA 1F3OA 1JAHA 1POXA 3WLAA 5A9SA 1Z06A 2H1OA 3G1TA 2VF8A 4KBYA 4UATA 3TQOA 3S28A 2RGUA 4ZYWA 1XOIA 5CW1A 6AT1A 2Q6TA 221PA 3ISJA 5ESXA 3LDUA 1YUBA 3I9NA 3INRA 2PKXA 2B37A 3DL7A 1UPCA 4R2HA 1XN1A 2SICE 4XA8A 1SN7A 2CLDX 1RQ2A 2XXAB 1IFXA 2JH3A 3VISA 3MJCA 4V38A 1WKVA 2B5OA 3HCBA 3Q0IA 3TZLA 1FP6A 2Y4OA 3I76A 1A8PA 1A82A 2C5BA 3K5IA 4FK8A 3U60B 3BTVA 4GX2A 4DGQA 1K63A 2Q7XA 1Y6ZA 1DIHA 3RRXA 3UZUA 5CB4B 2FGJA 4KXXA 1ORHA 3LV8A 2NXJA 4ZO4A 5B1HA 2VAXA 3TOSA 3OT1B 3ICWA 1G55A 5E1OA 5AKGA 3C6MA 3ROQA 3FZGA 2AW5A 4KQJA 4RSRA 4TMZA 4G09A 1E63A 4JWTA 4RZSA 3GB9A 4JI5B 2ZITA 5MN4A 3FKSD 1TX4B 4BXOB 4DN6A 2Y67A 4DY6A 2ISSD 4P93A 3SG0A 4RTRA 1S1CA 1GTSA 4DBZA 2BDEA 1PTJA 3JCZA 1J2EA 4N5MA 3D8HA 4FDVA 1F9AA 1R0SA 3I83A 3NFYA 4QQ8A 3VBCA 1DEHA 1CJUC 2OHGA 2DWUA 3PFBA 2F43B 3KHTA 2XNHA 3RAGA 4ZZ1A 3A1UA 3RC3A 2QAGA 4PQEA 5DHQA 3HY3A 5LBTA 3KOUA 2O2GA 2AOTB 2VHJA 3N2NA 4G9EA 4UCXA 3T4UA 2IYPA 2EIHA 1W5AA 2VP3A 1NKSA 2CUTA 5EP3A 3NW9A 2VTEA 3F78A 3REGA 3PJDA 4RD6A 4Z3KA 5KNDA 2EW2A 4FW8A 2PA3A 1WV1A 2X15A 1W4CA 3DJYA 4PPFA 4L85A 5EAIA 3NTVA 1JIUA 1T1SA 4OQMA 5GZ3A 3GLFA 3RR2A 5CHEA 4F97A 1FXWA 5HZGA 5E3HA 3FI0A 1U0RA 3CTPA 1RZUA 4AZWA 1MX3A 1YQ9A 4G8BA 4PQRA 2MINB 4TZ6A 1MC1A 3CE6A 2NWQA 2F3RA 4XIGS 1RRKA 3DKKA 3D7SA 4RMJA 1GL6A 1A8QA 3QFFA 1IWPB 2M6KA 3TAHA 2ZJZA 5IKPA 4W9RA 2YDYA 1ONPA 4K1LA 4IYRA 5H81A 4ND2A 1ZD3A 4YFYA 3RASA 3E82A 4J7AA 4UXHA 2YWGA 5ENVA 4JEMA 1FQOA 3SHVA 4BASA 4L73A 1X7XB 4LDNA 1Y3AA 3EVFA 3RVOA 4EKNB 1NBHA 1UIMA 1KJZA 3NP7A 2PT9A 4MWCA 3QMVA 3PBKA 2GXUA 5CP8A 2F1RA 4WWHA 1KEEB 1SIBE 1ZYUA 4DIOA 5ALQA 1R0BA 4A7PA 3C6YA 1UJ2A 3IEPA 3AVYA 4NCXA 1W5FA 3JPYA 3CU5A 5AW6A 3A14A 2O0JA 2X4LA 2G6BA 2R4QA 3A11A 1O97D 4L5IA 4QYSA 4XIFA 1CLEA 5CRIA 2QTHA 4V0OA 1MT0A 3KFXA 4G5XA 3UK0A 3M6MD 4S3MA 1N9GB 3S4YA 3PCRB 4NABA 4X93A 3B78A 1Q7GA 2VSYA 2F3TA 3ZWBA 4ZYXA 3EQ8A 2P2NA 2HF8A 2JGMA 4RD1A 3CONA 3TQHA 3G17A 4QUGA 1KS9A 2NUTA 5F73A 1W6UA 3I3SR 3PDJA 4L2IA 3U16A 1GPAA 4CG0A 4YUYA 4D98A 4BP3A 4K7JA 1IZ9A 2VDJA 4ZOAA 3AJAA 4BO3A 7GPBA 4E2XA 3MC1A 1DQNA 4Z6KA 1J8MF 5DTEA 4J7UA 4E07A 1JYFA 3LQYA 2I3BA 4BBAA 1LDYA 1I80A 3NMUF 4X84A 5BW4A 1N2JA 1J70A 3ZHRA 1T3LA 2ZRCA 1GXSB 1DZIA 2YN0A 3N39C 4Q9KA 2HCRA 3V2GA 4QPNA 1P1BA 2Y05A 4XWAA 2I4IA 2D5BA 2P2SA 5HGJA 5BSWA 1BKYA 1WDWB 4HZUB 3NTRA 4YROA 2O2IA 3O6VA 3QFCA 3KJGA 2R7MA 4JJZA 4A8TA 5L3SA 4P3NA 2Z04A 4PC7A 1K27A 2ZBEA 2XOKA 5HF6A 1HE3A 2ERXA 2WF8A 3RHFA 3CV3A 4DIDA 1VIAA 3QVTA 2IWRA 2NVOA 4B31A 2QRUA 2XUDA 3QNWA 4MYDA 2FG5A 3BH0A 4ZVVA 2XMPA 4C3VA 5K3AA 5BV8A 1BW9B 3DAPA 2WJIA 4QXQA 2PANA 2WJYA 3A1SA 3GFSA 3PICA 4WBNA 3FWHA 5B3KA 3SGLA 3DD1A 4IJUA 4MHSA 1ZQ1A 3JAMA 2JLWA 2E21A 1H2WA 4XQEA 5LP6F 4HEJA 1V1MA 3ZDCA 3HJNA 1N5MA 3KKPA 1IJBA 2C2ZA 2YWEA 4OA8A 4Y7DA 4QXPA 5ERYA 4DVGA 2CCJA 4DLBA 1J99A 2VJNA 1JS1X 3A2MA 3Q9LA 4INAA 3LWNA 1DTWA 5DSXA 4B3HA 4EF6A 5LU9A 3TGLA 2YYYA 5HHTA 4NFSA 1CUGA 1T6ZA 3VDMA 5AVYA 1KI6B 5DGCA 5F7XA 2DETA 3LW8A 2QD2A 1BOFA 1E77A 5AKIA 4DJEC 4MS1A 5BSHA 4DY4A 1YQDA 1JQ3A 3DBRB 4AF7A 3I6BA 4U7TB 16PKA 2C4NA 2I8CA 1PWZA 4D8YA 4QTXA 1NOJA 1FNMA 1JWAB 4EF4A 4QG3A 3F47A 4Q3NA 1YT5A 3DO5A 4QEDA 4CKEB 2HY7A 3GVHA 3VR6A 1US8A 5CPBA 4RK5A 1BHJA 1RU3A 2C92A 1RI5A 2R1VB 5TMDA 5KMGA 5C18A 5KDOA 2UZAA 3KBBA 3G8YA 3TVYA 2R6AA 1HQDA 4RK6A 2EF1A 2HO4A 4Z3DA 4DEYA 4TMKA 2E1PA 3HNOA 4NPCA 2GJSA 3SAJA 2AZMA 1HYBA 1R88A 1M8KA 5I7UA 4O8ZA 3WXBA 2QTMA 2QL5A 4Z9BA 4HN9A 2YYAA 3V55A 1FTYA 5JTTA 1SD5A 2ODBA 2BMEA 3MG9A 5ECYA 3GJZA 2V7BA 5CLHA 2GQ0A 1ZOIA 3K5PA 1P6QA 3I42A 4KX5A 3ZU6A 2Y92A 5CT6A 5LNK6 2HJVA 3A2KA 2EFJA 3I61A 5CVUA 3KRTA 2NO4A 4OHRA 3SR0A 1FVHA 1EGHA 1FP4A 1XN4A 2D5AA 5K6TA 4O4HA 2XMDA 2WAXA 1CFZA 4HDKA 3RHTA 3MWGA 4R16A 1Z45A 2IYEA 2VTKA 3KAJA 4KR7A 1VHQA 3BIWA 2IOFA 5M34A 3FNGA 1GPWB 1LNQA 1R74A 1SH7A 4FYYA 2XRYA 1I33A 1MJ5A 1XRPA 3GYGA 2IUEA 3JQ9C 2X0EA 1GTG1 1QYIA 3TMAA 2Y3IA 5BNTA 4MEAA 5EFZA 3ZZ0A 1DB3A 5EZSA 4YVFA 5CFMA 4M8KA 5C5DA 3ZDXB 3T9FA 4Q3AA 2G17A 2VK8A 1UJ5A 5HBRA 4WFQA 3NBUA 1A71A 3SXPA 3L79A 3HCDA 4GX0A 4BZQA 3QU4A 1ZGCA 2GFIA 4ZVSA 4FEGA 4NR0A 5JSUA 3H1BA 4A6XA 1KOGA 2GVNA 2X23A 4FOOA 1E7SA 3S8YA 3P5SA 5HZHA 1JTEA 1QPGA 3PX7A 4PLPA 1DAMA 1P2VA 5HDQA 2P9EA 1G21A 2JEYA 1KEZA 3QE0A 3EF1A 3ZQ4A 3ZWWA 4CDRA 4UUQA 1Y82A 3JASA 3SVLA 4JYZA 1O8CA 2EP8A 5D7NA 4NU6A 3LHIA 3B1FA 1M1NB 3G0IA 3GGCA 4GE0A 4J94A 3FTDA 2BFFA 3IHWA 4MV1A 2O05A 2JHFA 3ID6C 4GPIB 4CM5A 5K6AC 4DNQA 7REQA 3ZJVA 1V5GA 3IBFA 2H7VA 1P4GA 3ZV4A 5HJEA 3NPMA 1XZBA 2ISQA 4KMSA 1L5HA 5ALUA 1DIOB 3H1TA 3OD5A 1ZD5A 2GFQA 3CBQA 2CFSA 2D06A 3TUIC 3EIFA 3QKRB 3A6GA 3R5HA 4YGYA 3D7NA 1FDVA 2ZUTA 2PKQO 4HQKA 4MW0A 4ZVLA 1CNMA 5HF5A 3WLTA 2NACA 2WU4A 1PNOA 1CP3A 2C9OA 1K5PA 5JZOA 2SKEA 3HGMA 3LGAA 2FMTA 1X1SA 3UY4A 4C87A 3C5WP 2X0JA 2MOKA 2CJWA 3Q6IA 4L51A 3H87A 1Z16A 1YIDA 3VU9B 1Y98A 1YS4A 2DFNA 4ZARA 1AKMA 1P0CA 1D0SA 2G83A 3TLZA 4K1XA 5CFRA 1BGWA 1SVKA 3V8PA 4IUCS 1CJKC 4PX2A 4N5NA 3OEHD 5C7OO 2Q1WA 2NTVA 2QR2A 4X1KB 2JIMA 3GVIA 1GHTA 4BV9A 1DJMA 3ET5A 4GYWA 3UCEA 4AJJA 1U31A 4CKXA 3EZGA 4OMDA 4F2DA 1FSSA 5IKXA 2EJWA 5FWYA 3PG5A 4OMFG 1MO3A 3JR3A 1U2RA 2KE5A 2NU7A 5JR3A 4XJVA 2JD1A 1BE0A 1JKJB 3O4GA 4Q9NA 1EQAA 4Z9AA 1Z7BA 1FFCA 3OZCA 3REQB 4MPJA 3EAGA 4N0MA 3ZCXA 5BORA 4AW9A 4OLBA 5CXXA 1UKCA 1TECE 1IM8A 3BUSA 2O5EA 2R7KA 4JR2A 5IXSA 3H8SA 3GMTA 5A71A 2ZSFA 1NR1A 3MCTA 4YP0A 1RLUA 5K7SA 4P4SA 1BTOA 1IB0A 1P18A 1S2MA 4BBPA 4CKBA 5HR5A 1U7WA 3FVTA 3G3EA 4UM9D 1PZNA 3P2OA 1YE5A 3FSGD 3JD0A 4D46A 3A9SA 4UNNA 4CMCA 1HTTA 1PJQA 3BMNA 4BMCA 5K0TA 5EFOA 1WMEA 3OOWA 5EN4A 3AONB 2ZVQX 3V8EA 2DTEA 2IV7A 1M1XB 4PZPA 1Z4KA 3C41J 3HKBB 4HGNA 2KSQA 3D1JA 3RKRA 2W8ZA 2VK4A 2ZJOA 1GG8A 3L04A 1FYFA 1YVEI 4FIZA 2AC2A 1X7GA 3O9MA 4D8TA 4F7DA 2O8EA 1CERA 3NAZA 3STWA 2I6UA 3A9RA 1E96A 1X1AA 4Q66C 4S0XA 1NBEA 3V00A 2P5SA 4FHGA 1JU9A 4B09A 2Q5QA 4GYJA 5IJXA 4FZ3A 1S4QA 2HXSA 3ZV7A 5C1PA 5AHXA 4WEOA 2FNAA 2PXHA 1HK7A 2V9CA 4QDXA 1PQYA 5DBIA 3ZXXA 2PZGA 5A4IS 1Z29A 1B2RA 1ZP6A 2ATIA 2PGDA 1T5DX 2KMLA 4HB0A 4G85A 4MCJA 4YRRA 1IULA 1FX1A 2BMVA 3E9CA 1P74A 1OY1A 3UK1A 4RA6B 1RADA 2D8AA 2NZXA 2PXAA 2Q0XA 2IYLD 5JTUA 3W3ZB 4DLSA 3IJEB 5LYYA 2OZLB 2EOAA 3L40A 5F77A 3RIHA 1N2CA 1LA2A 1I5OA 1P0PA 1KJ9A 2VUIB 4H77A 1TEHA 4CR7A 4ABTA 5KYUA 4H6PA 5CA0A 5KS2A 3LSYA 4B8WA 3ZCPA 3P32A 1VL5A 1K92A 5F7OA 1KAHA 1XRLA 1ZI9A 2EKLA 3AQIA 1VI6A 5EXEA 2UUBB 1T2AA 3EA4A 1YQGA 2DBRA 2I4NA 3IDAA 4RLQA 5HUHA 2P4UA 1HE4A 1JR4A 2JGRA 2R6R1 1M6EX 2VZ0A 4Z54A 1NM5C 1T2CA 4UW9A 1J0BA 2B0CA 1HUQA 4FYIA 1TT7A 3O2JA 5BR1A 5K0ZA 2QZJA 1ZJ4A 3D4NA 4AJ4A 5KNBA 3EDYA 2PH1A 3EWSA 4BNLA 2VWHA 2HNKA 4P7BA 3VZCA 4QO7A 2JBWA 2QDKA 4PBRA 3FOBA 4U9UA 1CUAA 5B2FA 1NNEA 3LKZA 3OZEA 2UV8A 3IOMA 4Q3DA 3RBVA 4D9EA 4F5YA 5AW3A 1W5EA 2QTFA 5JATA 4EI7A 2IV2X 3RSSA 2QW0X 4QBFA 3ZWYA 3BL8A 4Y1GA 3E1GA 3Q9NA 2JFQA 3VZQA 1TF7A 5FBKA 1C4OA 1YA4A 4E03A 4NCHA 2GARA 2I2CA 1U2DC 4V0KA 2D6FA 2OB2A 4MI1A 3W7AA 4YRNA 2P1DA 2FSSA 1H1LB 1JB9A 1NJ1A 2JZCA 2BGMA 2X5XA 4J7XA 4P0QB 5THKA 1JJAA 4D3SA 3TNJA 3E9QA 3R6LA 4IQ0A 3SQMA 5EJ4A 3IURA 4M22A 5LL6P 1TC1A 2EZTA 2HCFA 2WD7B 4FCCA 1T4MA 2WE7A 3M6UA 2VQDA 3EB9A 2UYQA 5JQGF 1Q0HA 1R8YA 4GFDA 3VSDA 3U62A 4MVJI 5KNCH 3PUJA 2Q21A 3LBFA 1F0YA 1V8BA 2CV1A 4MW4A 1XWWA 3D8SA 5IBPA 2YS7A 1DX6A 1SXPA 1Y7HA 2HO5A 4WJKB 3WLLA 2G0TA 4NECA 5HW0A 4BB6A 3TTUA 2G28A 2FPIA 1P2GA 4JJFA 3S8MA 3T5CA 2H4XA 2Y9PB 3TKYA 2NZYA 1IOLA 4KLAA 5TGZA 1CU1A 4CLXA 4MQEB 2W2VA 4G9BA 4ITVA 2AGVA 3E2PA 5G4KA 1AKEA 1N7HA 1Y1TA 3BFVA 3EPJA 3T3NA 2W2NA 3IE2A 4HQNA 1IHUA 2OC4A 5IFLA 1PYDA 3A6LA 4OXQA 5JQWA 4FGZA 4GPAA 5FB3A 1QJ4A 2QN3A 4GMDA 4EB6B 4RQBA 3BCHA 2GESA 3LYAA 4ALJA 4CLRB 5AOAA 2HK9A 4JEIA 2WTMA 4KCGA 4HNVA 1PR1A 4U00A 3VTKA 3EMDA 1GRCA 1OWPA 2Y1KA 5HRUA 3MT7A 3RGWS 4DDVA 4OB7A 4AMUA 1ULSA 3FWNA 3N05A 2DFLA 5I7HA 2YJ4A 5D01A 5DGHA 2WYIA 1Z28A 1OZFA 1HDCA 3ETJA 4IWNA 5ITZB 3ZW7A 1MOSA 1CR4A 4IQ4A 3ISTA 4KFCA 2A35A 2E6UX 3SC2B 1D2RA 1DT5A 3COYA 3E9NA 5DI3A 2C5HA 2AZTA 2EARA 2FWAA 2FPSA 2TSYB 2PFKA 3LDFA 1TZ2A 3NU1A 1JN0A 4U6SA 4UVEA 5FNVA 3CKMA 1QFMA 2JARA 3D5EA 4H15A 2QR5A 4I9NA 4PZ9A 3RK1A 2I5PO 4TYQA 3ZOZA 2P69A 5C8ZA 10MHA 3U5ZB 1Q0UA 3FGZA 1PJ4A 3VOBA 2ZJ1A 4H27A 4KI7A 1FEZA 3EAQA 3T41A 3WK7A 2LP4Y 1KEPA 3KQHA 5GWXA 4L0DA 4OI2A 4P5DA 1M2EA 2VDNB 1E9VA 2A94A 3JALA 4GZ3A 4F2PA 2CXRA 1W48A 4TS9A 3ES9A 3RV3A 5IU6A 3LP5A 3PLNA 1XQYA 2JJQA 4IW3B 2FQQA 2GRAA 5FTNA 3RU3A 5AVTA 5E3IA 1GSHA 2QZ9A 3REOA 4URWR 4EIWA 3UV7A 4DMKA 1IE3A 2ZB3A 2BRUC 4XRGA 3D6TB 1DWQA 4BX0A 1U8EA 3ABIA 4LGYA 3V7FA 4GKVA 2JGNA 1PVDA 1I3NA 4EZBA 1ADBA 1NNSA 5FJIA 1YNOA 1E89A 3S7ZA 3WLSA 3QITA 1RDFA 4LBWA 2PJZA 3NKLA 4YA6A 3U9SA 1JA1A 5A9RA 3QG1A 1GPH1 3ILYA 3QSYA 1YVPA 2I7DA 4AJ2A 4C21A 3HKDA 2H3EA 1BHQ1 1P2DA 3LYHA 5FAXA 1NONA 4L5AA 4MA5A 3GDWA 4JOCA 3WGLA 1MABB 4MMZB 5JD3A 1XEAA 2GDZA 3AI1A 2GBCA 2XGGA 3LJKA 3VSCA 4AMZA 3ON5A 3CZAA 4RZ3A 3E3OA 1V2GA 2A92A 4WKCA 2P6MA 4YDSA 1QU2A 4M7OA 3E3AA 7ABPA 5K2MA 1MIOB 4D9IA 1ZOOA 5JNWA 4DAEA 1RQPA 4BS9A 1EM6A 1F6BA 1B1CA 2OYRA 1VPVA 2AOVA 1TIBA 3MF4A 3BC1A 4MVJA 3U0VA 4BLWA 3C1TA 4ZYVA 3OVMA 5JCPA 4C7OB 2WKPA 1YQEA 4D82A 2Q5CA 3T7DA 1U3WA 3KZ1E 1KE2A 3N6VA 3M4NA 4NARA 3V4FA 3IVCA 1W0KA 2HA7A 3W9UA 1OKKA 1GKKA 5HWSA 3AF2A 3NGXA 3PEVA 4G0PA 2JBHA 5B4TA 1G8JA 1AUPA 1KYYA 2YN2A 3NHBA 3P0EA 1X6VA 1XRJA 5CX1B 4DR5B 1EUZA 3FDJA 4ZHSA 1DO8A 4D0LB 4PG4A 4BQFA 3A32A 3NOVA 3ZHTA 1SG9A 4YQEA 4YUWA 3OCVA 4KKXB 2I7TA 1ZUWA 5H02A 3RFTA 1GPYA 3UT5B 3PLRA 2QROA 4HGZA 1DG1G 2FOXA 4WBXC 1SVSA 3KPWA 4LJRA 4LY9A 2L19A 5IHXA 1JBEA 3TIFA 4WPGA 3CM0A 3H7AA 3U7RA 2O3UA 1EP3B 1L8OA 1DDIA 3T1TA 1WMFA 1D4ZA 3NETA 4PE5B 1KY2A 2OORA 1Z0ZA 2NXNA 1RPZA 4M9UA 2R2AA 2VBFA 3TVDA 4PTYA 1ZUNA 3RNOA 4U6NA 3RSHA 1O58A 2J9FA 2VATA 4DCOA 2IHNA 1FU8A 1XV5A 1KJJA 2JJ2A 4PV7A 3IP5A 3I6IA 4QDZA 3F6BX 3CVOA 4DJ5X 2RGAA 1NXVA 2WK1A 4QBHA 4CUZA 4HYYA 1TF2A 3DLCA 3GO4A 4BGDA 2FP3A 5AD1A 4DWWA 3NKFA 1QNFA 1K89A 3HSYA 4V1CB 2H00A 1A7AA 2JDIA 4KQGA 3W34A 1YMVA 2VDWA 1Q2UA 4NWIA 2FJPA 2JW5A 3FPAA 3PS9A 3ZDRA 3NIFB 3VYRB 4XASA 1TAGA 4Q1VA 1JEYB 4LV6A 3LWZA 4C7BA 2C57A 2P9QA 4WESA 4HATA 4TMXA 4PYRA 1U4SA 3D8RA 2PRSA 5A3QA 1WHTB 2HJSA 4K6GA 3X2EA 5KAPA 3L8ZA 4Z5XA 1NYLA 2G9UA 3KJFA 3AIOA 4B7ZA 5FQNA 2IEYA 4RENA 1X8KA 3H5OA 1BQ3A 1V11A 3OZWA 3FLEA 5IM4A 1DO0A 2C29D 1LNSA 3R0VA 2MCFA 4BNDA 3IUEA 3G0DA 1NURA 2APJA 5PNTA 4FYHA 3IAFA 3KQPA 4HAZA 4K86A 4FD3A 4AJNA 2F9LA 4MRMA 1W4ZA 2V7EA 4FS3A 2EJUA 2IW1A 2X2PA 3GVXA 2TMKA 4F85A 3T52A 5BOSA 3GPCA 3FVQA 4Y2SA 1KH1A 4CIXA 4MI9A 1KNQA 1VFPA 2NPOA 3C7TA 1NQWA 1VGRA 2Y9MB 3COPA 3SJAA 1XTKA 1K5DA 3UB4A 4Q5IA 3VSBA 2L17A 3IO3A 4H1HA 1N2ZA 5D2CA 4IX1A 5FAKA 4FTWA 2IE8A 2CC2A 5LUAA 2O1XA 4ESVA 2B36A 4GLOA 1G3IA 3LHKA 2JI6A 4FC6A 4ID3A 4ND4A 4P7JA 1NLUA 3EVAA 3UFBA 3ECCA 3OFND 2QB5A 2CWDA 4MMYB 1KP3A 5KX5F 4DA8A 2ZULA 2CXQA 3ZGXA 4YAOA 1JH8A 5B53A 4AJ9A 3BSFA 3OQHA 4WZZA 1EVKA 1U7UA 2M1ZA 2C97A 1UMCB 3ANLA 2J3MA 3PUKA 4Y2UA 4DUGA 4F92B 5FPQA 4Z53A 4P8RA 1ZGJA 2WA2A 4R0NA 2HJGA 2IJGX 4YDQA 3O03A 4E2ZA 1A1SA 1JYSA 5CVEA 1BYUA 2PJUA 4ZT5A 1E2QA 2C7OA 2QYSA 1CUXA 1DWUA 2CXTA 3MOGA 5C4GB 3VR3D 1QYXA 2GFHA 1Y63A 3W79A 1A4XA 3LK7A 1EHCA 2AVNA 3KCQA 4WKGA 1JXMA 2F9MA 2YXLA 4IF6A 5K8VA 1IRXA 2ZCVA 4TPKA 4KHPB 1J5PA 3FUXA 4AG5A 4YAEA 1H2RS 5A4FS 2C2MA 1GA6A 2CDNA 4W9NC 1LVHA 2GKGA 2YR0A 4HUJA 3WWEA 2IYNA 2GRJA 5DX0A 5DBEX 5DEOA 5ADWA 3IFSA 3HA2A 1Q0ZA 3AHCA 4XLLA 3YASA 4TKLA 1NMQA 2BFAA 1JLKA 5TIIA 3BBPA 2YIJA 4ZQHA 4CEHA 1GZVA 4BLTA 2C8LA 5BQFA 2V96A 2BKXA 3AHEA 3JRWA 1ZN2A 1XYGA 2PRJA 3HLYA 2G1UA 3I1FA 4PXSA 5DBHX 5DHPA 4FB4A 3GLTA 1CQIB 3BD7A 1EGAA 1GZSA 1VTKA 1IOZA 3M82A 3O8OB 4HAYA 3I9V1 4QASA 1V5WA 5TF0A 5C5CA 2IDMA 4EMBA 1R8SA 4DUGD 1PZXA 2OFOA 1B8NA 4HRVA 2Y0CA 1BXZA 1MRSA 1T9GR 3M6VA 1JKXA 3FVRA 2DUMA 2BKEA 3LY8A 3PQEA 4HXEB 4CTKA 5KPJA 1E1CB 3SI7A 3LT5A 5E38A 5ITWA 4BBZA 3W0LB 1S4MA 4DSUA 3A1WA 1TCBA 2J0UB 3PUZA 2HAEA 2MSEB 2OD7A 3ROEA 5KQGA 1DINA 2VBGA 2ASVA 2TMDA 4E7OA 5HKOA 2AMJA 2PQMA 1Z8DA 3LHSA 4LE2A 2J85A 3UH0A 3NRCA 5GTDA 1I4DD 2RKBA 4KAFA 2GN6A 1YU9A 4N82A 1Z4QA 3V2IA 4GW3A 2OOSA 5JCZA 1QRRA 2IXBA 3GEIA 4L9AA 3QPUA 1Z0IA 4PFSA 3RLIA 3M1YA 4FZRA 1I7DA 2ACVA 2DZDA 4EAQA 3ZDQA 4R54A 2HSGA 1XZLA 4DV0B 4YRPA 1VKOA 2O0HA 2IUSA 2ODAA 4DDHA 1P9OA 5BW5A 4RHYA 1XCMA 4G8CA 4W7IA 5IWAB 2JVKA 4QGAA 1OR8A 1VHWA 3HB1A 2QNRA 1O9GA 3ND6A 9ATCA 2CF6A 3HKCA 2CFIA 1MNQA 1DVRA 2XKBA 4GVLA 3VNSA 1UBRS 2ZBFA 4D6XA 1WAMA 1M2GA 1Z7EA 1VMAA 3P9YA 1XZCA 5FR1A 3PPXA 1IBMB 1Z34A 5IT9A 1NX9A 3B8EA 1W2HA 3KR9A 3A6KA 3EPHA 2JLYA 5FUMA 4RIGA 1I5EA 3G68A 5GQSA 3U2QA 3T7TA 3NM5A 1OWLA 2IQIA 5DEIA 5B1IA 4X6YA 3GLSA 4P92A 1SU4A 2D1FA 1LLUA 1EX1A 2MDTA 3PXXA 4Q47A 2HU5A 4E5NA 3OSUA 2J5QA 3HI4A 4PS1A 4DR7B 1Y89A 3LPDA 4KUGA 1H1TA 3F3KA 2WU0A 4AF8A 1C3OA 1VIDA 3B1WA 2WDPA 4LHYA 2NQTA 4FFNA 1ADYA 2WM8A 1RLOA 3WGYA 3ENKA 2NO9A 3QX7A 2C54A 1ZRSA 3VU3A 2DOKA 4BNFA 2XNSA 1EFLA 2Z3WA 4CM8A 3CEMA 3ND7A 4TQUS 7YASA 1NGSA 1QGZA 3NBKA 1DSSG 2QF7A 3IILA 3L8CA 1U4OA 2BM0A 4GGPA 3DXZA 1U0FA 2P35A 2BBSA 2ERYA 1JLRA 5FHRA 1RHJA 5AQ1A 4R05A 2Z1DA 4GG1A 4NS1A 4DANA 3E27A 4Y18A 4EEZA 3T12A 2B21A 3HVIA 3EVEA 1HNWB 3NO4A 1SRRA 1KQGA 3PQ7A 5T6MA 2V0CA 5M29A 3KWFA 5KTTA 5JDIC 4JV5B 4HAWA 5KWJA 3JQAA 2Q8QA 2WVJA 4KXVA 1Y5MA 1U3TA 4ZXFA 2ZSDA 4D74A 2JCGA 5GONF 2H5EA 3FMVA 2ZJ7A 2XAUA 1TYZA 3M6FA 3W6UA 5JQGB 1M6VA 2ZPUA 4MZDA 1V8OA 5LMZA 1N2BA 4OOEA 5ADHA 2VXBA 3KZNA 3BK1A 4AO8A 1KO4A 4XUEA 1ULAA 5FXMA 1OHHD 1W5SA 4KBFA 4R9RA 4CE6A 4FYVA 3UM9A 1PJ3A 1O96A 4FFOA 3O3NB 2CZQA 1UKZA 4KMRA 2I9KA 1ZITA 4L22A 3VO1A 3ZYCA 4KHZA 5BSKA 2G8LA 2WR8A 2YJNA 3DEJA 2A78A 5ER9A 4ZEOA 3SC4A 1K2WA 2FUG1 1I9GA 2V8OA 3HO8A 4ND8A 3KYDB 3B9PA 5LMNB 4RCYA 3RU9A 3PZBA 4CLEA 1M66A 2O8NA 5H4GA 4AD8A 4X6LA 5EJ9A 2WDZA 4QATA 3JQ7B 3LVQE 4KK3A 2PMWB 4KW7A 1WF6A 4JA0A 3LBYA 4ASUD 2AN5A 3DDOA 4TVBA 1SBZA 4XWOA 2V6MA 3M6IA 5A5EA 4EKYA 4M4SA 1VL0A 2W6ZA 3AOEA 3VAZA 1LDGA 3ZD9A 3FPHA 1OZHA 4G56A 4KZKA 3LQ2A 4YQFA 1G8HA 3GP8A 1D1SA 2QX6A 4K9SA 2ZRQA 1QCZA 5BR8B 1RM3A 3N5KA 1U3VA 2GPJA 3DXFA 3IHLA 6REQB 1U2TA 4P33A 4DCJA 4BGUA 2WU8A 1WO8A 4FI3F 3EGEA 3C1OA 4OREX 3GD5A 3IJRA 2GPBA 2XT9A 5LP1A 4BJ5A 2H1IA 4EJSA 3P9NA 1UBMS 1SUPA 4QPPA 3NM6B 4FOPA 3S8EA 3WL6A 4U1RA 3EVBA 3I2GA 1E1MA 3M81A 4CEHB 1R6XA 1PFGA 3HCNA 2C99A 1TQ2A 3I9MA 4B85A 3U7QB 3EG5A 1WW2A 3PV0A 3V4VB 2ZIGA 4BFCA 1I3LA 2HLHA 1JAZA 3BD6A 3H1AA 4U5QA 4B3FX 1J2UA 1INLA 3RFXA 3IUSA 3CZ5A 3ZU5A 4KMMA 2J48A 2Z4RA 4X95A 3SBDA 3G1WA 1U2EA 2C3OA 3H18A 1W0JD 3FSJX 3JARA 3AFMA 3EPLA 1F2TB 3USCS 4KN5A 1TNDA 1CR0A 4RFSB 3X1JA 3UT0A 3ASVA 5FYQA 2ZZMA 2BP7B 3FCAA 3KCNA 3NBXX 4F0JA 3FFTA 3Q5EA 2IPMA 3G5UA 4CHGA 1QFSA 5FUQA 2DHCA 4P54A 5L9AA 4HDAA 2AOWA 4MUMA 4YRLA 1XVAA 1JQBA 2V7QD 2DPLA 2Q4RA 1AK9A 2CLIB 2R96A 5FEMA 1MV8A 5CITA 1SXJC 2B1GA 1JE0A 1B6GA 1QQ7A 3FTQA 2PUFA 2PCLA 4K40A 4ZVKA 3V7NA 4YASA 4UHEA 5F2KA 4Y0VA 4N9WA 1UUFA 4Q7EA 4OQZA 4X97A 4O4JB 2PFSA 5DGIA 3ZD8A 3EDOA 3H65A 3GGDA 2W4MA 1WDKA 4RHFA 2XLCA 1KRXA 2LDXA 3IERA 1MGPA 3QJGA 1MEOA 4ER0A 5FWNA 4C0HA 1P19A 2XWBF 4XDGA 4CBVA 2FWNA 2IH5A 4EH1A 5AR1A 4LWQA 1Y4AE 3KQTA 5NLLA 1EFVA 3IPAA 4RW0A 3H2SA 1R4NB 3QVJA 5CPFA 3RVBA 1DBWA 3CUYA 5ESDA 1AZLA 3K0CA 5D00A 2ZANA 4CEIA 1K2VN 5HM6A 1TMOA 2DBQA 3QSGA 4UNIA 3HYRA 2JGEA 5B3JA 2DEUA 1AM4D 1X1DA 1E1DA 5FD8A 2QN8A 3Q87B 3SQNA 3CKLA 2IU0A 2EVWX 1OPRA 1OILA 2GR9A 3O0DA 1XPRA 3UJAA 1PTJC 1YCGA 4P83A 3G79A 3ZIAD 5JMWA 2BELA 1GZ7A 3PC7A 3ADBA 3FY4A 2Y1DA 5CYOA 4EW2A 3OETA 1A4RA 3NOXA 4BEJA 4EEKA 8ADHA 1MH9A 1X7YB 3GZNB 2VH2A 4RTOA 4F4JA 4Q4LA 5BWMA 2QAGC 5LPNA 1C9KA 3D4IA 4I9UA 2PUAA 1XZQA 3Q3VA 3CWQA 1CNEA 2P6PA 2QUHA 4IDDA 4PLYA 1DMSA 4NEQA 4AIRA 5EERA 3KR1A 4P80A 5AW1A 2PYDA 2ZRDA 5E4YA 4D9FA 3JS5A 4CF3A 3O4FA 3NHAA 3TX6A 1IUNA 2WG2A 2A5FA 4J7CA 1ULHA 3EZXA 3OOJA 4U7FA 3SN6A 1LVGA 3ZU2A 4J3JA 4PLFA 4RVGA 3KC2A 4M7WA 4D9BA 1XHEA 3OTIA 1HL3A 2H2FA 3U4DA 3FZEA 2X13A 1LRLA 1A5ZA 2SCUB 3BMCA 3CLTC 3TNLA 1HTBA 4F2HA 3NQ41 2WJGA 3I34X 4GKBA 4GLJA 2DPXA 2CJFA 2CLEB 3BFXA 2QVCA 4XQ9A 3EF0A 4IRXA 1OWMA 3NDIA 3L6BA 1DS6A 3GFRA 4WLVA 4PNZA 2QMZA 4HXFB 3OX3A 1U2ZA 3V1LA 2VN8A 3BAZA 1A77A 4LZOA 1GFZA 1YS1X 1E2IA 3OQJA 1XQ6A 4B6OA 4EQ6A 3BVPA 3OE7D 1DE0A 3FCOA 4GSKA 3QELA 4TXHA 1RD4A 5B4UA 1L4FA 2AG1A 4M87A 3I72A 5JCJA 3RRYA 3WZLA 1QHHA 1WWKA 1SXIA 1Y37A 2I6QA 2LTAA 1YCDA 2QSYA 1KF0A 1UPFA 1D9ZA 2VP0A 3GH3A 3GV0A 3O8BA 4GUAA 4LYDA 3RS4A 3N2EA 4WJLA 2WAYA 5CVJA 3U4GA 1UM9A 2WKWA 1I6MA 1U2GA 1OWNA 2YJ6A 1WNTA 3M49A 3BE8A 4XYBA 1AMUA 5F1YA 4RA9B 4R7TA 4MIEA 4XUGB 1WBBA 5COQA 1KERA 5DF1A 3S29A 4BMPB 4DM4A 1OXXK 1QFZA 2VRCD 3GLGA 4PONA 1MN6A 5KC9A 3HFSA 2IF2A 3FYUA 4LYFA 1ISMA 1EBBA 1SBNE 3E2IA 3K9GA 3TL2A 3UKDA 1WXWA 1TCCA 5KX5B 1L8LA 3W5AA 3L4KA 4F3RA 1PF7E 3W2TA 1U04A 3SVTA 2XX3A 4FN5A 4DC0A 4CQNA 1UAYA 1NC1A 4E5PA 1QRDA 4H16A 1Y5RA 1SKQA 4KXNA 4MUGA 4IFTA 4O4LF 5FLEX 3KM0A 2BSQA 3UHPA 4YR9A 1TEZA 1BNCA 5IMBA 2VYVD 2JAQA 3MGAA 1H4VB 1D8AA 2Z6AA 2OA0A 4J2TA 1G7TA 3UOWA 4YXFA 2V3CC 3L06A 1IAQA 4UPDA 2PN1A 2W6OA 2JB9A 1C41A 2CCGA 1U8XX 4YI5A 4BNIA 2C96A 2Q07A 4B48A 1WB4A 1XAIA 3EARA 3MBKA 3JWEA 2A4KA 3FBGA 1Z5OA 2FUNB 2LRHA 2ADOA 2GB4A 3N2ZB 4DRZA 3SQXA 2A9JA 3CX6A 4ZTBA 5JXGA 5A03A 2IPAB 5LOVB 1I1OA 1VDMA 2XECA 1O9HA 1TCAA 5EWMB 2Y0EA 3WI7A 1Y34E 3ZD7A 1X42A 4DQUA 1QXSA 4KDCA 3H5LA 5KKNB 1WL8A 1UDRA 3IDZA 1HKHA 3JVUA 2VHQA 4DDTA 5JH7F 3G8BA 1CUJA 4HLUA 5FTMA 1LPOA 2CYCA 3ZWNA 3G2MA 2IU3A 2I91A 1I6KA 2AF3C 2VA9A 4R51A 4UHKA 1B0AA 4F4IA 2VYND 2OBMA 1E2DA 1MT3A 1C3VA 1E0DA 1YTLA 5D86A 1HBJA 4G0QA 3KQUA 1DCTA 2BJHA 4X8OA 5A05A 3OAAD 2W2OA 2F64A 2WFLA 3NVKI 3FWKA 3H0KA 4ICIA 4YPOA 1WB9A 3DKVA 3GU3A 2QRVB 1Q3KA 1P1JA 1XP5A 4L6AA 3WZMA 2DHQA 2Z2KA 5CLFA 1ZM9A 2J3LA 3C14C 1IWBB 5DN6A 5J4VA 1LPNA 1CUZA 2AIRA 3PUIA 3TR6A 2P1ZA 4AMYA 1NXTA 3O2SB 2IXAA 2B2NA 3DVAA 1W29A 4XPIA 4BAZA 1RBMA 2ID4A 4X90A 2OCAA 2W0MA 3M34A 2QRHA 4OIFA 3BG5A 4QPDA 1NXSA 4Y2TA 3EDCA 3WBJA 1P2FA 4AZ3A 2Q0HA 4OUDA 3VC2A 4ED9A 2PUTA 1C9EA 1SVOA 1SU6A 3IT3A 4INOA 3ZE7A 4C07A 2HU2A 4OHVA 4CKWB 2O8DB 3KB2A 1EX6A 3IEIA 3QXHA 2R7AA 2IBMA 2X5NA 1VLVA 2JIDA 2J32A 2R8OA 4WHMA 2ZBVA 4RZQA 1XCJA 3KU4A 5JFGA 1XDGA 2GZSA 3NFRA 5KYGA 4JQZA 1G9TA 2G5GX 3SS8A 1YB5A 3K94A 2M1XA 3HACA 1POWA 1LBEA 5L3QA 1VA4A 1KEWA 2O14A 5T41A 3HCRA 1QK4A 3Q98A 2A14A 1Z5PA 1T0PA 2IEIA 3NALA 1ZMBA 4RK7A 3M4XA 6YASA 5F3RA 3VVCA 1XGKA 4D3FA 2QENA 1GRNA 1ECLA 1EUDB 1UQTA 1KDOA 2BF4A 1U1GA 1XEWY 4TKUA 4E5MA 5JAMA 1OGYA 1YQQA 2PV0A 2Q0SA 3G0GA 4TWBA 4YCCA 1S5PA 1IBSA 1UC8A 3ORRA 5AJZA 4S04A 5TPZD 1UH5A 3INNA 4OG2A 4PANA 2YXEA 3LXUX 3OZUA 2VEOA 3P2KA 4QQFA 4RYDA 4ZQFA 5EPOA 4I5FA 5EIOA 3SHFA 4CFSA 4KQHA 3QY9A 4M6WB 2ZSEA 3B5JA 2DFKB 1I4TD 2DUUA 4HAUA 2RH4A 2MWMA 3W7VA 4JYMA 4KIJA 4XJSA 4E6EA 4J0KA 4ZAGA 1QBGA 1JLLA 3E9DA 3R75A 1NG1A 2FUEA 3WMRA 4YMLA 2D00A 2IODA 2KHZA 2O2XA 2VZ9A 3W8DA 3S81A 2HHJA 1E3EA 3VTZA 2Z08A 5H70A 1JEQB 4KE8A 3WWZA 2OAP1 2ZDGA 2Q5HA 3WSWA 4IDNA 1SZJG 2PT6A 3M89A 3DFIA 4C0SA 3EGCA 5ES4B 3IL2A 4ERNA 3IR7A 4DQXA 1FNNA 1OASA 5EQDA 5BWNA 3L49A 3TOVA 2JGAA 2VZEA 3DG9A 3PQ8A 3THYA 3FTEA 4EECA 3K9HA 3FWPA 4JAVC 1KIMA 1O95C 3VGPA 4YAJA 3C0KA 1ND5A 5ALIA 1VJ1A 3IVRA 5HIIA 3RYIB 4DT1A 4OJKA 1SXJD 1T4BA 4CI9A 5LFAA 2QX8A 4JP8A 2YQZA 2RHJA 2KQUA 2AJLI 3R7SA 1PJTA 3CXUA 2XZLA 4MEBA 2BKLA 4MYSA 4UBJA 3ZOKA 5JECA 1I2AA 2JFHA 3F7OA 2XRFA 5GONB 1Q0PA 1MP0A 1TJ3A 3LCMA 3QHAA 4CMJA 1QV6A 3FYCA 4JB3A 2RB5A 3P19A 1ZXBA 3H17A 4RBNA 2AHOA 4BFSA 4EHJA 1EWYA 1T34A 2NSDA 2QL6A 3CR3C 1E2EA 4OTZA 2ZU0C 3R3HA 5H9WA 1GGEA 1HYQA 5HTKA 1Q0TA 4YP9A 3VYVA 1PKXA 1XIVA 2YZKA 2JFBA 4H4DA 4LC1A 4JITA 4YRZA 1CZOA 1BE8A 1I9CA 4B8ZA 3AF4A 5D3MB 3SBOA 3GZTB 4NAHA 4PGHA 4U5XA 2WT9A 1NBMA 5MGBA 1AKNA 4LXIA 3OZ7A 2CL6X 1DIGA 3CZMA 2OEPA 4N9QA 1XJ5A 2I78A 2XGSA 4WNAA 5B37A 3V1UA 4EKEA 1PJSA 1R6VA 3KQQA 3KZXA 3OU2A 3I0NA 1ZU5A 5DISB 2PS9A 3TSWA 1T8RA 4M1EA 1RYYA 1J23A 3RCBA 2NN3C 3HJUA 4RO0A 3V7UA 1LF5A 3VUFA 2Q3JA 4LS3A 4YT5A 2G04A 5C46F 1ZHOA 5H3HA 1H0SA 3SQLA 3DR3A 4L27A 1SZPA 4OHFA 2G36A 1HQKA 1P7PA 1M1UA 2OCGA 1VIYA 1F06A 3HGQA 4MV4A 1IJEA 3TR0A 4ZYYA 4NXNB 4XB6B 2M6SA 3A7EA 3T38A 4TTQA 3U4QA 2IY9A 4DIFA 2HBZA 3VQTA 1NTOA 4DE5A 2HKIA 5KOHA 1G8GA 2ZUSA 4KE9A 4C2UA 4RSGA 1DMRA 3MTIA 5KNDD 4J1TA 1KR2A 1C3XA 1PZEA 2G4LA 2W43A 4OBXA 4D56A 4OD0A 2VJMA 2Q27A 5L40A 3RSLA 2VO1A 2NU8B 2XB4A 3RQSA 4LJSA 3PXCX 1TXGA 5HQJA 5EJEA 2CMFA 4JGBA 3LKDA 3CLTD 1YF3A 5CURA 5TT1A 2BFEA 2Q4OA 1UZUA 1YOVA 3OQVA 4A8JB 2I62A 5AI8A 5ESRA 2ANCA 2BFDB 2UZ1A 4NL4H 3MGBA 3TVTA 1Z4MA 3IKTA 1NNUA 5BSUA 4BX3A 2V4ZA 3TAXA 1NJFA 3BZUA 4UEKA 1J9GA 1JA0A 2B6HA 2VCEA 3LCCA 2ECOA 1UINA 4D3DA 1MB2A 4IDHA 3VSEA 3ZWQA 2P90A 2TMYA 3BTUA 4Q7MB 3RVPA 1XYVA 1VKNA 1FYDA 2OO3A 5IAKA 2CUKA 2NXCA 4BU0A 1K75A 3EXFB 5EJ6A 2AE1A 1AX9A 3K0BA 2R2GA 1Y7PA 5K09A 1ZONA 1QB8A 4IIBA 4ZT4A 1COZA 3O75A 3P9CA 1GCUA 2PPLA 2O4CA 3FN4A 1YJAA 5HQ3B 1BU5A 1CXZA 3X1MA 5K51A 3ER6A 1YL7A 2NUPA 2EQAA 3RBZA 2FZEA 4PC3A 2PS0A 5FNZA 4C76A 4NBLA 1UBCA 3WK8A 4HDMA 1MJHA 2A9FA 3NI2A 4IV5A 1GGNA 2AUTA 2JA1A 4LX8A 5AW2A 2GAAA 2PSDA 1PWYE 5KOJB 2ORVA 3U4IA 1E7YA 3C4JA 4EFLA 4EI2A 1UKBA 2C20A 1E9CA 2FOLA 2HNBA 1ZM2A 5G0SA 5LD2C 1VJDA 2RK6A 1G6HA 1ZSNA 3BL6A 1RYFA 4I1VA 2ODEA 3A4NA 5AI0A 1YR9A 1HGXA 4XDZA 4XFKA 1SCQA 1EFKA 4OP2A 3ER8A 3G6WA 1DV1A 1CETA 1HKUA 2OCBA 2CGEA 3ZZMA 1WD5A 3IT1A 2PQ6A 1T1RA 1HEIA 5JAPA 3HWX1 3RF7A 4J9UE 3O2NA 1OGJA 1UK9A 3EPRA 4IIJA 4KV7A 1ODFA 2ZB4A 4O59O 4CIDA 2A5DA 4H60A 2R1TB 1RWMA 2PXCA 1EK1A 5LWHA 1KC1A 4A26A 1HT2E 2P11A 1SK8A 1AIPA 1O2DA 4D4LA 1ONNA 2ZDHA 1JEJA 4FT4A 2IU4A 1OXVA 2YDXA 3PC8A 2YH2A 1I1QB 4R5MA 5J5CA 5DT9A 2FEMA 3H6KA 3JRNA 2XOKD 1KDVA 2IUUA 4FBLA 1ZZGA 3WMEA 5LQSA 3II6X 4GM4A 4KPGA 1GLVA 3G7NA 3DFMA 4TKVB 4CMHA 1LS6A 4KOAA 2VNHA 3C3BA 3FOCA 3SF8A 3IIIA 5BUSA 4PAGA 4UNSA 3H4TA 3ITKA 4A91A 5F64A 5T4EA 4F72A 4CCWA 5IJ0A