5KS2A

Rawv_ctd (helix form) of 16s/23s 2'-o-methyltransferase tlya
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
209
structure length
209
Chain Sequence
b'RAWVSRGAHKLVGALEAFAIAVAGRRCLDAGASTGGFTEVLLDRGAAHVVAADVGYGQLAWSLRNDPRVVVLERTNARGLTPEAIGGRVDLVVADLSFISLATVLPALVGCASRDADIVPLVKPQFEVGKGQVGPGGVVHDPQLRARSVLAVARRAQELGWHSVGVKASPLPGPSGNVEYFLWLRTQTDRALSAKGLEDAVHRAISEGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S/23S rRNA (cytidine-2'-O)-methyltransferase TlyA
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title A Novel Motif for S-Adenosyl-l-methionine Binding by the Ribosomal RNA Methyltransferase TlyA from Mycobacterium tuberculosis.
pubmed doi rcsb
total genus 64
structure length 209
sequence length 209
ec nomenclature ec 2.1.1.226: 23S rRNA (cytidine(1920)-2'-O)-methyltransferase.
pdb deposition date 2016-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01728 FtsJ FtsJ-like methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 5ks2A00
2WK1A 5FULA 1UFKA 4KIFA 5DXJA 3DLIA 5DM1A 4POOA 3KU1A 4M7RA 5EMKA 3DLCA 2UYCA 1NBHA 3MB5A 5D1NA 5GP1A 4AZWA 4EKGA 3DXXA 3GRUA 5GOZA 3KR1A 4A6EA 4E2WA 3WSTA 2G70A 1AQJA 1G8SA 2UYOA 2EFJA 5HIKA 4E32A 2P8JA 1JTEA 3GRYA 3TM4A 2VS1A 10MHA 3FPGA 3TMAA 5ERGB 3UA3A 1EG2A 2AR0A 1XDUA 5EPEA 1N7IA 2ZZMA 2OY0A 3HCDA 2P3OA 3LCCA 3O4FA 3O7WA 3BGIA 5DT2A 5FQNA 1QYRA 2R6ZA 5EC8A 4CKCA 2VDWA 1NV8A 2C7OA 4YUWA 3K6RA 4RTKA 1DUSA 3BUSA 4C03A 2JH9A 3B3FA 3PB3A 3TKAA 5KQRA 3SX0A 3EVFA 3MERA 1RI5A 3HVJA 1X1BA 1I9GA 2BR4A 3D2LA 2E5WA 2GPYA 4FT2A 4DF3A 2XBMA 4OX9Y 2AVNA 3IYLW 3G2MA 2OXTA 4PYKA 5DRTA 3OU2A 5EMMA 5LSAA 3LGAA 1QAMA 4FZVA 4X63A 3SGLA 3HVKA 3RW9A 4A6DA 2YX1A 2YQZA 3MQ2A 4RVFA 3CGGA 4OA5A 3C6KA 5EKXA 3GJYA 5K01A 2G71A 2FHPA 2O07A 3G2PA 5DX8A 4RTLA 2KW5A 3SSMA 4GQBA 2P3LA 5HZMA 2PWYA 1B42A 1X1DA 5EIWA 1R6AA 2ZSUA 2JHPA 3HA3A 4AZTA 3UWPA 3PTAA 3B5IA 4X1OA 2BZGA 3GNLA 1F38A 2ZLBA 2A14A 3E7PA 3BXOA 3IV6A 1P1BA 5CCBA 4PYNA 1TPYA 1JQEA 1N7JA 4BY9E 3HA5A 3KPWA 5CVVA 3OPNA 2AOTA 2N47A 1R8YA 4KVZA 2HTEA 2B25A 2QY6A 3I5UA 2VZ9A 3TM5A 2AZTA 2PLWA 3DULA 3OE5A 5K0GA 3CC8A 3A7EA 2B9EA 1KP9A 2Y1WA 1KPGA 4GOMD 3CVOA 5DX0A 4CWAA 2O05A 2LD4A 5CVUA 3VC2A 2ZIFA 4M38A 1Q0SA 3ELUA 3KPYA 2PWPA 3PT9A 5F2KA 3TQSA 4BLVA 2C7QA 3G5TA 3LDFA 4FS8A 3T7TA 1M0EA 4BP3A 3SSNA 4U7TB 3FTFA 1MHTA 3ME5A 2ZVJA 3ERCA 2ZULA 2NXJA 3R24A 5HIJA 3EPPA 5GM2A 2V7EA 3BWYA 4YUVA 4HC4A 2YTZA 3OFJA 5DWQA 2VDUE 2Y1XA 4YV2A 3A27A 3LCUA 1JG4A 1KYWA 3PVCA 3M6WA 4R05A 4RWZA 2IBTA 2P3QA 3G2QA 3M4XA 4RVDA 3TLJA 4HH4A 2Z6QA 4QTUB 1SKMA 4P7GA 5DRYA 3OE4A 1BC5A 4PIPA 1VL5A 2FK8A 3THRA 2GLUA 1YUBA 3QOWA 5FHQA 2R3SA 5MHTA 4MQ4A 5LQJA 2UYHA 5KQSA 1RI2A 2PX2A 3JWGA 3KQTA 5DM2A 5K0JA 3V97A 2PJDA 4KRGA 4GBED 2UZ4A 3A26A 1YZHA 1XDSA 2IDJA 1V39A 2AOWA 5LQRA 2AOUB 3KR9A 3REOA 4CTJA 5FWDA 4MHTA 3FUWA 5GWXA 1PJZA 5FWAA 3UJ6A 3HEMA 4BP1A 2P35A 1R8XA 3HM2A 2GH1A 1WZNA 2H11A 3UZUA 2JG3A 3LPMA 4LG1A 4V0RA 4XUEA 3SM3A 4YUYA 3KKZA 4RTRA 3F4KA 3JWJA 1VP9A 3MTIA 3RODA 3QV2A 1O9GA 3MHTA 4QPPA 2YXDA 3P9CA 1L9KA 3DOUA 5K0LA 4QVGA 5E9WA 3KPJA 1XJ5A 5K09A 1IM8A 2YR0A 1VPTA 1RI1A 1ZGJA 3GXOA 3L8DA 4H0NA 4HTFB 3Q87B 4OQEA 3CBGA 1JTFA 2OB1A 5IH3A 5K8VA 2NNWB 1N2XA 4AUKA 3LHDA 1EQAA 1BOOA 2ZW9A 1QAQA 5HIMA 5LR6A 2G72A 3GDHA 3BWMA 4IWNA 1NT2A 3X0DA 3R0QA 1INLA 3DMFA 1O54A 4PCAA 5D1HA 5C1IA 2ZBRA 3P9IA 4FSXA 4GOOD 4BLUA 4ER5A 3BT7A 3JWIA 5FHRA 1UIRA 3MCZA 4JXJA 4M37A 1D2HA 3KPUA 4E33A 4YMHA 2PGXA 5K0BA 5LQUA 1SVUA 4LWOA 3FUTA 2FRXA 3C6MA 1I4WA 1AQIA 2V74B 4F85A 1MJFA 1F3LA 4DQ0A 4E30A 1ZGAA 3T7RA 3G8BA 2AS0A 2IBSA 2I6GA 3FPFA 3HVHA 2ZWAA 3KQWA 5M5BA 1JG1A 1QAOA 4PYIA 1G8AA 1YF3A 2Q41A 1WXWA 1TW2A 5DM4A 4MIKA 3TPZA 3NMUF 4E31A 1R18A 2IGTA 4XCXA 2QE6A 3C3YA 5C0OE 2AOUA 3E23A 2P41A 2CMGA 5EIFA 2PT9A 5EG5A 4C4AA 3DH0A 2ZBQA 1EAMA 3EVGA 3NDIA 2JHCA 3G5LA 3UJ8A 1G38A 3FRIA 1L3CA 3FTCA 3UA4A 5E8JA 1JSXA 3FPHA 1EJ6A 3PX3A 4DCMA 3DXZA 5CVJA 1XTPA 4PINA 5DX1A 7MHTA 1WS6A 1KPHA 4PGGA 1XXLA 3P2EA 2AN4A 5EZQA 4E2YA 2AOTB 4R6XA 5DSXA 3NVKI 2NXCA 1AF7A 2B2CA 1EJ0A 4BLWA 2GA9A 3I58A 3FPEA 5BW4A 2BR3A 2I62A 4GF5A 4QDJA 4X61A 3B7PA 1M6YA 2ADMA 3MTEA 4KDCA 5E9JA 2ZZKA 1TW3A 1SQGA 3CJTA 3K0BA 1BKYA 4RVHA 3AXTA 4DZRA 2PBFA 3AY0A 3B89A 2YXEA 3NDJA 3AJDA 5EOVA 3IHTA 4CKEA 3NWEA 3NJRA 3SMQA 5KS2A 1RJFA 2B78A 4R8SA 5K05A 2NP6A 3GGDA 5CCXA 3LBYA 5FTWA 2P40A 4FT4A 5ICFA 3ORHA 5FA5A 2OYRA 2OPBA 1X19A 3KQVA 4AZVA 2AN5A 1ORHA 3M6VA 3FYDA 4X60A 5E1MA 2I7CA 3DUWA 4AZSA 4C07A 5K03A 3EVCA 1XCJA 3CJRA 5HEKA 3T0IA 2ZCJA 3KPVA 1EIZA 3EVZA 3LCVB 3EMDA 4OBXA 4XUDA 5E9QA 3I64A 4F86A 3MAGA 5ICCA 3HCBA 2PX4A 3M6UA 2AVDA 5FQOA 4RTQA 3EGEA 1I1NA 1IXKA 1NBIA 3EGVA 3HCFA 5DTMA 2BM8A 5E2BA 2PY6A 3BZBA 3UJ9A 2NYUA 2IH4A 2QRVA 3FTDA 3LSTA 3MCTA 1X1AA 5KVAA 4ER0A 1G60A 5ICEA 5T6BA 2VDVE 4EK9A 4C04A 1P39A 3EEYA 2NXEA 3FUUA 3GRZA 1NE2A 3KHKA 1JQDA 4ER3A 4ISCA 1Z3CA 2OO3A 2C7RA 3ER8A 3A4TA 4EVIA 1UWVA 3C3PA 1XVAA 1WXXA 3T7SA 2Z6AA 3TRKA 2OZVA 4RYLA 1SG9A 3P8ZA 5HOQA 1H1DA 5B1SA 3HP7A 5K0EA 5DXAA 4RTNA 2DULA 1AV6A 1R00A 4KDRA 5GINE 4OA8A 4ER7A 1YFLA 3M33A 4MWZA 3O31A 3UJCA 2B3TA 3NW9A 1JR4A 2PT6A 1HMYA 3VSEA 3DR5A 3R9XB 3ELWA 3EGIA 3FRHA 3FZGA 2PKWA 4FSDA 4DA4A 1QANA 2GAFA 4PYOA 1FJXA 2ONYA 4DMGA 3M6XA 3GIWA 4RVGA 3PFHA 1VLMA 3BWBA 3I53A 5CVEA 4ER6A 5K0FA 4KWCA 2CWWA 3P97A 1KIAA 3GU3A 3IEIA 1JG2A 1VQ1A 4P7KA 4YUZA 1KYZA 2DPMA 2XYQA 5KYGA 1G6Q1 1ZKDA 2XYRA 5EHIA 1L3BA 2PX5A 1IY9A 3LL7A 4HGYA 2ZFUA 3UBTA 4RV9A 3OZTA 1WY7A 1XCLA 2ZBPA 2F8LA 1D2CA 5E1BA 2ZIEA 2PV0A 5EGSA 5F2OA 1G55A 1ORIA 4U7PB 1R74A 2FCAA 1DCTA 4PCLA 2EX4A 4GUAA 1RJGA 1QZZA 2HMYB 3EVEA 4L7VA 3BKXA 3HCCA 4Y30A 5E2AA 3VC1A 5K0CA 3HTXA 1KR5A 4KW7A 4QPNA 3Q7EA 2PX8A 2HNKA 2P1DA 3KQQA 2IPXA 4C05A 2UYQA 2FYTA 5HILA 1RJEA 3G2OA 3ANXA 1FP1D 3A25A 3GWZA 4CTKA 5LQNA 3DXYA 1NW5A 3PX2A 3BGDA 4GC9A 4IKPA 1NW3A 3DMGA 3OZRA 1XDZA 2O57A 5GIOE 4ATNA 1FPQA 4B17A 5LQKA 3U81A 3SSOA 4RTMA 3G7UA 5EZSA 1YFJA 2CL5A 2ZIGA 3OZSA 3E8SA 3LDGA 3DMHA 4RTPA 4CXMA 2QM3A 4HTFA 5DPMA 3EEOA 3KR0A 3ID6C 2XVAA 3LKZA 4HG2A 3TKYA 5G02A 3V8VA 5CUQA 1NW6A 3QOXA 4C08A 5HFJA 5IKMA 3RIEA 2WA2A 2H00A 4K6MA 5CD1A 3GO4A 4IV0A 4EMSA 3G8AA 2AN3A 4HSGA 2IP2A 1NW7A 5FCDA 3KQPA 4P7JA 4F84A 3DTNA 1SQFA 3GCZA 2Z6UA 4P58A 2YVLA 1PRYA 3KR2A 4X41A 4R8RA 3GRRA 2IIPA 3P2IA 3R6TA 5CIYA 3ER9A 1L3IA 1T43A 2EJTA 2EJUA 4PWYA 4V0QA 3CKKA 5EHGA 4G56A 3UJ7A 3PS9A 3UJAA 2GB4A 3UJDA 2H1RA 2BM9A 2FPOA 3PLAE 3HNRA 3OCJA 5BW5A 2QRVB 1VP3A 4DKJA 2HV9A 4LWPA 2PXAA 3NVMB 4OQDA 5E1OA 3AXSA 4RSRA 4PONA 2ONZA 1KHHA 1M6EX 2PVCA 2BR5A 3EVAA 5CVDA 5E8RA 3EMBA 4KIGA 2C7PA 4CKBA 3AWIA 5GIPE 2I9KA 1VBFA 3UJBA 3C0KA 4YV0A 4E2XA 1P91A 2YUIA 2P7HA 1RI4A 3M70A 2XVMA 1YZ3A 1FBNA 4P7FA 4PNEA 3KQMA 3VYWA 4EQZA 4E2ZA 5FADA 3NTVA 5F2NA 3LDUA 4OBWA 4YV1A 5U4XA 3SVZA 2NP7A 3BWCA 2HWKA 5BXYA 5EVJA 1KPIA 2G8NA 2QYOA 4FP9A 1WG8A 1ZG3A 4YUXA 5ICGA 1X1CA 5EEGA 2ZTHA 4QTTB 3UFBA 1JG3A 1KXZA 3FUVA 3B3JA 5EEHA 1NKVA 2ZWVA 4HRAA 1RJDA 1RI3A 4GOND 4WXHA 1NV9A 3B3GA 1ZHFA 5EMJA 3CCFA 3P2KA 4QVKA 2XYVA 4PIMA 5LQCA 4O29A 5DSTA 3P9KA 3E05A 1D2GA 3SXJA 1Q0TA 4NECA 4R6WA 3HCEA 4Z2YA 4WVLA 1SUIA 2GS9A 3LX6A 1P1CA 3THSA 2ORED 3P9NA 2FK7A 4E70A 4XUCA 2NXNA 1FP2A 3GRVA 5DTRA 5E1DA 3LECA 2OB2A 5P8WA 4GC5A 1JSZA 1NW8A 4GOLD 1VIDA 5DLYA 1O9HA 3KQYA 2WA1A 2JH8A 4RTJA 4RTOA 3DP7A 3H2BA 2O0LA 3TR6A 4FGZA 4UOEA 4M36A 3R3HA 2JJQA 2OKCA 5H02A 4DM3A 2G1PA 3FUXA 4PYJA 2YXLA 5LQAA 3FTEA 4MTLA 3OU6A 2ZZNA 5JUWA 4DCGA 3P71T 4PYQA 2ERCA 2HR1A 3HCAA 5EQJB 3S68A 4LECA 4C06A 3SR4A 3LBFA 2CMHA 2IH2A 4YMGA 1DL5A 2CKDA 2ESRA 3EVBA 3ELYA 4PYMA 1YB2A 3ELDA 1Y8CA 3JWHA 2IH5A 3A7DA 5EKUA 4RX1A 3EVDA 2AOVA 3MGGA 5GM1A 2O06A 5T64A 5K0NA 2EG5A 2P7IA 3HVIA 2IDKA 9MHTA 2K4MA 4QQKA 4QQNA 5T67A 3FPJA 2PXCA 1ZQ9A 4ZTBA 5FUBA 4AX8A 5JR3A 1BHJA 5HIIA 4IV8A 4Y2HA 3BGVA 1SUSA 3LKDA 3OFKA 2IFTA 3I9FA 5DTQA 3HA7A 1L1EA 2PSSA 2VP3A 3FYCA 3KQOA 5EMLA 3G88A 3KQSA 3OU7A 4PYLA 2AOXA 3G89A 5C9ZA 2PXXA 3NWBA 2OBFA 2JHAA 5BP7A 1OR8A 1U2ZA 5CM2Z 4RTSA 4PGHA 2BH2A 1HNNA 3TOSA 8MHTA 3BKWA 3TFWA 4FR0A 4QDKA 5DM0A 5FA8A 3CJQA 4HGZA 3PFGA 1VE3A 4EKIA 4GEKA 1JQ3A
chains in the Genus database with same CATH superfamily
1JDBB 4L5CA 4OQFA 3HHPA 1IBRA 3FD8A 3I4LA 2PK3A 3R0VA 3DOOA 1OCEA 3G0IA 2VC2B 2C2MA 4UPDA 3F46A 4DWOA 4LDZA 5E4FA 3VTFA 4AQ7A 1RMQA 1TCBA 4DLLA 5TC4A 3T1OA 5LYJA 3WSTA 4U7WA 4C7KA 4EF4A 1ONPA 2WG0A 4EL5A 1NX6A 2VRNA 4DLVA 2JFBA 3D59A 3NV9A 1RABA 3R40A 4M9SA 4RLSA 3MWYW 2Z1NA 2BTQB 4DZZA 2WMOB 3MBOA 3IE1A 5B53A 4KKXB 3P32A 4HVTA 1IXZA 5HW0A 4LJYA 3AVYA 2QLJA 4S05A 3ZWDA 3KRTA 4YRMA 4X6LA 5BN3B 3TKAA 4DA8A 4W5TA 1K0FA 5FOWA 1ZIOA 3PC4A 1JR3D 5AI0A 1B8PA 4I5FA 5EXPA 4EHFA 2NQ8A 1OXUA 4MTCA 3WI7A 3LBIA 4S1PA 4AKHA 2GPYA 3SJZA 1KMHB 3AVUA 2OAEA 2DUMA 5C4IA 3CNLA 1SM4A 4CKWA 1MRZA 1U6IA 2VQSA 2ZJ3A 3EIHA 3CNOA 3JD1A 4X63A 1VGRA 4TT3A 4ZQHA 3FR8A 3SGLA 3WLTA 3F9IA 4KQXA 4UVEA 3L7DA 2W43A 3EQ7A 1W73A 2I0FA 1KBZA 2Z04A 3O1IC 4DCUA 2HXYA 3QVSA 3TQOA 2XX3A 1FC0A 4HDRB 2I6TA 1N5LA 5I7RA 5I7FA 2FZWA 2QPTA 3H2YA 1SG0A 4V0ME 5EVCA 4MP8A 1R6AA 3BDIA 4FKZA 4WXRA 3WRYC 1E32A 2WM9B 2Q3HA 5C4GB 2OCIA 1ECPA 1EFCA 4OAPA 1XVTA 4ON9A 5DW0A 2BT4A 2POCA 1N7JA 3RTEA 2CL6X 1HORA 3KPWA 4BZQA 4DDHA 2R84A 3HYLA 3OPNA 4DIOA 4RXUA 3N0TA 4TKLA 1PKXA 3L93A 4QL3A 1FQWA 1DO8A 2B92A 5KTKA 4HQ6A 4JR0A 1Q12A 4F60A 4OL0A 4X54A 1DG1G 3CVOA 4FFDA 5E6SB 4CWAA 2HMAA 3ESQA 3FG9A 4YQZA 1Y3IA 5KWVA 1Q0SA 4BZZA 2Z1DA 3Q11A 1UKEA 4DMUB 4FS8A 1XCMA 1G8YA 2IF2A 3BMOB 1J39A 5LDHA 2Y1LA 3WNVA 1FFXA 1IUNA 5F1OA 4Y6LA 2A58A 2QV0A 3O4RA 4FTWA 1UP7A 2NV6A 4ZWNA 1AA9A 3OZVA 1GXSB 3QBJA 3MUFA 2ON6A 5DRYA 3T3DA 2CNDA 4PIPA 1PW7A 2WYVA 1CK4A 3H4TA 1A2BA 3ILHA 4P9NA 3X1JA 4H7FA 4F9EA 4ENVA 4UZSA 5FUMA 4MV8A 5LQJA 3RADC 1N2BA 1SCBA 2HJGA 5J9FA 1D1QA 5AOCA 3U48A 2ZAGA 1E5TA 4JB2A 1W4ZA 3QF4B 4YLYA 1SUEA 3P9PA 1V39A 1EVIA 2A1TR 4L51A 4HY3A 1B41A 2G7MC 1YE8A 2ZXFA 3GDOA 4CTJA 5JYBA 4BFTA 1L1FA 3N2LA 1GPWB 4UUBA 2H11A 2HMUA 2HU5A 2NO9A 2GEDA 2ZRLA 3SLRA 3E0XA 3BWDD 4A9AA 7YASA 3ZDFA 1QRUA 4UU7A 3SM3A 1BS9A 4XUEA 4CKEB 3DKVA 2FWBA 4NMXB 4OQQA 4YRNA 4YUYA 5LU8A 3I1FA 3STWA 5F23A 4LBVA 5IBQA 2TYSB 5CVCA 5JVDF 1ZD4A 1W1WA 5EINA 3L6UA 2NSJA 3Q8MA 3L7IA 1G5QA 5FNZA 2OTCA 1KEUA 4AZVA 3NOXA 4OQEA 2QP9X 4YHBA 2FWRA 4L4UA 1Y3BE 1PSDA 5K8VA 4S04A 1B8UA 4CQMD 1DADA 1KYIA 4AKIA 5I48A 3UPUA 2QLBA 3CPJB 1Y1RA 2FUKA 3AF4A 5AM4A 1IVNA 4RK4A 3SF0A 1AV7A 3O93A 2FFJA 4AMBA 1MOZA 4X64B 4JP5A 2CDCA 2QXUA 2IYNA 3HSSA 3NHRA 4G0OA 3DLPX 4S0ZA 1RACA 1NNEA 2IXDA 3M7IA 2R8RA 4YRGA 1BJTA 2V74B 5TXGA 3ZKWA 1UMDB 3VSCA 1ISSA 1GCUA 3EEBA 3OEEA 3WSWA 2QN1A 3GGSA 5AVTA 3KQWA 2OMKA 1TMOA 2GA8A 4FGWA 4NS4A 1JHUA 1HQKA 2II6A 3KKLA 3UMJA 1R4MA 2YFQA 3EK2A 5J47A 2IGTA 3G7SA 1U80A 2I7TA 3QLVA 1O4VA 2PDAA 2CMGA 3MWLA 2V59A 4O2BF 2OEPA 1P7PA 3WBKA 3VISA 4Q4JA 4ABYA 4EJ6A 4MW0A 1XZGA 3G5LA 4HD8A 5CFMA 1WD7A 3N76A 5IZCC 1XD9A 2CMFA 5JS7A 1EKXA 1VC2A 1N2IA 1L5QA 2IZ0A 4RCYA 3JV7A 1JAXA 5DX1A 4WBNA 3U0BA 1G20B 2CFCA 1D0SA 1PEKE 1NVUQ 2AN4A 1OLOA 3AHDA 2AOTB 1XUOA 2VF7A 1R0KA 2F3SA 3HBNA 1I5RA 2ZJ1A 4M0UA 2FZGA 3WMRA 2NXCA 4XCQA 3W5CA 2BFPA 1E7SA 3J7TA 3MT8A 2LIVA 4LXGA 3T3IA 1Z2NX 4LX0A 4MEAA 3RS0A 2AI1A 2NO6A 4X7RA 4AJKA 3RIXA 4TRNA 2GXSA 1T1SA 2AD5A 3AI3A 3EXHA 2IY8A 3P0JA 4GRIA 3RF6A 3V4VB 1FFBA 1ULAA 2VHWA 5CH3A 3UV3A 1RWMA 3OP1A 5BW8A 8OHMA 2AHOA 4M1QA 3O21A 4EG4A 3QMMA 4EGQA 2X7JA 1LV7A 4GR9A 3IHTA 2YVQA 5IT0A 3NJRA 1VOTA 2UUCB 1PJ8A 2HBRA 2P2LA 1ZVMA 4ZCPA 4FEGA 3UC5A 1VECA 4R3WA 3BEOA 1NQTA 5GV7A 3N6VA 3IOMA 5EQFA 3HU2A 5JECA 1P19A 2XZOA 3K9WA 4C07A 4FMDF 3VU3A 3W5IA 4QGBA 1XCJA 3KVVA 2DFPA 1WZIA 3CJRA 1N1MA 3IURA 3PWKA 4HOYA 2GVZC 1C81A 2Q62A 2R1VB 4F2GA 3DG9A 4DQVA 4PE5B 2JATA 2ADFA 2VQEB 1GU0A 2R8OA 3BTSA 3M6UA 4WBSA 3ZK9A 2NPIA 4ZMBA 4RTQA 4GYJA 1E4EA 2PSFA 1D0IA 3FDFA 2PMCA 3DZFA 1H9AA 1P77A 2W6OA 2A3NA 4I4TA 5FLXA 3PQ7A 5C8VA 1OU4A 2VEOA 2ZUVA 1X1AA 3G1WA 3OOWA 4FHEA 4EPYA 5AIBA 4X8LA 5HS4A 1M0WA 1OY1A 5H4GA 3KQKA 2I8AA 1XWIA 4Y67A 5LD2B 2WPNA 1PZFA 1WCYA 3K0FB 4EK9A 2P3SA 1ZUNB 3E6AA 3GRZA 4ER3A 4HZIA 1JQDA 1CUYA 2YWXA 4JELA 2OO3A 4C4SA 4HLUA 4DIFA 2Z3ZA 2Y9MB 2BKUA 3IUSA 3TQFA 3R44A 1M2NA 2R11A 3T7SA 1COWA 1MGOA 5FPSA 3EODA 4D6PA 1ADJA 4YRRA 1TK9A 4L9AA 1EA5A 1N2GA 2FWMX 2Z0MA 4YPFA 1UZLA 4BMCA 3HP7A 4RTNA 4B3GA 3ZVMA 3UJ3X 1GCAA 2Q3LA 3IE0A 3ZE0B 3JCZA 1EZ4A 1YFLA 5AQEA 1OXSC 2YMQA 1GGHA 3EC7A 1BNCA 1DAGA 1W0KA 2BFBA 1KO1A 1SVOA 2C8LA 1JKXA 4MQ6A 3NW9A 3M3DA 2QTWB 3BFJA 1MBZA 1K8ZB 1SUWA 3R0JA 1DKMA 2HF2A 3QEMA 2Y0DA 4FDUA 1MQ9A 2QTTA 2Z8XA 2WU8A 4ALIA 5K0FA 3DF9A 1YE3A 4Z1OA 1M1NA 4RBNA 2R97A 1XTQA 4QXAA 4OQPA 3WSVA 1VQ1A 1IJBA 4C4ZA 4K0KB 3GCDA 4XDGA 1OFIA 2WZBA 2DUWA 4AIIA 3OIDA 4OSPA 4CGZA 5KYVA 4C4RA 2I22A 1N57A 3CZ5A 1E18A 4LRXA 5EKDA 2RB5A 4B4KA 2BFNA 5E1BA 3TTSA 4B3HA 2P0AA 2WUVA 1EFKA 4INOA 3ADCA 1PTJA 1NFRA 1JDSA 4P8RA 4I8DA 1L8XA 2PSJA 5A3VA 2FDXA 4EX6A 5K8JB 2FPGB 1KR5A 2BFCA 3HCNA 4XX1A 4BU1A 4EB0A 1S6YA 1YRBA 2HNKA 5JISA 5K0ZA 1IBMB 2JI9A 3KXPA 3QVUA 5F3RA 1ILEA 4DUGD 1XRLA 1AS3A 2OESA 2V45A 3VNUA 3PVSA 4JUFA 4XYMA 3SHQA 4IIUA 3FDJA 4AN0A 1BD4A 1GHTA 5E4YA 4BNVA 1KU6A 1UANA 1VRWA 1XDZA 5JDIA 4K9PA 2O57A 3Q12A 2GMWA 1FPQA 2PVSA 4RFSB 2V4UA 4WBNB 3SSOA 3SIPA 1LF5A 2FJUA 3HP4A 3HO6A 4QU5A 3CNHA 1B3BA 5C3MA 3ZCXA 2ZRFA 3QELB 3PNVA 1O97D 2ISSD 2P68A 2QPAA 1ZMTA 3EEOA 3UMBA 4KR2A 4M0DA 4BV8A 3CW8X 4FHDA 1WKVA 1T4BA 4RSGA 3HCRA 4ZVNA 4YN3A 1OXKB 2V5VA 3IAAA 4CN8A 1G8JA 1RHMA 1UKCA 1CZRA 1SCKA 5C1BA 4FHFA 2JASA 1YZTA 4ZAZA 3OX4A 4CBVA 4YP7A 3A6FA 4IRMA 4TVOA 4QUDA 4BO5A 4JB3A 1QZ3A 5KTYA 1QHIA 5DASA 1REQB 3IQZA 4G5HA 3O8OA 3CHYA 1YDFA 3N6RA 4G0PA 2JLYA 1O6CA 3VUEA 5CIYA 2EJUA 4G56A 2VSFA 1ORRA 1YR6A 2FPOA 3SX2A 3K30A 1KOFA 5DMXA 4ZDKA 2AXEA 3OECA 2QTFA 4V39A 3OCJA 4IFBA 5IF3A 1ZNZA 1E59A 2FZKA 4X6YA 1F0NA 1HO3A 2YDYA 2J4CA 2XZTA 2ZTUA 1HSOA 1H4SA 2EIXA 1LBQA 3CEHA 4XIGS 2WIBA 3Q7TA 3WV4A 5KYXB 5ALIA 1DTWA 2W0SA 1PQ4A 2NW6A 2C97A 2X1HA 3C0KA 2BI4A 2PMDA 1Y81A 3AU8A 3BE6A 5B7NA 3VBEA 5HKKD 2PKQO 1BVHA 3F7TA 1YKFA 3AMVA 5TQVA 1J42A 2FPIB 3NRBA 3RVRA 3FI0A 3DDWA 1UMCA 1E3WA 1GR1A 2B8TA 1OPRA 1BDIA 4NNOA 1QIKA 3H04A 1RD4A 5HBGA 4YXWA 1ITZA 4UNIA 5HHTA 4E5SA 4ODIA 4TL9A 4YUXA 1M8JA 1VMAA 3T5TA 3LYLA 5K8UA 4G8JA 2PBLA 2Q6TA 4N48A 4X94A 4TSKA 2WHEA 3CRW1 4UBOA 5CW1A 3TZQA 2OLKA 5D5QA 3NYRA 3NTXA 1QIHA 3MWEB 5CNKA 5H82A 4IJKA 2A0UA 2IUYA 4L2IB 5EERA 1FXWA 1Q7TA 5LP6B 3P2KA 3UH0A 4M1MA 3V1LA 2O5VA 2YWRA 5ILOA 4TT3D 4F3TA 1IG0A 2NUBA 1DIGA 3ELBA 3IPLA 4UVDA 3UKJA 5CEJA 1MB3A 4R1TA 1NR5A 2HBQA 3QTTA 4IXNA 4B2PA 3AEKA 3I72A 2HDWA 3O84A 1VLLA 4X95A 3SQDA 1PQWA 1E1LA 1DXOA 2ECKA 3FCAA 4E4YA 2XT0A 1GUAA 2X0JA 1H0RA 2YFYA 4Q4DA 3ZK8A 4E6EA 2IA5A 2X86A 1FP2A 4HDCA 4G1VA 2QB5A 5CXSA 4ZC1A 2D4HA 4GOLD 4MDHA 3C74A 1EFRA 4ERXA 1B8NA 5DLYA 5K1ZA 1CVLA 1Y1PA 3H99A 5IDYA 3VGJA 5I7VA 3PHCA 4H1TA 5DNAA 2PQ2A 1KMQA 1W93A 3ZS8A 1N2HA 2PO7A 3TBHA 4UOEA 1PS0A 4R1UA 3IR6A 2XCSB 2QD4A 2C4VA 3RV4A 2JBHA 3TXAA 4OK3A 4CTOA 4XA8A 3OU6A 3MRXA 3EYWA 3KCNA 3RROA 5DHTA 5IG2A 3KLBA 4BN5A 1W7AA 3NOOA 3UK7A 2WIFA 4XX0A 6ADHA 1ZINA 3HCAA 3TSYA 3OTHA 4LECA 4EFKA 5JSYA 2IU6A 4JKIA 5H8WA 4ZCSA 3E5RA 4LC1A 2JFXA 1NJ8A 3L1VA 5JCJD 2HNAA 1MORA 1X74A 1ZXXA 3ANMA 3DFKA 5B4UA 8ABPA 3NYIA 2E4UA 3PX7A 3K53A 3VZBA 3LIPA 3DLTA 4HAOA 3M1YA 1ZM2A 1BW9A 2P78A 2OG2A 1IOZA 4JR2A 2VWQA 3ZUPA 3EB9A 1VHQA 2COUA 4Q01A 1WP4A 3DWEX 1BQ4A 4MV5A 2OWDA 1TI7A 2HPAA 3EXFB 4NCNA 2R6GA 1M8KA 1XK6A 4G4SP 3QP9A 1TM1E 3KDPA 4L76A 2DERA 3ROKA 1QP8A 2J0QA 1UAAA 3KL2A 4LY3A 3ENNA 1ACLA 5C7IO 2PJRA 4HGZA 2CNNA 2OHXA 4OJTA 5D7NA 2HJRA 2H1HA 1ADBA 3QPCA 4PX3A 2LBPA 1MXFA 2EFDB 2IOYA 3O2NA 4PG4A 1F14A 2YN0A 3GELA 2FZLA 4OQLA 5CK5A 1P74A 4K2AA 1TQ6A 5BV8A 1Q16A 2JLWA 3MB5A 4BNDB 2E55A 1U28A 4CL8A 5A3RA 3HDJA 4B4OA 1XPUA 4M87A 5H3HA 3UTCA 4CDGA 5BQ3A 3M4YA 4I8XA 1JPNA 1JFRA 3K15A 4DLXA 3ZW7A 3HKBB 3GUZA 1TKBA 2CVHA 2H2HA 5JZVA 3G2NA 1WA5A 3O8NA 3NHUA 5KVQA 2ZJ6A 4LOAA 3HB7A 4OHCA 4BNGA 2GN6A 1G1MA 1I4EB 3L8MA 5L3ZA 5I7SA 1X9IA 1XTKA 4ZXPA 3QKWA 3SX4A 4E5YA 1FMJA 3FB4A 2ES4A 4JP3A 3HP1A 3R5JA 5AVWA 3K9FC 2X8LA 3FHOA 4JLUA 2Z30A 2Q45A 3VR6H 2V9PA 1DCTA 2OQ2A 3I12A 5F76A 3H0EA 3SC3A 5EJ2A 4L8WB 4BWGA 3MERA 1GA4A 2GDJA 1ODTC 2PV7A 1U2EA 3PF9A 2E5WA 1YS6A 4K8OA 4J3JA 5AI4A 1E1YA 2J3HA 4IIBA 3IA7A 2B9VA 3TSOA 2GZ3A 4Q6BA 2P9FA 1IWBB 2AJBA 2O7RA 4AJHA 3A1DA 3MD9A 2ZE6A 3LT4A 3FN4A 4OAQA 3Q3IA 3ILXA 1UC9A 3HJHA 5G3YA 1FF9A 5ITZB 4IDAA 1GWNA 2I4OA 2AI3A 1PT5A 3U7HB 1LRKA 1Z56C 1YTLA 1HY3A 2FZVA 5JAHA 3JPYA 4G8DA 1GDDA 2JIRA 4IL5A 5EIWA 2ZT7A 3VO9A 5L3QB 4YECA 3VOAA 1YAHA 1RPNA 5A62A 3CV3A 2BZGA 3MT7A 4M88A 4K6OA 1F38A 1BD3A 3B8HA 1IULA 4PYNA 1VYTA 3ACCA 4B76A 1JIQA 3O1JC 3BXPA 4R9RA 5AXCA 5CVVA 4NU5A 2D8AA 3AR4A 2ENWA 4P92A 3MXTA 3I5UA 5REQB 3AWDA 1T8TA 4EJ0A 5B1DA 1ZS9A 2EERA 5JH7A 4DG5A 1FVHA 2LXNA 3B1ZA 3E9EA 4N3GA 1QRTA 3A7EA 2B6NA 3ZBTA 4B4WA 1F4VA 1GQRA 1NJ5A 1XMXA 3SLKA 3KT8A 5FI1B 1RKBA 4ER5A 5AKIA 2D1YA 5FH9A 1P75A 3Q5EA 4XPZA 1U3VA 4KTVE 5AKJA 1VJGA 2XUDA 1JHDA 1AC5A 4Y6PA 1O95C 4PC7A 3V1KA 1JXQA 1SHKA 2KI5A 4LXYA 4X6XA 3A27A 3PNKA 2IE0A 1EGAA 3WIOA 2NO0A 3PVCA 3WL8A 1D2NA 4CM9A 4MA4A 4F4UA 3V2IA 4ZAWA 8ATCA 3UHPA 2VJKA 1VM6A 3L7AA 4TWBA 4I14A 3ITEA 3IUBA 1OTXA 3KJFA 4P7BA 3VV3A 2SHKA 3PNSA 3IKLA 3DPIA 4G1FA 2O2DA 4MQLA 1IWPB 5B3AA 2WW8A 4MQ4A 3JQBC 2QRKA 1SD1A 2BH9A 3W5UA 3C3BA 3CBQA 4Z53A 1J1IA 5IWCA 3L9XA 3B12A 2UZ4A 1X6VA 1GTVA 3PD1A 1L7EA 3QVWA 2AOUB 4G67A 1WL8A 5B6PA 1E98A 4WINA 1NN0A 3BMCA 1RZ3A 3L7CA 1GZ5A 2GEUA 4XJXA 3TQCA 3ZTTA 4MVJG 3QJYA 1DG9A 2OLEA 3KTFA 4JVLA 4JXKA 1M7BA 4YJ2B 5TT1A 1QVRA 1SXJD 2Q4DA 5G0UA 4UFPA 4N6OA 4TXLA 2MIIA 3F4KA 1YZFA 3LLCA 1DAMA 4D3DA 2ZWOA 1U8EA 3C8HA 3MHTA 4HYQA 4PG7A 3DR3A 5DHQA 3DOUA 2WD8A 4BKPA 1BGVA 2WF9A 4NZOA 4QVGA 1A1VA 4I9HA 1J2RA 1NUHA 1RC1A 4RC9A 1CR4A 1TEXA 3EDOA 3CBGA 1O7JA 5C32A 1GR0A 1PT6A 3ZWKA 2QX8A 2HWUA 4GI7A 3UNXA 3KS9A 3I45A 3UUWA 1W85B 1ODJA 2L19A 2GILA 2QMOA 3MUOA 4E5DA 3WHLA 1KVTA 2QN6A 3OJFA 1TJ4A 3R0QA 1N9GB 2H4FA 2ZSHA 4OU5A 4PZ9A 3QNUA 4OXXA 3RU2A 3WHPA 5B30A 5D1HA 2ZUCA 3GA7A 1PJAA 4J0FA 1AK9A 4YRQA 2WWWA 3UXEA 4CMKA 1GRVA 3K9GA 3KPUA 4BYGA 5CDUA 1PNOA 2FXIA 2NTEA 4YJ3F 5TPWB 2QYTA 4BYMA 2IITA 1CQZA 1CLEA 2WJVA 4O4LA 4BVKA 2I6GA 3OZFA 2GO7A 4ZI5A 4D02A 4FE7A 4AX4A 2ZWAA 3R0IA 2Q5OA 5FEMA 1G42A 1G20E 3MMNA 2Z8YM 5MGBA 5ALNA 1YVEI 4BLOA 5AQ1A 1DBWA 1KI3A 4TN5A 1P72A 3JY6A 4NH0A 1DJLA 1R0BA 4ZP1A 5EL0A 4IOLA 1Q7GA 4OGGA 4TS9A 4WMLA 5DE3A 5D51S 1TNDA 1EAMA 1L4LA 2JHCA 3RUFA 2Z4RA 3VR4H 2R1ZA 5EPUA 1QE5A 1AF4A 2QL9A 1C14A 1Y1SA 4P93A 2OM6A 1I4DD 2IPOA 2P9JA 3PICA 4I19A 4PINA 5CRIA 2D3TA 3H18A 4A91A 3M5CA 3JQAA 2RJ3A 4JLNA 3U3RA 3R9XB 3RKSA 4F2WA 3T61A 5KAMA 3KYDA 3G8CA 2Z2JA 1U7XA 4KOEC 4F6LA 1RAAA 1ZK1A 2DM6A 3ANLA 1T1EA 3EWSA 1NW9B 1S2GA 2ZYUX 5HQ3A 4IXWA 2WICA 3N87A 3S2IA 5H7XA 2YXEA 1DCKA 1TMGE 3WIVA 1U8UA 2R6AA 3FLMA 1RHKA 5AJUA 4B3FX 4B48A 2F48A 2NQTA 4BB6A 1RYZA 2VHTA 4WRRA 1JLKA 3WZMA 1OWPA 1MZPA 2C3UA 4N4AA 1RADA 1G6KA 1UJ5A 2FP3A 3USZA 4TTTS 3SJUA 4EJSB 3LX5A 2GD2A 4KWHA 1SU6A 3DEAA 2ZITA 1DXYA 4UM9D 1SG6A 4XUDA 5FIUA 3I6IA 3FPSA 3GLFE 1FJGB 3I64A 4LXHA 3RE1A 3PNPA 2ZTVA 3RYCA 2P4HX 1WMFA 3USES 4LXQA 3FHCB 3AC0A 4C0LA 3AT1A 4Y6GB 3SDBA 1V8DA 3CLVA 3HJRA 3UJ9A 5C31A 1CY8A 1EJ2A 3R5XA 2FEMA 2B98A 1QH0A 5F5LA 5HUJA 3X44A 3L1HA 3CUSA 5AVVA 4BFXA 2HBYA 3ZXUB 4ZEXA 5JCJA 1P39A 5TS3A 1BX0A 1QRDA 1NE2A 3S27A 4W9MC 1CUZA 3BXZA 1Z3CA 4O4HB 3TLGA 1KIFA 1OAKA 4J9UE 1CJCA 1GYPA 4LK2A 5BSEA 2OFXA 4EVIA 4EFLA 1AKRA 4MW5A 2IUTA 5BYBA 5KOJA 1M6WA 2XAUA 3NFRA 4NULA 2QTRA 2QY9A 2WZQA 2XUAA 3G5UA 4MR9A 2CT8A 2FF7A 3DT8A 5ARCA 1E96A 1DRVA 1DAPA 1XD2A 2N1BA 1PR9A 3HZOA 1BCRA 2H51A 2AD1A 2FETA 2HD4A 3I8OA 5AM3A 1HH4A 3CLRD 3OIYA 4P6VF 1IEQA 4Q18A 5LWQA 1CTQA 4JBGA 4OLFA 2W4IA 4XGKA 3SXUB 4D4MA 2JIDA 3FRHA 3GUCA 1OZ0A 3OWOA 2ZI7A 3PNQA 3QHAA 2LR0A 4TWRA 3LVBA 3EG5A 5SYNA 3EA0A 2C3PA 5JQGF 1CJVC 3F3MA 1QG6A 3N8HA 1YU9A 3BWBA 5ICCA 3EXG1 4R83A 4JA0A 2VK8A 421PA 4DIMA 3NHKA 1KEEB 2A92A 5JJCA 1Y8ZA 2EHDA 4XRRA 1CQXA 1B14A 4QM6A 1KYZA 4NENA 1QV6A 1G4AE 2LKDA 2ILVA 3MRVA 3INRA 1G6Q1 1ZIXA 3Q2OA 4HWRA 5CFRA 1TQ8A 3KFLA 4FYWA 3QG1A 1U81A 4Q7MB 4QDTA 3TTUA 3EQ8A 3NP7A 1VL6A 4Y9SA 2GN2A 2ZBPA 2BGNA 1FB5A 1K8YB 1QC5A 2FFQA 3O38A 1V16A 3AB8A 4JVMA 3TBKA 3STVA 4OOEA 5ERYA 1CIVA 1JEQA 1J0DA 3KV1A 4EG7A 1U7UA 3DBRB 1UC8A 5FX2A 3GEBA 1L4GA 1SQSA 5B55A 4HWOA 1RBYA 2AMLA 4M83A 4OLHA 1US8A 5JCPA 1Q22A 3G2LA 4E03A 2FYTA 2XEXA 1T3GA 3ROXA 1OXBB 3AKDA 1COZA 1X3LA 1PFUA 4IDQA 4IV5A 3A9CA 4HUQA 4E5VA 4E7PA 4QXRA 1WKBA 4AVYA 4V02A 1HQDA 2G4CA 2QQGA 4L5JA 2FN4A 3ONVA 5TIIA 2GXQA 3QEKA 4EYEA 2IZOA 1W48A 3P0IA 2YOHA 1C1DB 3PUIA 1EUCB 1OVMA 2F1OA 4ZOLA 3C4JA 4IYRA 4BMZA 3PZBA 2VQFB 2GAAA 1IAVA 3HQ4O 3RSFA 3SEFA 3A6LA 3JD0A 2C4UA 3E8SA 3FTPA 4MVJH 5GJCA 2IYPA 5AKXA 4F91B 5DPMA 1YZGA 2A1UB 3H86A 3LKZA 5DI3B 5EESA 1F06A 1PL6A 4IBOA 8AT1A 2RCYA 2XTAA 1Y7PA 3NT2A 5DM70 3WQHA 1KH2A 2BE7A 5KBYA 4MW2A 4BNMA 1ULBA 5HFJA 1NC3A 1BG6A 4GFDA 4OATA 4QHYA 5CD1A 1IRIA 1JVSA 4EPWA 1TIKA 1I3OA 1KMIY 2D06A 2IU3A 3KCQA 3IT2A 3CTPA 1SXHA 1QX4A 2PM8A 5KVVA 1TU3A 2GEVA 3GCZA 3O8QB 4FNOA 4CL2A 3K70D 4JI7B 4P5EA 2WHRA 3IRVA 3NASA 3W8RA 4HWKA 2EJTA 4PWYA 4BDSA 3AH8A 2PLNA 4WUTA 1I7QB 2BKXA 1WSAA 2BM9A 2H1RA 3HNRA 3PC2A 1CE8B 3SU8A 4ROSA 4YQFA 4BVLA 3KQUA 5WRFA 3RAPR 1T36A 3TYXA 1N2EA 3PG5A 4OAOA 2GTIA 5FFNA 2HQSA 4Y2QA 4O5AA 5CVDA 5FPHA 2WD9A 3RM3A 2FUCA 2GF0A 2OZLA 1DC7A 4DN6A 3IALA 1M6HA 3TNFA 4JJIA 1A9XA 2GPWA 2EG9A 1KS9A 1C29B 1X13A 3IGFA 4NPCA 4D82A 5COQA 4GKJB 4M1EA 1IVYA 4MRMA 4ZAYA 1SB8A 3CF4G 3QLVC 4W63A 4PSVA 1PJBA 2W48A 5IAOA 1SQ0A 3TCKA 2OBMA 2OENG 4PNEA 3LVFO 1H05A 3T3GA 4EQZA 1D5CA 1DKUA 1L8OA 2R6CA 4LY0A 5LIRA 3PNLA 4KPEC 2IHTA 4QDOA 3ZU3A 2F9MA 4H7KA 3RSCA 3Q7PA 2HWKA 5BXYA 1GNTA 5EWJA 1BN6A 5HRCA 4EUFA 3GG9A 3P9RA 1WG8A 4MRAA 2HFJA 3OPYA 3WXBA 3W1EA 2V6GA 4JT8A 4WH0A 1JG3A 1MABB 1ZLXA 1BW9B 3B3JA 2XAAA 3N3BC 3PHBE 3M89A 3SDZA 4EKDA 3FCOA 4FKMA 4GMGA 4LJLA 1NTRA 3DEYX 4TMKA 1HNZB 4JX8A 1ZN2A 4BNNA 5JMOA 1YONA 2GSDA 5E4TA 4M6WB 1BFDA 4GWKA 4BO3A 1GQOA 4L75A 2P5YA 2ORIA 3DBHA 3GX1A 4ND8A 4J3NA 5A0VA 2E5FA 4AJ2A 1GNRA 1TF5A 2OV4A 4K3VA 3DEJA 1Y5RA 2H0QA 5TLSA 1ENOA 1E6MA 3AFHA 1G7CA 1UWCA 1HYEA 3K0AA 4AWXA 3PE4A 1P1CA 3THSA 2ACEA 1YS9A 2G28A 1V2GA 3UHAA 1IUKA 1H3NA 2CK3D 1A0OA 2NTYC 2X1MA 2Z9CA 3GRVA 4L8FA 4DT1B 1J0CA 4M1YA 1RXWA 1JSZA 2HU2A 5UKDA 2F4VB 5BVGA 1AZWA 3LW8A 3UV6A 3N7UA 3RVLA 2WYUA 3AUXA 1KXJA 3FI9A 4IFEA 3N2GA 3NRJA 5K99A 3FSGA 4NNPA 1ORDA 4QUAA 1THZA 4G65A 5H02A 5JCXA 2GJKA 4KB5A 3FUXA 1A7UA 2A9VA 4JC5A 4JEHA 3B52X 1ID1A 2HN9A 4IYJA 4FGJA 2RARA 4MR7A 2Q1TA 3K9LA 3T1VA 4G9EA 3CWZA 4RZ2A 1JR3E 4BGUA 4MJXA 3SP1A 1KQPA 5IABA 1LNZA 2Q0XA 2LKCA 2X9QA 4PYMA 4YR9A 4GICA 3IO5A 4U5QA 4UREA 4DG9A 4KBFA 2HGSA 3L40A 2VOJA 2UZAA 2QUBA 2P7IA 2XMZA 1NE7A 2O5CA 9MHTA 1P61B 3HFJA 4W8OA 4XAQA 1W8DA 3KOMA 1Z7EA 3NNSA 1F8FA 3ONFA 1N0VC 1YIDA 4QEDA 3L0CA 3VR5A 3LHKA 3V4SA 4DCJA 2QG6A 4IJWA 2WKWA 1C2YA 1I51A 3MTJA 4YMTA 1MO5A 3DL0A 2AOXA 4KGZA 5GJVC 2CLMB 2ISCA 4B4UA 4BLRA 5JU6A 1IVSA 2PUDA 2FP4B 1FOEB 1NNSA 4FFNA 2GBGA 2QN9A 4JJ7A 1JEOA 2XD4A 1PZNA 1FTYA 1VKJA 2QRQA 3H11A 4PGHA 4U2DA 3OWXA 4LYEA 4RF2A 4B81A 3LUKA 4IXTA 2O0KA 3KT6A 3KQNA 1BFKA 1RQ2A 2B7BA 2J6BA 3IP1A 3UT0A 3VO8A 4GEKA 1C41A 2XADA 1BAPA 5BW6B 3VNQA 3RRMA 4Y7DA 1ZP6A 4Q1BA 1L4KA 2VYVD 5EI5A 2F6RA 3DLIA 3L7KA 4POOA 1Z7WA 2ZJBA 3RK0A 4DPMA 2PFKA 1IU9A 2VHEA 4MP3A 3MPOA 5DTIA 2HO5A 2P67A 1WB4A 3ZIAA 4BWFB 3ZJTA 3WGQA 2GZSA 1QG4A 3GVCA 2XHEA 3NGMA 5FBWB 5EUCA 5F7JA 3U7FB 1C1HA 2B83A 3ZW8A 2DSTA 1SKBA 2JHFA 1XJCA 1P2TA 3R5SA 5B7QA 4LF7B 2VBGA 2OY0A 3FWKA 2IOQA 3BAFA 5SV2A 2YJ4A 2VUTA 3GMDA 2EEZA 4A03A 2ZSEA 5D87A 1HE8B 4KJZA 4LXUA 2OC4A 3AHFA 3FSGD 3T12A 4ZRNA 4E1AA 4OHYA 4DR2B 1TUEA 2PGIA 2G25A 2G67A 1FLDA 1VSBA 3JYHA 1HDZA 3MW8A 3Q5DA 4IMJB 4NC9A 2C2OA 2PZJA 1R5OA 4JGBA 1ISPA 5E3JA 4MS1A 3PB3A 3SNHA 4CM6A 2GPJA 3HBLA 2H5IA 3JZFA 1RLMA 4RMGA 4MVJI 2R5FA 1LXCA 2J48A 1WZ2A 1U8TA 4O8ZA 4HQOA 5I5EA 4NG5A 4MW1A 4XWYA 3RT1A 3BMQB 3RHFA 4EDFA 4MDYA 4YLGA 4AJ1A 3LQFA 4ZV7A 5JDCA 5LPNA 1JFVA 1EVLA 2PAFA 1OT3A 3FNEA 4I3FA 4DIBA 3OU2A 4MCIA 1RFLA 5F9FA 2Q1SA 3HVKA 2OBNA 3RW9A 2BCGY 1EK1A 4M89A 1ZN7A 5CTJA 1PUXA 4Q3KA 5EKXA 2B8EA 3CRZA 5JD3A 1IK4A 1YCHA 4MUFA 2HXSA 1W59A 2ZBUA 3ISJA 2P3LA 1U4SA 2E82A 3ON5A 2DRIA 1GAWA 2VLIA 5EYPB 2COKA 3EGDB 3QENA 1GGEA 1ZI9A 4MKIA 3UWPA 3V8BA 2YWDA 3E81A 2IBMA 4LMRA 1PLJA 2K7ZA 4RZ3A 4LJSA 4D4JA 821PA 1IN6A 2QW8A 3DAHA 4HDRA 3UICA 4IUBS 3DOIA 4HX2A 3GFQA 2OYCA 4C1NA 1OBCA 3TTTA 1Y3DE 4WSOA 2IYSA 3ZNPA 3AEQB 1GZ7A 5CT6A 2QY6A 3EEIA 3USCS 2AZTA 2ZVPX 3JARB 3P94A 4FJ1A 2C4KA 1FNBA 2COEA 1QKKA 1FDIA 1NBOA 1E2MA 1WRBA 1JFFA 4Q15A 3VC2A 1ZQ1A 3WGTA 4LF6B 4B6QA 4JOSA 3TQSA 1NF3A 1TL7C 3OFVA 4FKBA 2GJAA 1JHZA 3EXIA 4ZU3A 3GGPA 1UEXC 2I33A 3P5SA 2QDXA 4Q6WA 1NUSA 3ME5A 3OUZA 3RWOA 1ZU4A 3HB1A 4ISBA 1DO0A 1L4BA 1FUEA 2J9XB 3EQ6A 2DCMA 4N18A 4M0KA 4YACA 4YUVA 3SDSA 5HZGA 4YV2A 3SYMA 4BFZA 5C4MA 2RGEA 1T36B 3R9WA 1PKEA 1XJ0A 3NP9A 3AUTA 5FWNA 1R66A 2O6HA 1RQLA 4LSGA 1Q3TA 1HNWB 1Q0RA 1F0YA 5DP1A 4CQJA 4PO9A 5B58T 3O26A 1J9GA 3VVMA 2CLIB 3B36A 3HVUA 3NNNA 3VAZA 2WJ6A 4MYRA 4ZHSA 5K0JA 5C5IA 4DLRA 2P11A 4ZFNA 1GARA 2JAOA 4E12A 5CLFA 3Q72A 4XWKA 3EXAA 3OETA 3HM9A 2V97A 3PKJA 1CB7A 3TCNA 1W76A 4B74A 2OCKA 4C4TA 2HLDD 3LRTA 1OWMA 3FVTA 1Y5NA 3BIFA 3I9MA 3C3WA 4G3XA 2CWDA 3KKQA 4ZO9A 4JI3B 1MAUA 2O3QA 3RFFA 1J07A 1T2VA 4JP1A 4QAQA 1OAOC 1X2EA 3PF8A 2NU7A 1PR2A 2H18A 1SKAA 3L0BA 2HO4A 1Z6TA 3DA8A 4IUYA 2Q5EA 4ARAA 5KWEA 4HQKA 1XZKA 4BAZA 3FHTA 4H0NA 4ESVA 4OP2A 1M34E 2A94A 5AVYA 2PZAA 5AM0A 4JI5B 1ZY2A 1C3LA 1C8KA 2QMUA 3EXG2 2B8JA 3G9TA 2RKOA 3I2HA 3INGA 4GU5A 1NVFA 2VDQB 3F5FA 3W8NA 5CXQA 1N6OA 2DLNA 2QWXA 4DPLA 2X77A 2BEWB 2PZBA 2UYYA 3TX6A 4F1JA 4BMXA 2DAPA 2OG1A 3PI6A 2YYAA 4ND8B 2Y6VA 4NSNA 4UU8A 4Q9IA 1D1TA 4AJ9A 1QVWA 5FHRA 3U3ZA 3GUUA 3O4GA 1FXUA 3N3AC 3AYXB 4YP5A 5LQUA 1LF0A 3FUTA 2FUEA 1OV4A 4BNFA 5A5VA 1GZDA 3B2QA 3L46A 1LBSA 2IXBA 3R5KA 5AUQA 3E9CA 4ZCLA 4L5BA 4EW3A 2JIOA 1Q11A 3TUIC 1Q1QA 3U7EB 1XXHA 3HVHA 2VAXA 3ABZA 4M21A 4N82A 5M5BA 6ABPA 1OWOA 1WPGA 1CRQA 1JHAA 3TLEA 5HM6A 5F33A 1V5IA 3T7AA 1W49A 4L9WA 5EE1A 3D3EA 1W6UA 1R18A 4R7GA 2C57A 1V47A 5E95A 4ZOAA 4UHJA 1ZIDA 1FP6A 1EP9A 2PT9A 3QLUC 4XR9A 5DVZA 4ZA2A 3RWBA 4UTOA 2F7SA 2AB0A 3CRQA 1RE0A 3L06A 4U0JA 4WQMA 3DL2A 4AQDA 3SYNA 2HK9A 4Q3DA 3U7QA 3U16A 1NVDA 7MHTA 4HN9A 5EXXA 4KFCA 3IVMA 5IM5A 2DZDA 1J06A 4A27A 4JBYA 4TYMA 2Q2QA 1XRMA 5MFZA 2ZIXB 1GPJA 2HJHA 2GA9A 3LLVA 1GG5A 1TA0A 1P1JA 4KQ1A 2BR3A 1AMOA 1FRNA 1TLTA 3MGKA 2Q5CA 3PDCA 5KKNB 2Z57A 3GT3A 3BA1A 1BZYA 4BN0A 4ZYVA 2PX6A 4HDKB 1KTVA 2DQ4A 3L0DA 2CFRA 1PEAA 3QMWA 1IN4A 3B89A 1UMDA 4IIEA 4PC2A 2XODA 4MKGA 3NBMA 5JVDB 4EA9A 4OH1A 4OQNA 2FG6C 4J7UA 4RD6A 5EUMA 1KORA 3KUCA 5CCXA 2NP6A 3JW8A 5FA5A 3G6KA 2J32A 1VI2A 4PSAA 3FYDA 2CYCA 4R1SA 5E1MA 4C4OA 1MVLA 1DFIA 1FW8A 1R0XA 2B5VA 2QJWA 3EVCA 3I2IA 1QQ7A 4FYJA 2GKSA 1LKZA 3H42B 4JUIA 4NENB 4BBPA 3IQWA 3QOFA 2E1RA 4UCFA 4WXPA 3ZE7A 3KAPA 2NXWA 2BKAA 3B3QA 3MEQA 2FMFA 1SU4A 3N8GA 4M60A 4NBWA 1HEYA 2O1WA 2I2DA 1XMPA 4RHCA 3ZV6A 2EXXA 3A37A 2O4UX 2RAUA 3MSXA 2CFTA 2I2AA 4HNTA 3RTGA 2PMBA 4Q1AA 5BQOA 3K5WA 2EQAA 5KNDH 1XZAA 2GBLA 3BTUA 4HH1A 4XTRA 2XQVA 1ZGGA 5T6BA 3LTNC 3AOEC 2CHUA 4H60A 3PQCA 3IX7A 4P31A 4FI3F 4MMXB 4PRZA 2C2HA 2NM0A 1IY0A 1Z88A 2VF5X 4MIYA 3RSQA 3GNQA 1QSGA 1N5DA 5HE8A 3KE8A 2FMTA 5J58A 2X6RA 2C2GA 4O6VA 3IEXA 3QXXA 5AHRA 5FNVA 3WRXC 4YDSA 2WFLB 3SQLA 2HA0A 4Q7KA 3ZNNA 2C78A 2Q07A 2QZZA 3O8LA 4GLLA 1KAGA 4A6XA 4V1CI 5FWXB 2IT1A 1G9TA 1XT6A 3CLSC 3D9QX 3OT1A 2R4TA 1J4AA 4M54A 2O2JA 1SQ5A 2VNHA 4PR0A 5CDYA 5MDHA 4G07A 3VI4B 1UPFA 1W25A 2XB9A 3CSUA 2QUKA 3M6LA 1QTQA 5IAJA 2FPUA 1Y7IA 2QNBA 3PL1A 3U4CA 3IFSA 3WWPA 2BBSA 1KSGA 5KNDA 1FLAA 1G3UA 4OGFA 1E8NA 3NXKA 2DUUA 2R6HA 4U9IS 4BB9A 2VP2A 4EMBA 3Q7QA 1Y3FE 1Y80A 3IT0A 1VLMA 1WUKS 4Z7NB 4J76A 4YAUA 2ID8A 4KO3S 5DOVA 3BMOA 3FKSD 1L2TA 3V6LA 3ZHRA 2YHBA 1L5MA 4FZJA 2D8MA 1BX1A 4YUZA 4I50A 3COYA 2PGJA 3L7LA 2FDRA 3BYZA 4U02A 3SY8A 3HBAA 2AWNA 4IKEA 4CG1A 1M66A 1TZJA 1RM4A 3KYIB 3LT5A 1QHYA 1I2CA 4R2IA 2C2YA 1GKKA 4J0DA 5EE3A 5C18A 1AKQA 2JLCA 4IH9A 5LL6P 1X0XA 2BGGA 3T7JA 2VUIB 2F8LA 2PD4A 3WJAA 3WLRA 4DMLA 3SXPA 1R74A 3G6WA 5B12A 1WMBA 3LM8A 4LSZA 4F84A 4LF9B 3L07A 2PNFA 3OM8A 2B35A 4IJQA 5KX5F 3E1GA 3HN7A 3IP5A 3HRKA 1O4WA 1KEPA 1RLOA 2ORWA 3FTQA 2B4TO 3GY0A 3KQQA 3FBTA 3R2JA 4KO1S 4DQ0A 5HKAA 3EQZA 3PUZA 4K5QA 3W5VA 1X15A 3BBPA 4HZUB 3RRBA 3TVTA 1NLMA 4R16A 1QX3A 1KQNA 5FTLA 2BKLA 5I45A 4K6HA 3LDHA 3FA2A 4MUBA 3W8EA 3D8NA 4OMCA 1L1RA 2W58A 4OFBA 3W7AA 1G8FA 2P1ZA 3LP5A 2DE0X 3HJGA 1Z2CA 1HZZC 1QTIA 1ZCAA 4JYMA 5EXDA 3OE1A 5I4CA 2CZQA 2W2VA 4FBGA 4JDPA 2XWBF 2Y77A 3V8QA 3ZE6A 1RBQA 4MS4A 4DCTA 4BQPA 4E5MA 4DDVA 1KYQA 3V5NA 1ZMXA 2RG1A 5CLGA 1REQA 3H1FA 5CDTA 2H65A 5JRZA 1GN9A 3WWCA 3PCXA 2VCHA 4HUQB 4JBWA 1P2UA 2JRLA 5EY5B 5IKMA 5KTOA 1VB3A 3VR3D 3EPRA 3RJ5A 3T3EA 1CRZA 1YNSA 5AO9A 4ZD6A 5EHXA 5ER9A 3F8WA 4HSGA 4X93A 4QTYA 1VRCA 4YRKA 2VJAA 3M1IA 3W1WA 3KP1A 4OGKA 3PCTA 4X44A 3KR2A 4LQ4A 3OICA 3STYA 2DQZA 2R1TA 3KKPA 3CVYA 2YJ6A 3KLNA 2LRHA 1WCXA 4YLEA 2AW5A 4P4NA 2QR2A 1C8LA 3JAKA 3KWMA 5AW4A 2VOEA 2HK6A 2HI0A 3U5ZB 1EVEA 1N0HA 1VP3A 2HV9A 3NVMB 1M1UA 4LXTA 2XITA 5E1OA 2J30A 4C6TA 3HO1A 5KREA 3Q3GE 3EVAA 2C0QA 3G02A 1QV9A 1BS2A 4KXMA 1R27A 4N8EA 4QDUA 3PEYA 2HHCA 2HPHA 1P44A 2PS9A 4LZZA 4NY1A 3EZLA 2Y05A 1JHOA 1TZKA 5I7AA 1P91A 3T5CA 2FZEA 1HQCA 4ND3A 3M70A 1SELA 3E48A 3Q0IA 4P7FA 5I6DA 3ZE9A 2R7KA 3G0OA 2E6KA 1L5HA 3IEVA 5F3DA 4O0LA 3ICWA 3U0VA 1YQ9A 1N6LA 2CVOA 4M1TA 3ZOKA 4HXEB 2NP7A 4AZ3B 3LCRA 1X1QA 4MYCA 4DLSA 1AMUA 3SKVA 3ZKAA 3QNMA 4S12A 3ESBA 3R5TA 4RVSA 4LYAA 4Y1EA 1NUTA 2V7QA 3OCYA 2FZ5A 3WVNA 4V0NA 4Y0NA 5A3JA 3HFSA 2YJ3A 4GRAA 3OCUA 2B4YA 4PXYA 2FOXA 1SY7A 2XI4A 3DW1X 4RHUA 5K3AA 4MW6A 1OA0A 1JKJA 1P7CA 2CB9A 3REGA 3RIMA 2VNSA 3INNA 3VPFA 3HGQA 3TLGB 5GZ6A 2XYVA 2JGMA 2APJA 5EQDA 3EHDA 3AKCA 1XAHA 1DX9A 2ZAIA 1GQSA 1W96A 2J59A 2Q7OE 5CB0A 2J33A 2J0UA 13PKA 2JZCA 4I6GA 4H17A 2ONJA 1FMFA 3P20A 1DUIA 3FOFC 4DY6A 2HQOA 1G8KA 5BT9A 1I80A 2OUIA 3B60A 3HYNA 2BGRA 4XYLA 5ELMA 2ECPA 5FUXA 3ZI4A 2V9ZA 4RTOA 1L7AA 4GGPA 1SBZA 3DP7A 4JGIA 3RRFA 2DCUA 2O0LA 2G1AA 3QNWA 5ENVA 4XXHA 3RQIA 3OVMA 3D4NA 1SXJC 3M82A 3P19A 1EZ1A 4GE0A 3P5BA 1C7FA 3AIIA 3Q88A 2OVBA 1ELOA 4HAVA 2Z8YA 2WNSA 3AF6A 1RE1A 1ADCA 2QTNA 5JUWA 5SZJA 4E3ZA 4F97A 2XSZA 5IM4A 4LOKA 5JNSA 4NDZA 2GF9A 1JA9A 4P3NA 2JZOA 5C8YB 1VHLA 2IK8A 2CL0X 3QUCA 4LJKA 5CIWA 3VU1A 4BFSA 4QD3A 1BMFD 4CR8A 1SK9A 4ZOCA 4MS1B 5ANRB 1ZI6A 2HKIA 1ZD8A 4Q9HA 2AA3A 3UVEA 2DHQA 3OFNA 4G5SA 1G59A 4Z4IA 2YZ7A 1G8GA 1NMXA 1OBHA 5CCDA 2Q3MA 1XDGA 3BGVA 2XXJA 1MENA 5CLHA 3V1MA 5KWSA 3J81A 2ZJZA 1GCIA 4GSYA 4J29A 2PSSA 3KUUA 1ATIA 3FB1A 5FOTA 1PR3A 1U98A 3CZQA 2W6ID 5ETJA 3GPBA 1KJQA 3UK0A 1RYEA 3G9QA 4WLNA 2ZS9A 1WZEA 1A88A 3TNDA 3LO5A 3QBVA 4AIRA 8MHTA 3QKRB 1U9ZA 2CXRA 1DC3A 2IZ1A 3RT9A 2OD7A 4OEHA 4D97A 2JLZA 4ZI3A 1P17A 3TWOA 2GRAA 5CGZA 1GNVA 2X3UA 3A1NA 3FOAA 2QUZA 1YJQA 2JIBA 1UM8A 1XF9A 5JYDA 2CXSA 1QNFA 2DKOA 3KU1A 4GQAA 3JS5A 5D1NA 2YXBA 3DXXA 4W6QA 4XWAA 4GVPA 3OIGA 1M5TA 1UDCA 3L01A 1Q44A 2IV3A 4M9XA 3NAGA 1LX7A 3O2JA 2P8JA 2VAVA 3BAZA 3GLIA 1E2GA 2W70A 1YK1A 1KSFX 1G66A 2YWCA 1H2HA 3DLAA 2DQSA 3K2IA 2V0GA 1Z6YA 1JHQA 2IOHA 5ALWA 2EV9A 3VV2A 2J3QA 2ZUTA 5KDOA 3MZ0A 1MPXA 1YQDA 4YREA 2C59A 1G98A 1GNLA 2R48A 1E1RA 5EC8A 4F3RA 1T8WA 3AF1A 3OQHA 1E1CB 4X3OA 5BWLA 4ZVPA 2XXAB 4EI2A 4B34A 4PBRA 5JPIA 1F0PA 2CMKA 3AZPA 3EZFA 4IG4A 2GFHA 3PNYA 4MUAA 5TJHA 3R7NA 2IS6A 3FSEA 3SX0A 3U3MA 3WFZA 3MLBA 3FTNA 1C5KA 1X7WA 1X1BA 1TIPA 5A5EA 4NYMR 1NVVQ 1AZTA 3RSZA 2G1JA 4FT2A 1MDBA 3A4IA 3T1NA 1JAYA 1IUPA 2OXTA 5CPFA 5LLDA 3Q8WA 2G80A 1RAGA 4L4SA 1W4BA 1ZL2A 3CIFA 4FI3C 5HX7A 3MD0A 2OC9A 1RHUA 2Z5GA 4FNAA 1M10A 2AF3C 2HIHA 2YX1A 2YQZA 4ZAXA 4BO2A 1QPZA 4CKCB 3VR5H 3QU5A 2UUAB 1XPJA 4EG3A 3GJYA 3OZCA 4A5OA 4RESA 2Q49A 3GAAA 1VG9B 4K88A 1B26A 2ATCA 2J9YB 4BFWA 1VXRA 1ZIYA 2HA2A 4EO9A 1V8BA 4U63A 2H4WA 4W8HA 3V7FA 5KQLA 4C7OA 5EAIA 1KI9A 1GEGA 3L79A 4S1TA 3IKVA 3OSUA 2ZLBA 2OQRA 3ES9A 4GT1A 3UK6A 4EZBA 3GFGA 4M9QA 2BFWA 1L5SA 3EULA 3HA5A 3IBYA 1MCZA 5HSGA 3B1WA 1E0DA 3OQPA 4P98A 2Z4TA 3I83A 5CP8A 3WNCA 4KPFC 2JVJA 4YT2A 3G8DA 2Y1WA 4KXUA 4OQMA 3A6JA 2SBTA 2ZEJA 4NCIA 2NUPB 1GSAA 1KRWA 2ATEA 1RRKA 4M0MA 2HMWA 2QQ5A 1BEUB 4U7JA 621PA 4YP6A 4CQLA 1A7AA 5AVQA 2DFTA 2WB2A 3BWYA 1XELA 4LV6A 5GGXA 1JAIA 3E35A 4HEHA 4UKDA 3R3VA 3M6WA 1QHHA 2BM1A 2HSJA 3I3OA 4YROA 3LE8A 1BDJA 1JMVA 2W2NA 4F8EA 5DWVA 3ZNQA 4MO9A 2Z98A 1A2KC 2I71A 3RVKA 1F51E 3UMCA 3D3WA 5AI6A 4EUEA 1HTBA 1U0TA 1CZNA 3RC3A 3KQTA 3UMYA 2B0CA 4R7TA 1UKYA 2FRDC 1XCPA 4GBED 1AN9A 3SJ7A 1WWKA 3OF2A 5AFSA 1MJ5A 1ULSA 2BIFA 1PGJA 2BFAA 1G21B 3AONB 1XLTC 4B8YA 1X7ZB 1KE2A 1ZCZA 1NG1A 4AO7A 2RGUA 3A6PC 1R8XA 1V3QE 2RGRA 4QUJA 3EY9A 1LVGA 4IDCA 1HK7A 1GPLA 2JDID 4TTVA 1ODFA 3BS4A 3JWJA 3Q98A 2BBTA 1HZJA 2EF0A 1XZCA 1ZJ6A 1VTKA 2MR6A 3A6ZA 3IAHA 3T38A 5A4AA 1MV8A 2PQMA 1NFQA 4AJIA 4UW9A 4YGXB 4G5FA 3CVJA 1GZ4A 6Q21A 2YR0A 3L18A 1BEEA 3V48A 5I7OA 3HJTA 4DARA 1Q14A 2H92A 5B58C 1I3MA 3S8YA 2XB4A 2NNWB 1BE0A 1B7GO 4CM5A 2ZDQA 3FDZA 5J43A 1BOOA 2PR7A 1S3SA 3H16A 4GG1A 2OCLA 4IMRA 4IDPA 5E6RA 3CVWA 1E62A 3VPXA 2I2WA 4U2GA 4C76A 1I7NA 4KL8S 3H5IA 1U7DA 1W4RA 3FPLA 1PK9A 2SKDA 4ARBA 3UUEA 2QD3A 1A7JA 1NP6A 2CHVA 3FGPA 4LHWA 4LISA 4LRUA 4Q7LA 1YA4A 4BLUA 2X3FA 4EUKA 5DN6D 3T52A 2AEFA 3WB2A 3THOA 3I39X 2VG8A 2ABWA 2QNIA 4IEFB 2IVFA 3KBBA 1AQIA 1RLJA 1RJ9B 2MINB 2I65A 1MH9A 4QOGA 4S1NA 4BV2A 5LYYA 3FPFA 3PFCA 3V4OA 1I8TA 3R3YA 3O3NB 3V2HA 4C0JA 4F4FA 1FDWA 4L78A 1TW2A 2O2HA 2YYYA 4B82A 2ZAMA 4EABA 3FF4A 3QFRA 1YZQA 4ZOQI 2QE6A 4MIEA 4KDEA 5TY0A 4BUCA 1G8PA 2FMHA 3C1UA 3D6AA 3PE6A 3DH0A 2HX1A 2O52A 2QTVA 1C7RA 1ZA2A 3UT5B 2NU8B 1Z06A 1T35A 2JL1A 4HFRA 3F2VA 3AETB 1H3EA 3ZGOA 1XTPA 1G3RA 3GCXA 1WS6A 4Z4GA 3QFCA 1D2MA 2C9MA 5EZQA 3VH1A 1DQZA 2CXPA 2PPLA 3LF2A 3WOHA 5C52B 3SQXA 2WOOA 2WVJA 4NV3A 1C1XA 4ZZ1A 1X8KA 2QTCA 3IDFA 5KCZA 3QX7A 2WM2A 3R7DA 1YDMA 4A26A 2BKVA 4JLPA 2HYDA 2HSZA 2XUKA 5FL7D 3ZDXB 2CVFA 4RVHA 1KO5A 1J24A 3VZRA 1DIRA 2EU8A 1L5VA 1F1BA 1Q15A 2L18A 3CT6A 3I9NA 1J33A 1Q50A 1C30A 1VIYA 3AINA 4FYHA 5D3QA 3MJCA 3CNQS 1OYWA 5A02A 4CKEA 2BTEA 3NWEA 2B4QA 4CIYA 5AK0A 5JRDS 1RJFA 2O54A 1XEWX 4UBNA 1PJCA 3AR7A 5FUWA 1ZM7A 4NAVA 3KYJB 3S29A 1WDKA 3E4CA 3LL4A 2IXTA 3I4FA 3D7MA 3PLRA 4FOPA 4XQCA 1LQ2A 4IEIA 5F5NA 4C88A 3DDUA 4DLPA 5KYNA 4RANA 5KZMB 1Q1NA 3FJOA 5ALFA 1NAIA 3CLKA 5B36A 4J75A 1NWHA 1Y0BA 4Q7QA 4CG3A 1T5HX 2OQVA 1HZZA 4AP9A 1O1YA 1E2UA 2XYPA 2JKYA 3EMDA 4OBXA 4XR4A 1NIJA 1Z4KA 4S35A 1NSYA 3ILSA 4FDAA 1JR6A 3JYQA 2I99A 2FX3A 2AVDA 4GPIB 4GO1A 4HWTA 5A2GA 2Q3EA 2Q5FA 4EY5A 3NBUA 4Q5IA 2VDPB 2BFDB 2WU4A 1XRPA 2QTHA 4RIIA 4DABA 4GPEA 2W2QA 2NZJA 4U9UA 2WM3A 3JQDA 3LUPA 1E0SA 3C70A 4N0DA 3OX2A 3EZ2A 5B1HA 5BN4B 5KC9A 2ZP1A 2BZSA 1NYLA 3PIIA 1WHTB 1UOPA 3KJQA 2DKFA 4ALJA 1UWVA 2FLWA 3NEAA 3AR5A 1VJCA 1G2OA 1U7TA 1KZ6A 2QGZA 4MI1A 1ID8A 3IVCA 4DGQA 1EGVB 2DULA 3VYUB 2PD3A 5IUNC 1R00A 3O7MA 3JQ8A 4NMWA 1P3Y1 4BL5A 3SK0A 2K87A 4IG9A 3VR1A 1DU4A 2ZI5A 3K9NA 3VVCA 1LDYA 4A8JA 5JJLA 1ISIA 4G5OA 2XOKA 1TD1A 3BDAA 4IIGA 2QQEA 1FL9A 2R00C 2H59A 4PSKA 4F2PA 5E6UB 5J4KA 2DY1A 3BF8A 4GPBA 3ZCRA 1KAHA 3OOHA 3V1YA 3U9TA 1M73E 4E1VA 4PBTA 1UAGA 2IXGA 4NBRA 3ISVA 3NPAA 2FAXA 3SEZA 1Q74A 1W5AA 2DTDA 1SCUB 3VC3A 3ZLUA 5CG1A 3FW1A 3GUHA 3NYWA 2H31A 3IUNA 2PXHA 1Z35A 4QRHA 3NBAA 3WK5A 4EUNA 4JL5A 4F4DA 3HKEA 2P6NA 4C01A 1FSPA 2C1XA 1VKHA 2QMYA 4EGAA 1ST2A 3WRXA 1U0SY 4BQEA 4KG7A 3A1TA 1SEPA 1L5HB 1USIA 3GEPA 3MTGA 3IOEA 3DQQA 3VU9A 4DDTA 1SC6A 4QBFA 3LQRA 3I6BA 1B1AA 3PD0A 2XKAA 2PHZA 1NQOA 3ZGZA 1J25A 4WADA 1PYOA 2QPOA 2Y4NA 3IIEA 4LBWA 2GX6A 3CNNA 4Y9TA 4J0EA 1H2EA 2JGAA 2QXYA 3F49S 2A86A 2A35A 3VJMA 2C1EA 2PZEA 1N77A 3QYJA 4B45A 4JYZA 1KJWA 3Q40A 4AS2A 4EAQA 5MN5A 5KNBD 3OC6A 4BX0A 5IJ9B 4RVCA 3DHEA 1CSEE 3K6KA 4XGNA 1Z29A 3LYHA 3SYRA 3HDGA 2ZBEA 1XHEA 1AK2A 3OT5A 4XD2A 5P21A 3LPDA 1C0PA 4XIJA 5LQKA 3UB2A 5A6SA 4L74A 3E3LA 1EP3B 3ZGNA 1F7UA 3HJBA 2QM3A 4C89A 3SSAA 5J4YA 5HCNA 2RJOA 3MUNA 1L5KA 4GVLA 1L7QA 3NYQA 1D6JA 3CZ9A 1FZQA 1T3ZA 3RBAA 4LEIA 3U4HA 4C08A 4HCJA 3UENA 3W6ZA 2X14A 2H7CA 2WIDA 4CTNA 4TN1A 1VHDA 2BUAA 4JJGA 2QIPA 1VMIA 2QRHA 2W6JD 3BH7A 4NARA 3G8AA 2DJIA 3RJTA 5L6MB 4HEA6 5A4KA 1R5JA 4JC8A 4QE3A 3B2EA 2ZSFA 3ZWNA 3U09A 1G21E 1ND6A 3KQPA 5CDHA 4P58A 5JMTA 2J5QA 4R8RA 5CAEB 2GK6A 3GRRA 2WG1A 3ADPA 3HXQA 5AI9A 5KYWB 1SKYB 1LBEA 3DMTA 4ZAVA 1H69A 1ZDMA 2E0IA 2WIJA 4ZMRA 2QUHA 2O59A 4BV9A 1O58A 3L1UA 5CFQA 4AF6A 1TVMA 3UMFA 3ENZA 4LOIA 3TFOA 4LWPA 2PXAA 1HDXA 4GPAA 1Q17A 3PXBA 4Y6OA 3ZG6A 2ZBFA 1TEHA 3ICOA 2CVQA 2BR5A 5FKJA 5JNLA 1MDFA 2AZMA 1W0CA 2PUGA 3M9XA 4BAUA 5I9BA 1GAJA 3PC6A 2BHLA 3HLYA 4HBZA 5BSHA 1ICEA 2O20A 1W47A 3IR5A 4CKBA 5GIPE 2Q1XA 3M2PA 5EJAA 2AYYA 1NZJA 4L0DA 3ROEA 3L49A 3ND5A 1E89A 4E2XA 4PW0A 4MI6A 1SNYA 3F1KA 3AFMA 5EP3A 1M1YB 1V0JA 3KD3A 1W6RA 3GFBA 4IDBA 4TS1A 5AJWA 4UMFA 4WDQA 5H3CA 2GN1A 3LDUA 3QE2A 3EAGA 4WLUA 4XI9A 1A9YA 1VSTA 1PYGA 2AXPA 2X6QA 4HAXA 4DV7B 1SA0A 1OROA 5I7WA 4GX5A 4B40A 1NRXA 4H3SA 2AEMA 3PWTA 5AK6A 3K70C 4I50B 1USGA 4TMFA 2WIGA 4DREA 3H4MA 3LH5A 1SB9A 2Z2YA 3LX4A 4CV0A 4NTZA 1J0AA 2R25B 3BJRA 3FVRA 3IHWA 3OQ6A 3N7TA 4WXHA 4KV9A 1DBVO 3EF1A 1ZVKA 2E4YA 4JBXA 5A0FA 4D25A 1H2RS 4GL4A 2JGFA 3WLJA 1DRUA 221PA 3PXGA 5CBPB 2IXFA 2FEAA 2XTZA 1P0CA 3NALA 4DCNA 3E05A 2GYYA 4NHOA 4YP0A 4BKOA 1F48A 3G68A 3UFXA 4M2LA 3OJXA 4TV8A 4Y6SA 2D00A 4IILA 1VL8A 3BWEA 3PEVA 1YS7A 4R5MA 3O92A 1RAIA 2EBFX 2ORED 1WOYA 2IQ5A 2Q28A 5HYVA 4S2EA 4ZT4A 3AI1A 5CCEA 2AQHA 3SVLA 1RRGA 4O4JA 1KI4A 3UWOA 4I46A 1P1RA 3IHKA 3TXXA 1JE1A 3H2SA 3MVEA 2HW8A 4ENQA 3L8FA 1PIWA 1B6SA 1R4MB 1AQ6A 1D8TA 2WWXA 4ZQEA 2OFWA 2GNAA 2E3JA 2R86A 4BC1A 5EXTA 1TEZA 1NBAA 5A9SB 3PUVA 4D7AA 1IATA 1CS0A 4ALKA 1XG5A 3Q8XB 3NC4A 2VRCA 1GL6A 4RJJA 3ZBQA 1C0LA 2J5RA 1EDDA 1NXVA 4NLLA 2AT1A 2CKDA 1C3XA 3HUTA 4OHBA 4BB0A 1YB2A 2BWJA 3AHJA 4GKAA 1DKNA 1KOLA 3D0OA 1KK0A 4F7DA 3GLFB 1AE1A 1KY3A 2IDKA 4JLSA 3TBFA 3W5BA 1JJFA 1ZUWA 2Q9BA 1ZQ9A 2WSIA 5SZKB 2RSLA 4CI0B 1BHJA 1LBHA 3ORRA 4KQHA 1YL7A 4QAJA 4HZGA 4UNQA 2P2ZA 2XV1A 2G4VA 2X7HA 4HDMA 4BGDA 2GCIA 2BW0A 3OTQA 4LXXA 1W44A 4PYLA 4B7XA 1MIOB 1A8PA 1WPXA 1ESZA 2REXB 1TAHA 3DS8A 3HCPA 2R65A 3NWBA 4NOMA 2QL7A 1PUJA 4QU8A 2JHAA 5JTTA 5LM3A 1KH1A 1OR8A 1RYMA 4CLRA 4XB2A 4K28A 5IJAA 5BUQA 4AXXA 4KMMA 3TF5A 5FBRB 5HJ7A 2C99A 1FP4B 1HE2A 1KMHA 2WSYB 5CU7A 2IX9A 3WP1B 1CY4A 3PFGA 3U40A 2BAGA 2VNAA 3JZDA 1KOGA 3M5DA 5HDQA 4MQEA 3RSLA 1GUBA 1EWKA 1LQUA 1K5HA 3L0YA 4RK0A 3AKZA 1NDHA 3SYKA 2R7LA 1EFHA 1ZW6A 2GNOA 5L7YA 3PQ2A 2AFIB 1MOPA 4WLFA 2YZKA 1G8SA 4MVWA 3TLKA 5FUVA 4D5EA 3C7KA 3U6BA 1FYXA 1G3MA 1QC5B 4JN6B 1ZONA 1DRKA 1QUFA 3TM4A 2EGUA 3QA3E 2VS1A 1VIAA 4ZYYA 2RAVA 1Z18A 3HXPA 1QLWA 1UT5A 1EG2A 2QT1A 3FMOB 3IVXA 2PEZA 5G0SA 1D09A 3HNOA 1FTSA 2J6CA 2VXBA 2AG1A 2Z2IA 3C1TA 4IZHA 4M8IA 4ZEMA 5BSKA 3ND7A 4JKOA 2TS1A 5LDGA 2Y1OA 2NVBA 5ED0A 5BWOA 1NNI1 4AP5A 3WLIA 4TSFD 5KAPA 1SURA 1FYFA 3VPBA 2ZYRA 3U4GA 1P3JA 2PRZA 2XIQA 5DCWA 1MG5A 3PDHA 3ROMA 4ZI7A 2Z08A 3ZDCA 5LMCA 2ZANA 4CGYA 1T2AA 2X7XA 1JSLA 1BYUA 1NN1A 2HF8A 1JI3A 2AJ8A 2H57A 2XMBA 4HLUC 3TCXB 3TTXA 5FPYA 5BN5A 1M9NA 4ZREA 3DM9B 4G97A 3PIRA 4CZ2A 1PFKA 3BDVA 2FI1A 4LJAA 1DAKA 2WTAA 5E7MA 4A2CA 1F12A 5J2TA 4RIHA 3OG9A 2ADOA 5CB4B 3NHLA 3MQ2A 5HTOA 1TE2A 2OGSA 4JYAB 1Z5VA 1E1CA 2HK7A 3EFHA 2EZ4A 4ZT3A 3X1YA 3HEAA 3T1TA 4RTLA 5IYZA 3SSMA 3VR2A 4QHTA 2E5LB 3C14C 4IFIA 3TVYA 3AP3A 3EGOA 3MUEA 1D04A 1X1DA 1YIOA 2AUMA 1PR0A 1JZSA 3UHFA 1E1QD 3AUAA 1XFDA 3EDMA 3X2EA 4AY2A 2IQIA 1P1BA 4CG0A 4LTNA 1TPYA 3I92A 1JQEA 4ZZ2A 4DRXB 3QE4A 4XJTA 5FTNA 2C5HA 3FWYA 5CM8B 5LNK6 1GAQA 3MS2A 1WV0A 2PTGA 2A67A 2B25A 2VZ9A 4FQ8A 2ZYAA 5EIOA 3VMFA 5CEFA 1CJTC 2UVPB 4E1BA 2PFSA 5FLEX 3KOUA 4RVUA 1KPGA 2CHFA 4ECAA 1ILWA 2ZIFA 3FWNA 1ESMA 1QM5A 3IPRA 3QX8A 4GYKA 1FFEA 4QUGA 3P2MA 1FDOA 3X1ZA 4ZPXA 4F06A 2R60A 4HJXA 3FTFA 3EXHC 1MHTA 4GR5A 2ZE5A 3LOPA 1B76A 4X6UA 5F4ZA 3KWLA 1Z0ZA 1TM2A 2IGBA 3T95A 4CQNA 2H2FA 3CG0A 4BWYA 3IBSA 3H1PA 5FORA 5ES4B 4B6OA 4FLFA 5A0TA 4LSMA 4LN1A 3LD9A 4EJSC 2ARKA 1BDMA 2GUGA 1ZNYA 4UNSA 2CSXA 4QTUB 1XQVA 2GPTA 4P7GA 4I1IA 2VP9A 5ADVA 1ZNXA 3A14A 3BMNA 4DIEA 3THRA 4RD4A 3G2IA 3HV2A 3EXEA 4P3PA 7REQB 5IZCA 4XLZA 2EKPA 1OASA 1HE5A 1RI2A 1X7DA 2AG5A 4V0MA 1NLZA 5DM2A 1AQNA 2XE7A 4L8GA 3KTDA 5SZHB 5DHSA 4LOHA 2NZXA 3A26A 5LP1A 4NEGA 1XRJA 4NK4A 4CETA 1ULUA 1DTEA 4EFNA 2JJYA 2AC7A 3EZNA 2G17A 2XOXA 4DNPA 1Y8RA 1V8FA 1KY4A 2I4RA 3D0QA 4OIFA 5FWDA 2CL7X 3C87A 4BP1A 3EEQA 3B1VA 1LB1B 1M2VB 3EUEA 3GJ0A 2FPGA 2I3DA 3GDGA 2H8GA 2PUJA 3TL6A 4ECEA 4X66B 1FMLA 2XKBA 3RODA 1FNSA 2IU4A 3Q1LA 1V48A 2OCGA 1E20A 4F04A 3UPTA 2ZUBA 1AX9A 2QQFA 1J56A 4C6HA 1GUFA 1N6HA 2EQBA 3OD1A 4MWEA 5K0LA 3FCSB 4H1VA 5E9WA 1XJ5A 3E3NA 1RXUA 3EA5A 3QPAA 4S1VA 4AJ4A 3DTVD 2ZE8A 5CG2A 3KVYA 1Y4AE 3TB6A 4HR7A 1IG3A 2IEBA 2P27A 3K32A 2YN4A 1GL9B 3D4IA 3FDXA 3RARA 1T9KA 3Q6NA 3LPLA 1GPMA 4L8VA 1R0RE 4RUKA 3RYIB 3KEFA 1JTVA 1W0JA 2FFAA 2IODA 2V6JA 1H1LB 4EEZA 1T10A 1U2DC 1E3EA 1LU9A