5KS9B

Bel502-dq8-glia-alpha1 complex
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
191
structure length
181
Chain Sequence
DSPEDFVYQFKGMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRRVEPTVTISPLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPIIVEWRAQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 181
sequence length 191
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ks9B01
1NC4D 3DYMA 2W0FA 4NFDA 1RK1A 3DSFH 1FV1B 4R4FH 1FYHB 1QBAA 2P46B 3RVVD 5IHBA 3GMQB 2BSRA 5KSUB 3WEXB 3U0WH 2D4DA 3QCVH 1JPFB 4MLIA 4FRWA 4H26B 5EOQH 4GXUM 2X10A 1WIOA 5E8NB 1JHKH 1CQYA 2K1MA 4LP4A 2GFBB 1RULL 1JZ2A 1CT8B 4LLUB 1U93A 3WBDA 2BNRB 4WV1A 1JWUB 3P77B 4JM4H 1GZPA 1ZT4B 4NJ9H 5GGVY 4JPWH 1PYWA 2APFA 2RGSA 4IHOB 5ADOL 3VXTB 4HPYL 4HWEH 5E2TL 3TPUA 1CFTA 1DBAH 1FVEB 1J8HB 1AE6L 1E0OB 3CMOL 3VH8A 4HK3J 3QIUA 1WEJL 1J5OL 1J0HA 1G7QA 5TQ2H 4DFIA 1U8IB 2FL5B 1QFHA 5IV2A 1LO5B 4X0KA 4QF1B 5F7FA 1CFNA 5JOPE 3N85L 5HHOB 4P4RA 3HAEA 4J3XA 2QSTA 4M6AA 3D0VB 2D9QB 5LCVH 5CZVL 2IPUG 4HS6A 4KI5E 3RDTD 4OZHF 4DW2H 3WHE0 2ICWI 1W72H 4G6JL 4UTAH 1N6UA 5FCUH 1Z9MA 3BGMA 2P5ED 4KRNA 4LQFH 4F9PC 3LKSA 2OJZH 3EGSA 4LLVA 1NCNA 2GTZA 2ZOKA 5C0FA 3KJ6H 2J4WL 3E2HC 4OM1L 1XT5A 4Z95L 1YEDB 3VCLB 5T3XL 3KPSB 5KSBE 1LO0H 1CXKA 3HNSH 4YE4H 1DVFB 5DRNB 4L8DA 4ODWA 1EJOL 3S36H 3TBYA 4R8WH 4OF6A 2GUOB 4PJDE 1KT2B 2CLZA 2HWZL 4YHKL 3WJLC 3RWIB 3NCFB 1DBJH 3ZKQD 2WLZA 1N5AB 3BDYH 4HJJL 4MD0A 1AHWC 5C0RL 4MZ2A 2DMBA 5C0EB 4Y7MA 4RDQG 4HMEA 1FO0A 3SBWC 3U6RA 2H41A 1UQSA 3MRFB 4POUB 3IGAB 4NQCD 5F3BB 4FFYL 3GSNL 2ZUYA 3H6JA 1KB5L 3LKNB 1CDYA 2LAAA 5E94B 3DETD 4FQQA 4EI5A 1QZ1A 4JRYE 4JY4A 5E8EB 3VRIB 3LB6C 2X44D 2AJZA 3WNNA 43C9A 2UUDK 5H2BA 1MRDH 1WJ3A 3BO8A 1MAJA 5JDSB 3MA7B 1QEWB 4YPJA 3SKMA 4GUPB 1DEDA 5DMIL 1KIPA 1ZVHA 2P7TA 3PL6C 1NCDH 3I2CH 1UM6L 5D7LD 4RFOH 2Q86B 5LAXA 2YK1H 3TH4T 3PNWA 3RU8H 5TE4H 1YYLL 3W0WA 2BNQD 4P3CL 4HKBB 2NY7L 3QIBD 5J0BA 3EOBB 5MP6L 1IGTB 2UZYB 2EE2A 1IAKA 2CD0A 1UYWH 5FCSH 2FDBP 1F3DH 4NZDA 1I3GL 5DWUL 4HUVB 1S9YA 2R29H 3D1MC 1A21A 5EOCH 4GMTL 2XZCL 4L3EA 4R97C 1CDUA 3BD3A 2IQ9H 3GO1H 3QUZB 4LCWD 1JI2A 3MV01 5F3HB 3U4EA 4LIQL 3FQXA 3QXDA 4KROD 2UVEA 3FCTB 3GJEB 5GGRB 4NPYA 4QHLB 1K4DA 1NLDH 1FE8L 3RRQA 4NHUA 3ARQA 1IC5L 4FXLA 1G9NH 1TNMA 1LO3L 4IRSB 4M7LT 4QKXB 3DO7B 2YD3A 4PJ7B 4PRHD 4NBXB 1X5XA 4NC2B 1T0PB 1NH6A 3FOLA 3FFCA 1KFAH 3SDDA 4DN4H 5FO9A 2EIZB 1T89C 2HH0H 2PCPB 2H32A 2HP4A 4MAYB 4KRMB 4OZGA 4M6OH 1Z3GL 1WTGT 1LNUA 3DROB 5AAMA 1FNSL 3B9KD 2EDOA 4BQCA 3MXWL 5E8DH 3U4AA 2P43B 3SQOH 3SE8L 3ULUD 1PD6A 4U1KB 3UZVB 2C3VB 3SKJH 3BKJH 4JGJA 1T04A 4NO5B 2WMPA 5F7KC 5KSBB 1AXTL 2RBLA 2YR3A 3RJQB 2APWA 4OSUH 1AIFA 3VMOA 2W9LA 5CFHA 4RBPK 1NL0H 2BC4B 4JHAL 1MF2H 4S1QL 4PJDB 5JXAL 3KDMB 3NZ8B 3P4NB 1W72B 2DB8A 1DCLA 4RGNE 3IJSB 5FF6B 1I1FB 3QA3B 3ARBC 3ARDC 3OAZH 2BJML 32C2A 4EBQL 5K9QI 4R6UA 1IGMH 3QSKB 3O6KH 3WIIL 1BFVL 2F5AL 4WU5B 1DQLH 1QBBA 1K8IB 4ZS6C 5DHXB 1U58A 2LAGB 3QO0A 1HILA 1TJIL 2ADFL 2ADGA 4L5FL 3TT1L 2B8OT 1M7DA 4JVWA 1T5WA 2CQVA 4ZSOE 4TNWK 4QYOB 2FNBA 2NY0C 2VQTA 2GJ6D 2HTLC 3HE7B 1U3HA 2VAJA 1A7NH 5CJBA 5CJOH 5T5NG 2R4SH 3RL2A 1A6VH 2L7UA 5TH2A 4UI2A 3VXSD 2R39A 4ELKA 3ARWA 3RUGB 3GMOB 3F12B 1DR9A 3NTCL 3I75A 5JHDD 1FSKC 2SEBA 4R0LA 4ZMAT 4HHAB 4P23A 1CXHA 1YNTB 3B5TA 3VFVA 4JFDD 4ZUSB 5F93C 2XA3A 2HLFC 3NH7H 4RSVA 1KJ3H 4K9EH 4XNYL 3KYMA 3IDGB 2NY3B 2WIIA 4X5WB 5D72H 5C09A 1P7QD 5EZIL 2EDEA 4LOUD 3THML 5EUKB 2WWKO 1JMZA 5DHYB 5EZLA 3F65A 3LN4A 3TO4C 4GKSB 5JIPA 1MI5A 1B9ZA 1WZ1H 3BIKB 5ACZA 5MEOB 2P8LB 3CXHK 4G6KL 4Z7OE 5C6PB 3BH9A 4JKKA 2P49B 1K3IA 2YMXH 3KPPB 3SE4C 3QEHB 3LRSA 2XQBH 4U05A 5D2NE 1GCFA 2ERJC 4WI4A 1XF5B 3LQAC 4HWNA 3UJJH 4FZEH 2OLDA 3PWPB 3WUWB 3ILPA 3D2UD 5M7QA 1YEJH 4NHCL 2UZIH 1TNNA 2V7NA 2B5IB 3GI9L 2OMBA 4MJIE 4TULL 4LF3A 1P4LA 1WCBA 2WUBH 4WI7A 4PPTA 3IU3B 1V3KA 2IC2A 3OKDA 4H25A 4XNQB 1MQ8A 5E5RB 1F3RB 1A3LH 5F8QC 2VC2H 1XEDA 3PV6B 1I1YA 3OGCA 2LV4A 3PQYE 4HS3B 5FHAL 1SM3H 1FDLL 1VGEL 4YPGB 3SJVD 1FV1A 5L0QB 1G6RB 3WFCH 3HC4H 4PRAB 3GMQA 2BP3A 5KSUA 2WZPD 4JJHA 3WEXA 4U1LB 1NLBH 1JPFA 2IPKB 1DL7L 3BKYH 1NKRA 3QDHA 4M3KB 2GIYA 2CXKA 4ZPTA 5E8NA 1S7QA 4GAYA 1GOGA 5CJXA 1BJ1J 3FB6A 1JWMB 1UB6A 1KCRL 3P77A 4Q9CA 5MEPB 4YDJB 2W07A 4RGNB 5J8OA 5BO1L 5D5MA 2G9HB 1U92B 1W0YT 3Q1SH 5CILL 5SWSA 1N5YH 1CVRA 4GRWH 3DGCR 4FFWD 1CVSC 2YOCA 2AS5M 4JFXB 4HUUA 1CICC 4M93B 4OZGF 4QHMA 2QQKL 3CSYA 5J7CC 2HG5B 4LNRB 3TBVB 5F9WB 3QDGA 1A1NA 1ZHBA 4XBPA 5AZ2H 3VXME 4EXKA 3RVTC 4ZSOB 1UJTA 3E3QE 4GXVL 3WFDH 3LH2H 2FL5A 2VDRL 1LO5A 3JTTB 1BFOA 1AKJD 4N90D 4NT6B 3ZYIA 4JKMA 5KJRH 1HHGA 5HHOA 3DSFL 1OF2B 1A5FH 2Y5TB 5E6IC 2G60H 1UWXH 4JFFE 5I8CA 4MXQC 2DQCL 3U46B 2GK0B 3RVWC 3RWEA 3C08H 3C9NB 4S1DC 3RTQC 3W82A 4Y16D 3MJ9H 2F9BT 2MQCA 5HGHB 4GRWE 4MCZA 3RGVC 5F1KC 4AG4L 4FQLH 4BUHA 1I8KA 3ISWA 3T77B 3QZWB 1MHHA 1QBML 4UDUB 5CKGA 4N0CD 2WBJC 3WMSA 4DKAA 1S3KL 5H35B 3V4VH 3VCLA 5IWLC 3KPSA 1DBAL 4FTVE 4OCRH 5HHQB 2R1XB 1OSZB 1P2CB 4FQ2H 1SBSL 3DXAB 5DRNA 2LU3A 1N7ML 1VPOL 1M71B 4B41A 1NBVL 1BBDH 1X4YA 2F58L 2GUOA 5JA9A 3BRGC 1P4BH 3MBEC 1N5AA 2Y7QB 3D69B 4HXAH 2G5BA 5KZCD 1U3ZA 2K3TA 4OM0L 1CD1B 3LV3B 5D2NB 2VDLL 5C0EA 3ET9F 5HGBB 4LKCA 2KUTA 3QRGH 1W72L 3IGAA 5F3BA 4TSCL 4OLEA 1T80A 3CFIC 3RNQB 3LKNA 3VFSB 4U1IA 1P84K 5E8EA 2ENYA 4MJIB 3UBXB 1JUFB 1IGYB 3QQ9D 2NY1B 5ETUA 5JDSA 4JO3L 4AEHL 3MA7A 1ZVSB 1FZOA 3KGRA 1U8JB 4CNIB 1T1XB 3HLAB 4YE4L 3QH3B 1E6JH 4PTTA 5IQ7H 4HBCL 4KRPC 3BPNC 4JRXE 1BFTA 1UM5H 4DVBB 1OGAA 2YD5A 4LCWE 4LVNB 1BQLH 3PQYB 4M9PA 5IIEB 1NBZB 1XGRA 4UNVA 4RMVA 3LDBB 4S2SA 2V2TB 3TWCL 2R0WL 3HG1B 1V3LA 1UXSA 5CJ8A 3EOBA 3ALWA 1T5XA 5D9SB 4MJ5A 4M62L 5D7IE 2AKRB 5FUZH 3DV6B 4QHUA 4B53A 2EEAA 4N1CA 5E0QA 5HI5D 3STZB 1KV3A 3W9EB 2XXMB 3S96A 5KSVA 4NN5B 5D7SL 1PLGH 4Y2DD 4HS8L 4ELME 4XRCB 3C60A 4NRXA 2FGWH 4Z0XA 1QUNA 4IS6B 3QUZA 4Y4FA 2C1OB 5GRUL 2JIXB 1B6UA 3RZCD 1BREA 2R56H 3HNTL 4P3WA 2V17H 1KGCE 1T66C 3FCTA 3GJEA 4P2OB 1I4FB 4QHLA 3D25B 1R3LB 4HWUA 4OCNC 3OGOE 2VDQH 4LSVH 1ODAA 1S7SA 3KJ4B 4GG8B 4RFOL 3WL9A 2YK1L 1IC7H 4Q9BA 5B4MD 3SY0B 4IRSA 5TE4L 4XZUB 3TEUA 1YNKH 4JFFB 1CF8L 4MZ3A 4P2QE 4I1NB 3EYQD 3CXHJ 4APQA 2A2QT 4PGDB 3RA7H 1UYWL 3SGKA 2YBRB 2ZOLB 4PRIE 1UH2A 4R7DB 1D5XB 5C0DA 2K7QA 2BNRD 3LS5L 3NCEB 1E27A 1RZ7H 5IP4A 5JW4M 2HT4C 1CDHA 4MXVF 1MCRA 3QEQE 3DROA 4MB3A 3BEWB 2GI7A 3FHQA 3QDMD 2DL2A 5D5MF 3ZTJH 3BESR 1AJ7H 2IQ9L 4ZG1A 4U1KA 1JYNA 2R69H 2FBOJ 1J8HD 5KSBA 1UEMA 4FTVB 1JE6A 1OOAA 3FMGL 1NPUA 3EJJX 4Z7VB 1WLHA 2HT2C 4YGVA 3T04D 2X4SB 1G6RL 3T4AB 4X9GA 5EU6E 1WBXB 1M4KA 2GJ6E 1A7BA 3VE0A 4PJDA 1S78C 1OT1A 1MCPH 3RAJH 3REWB 3MRCB 1J1XL 1W72A 3DSNA 5HGDB 3BN9C 4FMFA 4H8WH 1HOCB 2VZSA 3QA3A 4YQXL 3MRBA 2F8VA 4U7SA 5DFVC 3RJDA 1A14L 5EZOH 1II4E 4NKOB 2HJKB 4Q9QH 1MREH 4RQQB 2XV6B 4UBDD 4OKDA 1LEKB 4S10A 2BVEA 1T7VA 4WWKC 1KCKA 5E8DL 3ILQD 3SQOL 4JRYA 3TT3H 2OZ4H 3S34H 4N9OB 4NIKB 1UJ3A 2XKNB 3C8KA 3O2DH 4DGVH 1HN1A 4LCUB 2RFXB 5FHBH 1KCVH 1FIEA 4Z7UF 3TP4A 5FYJL 2GCYB 3AMLA 1DVFD 1FGNH 4OLWH 4X7SH 3S35L 3W2DL 2IBZX 4HHAA 5DURD 1YNTA 1LMKA 2APTA 1ZK9A 5DC9B 3LIZH 4JRXB 4ZUSA 3JWDL 3MMEA 2XXCB 4DQOH 2RR3A 3IB4A 4S1SL 3OX8A 4R9HA 4PP2B 3IU4H 4R4BB 2VZUA 4UU9A 1E4JA 3UJTL 3RP1A 3IDGA 4XT1C 1M1SA 2D3VA 2JCCE 3AGVA 5EBLB 5H94A 2YPVL 2VB5A 1ZLVH 1BQHB 3O6KL 1V8HA 4KV5F 1UVQB 4QY8A 5DHYA 3DBXA 3VXPA 4HEME 5D7IB 3GM8A 2A1WL 3OXSB 5IR1A 3BIKA 2EECA 2D9CA 3MV11 1WV7T 3T0EB 3O4OB 4U1JB 1QFWL 3DMMC 2VL5A 5DK0A 1H8NA 4I4WA 2HFFB 1DLFL 4AYFA 3EYSL 3O8XB 3KPPA 3LRHA 5CLWA 3QEHA 3L3HB 1N64H 1RZFH 1RIUH 5K93A 4MA3B 2X5PA 2AJVH 1ED3B 3VGDA 1J10A 1RUAL 2ARJA 3F62A 4H5SA 3GM0A 1U2CA 3B3IA 3WUWA 4MJ2A 4G8FB 3PIQA 4OFPA 3UO1H 4JQXC 1WWWX 4G42B 3JWOH 4JDZA 5KANG 2JB5H 4XPTH 5TDPB 1YEEH 2W0PA 3HZMA 3BD5A 3QDAA 4P2QB 3V6FB 3SKNA 3QP3A 3IU3A 4O5LH 3V6OC 4PRIB 2DWEA 3GKWH 4BH7B 5I1CH 2BY1A 3GJFH 5EU7E 2OBGA 3QEQB 5IVNA 4R90L 5KOMC 3PV6A 2JELH 4W4NA 2DM2A 1U8NA 4GLRH 2AI0L 1RZGB 3H7BA 3X3GH 2Z31C 3HPLA 1FZMB 5I1DA 2YMXL 3KPNB 4NN7C 4PRAA 1IEHA 1OAYL 3VFPA 1FFRA 5C0BB 4KVNH 3X14B 3ULVH 4U1LA 4V1DE 3C8DA 4Y4KA 5HHMB 4M48L 4IIQB 4OKVB 4DAGH 2X1PA 5EU6B 4N90E 1BIHA 1P84J 4FQPA 1JWMA 2LTQC 3MUGB 3DJ9A 3BRDA 2IMMA 4ODHH 4XVSL 5MEPA 4YDJA 1FAIL 1YEJL 4W4OC 4D9LH 2G9HA 3G6JE 5ICYB 1U92A 4FABL 4I3SH 4GAJL 4PP1C 3ZKXC 3Q5TA 1YN6A 4JFXA 4XVTL 4MAYD 3O6MH 1X5KA 2HG5A 1FP5A 2VDOL 1KUMA 2W38A 2FX9H 4ZSOA 3UPRB 3MRMA 3ULVE 1X5HA 3K8MA 1X44A 2EH8H 4PJ8D 4NKMB 2EDFA 2EYTA 5F7DB 3JTTA 4NT6A 1UADC 3MLSH 3HC4L 3QBTB 5DD3L 5JPNB 1RJZB 1OPGH 4U31A 5ILTL 5BV7H 2DQGH 1ZVYA 2GK0A 3BQUC 1G7IA 1UM4L 3P30H 3B2VH 4M8QB 3VG9C 3IRZA 4WRLA 2Q6WB 4Y19B 3W11D 4P9MH 2KZWA 2ZJSL 1YEHL 1R3JB 3F7YB 3ZO0A 2VZVA 5D2LE 2ZUSA 3V52L 1QYGL 4KUCF 4K7PX 4YC2C 3HI5L 2WWKT 1N5YL 1GGCH 4JHWL 5TE7L 1O7VA 1OM3H 4OI9A 5HHQA 4HIXL 2R1XA 4QGYA 5LWYL 2J88H 3INUL 1OSZA 4XXDB 4Y5VB 1P2CA 4NUGH 4Q2ZA 5AZ2L 1M71A 3O9WD 4UQ2A 1G0DA 4JJ5B 3VXRE 3HE7D 4LRIC 4P59H 5I9QC 2BMKB 4DVRL 3D69A 1FZJB 1R24B 4O2EA 1A5FL 4UOW0 3LV3A 5D2NA 1EFXB 5HGBA 1XMWA 4OI7A 5KSAB 4I9WE 5KS9B 3C08L 3UXFA 5IKCA 3O45A 4H0IA 4C57C 1KSRA 1YNLL 3AREB 2Y07L 5TDNB 4EIGB 4OCYL 1F6FB 3VFSA 1ZKAA 3BH8B 4I3RL 4U3XA 4MJIA 3RIFF 3UBXA 2IANB 1AXSA 2Q7YA 4OF7A 1JUFA 1R3IL 3HS0B 1IGFH 4JR9L 1ZVSA 5DJ8B 1T3FB 3DI2B 4UT9H 1U8JA 1T1XA 3HE6A 3SE3A 2VOTA 2HJLB 4M8VA 4X99B 2R15A 5B38G 1U3YA 2N1KA 3PQYA 4Y4HD 1BEYL 2XWTB 4RMWA 5TF1H 1ZOXA 3RWFA 3ZTNL 1FFPB 2V2TA 1JPSH 4KKNA 5F9OH 1A6UH 1XGPB 1OW0A 2Y6SC 4XCCL 3V5HA 3O6FC 4V1DB 1IVLA 4MNQE 5D9SA 4PB0L 4R4NC 3IAQA 4NSKB 5I73C 4LPWA 2J2ZA 1FNAA 3DV6A 4ZUWB 5SX4I 2DAVA 5FA3B 3STZA 5LXGH 4PJAF 2ATPB 3V7AG 3ZSSA 4QOKE 1X9QA 1UCTA 4YBLC 1XCQA 4IRZH 1JZ7A 2AABH 3X17A 1RZ8B 3WN5B 1BM3L 4DOHE 2X2YA 3BW9B 2QADC 3ZDXE 1AHWB 4RISH 4I5BB 1NCAL 3IDUA 3GMMA 4P2OA 1MFDL 3QDME 1I4FA 1NGQL 3VXMA 4R7NA 3G6AA 1R3LA 3FT3A 4NO0B 5K9OB 2VUOA 5L2KE 4GG8A 4DZBB 2NW2B 1Z9LA 1N0XH 2IWGA 3N1PC 1K2DB 4U6VH 4JFFA 1CGVA 3AY4A 4LLMB 5C8JB 1PBYA 3KNBA 4E41E 4N1HB 4PGDA 5FYKD 3S4SB 4ONHA 1HHKA 4D0BB 1UGNA 1ZEAH 3BEWA 5BW7C 1QTYT 3VGHA 1R3KB 5D2LB 1RZKC 3VRJB 1PLGL 3U83A 2ZUUA 4G80B 5GRJL 5F7YC 4NKIH 4LGRB 3B2UC 5HVHC 4J2XA 5L7XL 5CGYD 4FTVA 3Q6GH 3H9ZA 3RWCA 3L5XL 3HR5A 1QO3B 1WBXA 4BQBA 3REVA 1A6WL 1FNHA 4QRPE 5FYJD 2DS4A 5BV7B 4LSVL 1FYTE 2NTFB 3MRCA 5FKPA 3IVKB 4EXPX 4ZODA 3MJ9A 1HOCA 1P9MA 2DJSA 2B4CL 3DYOA 3H42L 2J8OA 4FN0A 3L5WB 3HZYB 2PUQT 3EDDA 4Z76A 4XI5D 4NKOA 4DZ8B 1CXEA 3GNMH 5IMMB 2YSSB 1CLZH 1RI8A 1RZ7L 1XF3B 35C8H 2DQFB 3M17A 3CLFH 4M1DH 3FONA 4RMRA 4LHQB 4MB4A 5E9DE 2IALB 4OB5L 3PXHA 1AJ7L 4ESKA 2COQA 2IPTL 4OQTL 2XKNA 2IG2H 5GZND 1HSAB 5FYJU 2RFXA 2RAMA 4MJ6B 3DXAD 3TESA 4HWBH 1IAIL 4JRXA 2A0LC 4L4VB 4LCWA 3QWRA 4HKJA 4R4BA 4XXCA 1FNFA 3OXRA 3EIFA 4G8GD 1NQBA 2NR6C 4QRQB 4GRLC 4GAGL 5FYLH 4MAUL 3TJHC 3KVQA 3HTLX 5I1LB 4MNQB 3NCMA 3DV4B 2VXTH 2NX5E 1ZHNB 2FB4H 1UVQA 2FX8L 4O9HH 5I19H 1F4WL 2BZDA 3MV9D 5D7IA 4M43L 5EULV 4XP1H 3OXSA 2H9GB 5E2WL 1MREL 3QJFB 4PS4L 4D8PB 1U91B 1U8OA 3CDYA 4MDJA 4QOKB 2WBWB 1FNGA 4ELMA 3CXDH 2HFFA 3RKDD 4ZAKC 7CGTA 1BVKA 3L3HA 4WJ5A 4DGVL 2HJFA 3O2DL 2AV7B 3LEVL 4DOHB 1TJHL 1KCVL 3KPLA 1KJVA 1QFUL 4WVRA 3E1F1 1D9KC 3MRQB 3QG6B 4JFPB 4D0CB 5FYLE 3MRRA 2D03L 3NPSB 2CR6A 5L2KB 4MWFA 4F57H 4L8SB 5IW6A 1DLHA 4ORGA 2I9TB 5IOPB 1SJEB 5TDPA 3HG1D 1MCKA 1NCBH 4ALAL 1CDGA 4OLVL 4P2QA 3SDYH 1QSFE 5EPMA 4LASH 3T1FB 1P7KB 4DEPB 3SGDI 1G9MH 1FG2B 1TIUA 2LVCA 3HMWH 3JV0A 4PRIA 3A67L 3U0TB 2CUHA 2BHZA 1U8MB 3QEQA 3GIVA 1FJ1B 3SO5A 2I60L 3C5ZB 1ZLUK 3S88L 3ZT6A 4ACPA 4N1EA 3VW3H 1RZGA 2H26B 2NY6B 2JIXD 4S0TD 3KYNA 2VLMD 4QRTA 3VA6A 1JHTB 2X4RB 1DSFL 4L4TB 2FYYB 5EU6A 2GJ6A 3BMVA 4QRPB 4K3EH 5C9KA 2FATH 3MUGA 4MNGB 1PSKL 3UO1L 1FYTB 3BKCH 5J6HA 5C0IB 5DRXB 4ODBD 5DEFB 1SVCP 4EN3D 5ICYA 3GI8L 5DUBA 2OR7A 4GBXD 1J1OL 1ND0B 1KPRB 2DIAA 1B0GB 3N06B 4ZUUA 1LQSR 4JO4H 2QHRH 1MJ7H 5D8JH 2ZPKL 4GRWF 2R0LL 3QUKA 5F97E 4F15C 3UPRA 1GC1H 4PJHE 3HC0B 2DQUL 1JBJA 5E9DB 1P7QA 4NKMA 4UDTB 1J12A 5FB8A 1QFWI 3EO9L 1X4XA 3QRFM 1EX0A 5I30L 3VI4F 2PO6C 4BUGA 3EDEA 5I76A 3OZ9H 2CPCA 5SX5H 4M8QA 1HSBB 1RJLA 3VWKB 4DAGL 2B1AH 3I84A 5T3ZL 3S5LA 4BYHA 4EOWH 1NFDB 3MFGB 4F9LC 1UC6A 4HUMB 4XVJH 1MUJA 4HX1A 2JCCA 3QULB 1TETL 3PXJA 1OLLA 3GSVB 4I3SL 4KAQL 4L3CB 5DQDH 5F7NC 2D31A 4KJWC 2NX5B 3RBSA 3LN9A 4ONFH 1CFQB 4XXDA 2LABA 3WD5L 4NQDB 4Z78B 4XC3L 1CGWA 3IDJA 5C86A 2OZ4A 5J56B 4ZUTB 3UBXI 4JJ5A 2EH8L 3EOTH 1QSVA 3F58L 4OZFH 1XGUB 3I02A 3WFBH 1S5IH 5GIRB 2BMKA 3V5DB 3W39B 1FL5B 1IM9A 4J3VA 1OAKH 3QQNA 4WHYG 1EFXA 4MHHG 4LCCA 3P30L 1F58H 1EHLH 4ODSL 4I2XE 4V2CB 4XNZB 3RPIA 1EIBA 1PAMA 2NXYB 2Z0BA 4FQHB 3O0RL 3CDGB 1S8DB 3MCKB 2GY5A 4W81A 2DQJH 4J4PC 4FXGB 3MLWH 1OAQH 3NA9H 4OIAA 3BH8A 3U9PH 1XF2B 4FXKA 1NGXB 1VENA 3B83A 3MREB 1VKXA 1QSFB 3ORJA 5D7IF 1DP0A 1QKZL 4FQ1L 1OM3L 4NYLA 4IBLT 5JW5B 2J6EL 4ZO6A 1H3VA 2CRMA 1C08B 3OAUH 3QXAA 1CE1H 5H8DA 4OD3H 4ELMF 3IAPA 1ZLWK 4H1LB 2XYCA 3T0ED 4BJLA 1C16A 1FZKA 2XWTA 2BVUA 4P59L 4JM2B 1DANT 3I6LD 5IFJB 7FABH 4HCRL 3QT2A 4UIKL 4V1DA 2AJYH 1GHFL 2P8MB 4NSKA 4LSQL 1YUHA 1BZ9B 4ZUWA 1AKJA 2CRZA 4HC1H 5FA3A 5EBMB 2VR4A 2ATPA 4WIQA 4WO4C 5EN2B 3ROOA 1RMFH 4TNVK 2HT3C 4LKXB 3OAYK 4KVCH 2OTWB 3G6JA 3MC0A 3SHSA 5BJTA 1I85A 3FB8A 3HMXH 4JPKL 4HIJA 1E6OL 3MBEB 3GJFA 2PR4H 2VDMH 3BW9A 4NWTL 5J3HC 3QAZC 2DLFL 4Z9KB 3UTZA 4UT9L 3VGFA 5E00B 3TNMB 1PEZA 3QUXC 5K9OA 4NZTL 1EEZB 1I1AA 4ISVA 2NW2A 5DD5H 4HH8A 5SV3A 3JV4B 3FQTA 4GKNA 5IGXH 5C0BD 1JGVL 3NABL 1JPSL 5C0CE 3MGTB 2YRPA 3CFEA 3LKOB 3AXLB 4X6DE 1DBBL 2GW5A 1MFEH 2C4FU 3G5VB 2GAZA 1RFDL 1DUZA 1G7HA 3OSKA 4PRBB 3QNYB 4YDIH 4FHBD 3DOSA 4HIHA 4P4KB 4Q6IB 4Y5XA 4D3CL 4HGWB 3E6HB 4P46C 5D2LA 4KRPB 4PG9A 8FABB 2OTUA 4ZXBA 2H2SD 4LLQA 5CHNA 4XP4L 3TZVA 5CCKL 5JXEA 1RJYB 5MENE 3GK8H 1NGWA 1QO3A 4GW5A 4TOYH 3PP4L 3VXRA 2B39A 5CIPB 2EH7L 1BJ8A 3SDAB 3MLTB 3IVKA 3NVQA 5IVZB 3W9DA 1CZ8H 3UTTD 3T08A 3JUYA 2FEEL 3HCVB 4RGMC 5CD3B 3HZYA 1IC1A 4MVBD 1LGVA 2EDYA 1MFNA 1D5MA 4M6NH 3N9GL 4M02A 4N8CH 5F71A 2YSSA 4K7FB 4G8GE 1XF3A 3VDCA 4X4ME 2JCCF 1A6ZA 2IALA 3VU2A 4E9LA 1KIQA 1OAUH 1X5LA 3UTPE 2H2PC 3TIDA 1GZQA 3MYZA 4MMZC 1CWVA 1HSAA 1NAKL 4LVOB 4U0QB 4URTB 3LQAL 1F02I 4YWGH 4OZFB 2FGZA 3Q6GL 3TVMC 1P4IH 3HB3C 1KENH 1LO4H 5I15H 2ZNXA 3DETC 5L6YL 3LZFH 4PD4K 4QRQA 3AFLA 2D7PA 4TSBL 5GGQL 3SGJA 4XBEH 4MNQA 3NCYS 5KSAD 2NW3B 1CFVH 1ZHNA 2YA0A 2R9HC 5A16B 1RUKL 3ARED 2H9GA 3GNML 4NQEE 3QJFA 5TF0A 2KDGA 35C8L 3V7MA 2BY0A 3U4BH 4ODXA 4QOKA 3EFDL 1UH4A 6FABH 2IAND 3MNWA 3QIBC 1K4CB 4WFHD 4YHOL 4F58L 2YZ8A 3T0BA 4GH7B 2AV7A 2IG2L 4Z6AT 1AY1L 3HI6H 1BECA 4OLZH 3MGAA 5D6DC 2BSSB 3KPTA 3X13B 1GL4B 3MRQA 3QDMA 3QG6A 2XZAH 1TMCB 1VESA 1E4KA 3V6ZB 4JLRA 5A2KH 5JW3L 5L2KA 3KYKL 2ITCB 2VLME 2EO9A 2I9TA 2FECL 1SJEA 1REIA 3CZJA 3L3DB 2HN7B 4WWKB 4C4KO 3O3AB 5HYIA 2CKBB 4LEXH 2OP4L 1JF1B 1P7KA 2CK0H 3PE9A 4E41A 1FG2A 2FB4L 1SJVA 3IFLL 5I19L 3UTSE 3WNKA 3OKMA 4O02L 1JPTL 4XP1L 1GIGH 1FJ1A 1VFOA 3C5ZA 2WP3O 5JORB 3G6JF 5F7EH 4FQIL 4XP6L 1F6LL 1HKLH 4JZNB 2X4OB 5F88A 2GJZB 1ZANL 3U30B 2V5RA 1L6XA 1CLOH 4C83B 3MACL 3MLYH 4WV1C 4NO0D 3ULVF 1DUYB 1IAII 4YZFE 1NCTA 4QRPA 2YD7A 1UA6H 3CFCL 4KUZH 5DUML 2E7CA 5D93B 5I6XC 3KR3L 1QD0A 5C0IA 5IM7A 5E6YA 5DEFA 3F5WB 4LSRL 5GS0H 1PZ5A 5T3ZD 15C8H 4QCIB 1GPOH 5FECB 4UT6L 5DGQA 2P24B 3LB6D 4HF5L 1UWGH 1KPRA 4LASL 1UB5B 1KCUH 3G5XA 1T21B 4KK9C 3PHQA 3TN0A 1U8LB 5D2LF 2VIRA 2EDJA 3HC0A 4ORZC 2VISB 3PL6D 1EXUB 5E9DA 2CO6B 5I1AB 3QO1A 3MV8E 4CN1A 4FOMA 5DJCB 1KELH 3QQ3A 5IMOA 4PUBL 3S35X 4BZ2L 1BZ7B 1H3PH 2VSDA 1F8TL 1HSBA 4NRZB 3Q48A 3SCMA 3CCHB 3S9DB 3P11H 2XWJB 3M8OH 1DN2A 5FDYA 3CC5B 4P49A 4AIZA 4K3EL 1ZA6B 3VD7A 4K8RC 1I3UA 4LPVA 3KAAA 2A77H 1H3TA 4WW2A 3KLHC 5CGMA 1AD9A 2ZUWA 3FO0H 5SWZD 1CQKA 1ZGLB 2CDFB 3QUMH 1QHPA 2NX5A 4IMKA 1MLCA 2Z31B 1JIBA 2V7HB 4Z78A 1MJ7L 1KN2H 2ZCHL 5L2JB 3QWOB 1GC1L 2PYED 4ETYA 1N6VA 2VN7A 3PGCB 4WTXA 1C12B 4MMXC 5GIRA 1FC2D 4K23L 1B90A 1FL5A 4HWBA 3OZ9L 1RHHA 3KXFD 3QQ4A 1U95A 1EV2E 1EMTH 2HFGL 3BAEL 2W9EL 2CLRB 4L9LB 3RY6C 1NC2B 1T1WA 2HLAB 3CFKB 4L4VD 3P0YH 5FOJA 3LPGA 3BMWA 4GS7C 4XVJL 4AH2B 4MQ7A 4YIQA 1XF2A 1NGXA 3MLXL 4L8BB 1QSFA 1EAPA 3DYPA 4UV7H 1JPGA 2ZSVB 3BP7A 4Z0BL 2D7TH 2NLJB 2JLLA 1S9VB 4LCIH 4RDQF 3EOAB 1NKOA 3OJ2C 1MVFA 3IDIB 4KK5C 3K2MC 4KKAC 5JZ7C 4Y5YA 3KPMB 1DBKL 1G7MB 2AXGB 4D2NA 4JZJB 4JM2A 4GLRI 3B5HA 4P0DA 3WFBL 3UTOA 3G5ZB 2MHAB 4JDTH 5IFJA 3ZDXF 1A3RL 1DQQA 3ARBD 1S7RA 3PHOA 2DTSA 1I8MB 3K8KA 4WEUD 1AD0B 4HZLB 3A6BH 4ZS6D 1GGUA 1CLYH 5EBMA 1NUFA 4OIIL 4I3GA 3BGFB 3JXAA 4LKXA 1KTLA 3B5GA 2PXYC 2DQJL 3NIDE 1ORSB 2NY0D 2JJTC 2OTWA 5HHXL 3V4PH 4U1GC 3U9PL 2HTLD 1A4JA 2A83A 3I50L 5GGUB 2AXFA 5E2VH 2VDPH 5JHLH 2GTWB 5JPMA 1J0ZA 5E00A 5HHVH 1LO2L 3QFJE 4UB0L 1MIEL 4PD4J 4HFWA 4PJHA 1ACYH 2Q8AH 4OD3L 1EEZA 3JV4A 1DQML 2HLFD 3MV8B 2NY6D 2OXGA 3IFPA 3SDDC 4FFWC 1H3GA 3TIEB 4U1MA 3TH3T 3LKOA 3AXLA 4LARH 4RFNC 3VXNA 5BOPA 1IMHC 2CLVB 1GGIH 3G5VA 2XA8L 2QQNL 2CXGA 4CDGC 3TO4D 4L8CB 4P4KA 3I6KB 3OKKB 2CKBL 1FNLA 2YPKA 3UTTE 4HGWA 3CUPB 3E6HA 1URLA 4FP8H 5HBBA 4YUEH 3IRPX 5IF0B 8FABA 4PGBA 1PQZB 4ZFOB 1F4YL 1IEBB 4PJIE 3ZSTA 1I7RB 1RJYA 3VGGA 4S1RL 3MR9B 5E03A 3R4DA 4MA1C 4F7PA 3TFKC 1T20B 4I77L 1WFOA 1MNUL 4M61A 2BDNL 3LKRA 3DHJA 3SDAA 4MQTB 3MLTA 2JB6B 2XNAA 3GB7B 1FH5H 2R0ZL 2ORBH 3WE6A 5D7JA 3HCVA 1D6EA 2AEQL 5CD3A 1KG0B 1KJ2H 1MFEL 1AFVL 1L0YA 5C6TH 1IC4H 4I2XA 4UINH 4FNLH 2QADB 4YO0A 1OP9A 4JPVH 4K71C 4WW2F 4Q0XH 1J8KA 3L5HA 4XCFH 1E4XL 1R3HB 4KKBC 5FM8A 4EDWH 4F3FA 4OFDA 4YAQB 1L7TL 1RIVH 3DRTA 1RD6A 3H2WA 4R0LC 5ADPL 1N8ZB 4P23C 2UWEB 4NQDD 4OZFA 3MRJA 3GK8L 3HUJE 1B4RA 3FAXA 1IBGL 3ARUA 2W59A 3WXWL 4RA0C 3P4OA 1RK0B 4QHNB 4CBPA 3UAJD 4ZD3H 4OLUH 4MQXC 2FLRT 2Y36H 2DBLH 5T5NF 2X41A 1MEXL 2XTLA 4X83A 5HVHB 5CJQL 5A16A 5E8PB 3K2UL 1CICD 4RGOH 2FWOA 3FN0L 1HNFA 1MWAL 3C87A 4WUKL 2Z35B 1J0YA 1MJ8L 4OCSL 3L6FB 3BP4B 3L7EA 2E6QA 1KIRA 5ITFB 5E6ID 5DK2A 1MPAH 4MXQD 2BSSA 5IVXF 5I1KH 5IBUB 3RVWD 2DKMA 2YC1B 3GBMH 5HYEA 3QFJB 3RTQD 4S1DD 5GJTL 1AGCB 1OAXL 2BCKB 5HI4C 3VFMA 4Y2DC 4BA8A 3MRPA 4JM2F 4JRWA 1CS6A 2X1XR 3RGVD 1DTUA 5CGTA 1IQWH 4HC1A 5C0CA 1FGVL 2M1KA 2WBJD 3O3AA 4X6DA 2FEEI 3RZCC 4PJ9A 4UAOC 4OGXL 4PJ5E 1LP9E 3QB7C 4TUKH 1UWEH 4MLSA 4OV5B 4Y0GA 3AB0C 1WFNA 1IQDA 5GXBB 3HMXA 4PFEA 2VKWA 1O0VA 1XGTB 1S7TB 3P0GB 4OCLC 1U8QA 5B4MC 1QHOA 2DBJA 5MERB 5IT2L 3LEYH 4MB5A 4M9OA 4LCYB 4JY5H 3MBED 3PABB 3IF1A 4W6WB 5ISZB 4OLXH 2G5RA 4PJIB 4C83A 4PREA 3LSOB 1V7MH 5MENA 1FBIH 1G7JB 5ESVA 3QNXB 4PJHF 3TJEL 1DUYA 3OBAA 1Z0MA 3O3DB 2VLRE 1HXMB 4LBEB 4OUUB 5GJSL 1Z6JT 4OJFH 5I8OL 3KYOB 5FUOL 2X70B 4OCXL 3MPCA 4QCIA 1A7PL 4ODUB 5FECA 2P24A 3O41B 1MCOL 4LEXL 4WW1B 2CK0L 4UV4H 4PJFE 2YN3A 3H9HB 5IUSA 3BE1H 3QJHA 4ZS7H 1YPZB 4G8GA 2QL1A 4X4MA 1GIGL 4KRPD 5SWZE 5C08B 2IGFL 3NGBB 5F7EL 2I27N 5DJCA 3MV9A 3TA3B 3Q5YA 5J9PA 4I0PB 4IRJB 4P2RE 1CXLA 5J11C 4ZFFA 1CLOL 1TVHB 4NRZA 2PYEE 5EBWA 1TTUA 2NY4B 3LN5B 2XWJA 3KPOB 3OR7A 1CBVH 1RVFH 1ES0A 3OKLB 5A40E 1KJ2B 2EC8A 2F5BL 4ODVL 3TV3H 3ULSA 2FECI 15C8L 4ZOEA 5IB3B 3CK0L 1MRCH 4I8DA 4P99A 4DGYL 3DHMA 2A9ML 4AJ0A 4OGYH 4NQEA 1T66D 1LDSA 4RX4A 1QSEE 3P73A 4ZFOL 3QWOA 5HYQB 1IL1B 1C12A 2DI7A 3MRIB 3QPXH 1GAFH 1JFQL 8CGTA 1H3PL 1P53A 2VLJD 4X4XB 1OSPL 2B0SH 1XZ0B 2CLRA 1TITA 1NC2A 3UDWA 2HLAA 5KVGH 3DX9A 5E1AB 4D94A 5IHZB 2UY7A 5IB2A 5MEQB 4C4KT 1YDPA 1BVLB 2J8HA 4AH2A 2IADB 3RHWK 2VSCA 5ID1B 1PVHA 4WHYH 4L8BA 4AENB 5BXFB 3BKMH 3FO0L 4PJ5B 5CEZH 2PO6B 1M6OA 2CUIA 3NCYP 1B4JH 4N8VB 2NLJA 2NTSP 3RIAK 3UTSA 3R1GH 3SDCB 1S9VA 3L1OH 5I18H 3EOAA 1JV5B 1KN2L 1YYMH 2WP3T 1J7VR 1JTPA 3MZTA 2DQDH 4EN3A 4P5MA 4GBXA 2IFFH 1YEKH 2IMNA 3QIWB 1JZ6A 1G7MA 1S78D 3BZFB 4LHUB 5EORH 3MUHL 2Z9TA 1OB1B 3IDMA 1NGPH 4OZ4B 3BN9D 3E6FB 4KMQA 5IB5B 1GGBL 2C3HA 1I8MA 5GGSB 5IBTH 5DFVD 4HZLA 1SEQH 3QHZL 1EK3A 5TGBB 1VA9A 3IJHB 1RZKL 3W5MA 5F44A 2WW8A 4TTGA 4KFZC 1GRWA 1IFHH 1WQVT 2CIKB 3QUZC 3ZMRA 5CEZE 4KHXL 4U1HB 4YHLH 4WTWA 4WWKD 1ORSA 4X6DF 2R4RL 1AGFB 2R1WB 3VXUD 5AG8A 1U41A 1JNHB 1KBGL 5GGUA 5HHPB 4XNUL 1X5ZA 3T3ME 1HIML 5EU3B 4RCAA 2F15A 4KU1A 1UZ6E 3MCLH 4U0RC 1TQBB 4K3HA 1RUPL 1GGYA 4U1SA 4BSVB 1KC5H 4IRSC 1KLGA 3OKNB 5DYOA 5CEYA 3UZQA 5F9JB 1FLRL 3BP5B 4K55A 5BS0D 5HYJE 3MV8A 1DBMH 5DT1L 4PLOB 2Q7NA 4M6MH 4KI5C 3TBWB 1DQDL 2BVQB 1SYVA 3TIEA 2QR0A 4P2RB 5IMLA 4MAYC 5D1XB 1T7YA 2N56A 3UROR 4LRNL 4OTXL 5FGCE 1XCTB 2R2BB 1J1PH 4UUJB 4KTEH 5DDHB 5L8KB 4L8CA 4R2GB 3V0VB 3MBXL 3V0WH 3I6KA 4UT7H 3OKKA 3QISA 3IETA 3T4YA 1CL7H 1R6VA 1W0VB 1JHLH 4EEEA 1MFAH 4HPOL 5D96B 3CFDB 4CAGA 1YY9C 3DMMD 1PQZA 3D39B 2DKSA 3NFNB 1NGZB 4YHIA 1YMHB 4NQTA 4TVPL 1FN4A 4NO3A 3U9UA 3MR9A 4MA8H 1MFBH 5HHVL 5K9KA 3MUJA 1QSEB 3AS2A 1NANH 1ZTXL 2Q8AL 1K85A 3GDBA 1HI6B 3T0WA 4QXUL 5E08L 2JB6A 3P9MB 4XPHH 4YHNA 4F7EA 2FBJH 2YPLB 5DLMH 5AD0B 3A6OA 4NRYA 1QVOB 1CU4L 3MRHB 5F70A 1EVTC 3TBSA 2XN9E 5DQ9B 2GSGB 1RUMH 2X1QA 2ZCLH 4XMKL 3GIZL 2VJXA 3VFUA 5M95B 3QEUB 1F4XL 4QNPE 3DTXA 3QAZB 3QUMA 4LDOB 4EUPG 4HKXB 2BOCB 3QUXB 4JKPL 1JGUH 1XAUA 1NMBH 4YAQA 4NQUA 1BD2B 5IROA 3WS6A 3TC9A 2OK0L 1O5DT 1PG7W 2Z31D 1WBYB 1N8ZA 4N0RA 5I71B 5JUEL 3STBA 4AT6B 1LEIB 4JZOB 4WY7H 3QUYB 1RZJL 1F11A 4YXLH 1U8HB 3TNNB 1C5BL 1MVUB 4M5ZH 2NY3C 1BPVA 4OZIE 4PRPD 1YEFH 1NCUA 3MLZH 3WJJA 3CX2A 4G43B 4QHNA 4R26L 1N6QL 2E27H 3L3IB 5CD5C 1SY6H 5IFHL 1FH5L 1HHHB 2ORBL 4YFLF 3F7PC 5DD0H 5E8PA 4AZ8A 5EO9B 4YX2L 4OZHB 1OTTC 5CZXC 3GMLA 2HYMA 4ERSL 1NEZB 1RIHL 1BF8A 3U48A 1H0DB 4KWUA 3RY4A 4DKEH 5T1KB 1YN7B 1U3JA 2D0FA 2Z35A 4G9FB 4RAUA 5AEAA 2H6PA 1RIVL 5DJ2A 1TTFA 3BP4A 5JQ6H 2YZ1A 4WFED 4XNXL 5ITFA 1G7LA 4KPHL 4HG4J 3EFFB 3MOBH 2AVGA 4J6RH 3L3KB 4BZ1L 3EO0A 3BQUD 3F7RA 3RWGB 1QNZL 3QFJA 4M7KH 2ZCKL 1AGCA 2BCKA 3Q3GB 3SOBH 4X6FA 5DA0B 5GS1A 4H88L 5HYJB 1B2WH 4KXZH 4DGIL 4PLNC 1G0YR 3C6LA 4KQ4H 5GGTA 4PJEE 4GJTB 5B38A 3HRZA 5HD8C 2R2HB 3GBNH 5KVDL 3NIFF 3OF6A 4YZFF 1WF5A 4OD1L 1BBJA 5FKAB 3ES6A 1S7TA 3UTTA 1I9IH 1OARH 2CSPA 3MJ8B 5L0QC 5MERA 1E4XI 5LG1A 4BQ6A 2JE8A 3WUZA 1OAZH 4LCYA 4Y4KC 1TPXB 5JR1H 3PABA 1S7WB 1G9NC 3WXVL 2I07B 4PJIA 4XAWH 2CJUH 3MZGB 1JN6B 4KK6C 1ZA3A 2C1PB 4KHTL 3JZ7A 3L95A 1AGEB 2GT9B 3MV7D 2X4UA 4LAJH 4FQJH 2APBA 4A6YH 3GSRB 3E8UH 2JK5A 1QRKA 5DJAB 2AEPH 3O3DA 4RGNC 2H8PB 1CTNA 3DNKA 1YY8B 3KYOA 1K5NB 1MLBB 3R0NA 3I6GB 1WICA 2X70A 3HZVB 3VGEA 1D7FA 4P9HH 1QQDA 5MI0B 4M93C 4GQPH 2E8ZA 5F9WC 3DWTA 4WW1A 4AQOA 1HKFA 3MROA 3H9HA 3T8XB 2UYLA 5MHSD 1AO7B 3O2WH 1Q94B 5I1GL 2EYSA 5LBSL 1GOFA 1XGQA 3LVEA 1T83A 2AK4D 2DYPA 4OV6F 4PJGE 4WUUE 1QPXA 1QLRB 5KVMC 4YK4B 3RGHA 2NNAA 4NJAH 3TA3A 1INDH 1JL8A 4I0PA 3PF2A 4U6YB 2DI9A 1TVHA 1KLUB 2Y6SD 4XCEB 4LU5H 4OCWH 4R4ND 3IKCB 2O61B 3HUJA 3HKFA 3DVFA 3EYFB 4WI2A 5D1QB 3KPOA 5CZKA 3IDXL 3WIFB 1LEGB 5EO1B 1TZHB 3CZFB 2HVKB 2BSED 1KJ2A 4U7KA 2W0FB 4J3TA 4G7VH 1I9EA 1HXYB 3OKYA 5CEXB 3S37L 4QWWC 1H5BA 3WS3A 4UV4L 2ICWJ 2YWZA 2QADD 4F9PA 2Q1EA 1AGDB 5I74B 1MCEA 1U93B 5KW9H 5K9QG 2APVA 4GFTB 1LDPH 5D2NC 1PYWB 5FK9B 2ED9A 5FV2A 1CD9B 4K9EC 1IGIH 4BK4A 3TPUB 1H15B 1CFTB 1RUQL 4BK5A 4AEEA 3TYFA 2X9WA 3QIUB 1A7RH 2FX7L 2MQ0A 3F7QA 5C0AE 5F8RC 5MEQA 1N4XH 2VWEE 3CFBB 1BVLA 4X0KB 3TV3L 2NY1C 1CFNB 2IADA 5ID1A 1QBLH 3SE9L 4P4RB 3HAEB 2DD8L 2R0KH 5GISH 3B9VA 4HS6B 4PJ5A 1LP9A 4TUJA 3S97C 4LVHB 4XTRC 1D5BA 4N8PA 4OAWA 4X8JB 4G6FD 1Y6KR 4LVNC 1JV5A 1LD9A 2IBGA 4OGYL 4NGHL 1ETZA 4O4YH 2ED7A 3NIDF 2Z8SA 5DUPL 3EGSB 5LGHL 5J6GA 1WUNT 3LDBC 3QIWA 4LLVB 5EH1A 2DQIH 4G9DB 4C56E 2ZOKB 1BOGB 3BZFA 2VXQH 4NM4H 3RI5K 3RX7A 3QPXL 4RWHA 1CR9H 2Z8RA 3E6FA 1CXFA 4JB9H 1VDGA 5DJ6A 2WSKA 2IF7A 1JNLH 1M7IB 4XPGH 2NY5L 4NN5C 1T2XA 3IJHA 4XP5L 3R8BB 4ODWB 2DM3A 2VLRA 3TBYB 2DQEH 4NNYA 5C1MB 5KVGL 1CK0L 1QR1A 3D85B 2G2RA 5C07E 4X9IA 2CLZB 1NFKA 4ZUVA 4DN3L 4MD0B 4L1DA 1AGFA 5K9JL 5IFAL 2E8YA 3H9SE 2XTJE 4P2OC 3LOWA 5HHPA 1FO0B 1MSPA 4PJFA 3NACL 3E3QC 2NXZB 3U6RB 4X7TA 3L3OB 1AI1L 3CMGA 2DTML 4BSVA 4PJGB 4WUUB 2DN7A 4TVPD 3OKNA 4J3UA 5SWZA 5F9JA 3BP5A 2A0LD 1EGJL 2AQ3A 3AY4C 3SKOA 4FQQB 4EI5B 3TBWA 5HDBE 4M7JL 3WIHH 1TTGA 4PJIF 2AJZB 43C9B 5ISZD 4K3JH 4A6YB 2H3NB 4GS7B 1KNOA 5H2BB 3BO8B 4P2RA 4GRLD 4RAVA 3TJHD 1V7NH 5D1XA 3RWJB 1Q0YH 2PYEA 1XCTA 5GRVK 2R2BA 1Z9SA 2E3VA 1SEQL 5DDHA 2EIBA 3V0VA 2XQYG 3LMJL 4O58L 3H3PL 5LAXB 4YR6B 2VYRE 2MQ3A 2P4AB 3W0WB 1KEGL 4ZAKD 3NFNA 3PWVB 4PY8I 3V6OE 1W8OA 3QHFH 1OQXA 3ZHDA 5IJVB 2FJHA 1D9KD 1QSEA 1S9YB 3JTSA 2VAAB 5C08D 4L3EB 1EO8H 1HI6A 1P9MC 4OGAC 1F6AB 3K4AA 4LSPL 3P9MA 1I75A 4IOIA 4PLKC 5EWIH 3MRHA 4J1UB 3U4EB 3HUJF 5DQ9A 2GSGA 3FQXB 1C5CL 3D9AL 4KTEL 4NPYB 2HKHH 1JGDB 1K4DB 1ZS8A 2PTTB 4NHUB 5IVOA 4WGVB 5CSGA 2BOCA 3ARDA 3UZEA 4AEIH 2XKSA 4KZEH 4XP9L 1WBYA 2NY2B 3FOLB 5CP7A 3U2SB 4AT6A 3O3EA 4X6CE 4JZOA 5GGVL 2GEEA 3QUYA 1A7QH 4X5XB 4IDJL 4MA8L 1U8HA 4OZGB 4QT5A 1MVUA 1FL6B 4XXCC 3TNNA 5DEZA 5TE6L 1MFCL 1Z5LA 5KAQG 1FORL 5FO7B 4Q74A 4G43A 2FLBT 3ZZ1A 3L3IA 4D9RD 5I16B 4W6YB 5E7FA 3SGEH 3DUHA 1NJ9B 4KDVA 1T04B 1HHHA 2GITB 4KK8C 3CSBA 5I1IH 4CU6A 2J3SA 3UCRA 3GSQA 2P5WD 1AIFB 1YQ2A 5EO9A 3W5NA 1TDQA 3RNKA 3O4OC 4P5TB 4U4BA 5F7UA 4AM0A 1H0DA 3O8XC 3OJDA 4JG1H 4WGWB 12E8L 3NOIA 4JG0H 1T7XA 1LP9F 3NN8A 32C2B 3EDJA 2PO6D 3H9SB 2XTJB 3PGFL 3CVHH 5ACLA 1L7IH 3SDCD 2X89D 4XPAH 4WEBL 3VWJB 3C5JB 4YDKH 1HILB 2ADGB 4CUCA 1M7DB 4GSDH 3Q3GA 1YEFL 4LHUD 3MLZL 2HVJB 5HYJA 1QRNE 5A2IH 2QSCH 1U3HB 1NMCB 4O51A 3RL2B 3CVIH 3MA9H 5L9DL 5TH2B 1FVDA 5LVEA 2R2HA 4ELKB 2NZIA 4KJWD 4YXHH 5DD0L 5JA8B 3BWAB 1CGSL 1INEH 4B50A 5FKAA 5C7XL 3EZJB 2XIDA 3CX5K 3F8UB 4HFUL 3GRWA 4WFFD 5IESH 3OB0K 2R23B 5C09B 3UMTA 4PJFF 2I07A 2EE9A 4IIQC 4GG6E 3JVGC 4X98A 4TQEH 2C1PA 1NMAL 1ZHKA 5EZLB 3LN4B 1ZSDB 5J12B 1MI5B 4Z7UE 1I9JL 3GSRA 4K8RL 5DJAA 4QXGH 3SOBL 3BH9B 4QTIH 2GK2A 1VACB 2BRRH 1K5NA 4OQ1A 3NCJH 4LPYA 3FOMB 4J4PD 5EU5B 2DDQH 5KVEL 3NFPA 1UZ8A 3LRSB 3RY5A 2IFGA 1DQJB 3S6CA 2XN9A 3GBNL 4QRRE 1XIWA 1CFSB 1ZGLP 1CDJA 1VEMA 3BDBA 3WNPA 1A0QH 1Q1JH 3GSOB 1PY9A 3ARGB 3NFSL 3EYUL 3WLWC 1FO0L 1QLRA 3MLVH 4EIZC 1OTUC 3LEXB 1LK3L 2V7NB 3ARZA 3D39D 5GRVL 4WHDA 4U1NA 1WCBB 2WV3A 4XAWL 1VEOA 2CJUL 1MH5B 1KLUA 1CDIA 4HULB 3IKCA 3QEGH 4H25B 2ZG3A 2DQTH 4UAOB 2EIDA 4FQJL 3V5KA 2AJXH 1Z0NA 3PWUB 1T1ZA 4OZIA 3VGBA 2AEPL 3WIFA 1TZHA 2VDKL 2HVKA 3CSGA 3OGCB 4WO4D 4GT7A 5EUOE 5A2LH 2HT3D 5JNYA 4XH2B 1X3DA 3R0MA 2XWBA 2R1YB 5LQBL 4Y5VC 1HXYA 5JTWA 5CEXA 1BLNB 5LGJB 5J3HD 3O2WL 4NC1E 4ZPTB 1S7QB 4GAYB 2C9AA 1MCSA 1AGDA 3FB6B 2Y4SA 1TZGL 2Y06L 1UB6B 1NAMH 2J1KA 3QUXD 5DD1H 1E4WL 5BZDB 4MXWL 1IE5A 2CMRL 2ARWA 1BD2D 3IXAB 5FK9A 1N2RA 5D5MB 4X80L 4NJAL 3AM8A 5C3TA 3MLUL 5SWSB 4M1GH 5J06A 3IJYB 4LCCC 3OJVC 4JQIH 5KSAC 1H15A 3OPZH 4PGEB 3AREC 4AL8L 4HUUB 4QHMB 3CSYB 1K6QH 2EEBA 1SY6A 3QDGB 1A1NB 1ZHBB 4XBPB 5ESQB 5JMRA 2AEWA 4MA7L 1I8LC 2BSTB 3CLEH 1KCLA 5HYSG 4Y8AA 1QRNB 2MCPH 2V2WA 3CFBA 1BFOB 2ZKHL 4P46D 5AZEH 1HHGB 1T03H 2WUCL 4PJEA 5I8KL 3VMNA 3D0LB 3D3VE 4A2MA 4ZTOL 5I8CB 4XC1L 3RWEB 1ZT1A 3EYVA 4OD2A 3G08A 2W1NA 4X8JA 4KTDH 5J11B 3KLAB 3L7FA 3LQZB 1N0LA 5DR5L 2W65B 5T1KD 2E7BA 3ZKNC 4MCZB 3CVHB 4G9FD 4NQSB 3ELAT 4G9DA 3T3PE 1I8KB 1BOGA 4UNTA 1MHHB 3K4DA 3AS0A 1XH3A 3GHBL 2RCSL 1OCWH 4G5ZH 4ZTPH 3T3MF 3JWOC 5EIVA 1IGIL 3WSQH 4GG6B 4U6XB 2CRIA 1UZ6F 1IZKA 3I9GL 1EBAA 3RVXC 1M7IA 4KY1L 1YJDH 4Z7UB 2ZUQB 2Y1VA 1R0AH 5IMKB 3G6DL 1QLEL 2QSVA 4H20H 2FO1A 4K94L 1EZVX 1OQOA 4XBGA 3D85A 3VXOB 3ARTA 2WNGA 2KQNA 1GH7A 1JTOA 4Y1AD 3WN5C 2G5BB 2HMIC 5IHUL 2H2PD 1L0XA 1HK6A 1ERNA 2A6JA 1BIIA 1FC1A 4YH6A 4LKCB 2X9XA 2X4PB 3ULVC 3L3OA 1A22B 2DLEA 2MMXA 4EI6A 4PR5A 3QDJE 3WDIA 2BVPA 3TVMD 3SO3B 3HB3D 2ESVE 4PJGA 4WUUA 5T1DL 5KN5B 4WCYL 1MQKH 2EKSB 5J4MA 1FCCA 4MYWB 4U1IB 5ICZA 1PEWA 4A6YA 2H3NA 2DWDA 1SVZA 1KYOK 3B8SA 1OP3H 4LDLB 3NPZB 5ETUB 5I1JL 3JV6B 3RWJA 4XWGL 1FZOB 4FZ8L 3RX8A 4Y5XC 5EIQA 3MRLB 4JN1H 2VLKE 2R9HD 4PTTB 4FQCH 3O4LE 2DQEL 1OGAB 1U6AL 4LHJB 4ZDHB 2Y9RT 3BWUC 4YR6A 2W60B 4U49A 1XGRB 2VLJA 2QQQA 2CGRL 4S2SB 4PGCA 3TZVC 2A9NL 1VEPA 1UXSB 4NKDA 3PWVA 1T5XB 4MJ5B 1AO7D 1VFBA 4LSUH 4QNPF 3VFGL 1LK2A 5IJVA 4QHUB 4P2CG 5BV7C 4DUXA 1IZJA 3FRUB 3S96B 1YEIL 2VAAA 5KSVB 5M94B 2F8OA 3KWWB 1KIUA 1C5DB 2Y25A 1F6AA 2CRYA 3C60B 4NRXB 2MFNA 4Z0XB 2E6JA 1DFBH 1O7SA 3RPKA 4Y4FB 4JFEE 4JANA 3AROA 5HI3C 4J1UA 2FHFA 3HC3L 1KJMA 1BGXH 4HXBH 4OZIF 5HTSA 1JGDA 3OKEA 3NZHH 4QRSB 4D9RE 2PTTA 1KXVC 1SJHA 5C0AA 1S7SB 1BOYA 3WL9B 5BQ7A 4U0RB 4PJAE 25C8L 1QACA 5KVFL 1KF9B 3D3VB 5L8JB 3QG7H 1DJSA 2P5WE 4NNPL 1NAMB 1FVCB 1T6WA 1VFAB 2HRPH 3MRDA 4TNVF 3U2SA 1MIMH 4RWYH 4APQB 3PJSB 3QHFL 2J7LA 3IDYB 5DMKA 1TZIA 3K4ZA 4X5XA 3BJ91 4XMLH 3WKML 4NM8H 5C0DB 1FL6A 1E27B 1HWHB 3BT2L 4EUPH 4JPIA 5TFSH 4WENB 5FO7A 4UTBL 5IW3A 1AC0A 5DFTA 4C56A 5E24E 3WFEL 3SGJC 3P0VL 5I16A 1NJ9A 3PGDB 2GITA 5SV4A 3V6BR 1JZ8A 1YMMD 1KPVB 4MCYB 3RL1A 5T5FH 4YGVB 3TGXA 4HT1L 3QIUD 1ONQB 4KTYA 5FM5M 4KK9D 3L5IA 4P5TA 1XGYL 2XICA 3VE0B 5C07A 4PJEF 2ILLA 3SDXE 3OHXA 1HINL 3B43A 2ZWLT 3U7YH 3IDNA 2D0HA 3H9SA 3MRBB 1AXIB 1FPTL 4YDVA 3GEWB 1S9WA 1E4KC 3VWJA 3C5JA 3NPSC 3QDJB 4L8SC 3WO3B 2FD6L 4PJCF 1FLTX 4TRPH 3MNZA 3S3SA 3K81A 3UYRL 2ESVB 3V79C 3DMMA 3W81A 2HVJA 4AMKH 3ARVA 1Z2KA 3QI9A 4JRYB 4K8RD 1KCSH 5BRZE 4X9HA 4DEPC 3LHPH 3FN9A 4HW6A 3BGAA 4G6ML 1UJ3B 3C8KB 3KLHD 2E9IA 4XHQA 2BXZA 1FFQA 5DVNA 4JHBA 4M4RA 1PG7L 2OR9H 3BWAA 4YEEA 3C5ZC 1HQ4B 4DWHA 4JQXA 3TH2T 4YHZL 3O4LB 2R2CA 2F54E 3MMEB 1CCZA 1MHPH 1W0WA 2NY6C 4R96B 3OX8B 4UU9B 1JF6A 1MRFH 4FQXB 4CMMB 5H94B 1ITCA 4JG0L 2VQ1A 2R23A 5INCB 4P3DB 5BCAA 4LSSH 3V6OA 1Q9OA 2YWYA 1AQKL 4QY8B 3T2NH 3DBXB 3VXPB 4XPAL 5EA0H 1ZSDA 3MODH 5FGRA 4XCYA 4PJGF 5IR1B 3WIHA 4EZMA 4NZRL 5ITBH 4XPBL 4GSDL 2C26A 3FO1B 4LAQL 1ROWA 1VACA 4EI5D 3OTTA 3KPRE 2VL5B 5DK0B 2F53E 4I4WB 5C0GA 3FOMA 5EU5A 1MJUL 3RIFK 3LRGA 2VDNL 3MQIA 5I0ZA 1DQJA 5J1SC 4TPRH 1CFSA 3BZEB 5I1EL 5AWNH 3LS4H 2ARJB 4H5SB 3GSOA 3B3IB 5DJZA 3MRGB 3ARGA 3B6SA 5T1MB 4CJ0A 3PIQB 5GS2D 4YXKL 4KK5D 3ARFB 1EEUA 4PJAB 2XACC 4JDZB 4KKAD 5JZ7D 1FFNB 3LEXA 4OFYA 3KPQA 3PV7A 4NFBA 3HZMB 3X3FL 4N0YL 3SCMC 2BX5A 4FFZL 1EH9A 2ZNWA 5ANME 3VWKC 3SKNB 1MH5A 3UC0L 4X6CA 1F3JB 2DWEB 1NDMA 3PWUA 1IAOA 4L3ED 5GSVB 2AK1H 4HJGB 4K07A 2XZQL 1U8NB 1XR8A 3BXNA 3H7BB 4IMKC 3NCJL 2PXYD 3HPLB 4XH2A 5EU4A 5D6CB 5I1DB 1T7ZA 4K2UH 2R1YA 3VFPB 2OCFD 4ONGH 4H0GA 4Y4KB 3STLA 3FFDA 1F00I 4J12A 1BLNA 5LGJA 5IQ9B 2DF3A 1KN4H 2DM4A 4AY0A 1ACZA 3PDDA 5ALBH 2Q8BL 1KYOJ 5BZDA 1T0MA 3UAJC 4JO1H 5D4QA 3IXAA 5BVJB 4DKFL 3IJYA 3FFCD 4U2YA 3SDDD 4NKQB 1RU9H 1YN6B 4XNZC 2P5EE 4PGEA 5C2BH 5CMAB 2NXYC 4JO2H 5ESQA 5T3XD 2BSTA 3MRMB 2IAMA 2WLYA 2I9LA 1QRNA 1HZHH 2EYTB 3RZWA 4LDEB 5BRZB 1TXKA 2QJDA 1YECH 4R4FL 2DM7A 3D0LA 5IK3A 3V4UH 3U0WL 3HA0A 2XG4A 1G7IB 2A6KA 3QCVL 5IG7A 5EOQL 1T22A 3AS3A 1JHKL 3KLAA 3LQZA 4X7CC 2W65A 4JM2C 1NAML 4D9QD 3WUWG 2NQCA 2P48B 3CVHA 2E7LA 4JM4L 4NQSA 3TFKD 4NJ9L 1DDHB 3OG4B 4JPWL 1J86A 2YS4A 3FB5A 5FM4A 1MAMH 4HWEL 4IOFC 4GG6A 4U6XA 2VXSH 3VI4E 1BAFH 4NQCE 4F37K 2BFVH 4HK0A 4Z7UA 3NBNA 5D7KD 3OAZK 1G9MC 4Q2ZB 5IMKA 3N1QC 1G7PA 4JFOA 4UQ2B 5TQ2L 3VXOA 4FG6C 5HDBF 5IB1A 3KPRB 1U3HD 5BMFH 2F53B 2QQLH 3O6FA 4KKBD 1JK8A 4RZCA 4XX1G 3OR6B 4O2EB 3LKQA 3PWNA 4P57B 4JKWA 5LCVL 1A4KA 4BM7A 4QRRA 2J8UE 4P23D 2B1HH 5D7LE 2X4PA 4DW2L 1WFUA 1NC4B 5D1ZA 5IKCB 3O45B 2O26U 1Y18B 1BHGA 5FCUL 3VFNA 4UTAL 4HMDA 4NWUH 5KN5A 4Z7WE 4LQFL 2BNQE 2EKSA 3HPJB 2OJZL 1NDGA 3LY6A 3VFOA 2DRUA 3KJ6L 5C09D 1X7QB 4JGUA 1AXSB 2Q7YB 1OCWL 4ZTPL 3U7WH 4IM8A 3WSQL 5ANMB 4MQXD 1LO0L 3JV6A 4P4KC 3UYPA 2WQ8A 4Q6IC 1BF2A 3MRLA 3OG6B 5GZOD 3HNSL 1P5VA 1X6NA 3HE6B 2FIKB 3S36L 5DJXB 2N7AA 4R8WL 5F89B 4ZDHA 5EUOA 1S5HA 2W60A 1DBJL 1GC1C 1L9MA 1Z9OA 3RWFB 3S37X 1JVKA 3BDYL 1JMXA 4GQ9H 3X11B 3ULUH 4KMTH 2O5YH 3V5HB 5GHWH 3O11A 3UJIH 3NA4A 1TJGH 4UNUA 1C7SA 1UACH 1VSCA 4WU7B 3K7UA 4KKCC 4MD5A 1FNEA 3SDAC 3FRUA 4OBSA 4PRHE 1INQA 1Y0LA 5HI4D 3KWWA 2ID5A 1QSZA 5D7JC 1JYXA 1C5DA 3RDTB 3FRPG 3D6GA 3QZWG 1XCQB 3VG0H 1NCCH 4X6CF 3D18A 2I5YH 1MRDL 2P5EB 1Q72H 1EHAA 2ITDA 4LL9A 5TPWH 2H45A 3ZE0E 1K8DA 2WWMD 3GFUA 3GMMB 4J3SA 5B3JF 3VXMB 4R7NB 3G6AB 4G3YH 4QRSA 3FT3B 3ULUE 1IKFH 1NCDL 1MCHA 3I2CL 1HE7A 4K7PH 4I18B 1YMME 2NPLX 3H8NA 4LVOC 4X5LA 5HDLA 3RU8L 4NN6B 1YC8A 2OTPA 4JCLA 1B6DA 1PKQE 3D3VA 1T2JA 1NAMA 1FVCA 4IOSD 1VFAA 1F90H 3KNBB 3BSZH 4XWOC 3PJSA 2NCMA 5HSFA 3BDXA 1A64A 4ONHB 1HHKB 4NQVB 4ZPVA 1G0XA 3LCYA 3TYGH 4GRWB 2R29L 2VXUH 5EOCL 2Z8WC 1OP5H 4EQ2A 3S3JA 3GO1L 3O2VH 3WHE1 5ALCH 3VFWA 3PGDA 3UBXG 4NQCB 4M7ZB 1GYAA 4K3GA 1KPVA 4MCYA 1D5IH 3QDGD 4HXBL 3GGWB 4NZUH 3RWCB 1ONQA 3HR5B 1RURH 3REVB 1NLDL 5KTEH 2Q3AA 3N0PB 2HAZA 4DTGH 2FO4A 4Q7DA 5HHOD 1G9NL 1KEMH 5FKPB 3VXSE 5C0NC 5JHDE 2AJSH 1KFAL 4JFDE 4Q9RH 4Z76B 4DN4L 5FUCE 1OTSC 4DCQA 3QDJA 1NSNH 1T0NB 2HH0L 4JAMA 1UWXK 1KXTB 3OQ3B 4M6OL 2ESVA 4Z7WB 4MSWB 5DTFA 3M17B 5DEGA 3DURA 3FONB 1A1OA 4FMKA 2EYRB 4ZOAA 4HZAA 5ELIA 4GG6F 4JEGB 1CGYA 1UXWB 4N0UE 3SKJL 3BKJL 3KPSD 1RULH 3G04B 5T1LA 2EZ0C 4WFGD 5ADOH 4OSUL 3ZKMC 2VLKA 1HQ4A 2DMCA 4HPYH 3O4LA 5E2TH 1NL0L 4LCWB 1MF2L 4PG2C 4R96A 4HKJB 1AE6H 3OXRB 3U30C 4FQXA 3CMOH 4QTHB 4CMMA 4KROB 5DQJA 1WEJH 1J5OH 5INCA 4NBYB 4P3DA 3QNZB 3QPQC 5C0JA 1IGML 5I75B 1DQLL 4FA8A 1TCRB 2ADJB 3N85H 5D93C 1ZHLB 2XY1A 4TRPL 4PRHB 5A2JH 3FO1A 1U8OB 1X6LA 4MDJB 5GSRB 5A3ID 4AMKL 1FNGB 4ELMB 4G6JH 5CJOL 1A7NL 2H1PH 4XAKD 1BVKB 3D48R 2R4SL 4JFEA 4WJ5B 1A6VL 2HJFB 3B9AA 1NCWH 3MJ7A 4LLAA 3VD3A 3KPLB 1AGBA 1KJVB 3BZEA 2J4WH 4OM1H 4UOJA 3DUUB 4Z95H 5EUOF 3SJVE 3MRRB 3MRGA 5T1MA 4MWFB 4ETQB 3NH7L 5IW6B 1DLHB 3ARFA 4PJAA 1KJ3L 4K9EL 4ORGB 1FFNA 1BQUA 3ALPA 4L1HA 3KHOA 1A9BB 3WNLA 2P5WA 1EJOH 4CVXA 5D72L 5C9JB 5EPMB 5DSCA 4HUWB 2HWZH 2A6DB 1F3JA 5EA0L 2MJWA 4N5EC 4HJJH 1C7TA 1P1ZA 1WZ1L 5C0RH 3GIVB 5GSVA 4HJGA 2C7UA 4WEMB 3C60D 3QUZD 4Y4FD 2X89A 3MXVH 1J0JA 3E0GA 3IS0X 5D6CA 3KYNB 4FFYH 1PJ9A 3GSNH 1U0QA 4QRTB 2XQBL 1KB5H 3ZE1E 2OXHA 5IB4B 4N9GA 5IQ9A 3OWEA 3WDJA 5TQ0H 4ZYKA 2V5TA 3UJJL 4FZEL 2GJ6B 1I7ZA 2ZUVA 4F2MA 3G5YA 5JOPD 4HUXA 4IRSD 3SDXA 3O3BA 5J6HB 4PLJC 5BVJA 2UZIL 2FSEA 5JHDB 5DUBB 1TVBB 3OB0H 4KI5D 4EUPA 4OGZA 1UM6H 4APQD 4YJZL 2WUBL 4L9LC 3MX0A 1BQHG 4JFDB 4ZUUB 1QLFA 3A0OA 4MD4B 2OS7A 5CMAA 1D6VH 2ICWA 3MNVA 1YYLH 4P3CH 2ZUXA 4LLYA 2NY7H 3QUKB 3T3PF 3DX8A 4BFBD 1A3LL 2Z8VC 1TENA 5IBLC 2VC2L 1Q8MA 1P7QB 5FB8B 2X4NA 1SM3L 4OFVA 1U8KA 5BRZA 1NUNB 1I3GH 3WFCL 2QSQA 1ZLSH 5I76B 2M2DA 3T0DA 1S9KC 1YY9D 4GMTH 1G6VK 2XZCH 1NLBL 1RJLB 3BKYL 1VGKA 2E9JA 2F54A 2WANA 2B20A 3S5LB 4JZJC 4JGMA 5CBAA 2MWCA 4I0KA 4JVUA 3RWDA 3MOAH 4HIIA 4C59B 1MUJB 1DDHA 4HX1B 2OSLB 2JCCB 1B0RA 4KUCD 3Q1SL 4YBQC 2D31B 1FE8H 1I7UA 1IC5H 2X4QA 1WTLA 4ZNEE 3PWLB 1LO3H 2YUVA 3O6LH 3BGFC 3BYTA 3IDJB 1GSMA 3WFDL 3LH2L 4HSQA 1GXEA 4FS0A 4JRYD 3KPRA 1HZHL 3QHTC 3I02B 2F53A 5KJRL 3C8HA 3OR6A 1IM9B 3R8QA 3FQRA 4P57A 1Z3GH 2YHGA 4X6BA 2G60L 1FNSH 1WIUA 3LD8B 3MXWH 3X12B 5E5MA 5HY9B 4LCCB 4WO4A 1NC4A 1PX4A 2C4FT 3MJ9L 1Y18A 1WGOA 3RPIB 3SJVB 1AXTH 3FTGB 3HPJA 2NY3D 4FQLL 4HUKB 2O5ZH 4GOSA 1X7QA 4FXKB 4YHMH 3V4VL 5CD5D 1VKXB 4JHAH 5ANMA 4S1QH 3EHBC 5GS0C 4NYLB 5JXAH 4OCRL 1BAFL 1A7OH 3JBG7 3T0VA 1N3NA 5F7LB 2M26A 2FIKA 4UQ3B 4FQ2L 1ZLVK 2BJMH 4EBQH 3QXAB 1OTTD 5CZXD 1A9EB 5DJXA 3WIIH 1BBDL 1BFVH 2F5AH 5F89A 4XMPH 2Y23A 5EC1A 1C16B 1FZKB 3FT4A 1WBZB 1P4BL 4HUNB 2ADFH 2PETA 4L5FH 3X11A 5JO5A 4HXAL 5DMYA 1KTDB 6CGTA 5F6HI 3V8OA 1S7VB 3QRGL 1YUHB 3PWPD 4WU7A 2WAHA 3H0TB 5HHNA 1AKJB 5AG9A 3EYOA 3U36B 3ROOB 3BIAX 3NTCH 2BVYA 3BYYA 1HHIA 3RDTA 3G6JB 1AP2B 5BJTB 3FB8B 2XRAH 4HIJB 4Y16B 3VFTB 2AQ1A 3GJFB 5EZJB 4OLYH 2BNRE 2P5EA 3OV6A 4M7LH 2HA1A 4XNYH 5HD8D 2CDGA 1TCMA 3T2OA 3UTZB 4HLJA 1E6JL 1SMAA 5IQ7L 1DEEB 2RIKA 4N0FA 3BI9X 3GSNB 5C71A 1UM5L 5EZIH 1XR9A 3THMH 3WS6C 1I1AB 4ISVB 3VMPA 1BQLL 3MSPA 4I18A 1J8HE 5DMJB 3FQTB 4GKNB 2I26N 3GJFK 5EO0A 3I3EA 4QGTA 4KMTL 4R3SB 4TTDC 1VADB 3CFEB 4Y4KD 1HHJA 2LVEA 2HTKC 4G6KH 4BELD 2GAZB 2D7QA 2ZG1A 4HJ0C 5E56A 1DUZB 1G7HB 4PB9H 3V9FA 4KK6D 3OKOA 5FUZL 3WJJC 1G1YA 1WK0A 3DX6A 4HIHB 4NQVA 3SDXF 4Y5XB 4RGND 1X5AA 5C92A 4PG9B 4WTZG 1R5VA 2FGWL 4F7TB 1L6ZA 3NMEA 1BJ1H 2L0DA 2OTUB 3DVGB 4ZXBB 1CTOA 5B8CA 2UUDH 4LLQB 4NQCA 5CHNB 1D5ZB 2R56L 5DJDA 3TZVB 2V17L 4NHCH 2GY7B 3GGWA 1NGWB 4RAHA 4GW5B 4TULH 5GS3A 2VDQL 3VXRB 4AIXA 5IW1A 1IC7L 3TCLA 4NO2B 3W9DB 2VITA 1YNKL 1WT5A 43CAA 1F90L 2J8UA 4IJ3B 4NDMA 3BP6B 1FDLH 5D7LA 1D5MB 1VGEH 3EW3B 3RA7L 1I3RA 4CMHB 1T0NA 5B39G 3C6LC 4Z7WA 4MSWA 1G1CA 2BNQA 2VXUL 3QIBA 4CVZA 2IBZY 1A6ZB 2EDKA 2EYRA 1NUGA 1DL7H 5I1HH 1KIQB 2QEJA 3TO2B 4RIRB 3GSUA 3TIDB 1GZQB 1UXWA 5D6DA 2R69L 5ALCL 3GZKA 3G04A 1QR4A 2CDEA 1ULVA 1MHEA 4QWWD 5BO1H 2IPUK 3VGAB 3FQUB 4U7MA 1GOHA 1RURL 2ICES 3S98A 2ENSA 2XT1B 1BMGA 5JIKA 1MCPL 2GSIA 2W92A 3RAJL 1KEML 2QQKH 3CDCA 2CIIA 3K1DA 4QTHA 5C3LD 4H8WL 4GXVH 1CDCA 3QNZA 2VDRH 3ZT5A 4Q9RL 2YXFA 5EZOL 5DVLA 1MCCA 1TCRA 2ADJA 3RVUC 4NUJA 1NSNL 4ENEC 4Q9QL 1ZHLA 3VRLE 4KKLC 3S4SG 5I66B 3JWNC 4PRHA 2FJFB 2DQCH 3FZUD 1T4KA 1T7WA 5GSRA 4ODXB 5IJKC 4U6HB 2IQAA 4MJID 3MNWB 5SX4H 2XFXA 3TT3L 2NY1D 2OZ4L 3S34L 3K8LA 4AG4H 5FHBL 3IFOA 3HE6D 1T83C 2UV3A 3B9KA 1FGNL 4OLWL 4X7SL 1QBMH 3QDMB 1U36A 1S3KH 2WINA 4XTRD 3DUUA 3NGBC 3LIZL 1RZJC 4JLRB 3PQYD 4RBPH 4DQOL 4ETQA 4KRLB 3TA3C 3UTQA 4I0PC 3RKPA 1YMMA 3IU4L 4IRJC 2C5DC 3AC0A 4YHPA 1A9BA 3MO1A 1PKQA 1SBSH 5LGKA 1CGUA 2PW1B 1N7MH 1VPOH 1NBVH 3GMRA 2F58H 5C9JA 2HKFH 2NY4C 1HNGA 4E41B 4HUWA 2A6DA 4XB7A 3BPCB 1BP3B 3OKMB 4EDXB 9CGTA 3ARXA 4Z77B 4PJ7E 4OM0H 3PWJA 4GXUN 5IVXE 2VDLH 1J05B 5E4IA 2OI9B 5CINH 1PW3A 3QCTH 1JCKA 1CFBA 1P69B 2AW2A 1H5BC 2H1PL 4TSCH 5F88B 1N64L 5CUSH 1RZFL 1RIUL 3FQNA 1NCWL 2KKQA 2BK8A 2AJVL 2YD8A 4P2OD 5IB4A 3ESUF 3VXMD 1MCQA 1H8SA 1EHNA 3Q6FB 4JO3H 4AEHH 1CDBA 4CRPA 2WBKA 5IM7B 1A2YA 3VXSA 5DD6A 3JWOL 2JB5L 4XPTL 1PZ5B 4JFFD 5JHDA 1YEEL 1TVBA 4HBCH 3MYJA 5DURB 5TDOB 1XFPA 2E9WA 2N7BA 5BVPH 1IGJA 2AV1B 4JFDA 4MD4A 3G9VA 3G5XB 4O5LL 3PHQB 3GKWL 3TN0B 3TWCH 2R0WH 4CGTA 4NCDA 5I1CL 2VIRB 2BVOB 4Z7NE 4M62H 2APXA 2JELL 1FCGA 1X5YA 3QO1B 5L8LB 4HAGA 3X3GL 1OD7A 4N0UA 3MXVL 3QQ3B 1PG7X 5IMOB 4FTVD 5BOZG 3MRNA 4LNVA 3SDCC 3ULVL 4KVNL 4PYGA 5D7SH 3RY6A 4K7PY 2OL3H 4HS8H 4KJPC 3U1SH 3SCMB 4TYUA 4CJ1A 5TQ0L 3QIWC 4XGZB 5GRUH 4AIZB 2EC9U 3HNTH 1MHCA 3ARSA 3RUGE 4ODHL 2VTFA 4WW2B 2OSLA 4JQVA 1AD9B 2Z93A 4OGAD 4D9LL 2J8UF 5FV1L 2AAVA 3Q0HA 4PLKD 4HKZA 1MLCB 5I2IA 1A6TA 3D2UA 3PWLA 1D6VL 4PIRF 2FIRT 3O6ML 4X4ZA 4DK3A 4Z7WF 2FX9L 3WO4C 1CF8H 1HEZA 2DL9A 4BKLB 3TM6A 2DMKA 3LS5H 1HYSC 3MLSL 3C09B 1ZLSL 1JGLH 1JPST 1OPGL 4DK6A 5BV7L 1RHHB 2DQGL 3CFJB 3QQ4B 1U95B 3X12A 1TQBC 5HY9A 3B2VL 4JRXD 1MELA 1T1WB 4P9ML 3QWRD 3SJVA 2FEDC 2PXYA 4EJ1C 4MDIA 2JJTA 3FTGA 3FMGH 3BPOC 4S0SD 2Z4QB 3MOAL 4MQ7B 4YIQB 1IKNC 1G6RH 4UILH 5D1XC 2V5MA 1GGCL 1EAPB 3PWPE 1JPGB 3BP7B 4R2GC 3EO1B 4KK8D 2FZ3A 1J1XH 3QXWA 2J88L 2QTEA 1Q9KA 5FYKH 4UQ3A 3O6LL 4NUGL 5IVXB 1BWWA 4YQXH 5D96C 1A9EA 3SGDH 4Y5YB 3P2TA 1A14H 3O8XD 1WBZA 4IDLA 4ONOA 4WI8A 5HJ3A 2MPAH 5F1OB 1P7HL 3WDHA 5DXWA 3K74B 3MRKB 1DQQB 4F8QA 1KGCD 1KTDA 3FQWB 3ZE0F 1S7RB 3PHOB 2A6IB 3ALXA 3ULUF 3CPLA 4UIMA 1FG9C 1S7VA 4PJ8B 4XX1E 3H0TA 2NMSA 2F74A 1EEQA 3U36A 1KTLB 5FYJH 3S35H 3W2DH 2O5ZL 1AP2A 4P2QD 5FYKE 4YHML 1CI5A 4Y16A 1A4JB 3JWDH 3VFTA 2X9YA 5EZJA 2A83B 4S1SH 3EUUA 4PRID 1IGFL 1UKTA 2AXFB 2F19H 2G75B 3ECBA 3UJTH 2FR4A 1A7OL 5JPMB 5HGAB 3RI5F 3U0PB 3QEQD 2YPVH 1C1EH 5DMGD 2EDXA 1DEEA 4HFWB 3GSNA 4PJHB 1T2QH 1KB5A 2RJMA 4XMPL 3IFPB 5I71C 2A1WH 5TF1L 1UKQA 1R5IA 5DGRA 4R3SA 4U1MB 1VADA 3QUYC 5F9OL 1A6UL 1VFMA 5HHMD 3VXNB 3H3BC 3O9WB 1FIGH 1MAKA 5FYJE 1QFWH 3BPLB 5EU6D 1DLFH 4ZNCD 3EYSH 5INDB 2BVTA 3ABZA 1WITA 1F4HA 4GKOA 5LXGL 1LE9B 2NY5C 2AP2A 3V0AC 2YPKB 5DRWA 1SBBA 5FO8B 1J88A 5FGBA 1RUAH 3CJJA 5HVWA 5KBNC 4ZO8A 1T6VN 4F7TA 4PGBB 3BUYA 3DVGA 2XRAL 2A38A 4IRZL 2AABL 4OLYL 4ZNEA 1D5ZA 2FCBA 4M7LL 4RISL 3ROLA 5DJYA 4HGKC 4F7PB 2CH8A 4X4YB 4O2CB 4KZDH 4M61B 3LKRB 4H1LG 3WLWD 2OL3B 1N0XL 2ZSWB 2VMFA 2XNAB 1I8IA 5KAQF 4NO2A 1OTUD 1IJ9A 3WE6B 1V3MA 3DXAE 4U6VL 5D7JB 1D6EB 5HYSA 4R90H 3FL7A 4YNYB 5BZWB 3BP6A 4I48B 4Y19D 4PB9L 2AI0H 3GSXB 1XF4B 4GW4B 5DRZA 4Y4HB 4I2XB 4IMLA 3VDBA 4YO0B 1OAYH 5DZLA 4UOW1 3Q5OA 5SX5K 1ZEAL 1P5UA 1KXQE 5IEKA 1EAJA 5CLTA 4F3FB 2XPGA 4M48H 3TO2A 4RIRA 3DRTB 3MV9E 4IEFB 4NKIL 5E8OA 5CKAA 5EIIB 4HIEB 3EBAA 4XVSH 3S36X 2RB8A 1FAIH 3MRJB 4Y2DA 4FABH 3FQUA 2QKIB 5HPOA 4GAJH 2C4XA 3P4OB 1TPXC 1AH1A 3VD5A 4XVTH 1IM9D 3RZCA 5ERWA 2VDOH 3VFRB 1EFXD 4HV8B 3MLPA 4BH8B 5K59F 4XVUD 3DUSB 2EDLA 2FWOB 4LLDB 5I66A 5DD3H 1CLZL 3HG1E 5F72S 2FJFA 5ILTH 3EDKA 1EEYB 3CLFL 4M1DL 1UM4H 5MI0C 4U6HA 4H26A 5I1HL 4P2YA 1XIWC 2GFBA 3L7EB 1N26A 1CT8A 2ZJSH 4LLUA 1RZIB 2BNRA 1YEHH 1JWUA 1KIRB 2ADIB 5DK2B 5F96H 4WWID 1ZT4A 4W70A 3V52H 1QYGH 2JJSA 4IHOA