5KS9E

Bel502-dq8-glia-alpha1 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
193
structure length
193
Chain Sequence
QVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVALNNNAGNMLTFGGGTRLMVKPHIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 36
structure length 193
sequence length 193
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9E02
2DWDB 1RHHA 1FBIL 4TUOA 4JFXB 4LOUD 1CFNB 4XPTH 2Z31A 3DVGB 1EFXB 4X8XA 2WBJD 3KLAA 3FB5B 3HMWH 4M3JA 4X80L 3V6ZA 3MLUL 4HIEA 1SJVA 3SDYL 3BHBB 5DRWB 4KK6C 2JB5H 4Q97A 1F5WA 3DVFA 5JDSB 1ZS8B 2HAZA 3L9RB 4GRLC 4OIBA 4EN3B 1A6VH 1RMFL 5BQ7B 3FQUB 5GRUH 1JN6A 1S7UB 4FFZL 2FBJL 5TF1L 5IB3A 3ARGB 4OZIE 5FDYA 4RDQG 5DFVC 4HBQA 3E2HB 4U1HA 4E41A 3PGFH 3O4OB 1RK0A 5EIIB 1DTUA 3O3AB 1DBMH 3JBG7 4L3CA 5HGHB 1BD2A 3N50A 1NMBL 1A02N 3AMKA 4FQ2L 2I9LB 3LD8C 1ZAGA 1GGTA 3W0WE 3DMMA 5E5UB 3S98A 1BLNA 5GSVB 2R2EB 1LDPH 4JRYD 2VZ3A 1U8IB 4AIZB 5FIEA 4E0RA 5IT2H 1HQ4A 3JUZA 3SO5A 4Y5XC 1WISA 3B9KC 3WHXA 3IGAB 4R97C 4Z7QE 2JJWA 1D9KC 3NTCH 5LWYL 3MRIA 4JGJA 3DI3B 4I4WA 3LPGA 4M7JL 1KC5H 1MJ8H 3TWCH 5SV4A 2CLZB 2NY0C 5GGVY 5EZIL 3LCYA 3SQOL 1J8KA 1BMGA 1RZKH 3BMWA 5KSBE 5D7IA 2UWEB 4JHWH 4OLVL 1KPVB 4KTEH 1JWSB 2Y23A 3RBGA 4GBXA 1M05B 4P5TC 2XTJB 4PJGA 1T7VA 2ADGB 2ICWA 5I8OL 4LLWA 2YK1H 1HXYA 5E6IB 3ISWA 3ALPA 1H3XA 2ZUQB 2ARWA 5GHWL 1RIHL 5C3TA 5D1ZB 4WI3A 1T7WA 5MENE 3U6RA 1LEGA 3ZL4L 1NDMA 2HFEA 3WUWA 4DKDC 5FA4A 1CFTB 1ITBB 3HAEH 3W2DH 3T3ME 4UOJA 3OAZH 4AIXA 3D2UB 4JZOB 2V2TB 3PV6A 4NWUL 1AQKL 4HEME 1ULVA 3V5DA 1TCRA 2K3TA 2GJZA 2DLIA 5FOBA 5DYOA 1AGEB 3FOMA 1T1YB 4AIOA 1TVHB 4IRSD 4E5XB 1MI5A 3BEWA 4Y1AB 5D2NC 3DX8A 3BKMH 3GSXB 1S9VB 5C8JB 3KWWB 2J2ZA 2K9UA 2DQGL 3S36X 4URTB 2G5RA 1QKZH 3VXUD 5DEGB 3ARQA 3MACH 12E8H 4W4NA 5J6GB 3RVWD 4R6UA 1ZMYA 3D3VD 3PL6C 5EU6A 4KQ3H 5D1QB 4P46B 5GJTH 1BM3L 5HGDB 3P0YH 3MUY1 4X8JB 2GAZA 4KROB 3TC9A 3HG1A 3H7LA 1S7WB 3IJYB 1UXWB 2APVA 4YHYC 3FB7A 3O6LL 4PY7A 3VFVB 3OJMB 2JE8A 5AD0B 2BC4B 4P23B 1B0GA 3LHPH 3TBYB 2JJTA 3RGVD 3TBWA 4L9LB 3GRWA 4P4RA 3C8KA 4MXWH 1YMMD 3HUJF 3MO1A 3E6FA 1BVKB 1OT2A 2RBLA 4HFWA 2DQJH 2QSVA 1H9VA 2ZUWA 3C5ZA 1JE6A 4GXVL 5D71H 3UJJL 3MRGB 2BSSA 5FGCE 1ZHKA 4UDTA 2H2SD 3ULUF 2GCYA 2X6MA 4XXCC 3ZYJA 3F58L 3GRWL 1D5IH 1F3DH 5DUPL 3Q5YA 1T1XA 2APWA 1IE5A 5C2UB 5F70A 1JGVH 4KHTL 4XWOD 3FFCB 1JHKH 4NBXB 1YYML 4JG0L 1VFBA 3UJIL 4PJXE 1NGPL 4WWKA 5E4IA 1BZ9A 2ZUXA 1NCDH 2WIMA 1R24B 4X6EA 3E2HC 4E42A 4C83A 3O4OC 1KULA 5EUOB 5FGSA 1H3VA 4PYHA 4P57A 1AR2A 3IYLW 3GO1H 2XWBA 4DVBA 1R3HA 3PWJB 1QLEH 4LP4A 1INEL 3FAWA 4Y16C 5JW4M 4HUKB 3T1FA 5CP3H 4PJXB 4LLQB 4XVUC 3ET9F 2X1WL 1H0DA 3R0NA 3MFFB 4JVPA 5GRVL 3SEPA 4M43H 2QQNL 5I1CL 4P3DB 4PJ8D 3GBNL 5LAXB 4U1JB 4FS0A 2MJWA 3H9SD 4YDIH 4M6OH 3I9GL 4R4NC 1YQVH 4OAWA 4HQQL 4ZXBA 4Z78B 5J1TC 4OZGE 4L29B 3PNWA 4BQBA 4G6FD 3L3KA 4XCYB 5DWUL 4UIMA 3DX9A 2BXZA 4MA1B 3U7YH 3EOBA 1BZQK 1F90L 2P8MA 4MA7H 2VR9A 5I8EB 1MUJA 4NPYA 3DSFH 3CFDB 3HC0A 2VZOA 1JK8A 3LH2H 3T3PE 3TBSB 4NSKA 4Q9RH 5DO2C 5E6IC 3MCLH 1JHLL 3U36B 3UBXG 4RGNE 4GAGL 2W59A 1ZHNB 5D1ZC 3ZTNH 2YMXL 4UTBL 1UM6H 1OD9A 3IDYB 1JPTL 1UJ3A 4NP4L 3HAEB 3I85A 2MFNA 4F7EB 4QTIH 4QKXB 4WV1A 4I18A 4GG6A 1RY7B 4JDZB 3N85H 4GKZA 1XT5A 4JFQA 2C4XA 3ALXA 4KK6D 4YJZL 2AJSL 3MMEA 1YPZE 4GRLD 4ZTPL 1LWRA 5J56B 3KYOA 3L7FB 1BIHA 3ZE2E 5C0ND 2M2DA 3E3QC 1R5WA 1Z2KA 1RZJL 4AENB 2VTFA 4LSQL 4ZDHA 5DFVD 1CD1A 5E7BA 4X6FA 1ZT4A 4U31A 2BVQA 5CJXA 1PEWA 1OP3K 5J0BA 2FBOJ 3MV9B 3RWIA 5ESVA 1J12A 5AZEL 1MVFA 3GSNL 3QUXA 1DL7L 1JWUB 2HT4C 4MNQD 5E5RB 1VERA 2D03L 5D7LD 2Q8BH 4MJ2A 5I19L 4Z76B 5IB5B 5AYUL 1CK0L 3ZKMC 4YXLH 3B9KD 1S9WB 1D9KD 3LN5A 4UT9L 3J7HA 4M5ZL 5DS8B 5E2VH 4P23C 5D7IF 4HZLA 4ZAKA 2NY0D 5DF0A 2OL3L 3UTTB 3L5HA 2P7TA 4U6VL 5JTWA 2DD8L 4QRUB 3KYKL 3LV3B 4MSWB 1S7QB 1CR9L 4PJGF 2CRMA 3D39A 4P5TD 3DHMA 5T3XE 3ZE0E 1ZLVH 1DLFH 2YPLB 4M5YH 1G1YA 4U1SA 3L3HA 3GKWH 3H7BB 3ZDZE 3BPCB 1EMTH 2AK4B 1T80A 1LO5A 3C9NA 4JFFD 4R2GB 5C0JA 3T08A 3F6IA 4M00A 5T33L 5DRZB 2Y36L 2X44D 4LBEB 5LKNA 5FM5O 1BFSA 3QWQB 3DV6A 4HX1B 4JFEA 3C5SB 4U1KA 5I76B 4ZUSA 5GGRA 4ODXB 5EU5B 5DJ2A 1UADC 1VACB 3KLSA 2PO6B 4XBPB 5CHNB 1F2XK 3W5MA 5MI0B 4WY7L 2EE6A 2VDKL 2G2RA 2GHWB 4ORGA 1HH6A 4NC1E 2AGJL 1VFOA 2X4QA 4I48A 5D6DC 2XXCB 4YWGH 3IU4L 4U1IA 4JHAL 4P2QD 1IM3A 5HHQA 2BY2A 1RZIA 3VFMA 1RSFA 2X4NB 3MRMB 5I8KH 1GGIH 3MV7A 1EO8H 1KLGB 1E6JL 1GGCL 4N8PA 5HYSG 5KJRH 1NCCL 3OAUL 4O4YL 1CU4H 4KC3B 5C07E 2OX5A 3H9HB 2E7BA 2QEJA 2LVCA 3OG4B 4LCWD 2NY4C 1B2WH 4PB0L 3VXPB 3EFDL 5HGBB 1J86A 2VOTA 2OZ4L 3MJ9H 4PTTB 3PL6D 4EDWH 1E4WH 2PW2A 1TQBC 2BNUA 2CMRH 4UUJB 1CD8A 5KG9B 5KS9E 1DE4B 5F89A 1SMOA 5TQ0H 3IFOB 2I5YL 2R4RH 3HR5B 3QPXH 3NIFF 4HSQA 1OW0C 5JHDE 3RUGA 4AQOA 1JPSH 2ARJA 1J1XH 1FLTX 1T66C 4PRIB 4B41A 4PD4K 5CEXA 4PJ5A 2BSRA 3VW3H 4LLYB 1KNOA 1L7IL 3PDOA 1CVRA 4E9LA 2XPGA 5H94B 3T8XB 1JHTA 4IIQB 3QEHA 1AE6H 3AREC 5GS2D 3MUJA 1Q9WB 4M8VA 3I6LD 3REWA 4JO3H 4UQ2A 3GJFH 5FO9A 4YHMH 4A2MA 4LARH 4YK4C 3OKOA 5GGTL 4DZBA 2FX8L 1KIQB 3EOTL 1VKXB 5E5MB 1TITA 1AD0B 3P73B 3T0BA 2Q8AH 4OM0L 4GQ9L 5KVGH 2VXQH 4MQSB 2OMBA 15C8H 4RGNC 5GS1A 1AGBB 3GIVB 1XF2B 2YBRB 4OI8A 4DCQA 3CVHL 4X9HA 3K4AA 1DJSA 4WFGE 4GW4B 4MB4A 2VZ1A 1MH5A 3ARDB 5FB8A 3S88L 1DBAH 2AW2A 4WFHE 2J4WH 4F7TB 2A73B 2JJSA 4EBQL 3MNWB 2MNUA 2AXGA 1JPFB 1U2HA 3A67L 4RNRB 4RRPA 5MHSE 3VXRE 2DTML 3QDGE 5BXFA 1K6QL 1QR1A 3CFIC 1Q94A 1U8HA 3QUKA 5ALCL 3TYFB 4TNWF 4Y16D 3BO8A 5ALBL 1FNGB 3OPZL 4LKXB 4XVUD 1G7QA 4POZC 1GZPB 4Y4HA 3ES6A 5J7CC 1HOCA 1FFPA 5IROA 3HNTH 5INDA 4S1DC 1KIRA 1U8QA 1KTDB 4HJGA 5JR1L 4EQ2A 1T4KB 3FTGA 2R2CA 4R4ND 1PSKL 3W0WD 1YC7A 2D7TH 4XAKE 3DUSB 1T7YA 4F7MB 3V8OA 3V52H 3O41B 3FO9B 3VA6A 3MNVB 1AXTH 3QNZB 3VRJA 4MAYA 1JNLH 1DSFL 4AK1A 1HDMB 1V7NH 1WFUA 3RY6C 5E08H 2XTJD 2VLLB 3QHZL 2YC1A 4F33A 3C08H 3P2TA 2FD6H 2H2PC 4JRXE 1C08B 1IT9H 5K9JL 2X4SB 4QHLB 5E6ID 3BW9B 1QSFB 5JUEH 3CJJA 4MVBC 4OZGA 3FHAA 2BVTA 2XI9A 3V7AE 5D1ZD 4YDVB 4WUUB 2CKBA 4L5FL 3MYJA 1U8PA 2H26A 2DI7A 4GG6F 2FIKA 3BH8A 3HCVA 1T2QH 3HNSL 2DM3A 2PO6C 5C0FB 3PABB 4MCYB 4JRXB 1K2DA 3BVNB 1YDPB 3KYMB 4O58H 4RZCB 4J8RB 3OR6B 3HS0B 1MCRA 3EYVB 1QFHA 3DRTB 3QCVH 1J05B 4PV8B 4Z7UF 2CKBL 5H8DA 3N06B 1UGNA 5HYIA 5MEND 4Q6IB 4DGVL 5HHOB 1K4CA 3VDCA 2GT9A 4XAWH 4G3YH 1EBPA 3HZVB 4GKNA 2VDRH 1J1OH 2YKLL 5I1AB 2WWKT 4XHQA 4PYGA 5CGMA 4N9GB 5DDHB 5I1DA 3QO0A 1BFOB 3QR2A 4W4OC 2KL6A 3IU3B 3P11L 4HG4K 2YRZA 1YNLH 2VAAA 3B3IA 5IV2B 3WDHA 3R8BB 2HRPL 4JPVL 3QUYB 4ETYA 1VCAA 1YPZA 4UB0L 4WW1B 2B1HH 4CVZA 4NQCE 2HT4D 3HC3L 2AJZA 1OWWA 4YLQT 3ZKMD 4JY6A 2H8PB 4XNQB 3QXVA 1HNGA 3IXAB 4KRMB 5LGHH 4DGIH 3QUMA 4N0FB 4RMVA 2EDXA 1A7BA 4P23D 4HKZB 5JOPE 3BRFA 1CICA 1KLUB 3N9GL 3EYQD 2PYEE 2VE6A 3GM8A 3SOBL 3IFNL 3D69A 3ROLA 1BJ8A 3TBTA 4IIQC 4G8FB 4RISH 2BOCB 1JI1A 1BHGA 1Q9LA 4Z7QF 2IQ9H 3QUML 1VADB 5KANI 5FHAL 3MRPB 3BP4B 1T89C 5AG8A 1HHJA 32C2B 2WSKA 5F7MC 3RIFK 3W9DA 4TPRL 2VH5H 1WWWX 5IB1B 1R3IL 1NAMA 2X4UA 4M1GH 4QGYA 1CCZA 4IMLB 4EIZC 3EO0A 5JORA 4RBPK 3Q5OA 1OB1B 4ZFGH 3FFCD 3C87A 4UILL 3X3FH 3NABH 4JM2A 1E28A 3X3GH 2F19H 3ARDC 2VISB 1QFPA 3DI2B 4ZO8A 1FJ1B 3CPLB 1RURH 1XCQA 1KYOK 1QFWI 2ADFH 5D1XA 3IDMA 3DUUB 3K2UL 1A4KB 1E4KA 5IVZA 3STLB 4CN1A 1SEQL 1YEDB 5E1HB 2D0HA 5GRYA 3R1GH 3WJJC 4KJQC 2BXYA 4FQLL 1GGYA 5I1LA 4HAGA 4BFEA 3CLFL 4JLRB 4KUZL 3FQNB 5EO1B 1T83C 3RDTB 4UU9A 3SGEH 5J11B 3V5HB 2R1XB 4IOIB 4X5WA 1IMHC 1X7QB 2X10A 4Q74A 2HFGH 2V17L 1N7ML 3ARBB 4Z5RB 3UEZA 1FYHB 1A6ZB 1S8DA 3CUPB 3QZWB 2XZQL 2NY4D 1P69B 4IDJH 5L6YH 2XN9E 3MRRB 1OP5K 4YHNB 4AH2B 2GJ6B 4DGYL 3E8UH 1XGQA 2H1PL 4AT6B 4PJDB 4XC3L 4FN0A 4Y7MA 3E6HA 1IJ9A 2VLRE 1FL6B 5EIVA 4M7ZB 1KOAA 3QH3A 3GSVB 3IFPB 3WEXB 1T66D 1PJ9A 4TULH 1BREA 5C0BE 2AJUL 1WBZA 4LHUG 4LP5A 4DEPB 3SDXE 2OTPA 4P5MB 3ARED 2YPVL 3OR7A 4X6DE 4M7LL 5AUMB 5ERWA 3RWCA 1IC7L 4LPYA 4OD2A 1MJ7L 3IF1B 4IBLT 5KS9A 4I0PA 3QIBC 3OTTA 4WGWB 4GKOA 1IEBB 3FT3B 4PGCA 3TH4T 2V7NA 4RGND 3S4SA 2PR4L 4XCNB 2Y06L 5EOQL 2R29H 5EA0H 4HKXA 4M6ML 4UIKH 1JGLH 5BMFH 2P42B 3FOLA 1NEZA 5J9PA 4FZEH 3JV5A 1AJ7L 3ARSA 5IMLA 3L3DA 4A6YB 1QO3B 4HS8H 1ZTXL 2A6JB 2IFFL 3JXAA 4KZEH 1G7MA 2W0PA 1EHNA 5E6ZA 4NRYB 4K8RH 2VXVL 4CVUA 2EIZA 2YD8A 2FCBA 2IQAB 4JVUA 3QUYC 3MV9D 5DUBA 5GPRA 4KJPC 4AEHL 1BJ1J 1L0YA 4LDOB 1NAKL 3QQ4B 1BFVH 4POZD 4L4TE 3MLTB 5MEOB 4B0MM 2UZIL 4C4KO 3WD5L 4S1DD 3VDAA 2CSPA 5GS3A 1YEFL 3QQNA 4RAUA 1FNEB 1BJMA 3QI9C 4LCIL 3S96B 1ZGLB 2OTUA 4ETQB 4FOMA 2R4SL 4MJ5A 3VG9B 4GXUM 2ICWJ 1DEDA 1Z9MA 3OAYK 3QJHB 3PGCB 3BPNB 4S1QH 4Y2DA 5KAQG 1OGAA 5K9OB 5ID1A 4HUXB 2CK2A 1C7SA 5I1HL 3DROA 2YPLD 3UC0H 3C2AL 3PQYB 1BWMA 2CK0H 4GRWH 2H2PD 4NO0A 2H6PA 4TRPH 5GIRB 4OZGF 1CLYL 3UTQA 4HIHA 3NGBB 2OP4H 4R8WH 5F9OH 5LXGL 1N2RA 2Z4QA 2W91A 1YC8A 3EUUA 4MVBD 3G5ZA 3UTSA 1CFSB 3DGCR 3ZLQC 2XNAB 4RAVA 3ESUF 5I1KH 1RU9H 2J6EH 5T3XD 1RK1A 2P5WE 2PO6D 1L6ZA 3M8OH 3IETA 3GMNA 4IHOB 2NW3A 3MOAH 3WNNA 2DIJA 2WK2A 1T7ZA 4UT6L 1QLRB 4NC2B 4DN3H 4NN5C 1I9RL 5JW4N 5F8QC 4HS6A 3BZDA 2E6PA 4HGWA 2HWZH 5C3LD 1A47A 4F7PA 3RDTC 1NKOA 1B0RA 1KCRH 2XY1A 4MJIB 5D7JB 5J11C 4XB8A 2VAJA 3EHBC 3MREB 4X6CE 2W9DL 4UV4L 1KJ3H 3P0VL 3ARBC 5DVKA 4CN6A 1FP5A 1YPZF 5FO7B 1MEXL 4PJEB 5BVPL 4R4BB 1XGRB 4BQ8A 3KS0J 5KSUA 4WRLA 1A7NL 5SX5H 4H1LB 1CTNA 2EDDA 2EE3A 1DQQB 4YGVA 1UWGH 3QCUL 3DOSA 1L0QA 4KJYB 4OLYH 4YHKL 2OJEB 5J8OA 3INUH 1SM3H 5J3HC 4X6CB 4U33A 1SJEB 4XP9H 2AJYH 5C6TL 4M7ZC 1IC5H 2ZCLH 4NWTH 3D87B 3FQWA 1MLCA 3FQRB 5GGQL 1SY6H 4PRID 4JRYA 5ETUA 3X17A 2HG5B 4DEPC 3W5NA 4ODSH 3S7GA 5L9DL 2ZWLT 3O11B 2OSLB 1TQCC 3AM8C 5DJXB 1AGFA 5HPOA 1JPST 5EU3A 1WSST 2YN3A 4K7PY 4LKCA 5D8JL 1GSMA 4R0LC 5HBBA 5EUKB 2R9HC 2CRYA 4QY8A 2B20A 3QHFL 4PGDB 2E9JA 4P2RA 3NA9H 4JM2F 4QF1A 3HPLB 2FGWH 4NKMB 2OBGA 4NBYB 3B9DA 5I8CB 3QWRD 1J88A 3ARDD 3D85A 5C0EB 3U0PA 4F8TA 3SJVE 5H35B 1Z0NA 3ZE0F 1HCFX 3NOIA 3RWEA 1YEKL 5CIPH 5F88A 1CFVH 2DQTH 4ODTL 3MXVL 3BWUC 3BQUB 1FVEB 1AP2B 2AK1H 5JDJA 1PYWA 1SJXA 3V0WH 2CUIA 4PJBB 2DLFH 2BMKA 4I2XE 3GJEA 1F02I 1UB5A 4KJQD 1EXUA 2X4TA 4HWBH 4WFHD 2XQBH 4K7PH 1E4XI 2FRGP 4CNIA 4QGTA 4HPYL 4L4VE 1CVSC 1QSEE 2CXKA 2X05A 2EKSA 2AXFA 4FQHA 3TO4A 4Y0GA 3P3YA 3VXRD 3QDGD 1C5BH 5EZOH 3FQTA 3O9WA 1JZ4A 1A7PH 3MR9A 4I2XB 2VC2L 4H0GA 3SKOA 3D25B 2ZSVB 2C3VA 4N9OB 1PEZA 3VG9C 3C6LB 4LL9A 2P5EB 3BZ4B 4L4VB 3WFHB 1R3JB 3GSUB 5IEHA 1HI6B 1QQDA 4OQTL 1UWXK 3TM6A 1ZOXA 4L1DA 3KJ6L 4GRWB 4R7NA 5J57B 2Y07L 4OCMC 4JANB 4Z6AT 2HH0H 2EE2A 4HFUL 4XAKD 3NGBC 1FZJA 1A6UL 3C8HA 4QXGL 1FC1A 4HUVA 4G43B 3K7UA 3QEUB 4M4PA 5HJ3B 2XN9A 2HT2C 3ZYOA 1KXVC 1VDGA 3REVB 2YEZA 5FK9B 5KS9F 5MEQB 3FO0L 2VXSL 4JPWL 2X7LA 4JRXD 4C56B 3TA3B 2COQA 2DYPA 3QIBD 4YHPA 4O2CA 1IAIH 4KDTA 1AIFA 1P7KA 5D9SB 5J1AB 1KELL 1RFDL 3F7YA 4MXVF 1G7JB 5DURB 4ACPA 2AP2A 5DMGC 2ORBL 2UVFA 3CSPA 1KJVA 4QO1A 2HA1A 3SDDC 4V1DE 5HHOD 1IQDA 4NKDA 4OUUA 4YHZH 5D7JC 2KQNA 3QRGH 1XF3A 1D5BB 3IDNB 2EDEA 4XNMB 5CEYB 3BGFB 4NCC2 3VFTA 5A2IH 4P9ML 3DX7B 1D5XB 1FRGH 3VXTB 1EGJH 4QXTB 3CCHA 3QUYD 5TFSH 5M95B 4NQTA 5DZNA 1FVDB 4KJPD 4JFYB 1X9QA 3KGRA 1S7VB 2PXYA 2DMCA 2R56H 3LEVL 3O0RL 3DVNA 1A2YA 1N4XL 5KN5B 2A74B 5F3BB 4NQSA 1G6RL 1VHPA 4BFIB 2EDBA 5CLTA 1ZHBA 3AU1A 3ZKQD 4GMSH 3EKCA 4N0CC 3U4BH 5HPMB 5F7FA 3QI9D 3ZZ1A 5D72L 3U0WL 2WQRA 3WKML 4NQCD 1N8ZA 2DQCL 4YPGB 2QTEA 2R0LH 2VDNL 3SDAB 3H9SA 2F15A 1T22A 5E2WL 4XI5C 4L4TA 3P9MB 2WANA 1TJGH 1A4JA 3JV6B 5EBMB 1W2KT 1EEYB 1YN6B 1I7ZA 2IH3A 2PYED 3LEYL 1QBML 5F71A 1LEKA 4Z0BH 3RAJL 4NHUB 4U3CA 1N3NB 5EC1A 4BELD 1WJ3A 1IAOA 1NGXA 1EX0A 4HC1A 5E94A 5CIPB 3I2CL 1FG2A 3K4ZA 5DMYA 5F7DB 6FABH 1MHHB 4MDJA 4OT1H 2ADIB 3BQUC 2FNBA 3O8XA 1CL7I 3U30C 1VFAA 3RA7H 3OKKB 1FV1B 1ZVSA 4OF0A 4HC1L 1XR9A 3EIFA 2A6KB 4FQIL 2ZCKH 3L5WA 3OXRA 4PJ9B 4IOSD 5L88H 4HT1L 3A0OA 1S5HB 4RCAA 4W68A 2VWEE 4OD3L 3RDTD 4QRQB 1WZMA 4JFOB 1ODAA 4W70A 1MRFH 4PB9H 4D8PB 3EHBD 1A3RL 3JZ7A 1D5ZA 1U6AL 1WAAE 1ORQB 3ARXA 3ARBD 1F8TH 1YECL 1IRAY 2H3NB 4LFHD 4N90E 1ZSDB 4M6NH 3B5HA 4CJ0A 1P4LA 4I8DA 4X7TB 4PLNC 3C6LC 4U6HA 4WI4A 4CW1A 4LSSL 3QQ3B 2GJ6D 1A6TA 1T7XA 4PP2A 4N5UA 3O6FB 4FZ8H 5E9DE 1QFUL 5C0AE 2XWJB 4UQ3A 3GGWA 5J3HD 2W0LA 1FIEA 4P59H 4BM7A 4ELKA 2AJ3B 5IKCB 2WMPA 5JQ6H 3KPPA 4L3EE 1D5MA 5D6CB 1CBVL 2EE9A 4HIIA 3O45B 2QHLA 3CH1B 4J12A 3MOBL 5TQ2L 3RWJB 3RI5K 5HHNA 4ZUVA 5AYQA 1D9KA 4OCYH 2RFXA 3I6GB 1EFQA 2DJSA 3U1SL 5FKAA 2VLRD 1P7QB 2JCCB 3D18A 3RVTC 3TEUA 1AD9A 5L2KB 2R0WH 3JWOH 1Z3GL 3TA3C 4L3EB 1MREH 1T2JA 1I1RA 1DUYA 3RNQA 3RJDA 1W72A 2WWKO 3NAAL 4GOSA 5C0BD 1KG0B 3Q0HA 4XMPH 4EDXB 5FFLA 2AKRA 3EFFB 4P5TA 4GLRI 1X4ZA 3G6DH 4TN9A 3MLXH 1A0QH 3FT4B 3P30L 5EZJB 3DV4A 1BGXL 3GFUA 5KW9L 1CD0A 2BNQB 2A1WH 4LRNH 3BGFC 1W72L 3UTPD 1PZ5B 5EOTB 1GJIA 4O51B 4D0DB 2VQ1B 4NDMA 1CN4A 3MBEB 3GSRA 1KCUL 1AO7E 2NY5C 4JAMB 2X1PA 1T0PB 3OAZK 5ICZA 3H6JA 2WINB 1MFEH 3MLRH 3MLZH 3VXMA 5ISZB 4CGTA 5DJ8A 2P8LA 2VQUA 2PCPA 5BW7C 3GMLB 1OM3L 4NJAH 3SDCB 4XC1L 4EVNB 2F5AL 4G80A 3I75B 1V8HA 3ZDXE 4FHBD 5TE4H 5BZDB 5CGTA 1DZBA 3GZKA 1VPOL 2UZXB 3P4OA 1NBVH 3QDHA 5D2NA 5DEFB 4JHBA 3SO3C 4JJ5A 1UZ6F 2C9AA 3Q48A 1F3RB 1DVFA 2EH7H 4JFPB 3RIFF 1YMHA 3R0MA 1CGTA 3NZ8A 1PKQA 4PJ7B 5A2KH 3QIUA 2VZTA 2PF6A 1TZIA 3LKPB 4PGZA 3PL6A 5CJBA 3PIQA 1JZ3A 4TQEL 4QRRB 3FCTB 4BZ1L 4ZTOH 2I9TB 1AQDA 1I8KB 3O3BB 4KVNH 5E00A 2HT2D 1I7UB 4FQCL 3MUHL 3LRSA 2CIIA 2NMSA 4Y5VC 4YHOH 3HN3A 1YEEH 1DQJB 5D70L 4GAYA 4ELME 2V6HA 3P77B 1ZV5A 5HGAA 3MV8E 3WIIL 5CBEA 1HH9A 3Q1SL 3BPLB 1BX2B 5M94B 5DHYB 4BFBD 2Q76A 4OI7A 4RGOH 2GQHA 4NNYA 1G1CA 1WEJL 4OLZL 2DWDA 5DMGD 4ZD3H 1B6DA 2CO7B 3SDXF 4PJ9C 1CFNA 3O3EB 5JXAH 3SDDD 4X6DF 3VMPA 3DVGA 3GMPB 4KV5E 1EFXA 5IVXA 2P5WD 4KTYA 4LNRB 4H88L 1FZOB 1M7IA 3BHBA 5DRWA 5D7JD 4H25A 3DUHA 4ODVL 4M7KH 4G5ZH 3VI4E 4Z7VE 3L9RA 4EN3A 4YPJA 2WZPD 3HMXA 5IM7B 3FQUA 5KVEH 1IBGH 1HXMB 2FJGB 4LSPH 1S7UA 4WJ5B 1NANH 2DI8A 3ARGA 2XRAL 3S34H 5IBUB 4UNVA 3TBVB 2R69L 4P5KA 2VWEC 3O6FC 1T0MA 4V1DA 2CJUL 5IFAH 3ULVC 1M1SA 3MBXH 2HLAB 4PRNB 1PGRB 4UT7L 2I9LA 4BYHA 3OWEA 5IWLC 3L95B 1HWHB 4JCMA 2O93L 4G8GB 5GSVA 1A6WH 4N0CD 5C1MB 4N5EC 2VDMH 1U8IA 4AIZA 3KPRE 4XP1H 5EIQA 2VB5A 1J11A 2W0FB 4FABH 5ICYB 3IGAA 2H41A 3ZHKA 4HZAA 1I7TA 3BUTA 4FA8A 4XI5D 4OLWL 2H45A 4M4RA 4KKNA 3GMMB 4QOKB 4LAQL 5T1MB 4X98A 5C6PB 3MLWH 2UWEA 4B7IA 4CVXA 1KPVA 1JWSA 1P5VA 5BV7C 4LLDA 5DSCB 2P1YA 4FQQB 5C0CE 3GSOB 3TO2B 1M05A 4KGJA 1JGDA 4G6JL 3BUYB 1HINH 3M1BA 3BKCL 2ADGA 4BSJA 4PJFB 2F54E 1MCOH 2A9NH 2N7BA 3V4VH 1KEGL 3VFRA 1U3HC 4HK0B 4I9WE 2OYPA 4YEEA 1PG7W 3BQUD 1HEZB 1NLBL 2E3VA 4GW5B 4KQ4H 3TNNB 4X83A 4RIRB 3MBEC 3IDIB 1FVCA 3EOYG 3V0VB 3VFGH 3Q6FB 1HSBB 5F7LB 5T1DH 5I1GH 1OY3B 1QHPA 4WUKL 1OAZH 3SJVD 3DBXB 1MJUH 1DBJH 4MWFA 4EIGB 1JRHH 1YZZA 3D2UA 2V2TA 4WU7B 3P4MB 1H3GA 1DQDH 1AHWB 3SDCC 3FMGL 3LS5L 4KZDL 3B9EA 2FH6A 1IKNC 2FH8A 3WSQH 1T1YA 1TVHA 4E5XA 3MODL 4OFYA 4Y1AA 3C6LD 3HHRB 4X7SH 3KJ4B 3GSXA 5AAWA 1S9VA 2P5ED 1N0LA 4L4VD 1S7RB 2DQDL 2XZCH 5C8JA 1QSED 3KWWA 3TP4A 4XCFL 4PJIB 5CSZA 5D96B 3TT3H 1KGCD 2CGRL 4RDQF 4FG6C 2CIKA 1ZLSH 5MERA 5J6GA 1A14L 1C16B 2NXYC 1WAAA 1UACH 1FPTL 5D1QA 4P46A 4LSUL 5F7EH 5GZOC 5HGDA 3KYNB 3HPJB 4X8JA 2VLJA 3B2UC 2CUHA 5GJSH 1UYWH 5C6WH 3ORJA 3VFVA 2VDPL 5E9DA 2BC4A 5C0AA 3RVTD 3TBYA 4FQXA 1WVZA 4OLXH 4L9LA 3TA3D 2VXUL 4JGUA 4K9EC 1FO0H 3MRFB 3BPLC 1BVKA 1RVFH 3I6KA 3RWFB 1GGBL 5DQDL 3L6FA 3FT2B 5DURD 2X42A 5CD3B 1X4YA 1CXEA 2JJVA 1PLGL 1ZLVK 3MRGA 3NCJH 3T0EE 3L7EB 4GSDL 4X5LA 3S6CA 5A2JH 3AB0B 3G9AB 4LSVH 3MCG1 5LQBH 1YEGL 4JO1L 2EYSA 1NBYA 4F9LC 3TFKC 1VB9A 4XPTL 5DLMH 3CZFB 2EEBA 3WNKA 5BV7L 4PLJC 5IMMA 1R24A 1YEJH 4WU5B 1B4JH 4U3HA 5EUOA 1Z5LB 2E6QA 2FATH 5DC9B 4PD4J 4F15B 2GKIA 1EIBA 2NX5E 1J0YA 1IFHH 1I3VA 1KJ2H 3PWJA 1I9EA 2Q7NA 3KNBA 4KGLA 3S35H 3QUZB 4H8WH 4PUBL 5J13B 3VWJB 3PGFL 4OLUL 4OZHB 5IK3B 3WFZA 3WFCL 3MFFA 4F8QA 4G7VH 4LIQE 5HHXL 2FO4B 1ZVYA 5LAXA 1LNUB 4DN4L 5DMKB 4U1JA 3FO1B 5DJDB 2NX5B 1ZLWH 3VFUB 4JGMA 5E2UH 4WO4C 3CSBA 3SQBA 2WUCH 4MD4A 2WIIB 4FNLH 4YDKH 3UPRB 1UFUA 4XCYA 1FL3B 1BBJB 1OP9A 1MHEB 4I3RL 2VDQH 1C5CH 2YD4A 2CH8A 2V5RA 5I8EA 3ARFB 3F7QA 4F57L 7FABL 1RZKL 4YDLB 3PUCA 2J7LA 4JHWL 5A40E 4EUPB 4Q9BA 2FYYB 2P47B 5DD5H 2EYTB 3U36A 5E0QA 5IBLC 5FHBL 3OKLA 3QA3B 1ZHNA 1OWRM 4PGEA 3GJFK 3MX0A 4QYOB 1FAKT 3U46A 5IVXF 2F9BT 4J3OC 4PJ9D 3HAEA 1NGWB 3O2VL 5F1NA 3P4NB 4JDZA 3PWPE 4HLZG 2MCPL 5DRXB 2Y7QB 5KVFL 4K9EL 4F9PC 2IPTH 5D2LE 5GS0C 4TTGA 1V3JA 4I3SH 4PG2C 1DBBH 4DW2H 3GBML 1G9MC 4NBZB 2Q3ZA 4IRJB 3OHXA 4KDVA 2IMMA 3S5LA 1OT1A 3BP7B 3ZHDA 4AENA 2DQUH 4ERSH 5GRWA 3O6FD 1XEDA 5IUSA 4WHTB 3ULVD 1EAJA 5T1KA 2APTA 3OB0H 4NKIH 3BKML 2OTWA 4N90D 3MV9A 1F3JB 4HH9B 3SKUD 4D9QE 1OAQH 3RZCB 2VJXA 1JWUA 4N5ED 1JPGB 3QEQB 4QT5B 4UAOB 4TSAH 5ITFB 1NBZB 3GUTA 1OSZA 5ANMB 3ILPB 4PBVC 1IC1A 5IB5A 1QKZL 2AJXH 3MACL 5FYJU 3UYRH 3HRPA 5DS8A 2BNRB 1ADQL 1R5VB 5JA9A 4ZFOL 4KQ3L 1J1PL 1FO0B 5GJTL 1FGNH 2ZG3A 1CLZH 2J1KA 3P0YL 1BQLH 4L3ED 3UTTA 4X7EC 1ZWIB 5AWNH 4LAJH 2GTZB 3HRZA 4MSWA 1JZ6A 1S7QA 2DQHL 1HNFA 4LNVA 5DMIH 1LO4L 3PHQB 3T4YB 1K9TA 2E9IA 3B2VH 2YPLA 3C09B 3H7BA 3BPCA 1MQKH 2AK4A 3GSWB 1H15B 3QNYB 1U3HD 5E70A 5I73B 3KXFB 2E9WA 4HS3A 3WN5B 3QO1B 4JG1L 3IFLH 1NFDE 4OCWH 5SX4I 5TE7H 1J8HA 4BSWB 3OXSA 5I76A 3F65A 4P9HH 4R26L 3JWDC 1OARL 3MBED 1D5IL 1I1AA 4ODXA 4YDJA 5I9QB 3EJZD 2IG2H 3AUVA 3CXDH 2HVKB 4XBPA 1JGVL 4OIIL 1RUPH 2ID5A 1T04B 3BXNB 1JHKL 5JHLH 5ISZD 4F15C 1KJ2B 5E8DL 1MAML 3SDCD 4JKKA 5CP3A 4MZ3A 4HF5H 1OD7A 2YD2A 3QXAB 5FA3B 5JIIA 1YY9D 5IIEB 4X5XB 3VFSB 2E6JA 4APQB 1AO7D 4HKJB 2X4NA 2APBA 3MRMA 3GO1L 1I3RB 1BOYA 1QLEL 1GAFL 4NQEE 1LP9A 1G0DA 5I1EH 2JIXB 1LK2B 3BEVA 1FNSL 4NOFA 4XVTH 2FGZA 1WAAF 35C8H 3H9HA 4M43L 3MA9L 4WHYG 3SN6N 4FG6D 4TTDC 1RPQA 2NXYD 3ZE1E 3D1MC 3VXPA 3PWVB 4PTTA 5HGBA 1G9ML 2QQLH 5FGBA 5GZOD 1KYOJ 2F8VA 1IM9D 3SKMA 4M6OL 2V9RA 4UUJA 1YQVL 3ARFC 1DE4A 3IFOA 4KHXH 3HR5A 1GZQB 1Q38A 4XNYH 5CZXC 3KLDA 4PRIA 3U7YL 3H0TB 3OMZA 4LLYA 1TTGA 1HZHH 1SBSL 1LO2H 1OLZA 4U6TA 3T8XA 4KVCH 4JDVB 5GRJL 1N5AB 3LH2L 1Q9WA 4Q9RL 3UJTH 3VH8B 4K7FB 3MCLL 4S10A 2Y5TB 1YYLL 1VKXA 3LRHA 5E5MA 1AD0A 1MWAH 1CT8A 1EEZB 1YEHH 3P73A 4DUVA 4QHNB 1DUZA 1WBXB 5DD0H 1LDSA 2DB8A 4QLRA 3MV8D 3ZTNL 3ARVA 3GIVA 3GB7B 1R5IB 1XF2A 3TFKD 1OAKH 4GW4A 2X1XR 4QTIL 3X12B 1KN2H 3HZKB 1U8OB 4UOW1 3N85L 5EUOF 3K46A 4M48H 4PLJD 4F7TA 2A73A 2BCKB 4NM8H 5HYJB 3PDGA 3T65A 3SPVA 2NZ9C 2B5IB 3T0EA 4RNRA 2HKHH 3FB6A 3TCXA 1Z6JT 4PS4H 3OKMB 2E27H 1I85C 2FJHB 3UZVB 4OCLC 3LS4H 2XFXB 4YXKH 4NZUH 1VEOA 4FQ1H 3TYFA 4F3FB 1FLRH 4G8GD 1IGMH 1FNGA 3RZCC 4LKXA 4N0UE 4Z77B 4UAOC 3JWDL 1FGVH 3RI5F 2NTFA 2A6IA 1GZPA 3IDXH 4P49A 5DK0B 3PWUA 2IANE 4PJAB 1T4KA 1A7QH 5EH1A 1MCPH 3EBAA 4KKAD 2EIBA 4QOKD 4WO4D 5A43C 2BVOA 3DUSA 4F7MA 3JV0A 3O41A 3FO9A 1I1FA 2ITCA 3KPRD 3SGEI 3Q3GB 2R1YB 4NFBA 3MLVL 4BQ6A 1S5IH 5C08E 4K94H 1UA6H 1PVHA 2CDFB 3FZUC 2J8UE 4G9FE 1DQLH 1HDMA 4X4XB 3U4EB 2VLLA 4NO2B 4JKLA 1GHFH 5JXEC 5T3ZH 3VG0H 4P4KB 2GTWA 1CF8L 1FYTE 4QWWC 2MSPA 1C08A 2EXWC 4QHLA 1QNZL 3EZJB 3BW9A 1QSFA 4O2EA 5IBLD 2B7DT 1LQSR 3UX9B 4PJHE 5C0CD 5C08B 4YDVA 1H5BB 2HMIC 1UWEH 3GKWL 4WUUA 1EMTL 4MB5A 3JTSA 1F6FB 3VGGA 3PABA 4MCYA 1IZKA 2V2XB 3BVNA 4M03A 1YDPA 3OKEA 1XF5A 4GS7B 4F58L 3KYMA 1I7RB 3DX6B 4RZCA 3OR6A 4X4ME 3H42L 3HS0A 2W9EH 3O3UN 3EYVA 3I50L 1J05A 4PV8A 2YWYA 3HC4H 5GS0D 4PJHB 2AV1B 2UY7A 4DFHA 3Q2CA 4NUJB 4Q6IA 4APQC 4U0RC 5HHOA 4AEIH 4JKMA 4KV5F 3QFJE 3HZVA 4J4PA 5CKGA 5I1AA 3ZT7A 4N9GA 1CGSH 3LOWA 5EORH 4MS8C 1QVOB 4Z7VF 4ZUUA 4YWGL 5CD5C 5IV2A 3WFDL 1RHFA 5ILTL 3MJ9A 3RTQB 3VRIA 4Q9QH 5I8KL 2C5DC 4U1LB 1TNNA 3Q5TA 4Y19B 1OAXL 1U9KA 1IGFL 4LCYB 2WUBH 4XNUH 1CU4L 1UM4L 2VR4A 3LIZL 2H8PA 5ELIA 4XNQA 1QRNB 4OF7A 4NZRH 5EFIB 1B2WL 3O4LE 4DFIA 3BX7C 4N0FA 4JO4H 4GAFB 4XPBH 1KENH 3CGTA 4OCXH 2B0SH 2JELL 4OF6A 1JF6A 1KLUA 4R90H 2CMRL 5T1LB 3T2NH 2MPAH 1I75A 4NUGL 1MY7A 2D4DA 2R4RL 3QPXL 4ZNEE 2NQCA 4GAJH 1FIGL 4U1MB 4RRPG 1VADA 1MWAB 5EB9A 2FEEL 3LKRB 2A6DB 3BP4A 2ZOKB 4DKFH 4J3TA 5E2TH 1WBYB 1JGEA 4KI5C 1K8DB 4HGKC 4JO3L 5SWZE 3FQXB 4O02L 1QLFA 3RU8H 4J23A 1NC2B 4D0BA 1DN0B 4UDUB 1QBLH 3G6JB 2Q8AL 5KVGL 1F58L 4G6MH 1KN4L 1IEAB 1FJ1A 3CPLA 1EH9A 2PTTB 3A6CL 3BRDA 5JW3H 2B5IC 5K93A 5K59E 1MIEH 2AV7B 2EDKA 3BH9B 2AEQL 3DUUA 1TTFA 3KPSE 3OV6A 4Z0XA 3STLA 1DBAL 1YEDA 4X9BA 2J4WL 3QUZD 2QADB 5F1SA 1F11B 3VWJD 4JY5H 2X41A 3MLYL 1OCWH 1IGYA 4JLRA 3S37L 1LP9F 3FQNA 5EO1A 1HKLL 1KB5B 3GHEL 3RDTA 2OM5A 2X40A 3V5HA 2R1XA 4WW2B 5A16A 4QHUA 1X7QA 1ZA6B 4WEBL 4M3KB 1RZGB 5HHPB 2NX5D 3ARBA 4Z5RA 4BSVB 1A6ZA 3PWNB 5SX5K 2D7QA 4NQUA 3VXSA 4O00A 3DETC 4TTDD 3S3PA 3O2DL 4J1UB 4P2OC 5CZVH 3ULSB 3DRQB 5TDPA 2P43B 1RV6X 2VLKB 4JQXC 5FAAA 2GJ6A 5TDNB 1U3JA 4AT6A 1AXSB 4PJDA 4UV7H 5IGXL 1Q8MA 1XGTA 5IR1B 3ARFD 4Y5YC 1MFAH 2HYMA 1UENA 1KCSH 1YJDH 2D7TL 3ILQC 4POUB 4S1SL 2H32H 4P4KC 3HE7B 5CZXD 1AXTL 5IFJB 3IFPA 1ITCA 3WEXA 1SEBB 4XPFL 2O5ZH 3IDGB 1JNLL 3SE3C 5DQJB 3P9LA 2DMKA 3BAEH 1V7NL 2OXGA 4OD1H 5E08L 1IL1B 3GI8H 2R1WB 2YXMA 1H5BC 2XG4A 4MNHB 1TIUA 5FDWB 5JW5B 5AUMA 3ZDYF 1IT9L 1WC7B 3TN0B 1NKRA 2ZKHH 4WNQB 1EUUA 4LHUD 1QFOA 3IF1A 4ODHH 1DFBH 3V6OA 4HIJB 3IKKA 5JUEL 4GS7C 3U7WH 3O3DB 3FT3A 1LK3L 3DVIA 4XCNA 1OAUL 3PWLB 1T2QL 5IG7B 4PRHB 2IADA 4OCSH 5EU7E 1X6LA 5J4MA 4GUPB 1G7PB 1G9NC 4Y2OA 3NA4A 1GC1C 3DO7B 2FEDD 5ADOH 2QQQA 1QO3A 4W6WB 1J0JA 1Q0YL 3BKYL 3PWPD 5LG1A 2UVEA 2NZ9D 4NGHH 3QDJE 1J0ZA 1Q9KA 2L4OA 3JSSA 2V5SA 4NM4H 1U95A 3VWKC 2I26N 4NRYA 4ZO7A 3EOAB 2FX7H 2IQAA 4YXHH 3QG7H 3ZKXB 1A1MB 4LLMA 3WUZA 3AVEA 3RZCD 1OSPL 3L3OB 3QEQD 3RKDC 1MAJA 3QQ4A 3EDKA 5D7SH 2PNDA 1S3KL 2ERJB 5E8EB 4PRBB 2ZJSL 1AKJB 2J5LB 4NN6B 2CDGB 3HI6H 5BS0B 1MCIA 1QA9B 1QHOA 4JO2H 2B1HL 2F74B 1UCBH 2MHAB 5A3IC 2ATKB 4NQDB 5ECJE 3BI9X 1J0IA 3S96A 4D9QD 1I8LC 1A5FH 1ZGLA 4HKBB 1OQOA 4BA8A 5GGUB 4RA3A 2I60H 5LGHL 4L9DA 4DGIL 3QJHA 3L1OH 4MA8L 5FYKU 3FZUD 5K9OA 5I17A 4R96B 4CDHA 3WL9B 3PQYA 3HR6A 1JWMB 5JXED 3C60B 4U1GC 4QWWD 3MGTA 4RISL 2EXWD 1MFBL 3KXFD 4X80H 4QRPB 4XTRC 3MLUH 2IQ9L 3PHSA 1U42A 3BSZH 2MTPA 2P4AB 1CFSA 4NCC1 1ND0B 5JOEA 2HMID 2HJFB 1IGCL 4M1GL 1MCDA 5CILL 1PG7L 4AZ8A 1UZ8B 4ZFGL 2FBJH 4IHOA 2YD5A 3NABL 2WBJB 2BY3A 3X3GL 2F19L 1U91B 1WZ1L 2Z8RA 1QLRA 3LMJL 2DL2A 4KKLC 1XZ0B 4Q7DA 1RURL 3CNKA 5TGBA 3STBA 4FRWA 4YH6A 4CMHC 4APQD 1X5LA 4NZDA 3WFEH 1T0NB 3VJ6B 4MJIA 3NCYP 5BCAA 1INQB 3VFOB 4PRPE 1MELA 3R1GL 4MS8D 4ODUB 5CD5D 5I66B 5FO7A 5D2LF 4KTDL 4PJEA 2C3WA 2XTLA 4M7JH 4H1LA 2XWTB 4DZ8B 4HCRL 1DQQA 3MCKB 3SQOH 3NMEA 3HUJE 4KJYA 5C0GB 4IRZH 4OLVH 4K23H 4NQED 3QFJA 3CMOL 2I27N 1SJEA 5H37H 3S4SG 5DR5H 4CBPA 1FQ9C 2YA2A 2HJKA 5L6YL 1BJ1H 3GSQB 1EV2E 3ULUE 1VSCA 1RD6A 4QXUL 1NEZG 5DXWA 5I8OH 8CGTA 3BPOC 1YEIH 4G8EB 4HWZB 3HUJB 4OUOA 1MFDH 3I3EA 4HMCA 5DJXA 1BF2A 1WT5C 5GHWH 1RIHH 3TN0C 4Q2ZB 1F4WL 1BQHA 2P8PA 2FECL 5F7NC 5JZ7C 4TULL 1KLFA 1P84K 5EUKA 4MA3A 3CX5K 3PP3H 3ZL4H 5KAQF 4KI5D 3KR3L 2JF1A 3HPLA 3MGOA 4NKMA 2ZOLB 3VA2C 5I8CA 2NW2B 3L3JB 1AQKH 4NWUH 1I1YB 3NN8B 1YNTA 4BKLB 4EKXA 5C0EA 3HZYB 5FUCE 2DBJA 5HYJD 4R4FH 3HI5H 4FTVA 5B3NA 3E1F1 2R29L 1FL5A 5EA0L 5GQBA 4UIKL 1JGLL 1AP2A 5JOFB 4OFPA 3BP6B 1JZ5A 2BVUA 3ZKXC 4FZEL 4PJBA 1KTRL 5EU7C 2DQGH 4HS8L 1CDCA 2YSSA 4KZEL 1WWAX 4IRSB 1EA9C 1E27B 1INDH 2IBZY 1XR8B 4K8RL 4KJWC 3OSKA 1AI1L 1AXIB 4S11A 5L2JB 2VL5B 3S9DB 5DK2B 3ZKNC 3F7PC 2F53E 4LCCA 4HW6A 3KPSA 1BFVL 1J0KA 3DETD 4XCCL 3D25A 3VXUB 4P2OD 2ZSVA 4B7LA 1NEUA 4PJDF 2M26A 2P5EA 5FYLD 3WFHA 3GSUA 3DHJA 3QDME 1HI6A 2O61B 5EU4B 4XXDB 3RL1B 3T4AB 2X9XA 2IAND 1QBBA 3SY0A 3ILQD 5I6XB 3S36L 1I8IA 4P4KD 2BY1A 3UJJH 4JANA 3QXDB 4N1EA 1P4BL 3ZE1F 4R3SB 3LRGA 3RY5A 3TZVA 1IEHA 4G43A 3QEUA 5C08D 4KUCF 5HJ3A 5TH2B 2J6EA 4KHTH 4G9FD 3REVA 4L8SB 1YYMH 5FK9A 4JG0H 4TRPL 1FNAA 5MEQA 3KLAB 2AEPL 4E41E 2OP4L 3UXFA 5EOCL 5F9OL 4C56A 3TA3A 1C12B 5DJZB 3VCLB 1BD2E 1OVZA 5J1AA 5D9SA 4QNPE 3MRNA 1U93A 5I1KL 1G7JA 3RWGB 4AJ0A 3KVQA 1JN6B 1L6XA 1QD0A 3M8OL 3EDDA 5EZLB 3MOAL 1P6AB 4WI2A 3ZTJH 1D5BA 4XP6L 1ZLUH 1RK0B 3IDNA 4RSVA 5CEYA 3GBNH 4RQQB 1U92B 3TIEB 3VWKD 2Y5EA 1F45A 1D5XA 3VXTA 3WCYA 1KXQE 4ZOBA 5F1OB 5D7IE 5C09E 1FVDA 2WLZA 4IS6B 4JFYA 4Y19D 5CEZE 1K85A 1S7VA 4E0RB 4HQQH 1OTSC 1HQ4B 3T09A 1U8LA 3WHXB 4PJ8B 5CGYC 2A74A 5F3BA 4BFIA 3WS6C 3MRIB 1Q1JH 2ZPKL 5BW7A 1LILA 1XIWB 1SY6A 3QDJA 4QTHA 5A3ID 1UWGL 2ENYA 5HPMA 2KUTA 3OB8A 4J3XA 4OLYL 4OTXL 1I1CA 1F3DJ 2ED7A 1SM3L 4O5LL 2NY7H 4NQXB 1JHLH 3F8UB 4YPGA 1V5JA 4WENB 5I74C 2GY7B 4GAGH 3SGJC 2ZCLL 4NWTL 3SDAA 4KRLB 4PJGB 2OR9L 5FYJE 3AY4A 2YMXH 2ICWB 1YUHA 1NUNB 3ULUC 1RQ5A 2KZ1B 4NP4H 3CFCL 4XTRD 2V7HB 1E4XH 3ARPA 2H9GB 5FCUL 4U2ZA 1N3NA 3P0GB 3WFBL 2UZYB 4JKPH 2AJSH 3QIWB 3U6RB 1MI5E 4NO3B 4PY8J 5TJWK 4ZTPH 4LLVA 5KANG 2OK0L 5CIPA 1KTLA 2HFEB 3WUWB 3NA9L 1BAFL 5F7DA 1EVUA 1MHHA 2IWGA 3UDWC 5GS2H 2ADIA 4MB3A 1NFKA 2YZ1A 5IF0B 3PV6B 2RCSL 4LSQH 2CLVA 2ENSA 4JREB 1G84A 5LGJA 4AL8L 3VRLF 5SWZD 5HDLA 5FOBB 5DYOB 4J3WA 4KKLD 2D7PA 4HWBA 4D9RE 1MI5B 2A6KA 3U2SB 5EU6E 5BRZE 2R2BB 5FUCC 2DQTL 5CJOH 3HMXH 2E8YA 1T6WA 1T1ZB 1B6UA 1S5HA 2AK1L 5AZEH 3GSNH 3HG1E 1DL7H 4QRQA 4D8PA 1VGEL 2DQIH 4B53A 1ORQA 4NRZB 3FB8B 1IC4L 4N1CA 2D9CA 1CK0H 3QEGL 2MQ0A 2DM7A 1ZSDA 2XQBL 3DARA 3NIFE 1BPVA 4GT7A 4UT9H 4U6XB 1ROWA 4X7TA 5HHME 4ZFZA 1O0VA 2VLKD 3QQ3A 3HFMH 5GSRA 3CXHK 3BMVA 4QHMB 1C5BL 4GMTL 4MNQB 4U6VH 3M07A 5D7LB 3IJSA 2XWJA 1A7PL 5T3ZD 2DD8H 4PY7B 5GGRY 1CR9H 5I6XC 3B9KB 4R97B 5DTFB 4G42B 1B0GB 3CAFA 5IWLA 4PRPA 2EDFA 1WTGT 2K7PA 3SE8L 3E6FB 3O45A 3IDJB 1CXKA 3BJ91 4DAGL 4XBGA 3RWJA 1O7SA 3RFZC 3DPBA 2Z31C 2HH0L 3I6GA 4UDTB 3TN0D 2GCYB 2YUVA 3RGHA 1P7QA 1T5WB 2JCCA 5L2KA 5JZ7D 3EDJA 3W81A 2GIYA 2QR0B 1FORL 4K3EH 1QP1A 5A2LH 4XNXL 2M8XA 3BZEB 1KG0A 2VDKH 5E1AB 4EDXA 3EFFA 2OI9C 1F6LL 4M93B 1MCWW 4OZFH 4L8BA 4ZSOE 1IAIL 3C5JB 4N0RA 5EZJA 3BKJH 3IU4H 2BNQA 4JHAH 1Z9SA 4PJBF 4GQPH 4DOHE 5HHVH 1EGJA 1PZ5A 4DVBB 1NUDA 5EOTA 1NC4D 4O51A 2YD1A 1NCCH 4D0DA 2F8OA 4LEXL 2VQ1A 3T1FB 3OAUH 4O4YH 4TOYH 3QRGL 4F80A 1KCLA 4JAMA 2DAVA 3D0LA 2WINA 3BN9C 3V8CA 4KJWD 2OZ4H 5ISZA 1FRGL 1EGJL 1AKJD 3B5GA 2GY5A 2PYFB 1I8MB 4DOHB 5BS0D 1I9JL 5A1AA 4JEGB 1ZA3B 1Y0LA 3I75A 5F8RC 3ZKND 4NC0B 4ZXBB 2R56L 3ZO0A 1NCNA 2BHZA 3L3KB 4LQFH 2MQCA 5TPWH 4LCWB 1JRHI 4HBCL 4GBXC 2FL5A 4NYLA 4J6RH 4RMSA 3V2AR 3MROA 2P8MB 4GRWF 4PR5B 1UXSB 1L7IH 4AEFA 1UH4A 4GMSL 3WIHH 1Y6MR 1CL7H 5IOPB 1JK8B 5DJCA 4GG6E 2DDQL 3DLQR 5TE6L 4YHYB 4PJ7A 1JNNL 5DRNB 2FX8H 3LKPA 4TVPE 4OM0H 4GQ9H 3RL2B 2MQ3A 4LEOB 3MYZA 4QRRA 3FCTA 4JPKL 1HQRB 3QIWC 2I9TA 1I8KA 1AGCA 1TJGL 4JFZH 3R8QA 3IKCA 3CVHH 1UJ3B 1X3DA 5K9KB 2Q7YB 5DK3A 1PKOA 3WE6A 4I18B 4GG6B 4CJ1A 1DQJA 3S88H 4BQ9A 4JFQB 3WLBA 4FFVC 5C9JB 4JREC 4EBQH 1IGIH 1E6OH 1BX2A 1I9IL 5DHYA 5IQ7H 3MMEB 4MCZA 5KZCB 3A67H 1UM5H 5HYQB 2SEBB 1R6VA 1CLOL 1FCCA 2DTMH 3SBWA 3AAZA 1K6QH 2YA0A 1IAIM 1V7ML 3HI1A 3O3EA 4OT1L 4Z7UB 1T03L 5IESL 3GMPA 1HWGB 3GSNB 4JPIB 5ALBH 1FZOA 2NR6C 1TETH 1CD1B 1QSZA 2BDNH 1ZT4B 4X6FB 1AFVL 2BVQB 3BP5A 1RJLB 5IM7A 1R0AL 2ZCKL 1HXMA 5JR1H 1JFQH 1NBQA 2FJGA 5J1SC 4W81A 4WJ5A 3CK0H 1MHPL 2OL3B 1MRFL 4PB9L 1GVIA 1PSKH 4Y16B 3TBVA 1OTSD 1SJHA 2V5YA 1F8TL 3N1MC 3D39E 4OZIB 5CGYD 4M6NL 2HLAA 5DQ9B 3LN5B 5SV3A 1K3IA 3G08A 3MOQA 1DSFH 4OFDA 2HKFH 2JJTC 3L95A 4G8GA 3QHZH 3RVVC 4GLRH 4FZ8L 4K3DL 3PV7A 3W0WB 4JFEE 4HPOL 3C5ZC 5EULV 5K9JH 3DGGB 2W0FA 1KCVH 5C09A 1ZLWK 3WS3A 3KPNB 2VXTL 4TYUA 5FO8A 4NN7B 4PREA 4U1SB 2RJMA 1OOAA 3GMMA 4L5FH 1QACA 3ZTJG 3ULUD 3C9NB 5C0JB 3HNSH 3VFWB 4OCYL 2P44B 5DSCA 5CEZL 1KB9K 4FQQA 5KSBB 3GSOA 1KT2B 3TO2A 4OZFB 4M93C 4WWKC 5GGRB 2R0WL 3N1GC 5DJ2B 4CADB 1MVUA 5FV2A 4PJFA 5KVDL 2GYSA 3UO1L 3MV7E 5DJYB 4DGVH 2P45B 4RA0C 4HK0A 2KQMA 3IS0X 4ORGB 4NT6A 3QCTL 1FNLA 4LHJB 5GGVH 2F5BL 4GW5A 3TNNA 4W6XB 2X4QB 4ENEC 3IDIA 3P11H 3Q6FA 1HSBA 2IBBA 3P4LA 1IM3B 4LRNL 3VFMB 5MENB 3DBXA 5LBSL 4UB0H 5EWIL 1YNKL 3MV7B 5FYJL 2X70A 4MNGA 4S1RL 3P4MA 1AHWA 3RUGE 5L7XL 2FO1A 3G04B 4ZXBC 4YHIA 5I15H 4PJ5E 3MLRL 1N59A 2DMBA 2AI0L 3SE4C 4ZPVB 1S7RA 3N9GH 1FFNA 1JBJA 5BRZA 3SOBH 3OB0K 2LV4A 3VGAC 5TE4L 2ILLA 3H3PL 1DN2A 1P9MA 1WCBB 3G5VB 2OQJA 2ARJB 4Y4FA 3V95A 1NBVL 2F53D 1C16A 5FHAH 3OL2A 1XGUB 4OCNC 4RX4A 5CEXB 2BSRB 1KNOB 4TPRH 3KYNA 1R3IH 4HUUB 3V6FB 1X5FA 3QEHB 2YUXA 3CVHB 2JCCF 3REWB 1WLHA 1UJ3C 1RUQL 2Z31D 3OKOB 3L3IB 1RZJC 3IRZA 4I18C 4OGYL 1FH5L 1RZ8B 3DXAA 4QXWA 5HVFB 5HDQH 4ZTOL 2VLMD 2P24A 3RWFA 1U3YA 2NY1C 3OJDA 3FT2A 1CXFA 5CD3A 4I1NB 3K2UH 3T0AA 4JM4L 4YHOL 5FB8B 1BVLB 1SEQH 1YEEL 3L7EA 2NZIA 2CXGA 2EDQA 3QPQD 3U7AA 1NSNH 1HYRC 4E41D 2AXGB 2N1KA 2BVYA 5FGCB 2VITB 4OBSA 4RGOL 4TUJB 4XT1C 4KUZH 1BD2D 5T3XH 5FF6B 5BXFB 5CJXC 2EO9A 4ZD3L 2DLHA 1Q94B 1U8HB 3CZFA 2VIRB 5B21A 1A9EB 1Q0XH 3QUXC 4LRIC 2YUZA 3QULA 5F96H 2P49B 4MDIB 5L0QC 5MEPB 2XZQH 4OV5A 4EOWL 1Z5LA 1QSVA 3BN9D 1FFPB 1JYVA 4ZSOA 5INDB 5KVEL 1IBGL 2Z8VC 1KIRB 1U8QB 2V2WB 4HJGB 4DGYH 5I2IB 4LSPL 2D3VA 3VMOA 1NCBH 4I13B 1XIWD 4O9HH 4XC3H 1PD6A 2WAHA 2VABA 3QUZA 4ZAKC 3BDXA 4YFDB 3VWJA 4OZHA 1IGTB 5IFAL 5CEZD 1CGYA 2NTSP 3CDFA 1RJYA 2NY4B 5SWSE 3NBNA 4ZUTB 4GBXD 1L4IA 4MAYB 2ICCA 3G6AB 4Z8FL 4L1HA 3KDMA 5DMKA 2EC9U 4UZGA 2ATPA 4NN7C 1UVQA 3HE6A 3FN0H 3FO1A 4ZS7H 1A6WL 3VFUA 4PJ7F 1TQBB 4LPTA 1AR1C 2PW1A 4KMQA 3MUGA 2YPVH 1OHQA 1RIUL 3DSNA 2WIIA 4OJFH 3CFBB 1B90A 1IC7H 3UPRA 2EC8A 1BBJA 1KFAL 3K4DA 1MHEA 3VXNA 4OZGB 3THMH 1E4JA 3QIWD 2DM4A 2CKBB 4JFDE 5I71C 3MYJB 3GHBL 5FYKE 3HCVB 3K0WA 5FYJD 1NLDH 3MLWL 1DCLA 9CGTA 3AREB 1T21A 3RPKA 2EYTA 3LKNA 1XAUA 4YK4B 1U8MB 5E8NA 1AJ7H 4A2LA 1QEWB 4FFVD 5D7KD 1J0HA 1ZTXH 3QA3A 2LQRA 5EN2B 2IFFH 4PP1C 4LVOB 4RGNB 4QYOA 3BE1L 2A9NL 3QYCA 1MI5D 3V4VL 1KIUA 4K7PX 1K4CB 4OIAA 1NGWA 1QBAA 3B6SB 4OF5A 3P4NA 4AEHH 1JMZA 5HI5C 5I1DB 2NR6D 4LPUA 1V3MA 3QO0B 4WFEE 1NAKH 3F7VB 4YX2L 3VFGL 2VAAB 3B3IB 5T1DL 3ZMRA 4QNPF 2UZIH 4TVPL 1V3KA 3WD5H 1OAZL 4IRJA 2BOBB 1DBJL 4D9RD 1YPZB 3LPFA 3BP7A 2C4FT 1YEFH 4CDGC 3LN9A 3MRBB 5EC2A 1S7XA 3DTXA 4LCIH 4P3WA 3HG1D 4JY6B 1NGQH 4KH2A 1OF2B 2M1KA 3QUMB 1BBDL 3RHWF 4UI2A 4YFLI 2AS5M 2FHBA 5I1HH 4HH9A 4CKVX 1XH3B 2NNAA 3RZCA 3C2AH 3RVVD 5HHMD 1JPGA 4NFCA 4OI9A 4QT5A 2B4CC 3WLWC 3DWTA 4U1NB 5ITFA 1JVKA 3C5ZD 5ANMA 3ILPA 2BVPA 3MRLB 1Q9LB 1ZLSL 5LXGH 1HYSC 5AZ2L 4GKSA 2BNRA 1R5VA 1UACL 3LVEA 2Z35A 4K2UL 1FO0A 5JNYA 5F7EL 2B1AH 3W9DB 1A3LL 4AG4H 1UG9A 4YUEL 3WXVH 2X4UB 3RIAK 1ZWIA 5C7XL 5JORB 2GI7A 4OBRA 2GTZA 4KMTH 4UINH 4JM2B 1E28B 1P4IL 2FZ3A 4OQ1A 1GH7A 3PHQA 4JN2A 4PJFF 4WWKD 4UT6H 2JJSC 1I9RH 1JUFA 1RVFL 3W11C 4JZNB 1JV5B 3UTOA 5HD8C 3VGDA 3GSWA 3MJGX 5IP4A 3KXFA 3WN5A 4HDIB 5DVOA 5IVZB 1C5DA 3FN3A 5F7UA 1EVTC 1N5YL 4POYA 2YD9A 1G7LB 1BOGA 4ENED 2BSTB 1W0WB 4LSVL 5LQBL 2O5YL 2HVKA 4TSBL 4LVEA 1S9YA 1A7NH 1T04A 5IROC 3RQ3A 3OGCA 5DLML 1QG3A 1LMKA 1KJ2A 3QCUH 4ZPTB 4Q58C 3ESVF 4YHKH 1YEJL 2HVJA 3QXAA 5FA3A 4OGAC 1HIML 1B4JL 4ZXBD 1TZGL 3QNXB 4DJMA 5IIEA 4X5XA 3NZHH 4HKJA 1I4FB 2FATL 5GGQH 4MAYC 1IFHL 4K71B 3QT2A 4HXBH 5EOCJ 3CDGB 1PZUB 2HFFA 4HH8A 2JIXA 1LK2A 1OAYL 4LMQE 1T20B 5L9DH 4D0CB 4HUMB 1ZT7B 1X5IA 2FHCA 3SCMA 1A7RL 4O2FA 5C07B 5F6HJ 5E8OB 3HAEG 5EO0B 1PW3A 3WMSA 4XH2B 4WHDA 5AAMA 3PHOB 3QG6B 1N6QL 3QHFH 1KBGH 5IHZB 5E2UL 4MXVE 1UB6B 2F58H 3OR7B 1NFIB 1JMXA 2WUCL 1GZQA 4FNLL 3LN4A 3MV11 3U0TB 1D7FA 5C92A 4OD2B 1U0QA 5KS9B 1CG9B 3H0TA 5JHDB 1C5CL 2V7NB 3S5LG 2PN5A 3S4SB 5CJ8A 1YEKH 4TVPD 2KPNA 5KZCD 2NY1D 4OCRL 4LVOC 4ODTH 2B4CL 5JW4Q 4JDVA 1GPOH 4CL7A 3VH8A 5DD5L 5DD1L 4D9LL 5J9PB 3K81A 5IMLB 1EEZA 3OBAA 4QHNA 1EZVY 1FC2D 3PXJA 5TDOB 5B39B 3B5TA 1WK0A 3GB7A 4RFOL 1R5IA 1PQZA 5HDBF 4JZJA 4Y88A 4OFIA 5DUBB 3X12A 1U8OA 2Z91B 3HNVH 4BK4A 2FX9H 4X4ZA 5F9JA 3K74B 2BCKA 5HYJA 5T5NF 4ONGH 4OSUL 4I3SL 2W0KA 4LPWA 2R2HB 5GGSA 4DW2L 1OGAE 2ESVA 4N8CL 3OKMA 4CU7A 2FJHA 3MRCB 1MLBB 2DQEH 2GSGA 3QBTB 2C3XA 2D31A 1KV3A 4OQTH 4F3FA 4RAUB 5I18L 4ZOCA 4ZAKD 3VXRB 3QDGB 1CICC 4XPHH 3KJ6H 4JN1H 2OTUB 3F5WB 1NDGA 1U2CA 2GUOA 3MRJA 3UTSE 4HFUH 3D39D 5DK0A 2UUDH 1N0XL 1CQKA 1MJJB 4PJAA 5KSAB 3DROB 2YWZA 3E0GA 1OAQL 5JMOC 1AR1D 5SX4H 3U82B 3NCYS 1GYAA 3RJQB 1FDLH 4KPHH 2H6PB 4HIHB 4JPWH 5IVOA 2BK8A 4JQXA 3Q3GA 2R1YA 4JFED 5DO2D 4UNUA 4JM2C 4QRTB 2CDFA 2DN7A 2EDHA 1RZ7H 2Q3AA 1RFDH 3CU7A 1DP0A 4RAVB 3U4EA 5SWSA 4NO2A 4NNPH 2ORBH 3H9ZA 5AWNL 3LKSA 3GMNB 2NW3B 4DWHA 1HHIA 3FO2A 1HSAA 4ONFL 5JW4R 3SE3A 1E4KC 5DMIL 2WM0A 1G7IB 3QIBB 2EEDA 4M62L 4CU8A 4PP1D 1AC6A 1MQKL 4HS6B 4HGWB 4YO0B 1LE5B 2J8OA 5DHXB 1A1NA 1MY5A 1Q72L 4H26A 1B0RB 2V2XA 4JFDA 5DUML 3IFLL 3MV7D 3JUYA 4OCWL 5HI5D 1I7RA 3DX6A 1T6VN 4D3CH 4P9HL 2K1MA 1KPRB 3O0RH 4A6YH 2AV1A 1G6RH 3F6LA 3T0DA 1M7XA 4JRYE 4NC1C 3GI9H 25C8L 5FYKL 4K71C 3B4NA 3I02A 4WFFE 3EGSB 4HF5L 2DQCH 5IJVB 1J18A 1HHGB 4MD0A 5FUOL 1U8KB 2VDNH 4HV8B 3RTQA 5E2WH 1GL4B 4P2RE 4FQPA 5ETUB 3MRHA 3D5OF 4TSCH 1CTOA 3MNZB 4C57C 1A6AB 5I1EL 3WLWD 3UYOD 5I1JH 3QI9B 4LCYA 2W9LA 4NHCL 2R8SH 4NQCB 4RFNB 1QBMH 4G7YL 1QRNA 4ISVA 4KKBC 1HYSD 5EU3B 3BT2L 1LD9A 4LKCB 4WTZA 3AS2A 4I0PC 3OZ9L 3IVKB 2ZNXA 4CMMA 2XQYG 5T1LA 3BD4A 3I2CH 4LDEB 4KHXL 2Z8WC 3QQ9C 2PYEB 4XNYL 4U1MA 1ED3A 1SYVB 5CZKA 2J12B 1MWAA 1ETZB 3D0VA 3D85B 3LKRA 2A6DA 2ZOKA 3H2WA 5KTEH 3W11D 4OF8A 4FQIH 1HZHL 1LO2L 5HD8D 3MPCA 4R9HA 2BHUA 5ADPL 1S9XB 1K8DA 4M1DL 5I75C 1NAML 2IF7A 4OD3H 3FQXA 2RAMA 3KPLB 3LQAC 1NC2A 3IJHB 1DN0A 1U6AH 3GJEB 2OS7A 1U41A 3C8DA 3G6JA 1YECH 1P2CA 1UB5B 1IEAA 2R0ZH 4MD5B 3CLEL 2PTTA 1G7HB 4NN5B 3UROR 5MP6L 3B8SA 4ALAH 4FMFA 2AV7A 2AXFB 4FXKA 1IAKA 4QCIA 3BH9A 4FQHB 1X5KA 2AXHA 3TO4B 3VGFA 3K8KA 4LSSH 1UZ6E 2IFGA 1KN2L 4QHKJ 4RFEA 5FM8A 1QFUH 1K4DB 3O9WB 1F11A 4H20L 1TLKA 4OGAD 5I16B 3SKJL 3U9PL 2C3VB 2HKHL 4PS4L 1P84J 3VXQB 3CX5J 1CBVH 4MAYD 4Y2DC 3D9AL 3T2QA 4WW2A 4NZUL 4FQ1L 3OAYH 4H1LH 2OJZL 3MOBH 5HHPA 5KSAC 5TQ2H 5DC4B 3RUGF 4BSVA 4JQIH 5EG6C 3FRUB 1FGVL 1MRDH 4J1UA 1CGUA 3ULSA 3DRQA 3SKNB 3BOVA 1FZJB 5IW1B 4G6KH 5TDNA 1A7QL 3H3KA 1W0VB 1AXSA 2XN9B 4YBHA 2IH1B 5IR1A 3NAAH 2EH8L 1N64L 3HE7A 4M7LT 1TQCB 4C54A 1EHLH 5IFJA 1MCSA 1EHXA 4YHLL 2VLRB 2DYPB 5IFHL 5BO1L 4PJCA 3IDGA 2MKWA 1AIFB 1UA6L 3P30H 4NOBA 4R0LB 4XPAH 1BGXH 4JVWA 1F4AA 3TNMB 2R1WA 3T0XA 1GHFL 5D5MA 5B38B 1VA9A 1ACYH 1KJVB 5C0BB 5FDWA 5JW5A 5E03A 1IQDB 4NKDB 3GK8H 3PP3K 4WNQA 4XRCB 5K9QI 3SDXB 5SWQB 2IAMA 4OUUB 1RZFH 4X6DB 1XF3B 2P46B 3JTTB 3O3DA 4PGBA 1ZANL 4KXZH 1TZHB 2JB6A 2X4RB 1G6RB 3OJ2C 2BSED 5CMAB 1NL0H 5EBLB 4PRHA 5IG7A 5IB4A 2OXHA 1OM3H 4P2CG 4XC1H 2JJUA 5F9AC 5CSGA 2ICWI 2PXYB 1XGYH 3UPAA 3DVNB 3HC4L 1VPOH 2IPKB 1SMAA 4NQSB 5F7HA 3BD5A 3H9SE 4WFED 1O7VA 1ZT1B 1ZHBB 3AU1B 1A1MA 2IGFH 3MC0A 1CICD 3ROOB 3WJLC 3LQAL 2BP3A 3L3OA 1KEML 3MRKB 1CGSL 4XP4L 1MIML 1N8ZB 2AJVL 2W38A 4XNZB 1IGJB 4RGMC 1U58A 4PJAF 2GITA 5E8EA 3TH3T 4RFNC 3VD4A 4PRBA 4X6BB 2CDGA 3O2WL 4BZ1H 5BS0A 4YNYB 1QA9A 4L4TB 3DIFB 2A2QT 4Z7WA 4N0YL 2MHAA 4NQDA 1A4JB 4RMRA 3V4PH 4FQCH 2WUBL 1B3JA 1H3UA 4LCUA 1LEKB 5GGUA 2FHFA 2YXFA 3WIIH 3QJFA 4JM2D 2DKSA 4NZTL 5D93B 1ZE3C 1KENL 4R96A 1TNMA 3O6ML 1FG2B 3T2NL 1JWMA 2MPAL 3C60A 4BQCA 4PPTA 2QHRH 2C1OA 2CRIA 3JVGA 4GAJL 4W6YB 4RMTA 1OPGL 4QRPA 1EERB 4H88H 4TUKL 3EYOA 1XCTB 4JE4B 1XFPA 1YN7A 2FR4B 4MHHI 1CDUA 3NCCB 5E2TL 5HY9A 3L5WB 2HJFA 5HI4C 2CLRA 3PP4H 1UZ8A 3SDDB 3JWNC 1EPFA 3RU8L 3TO4C 2XRAH 2WBJA 4HUWA 2P5WB 1U91A 2R69H 1QBLL 3S35X 5IEKB 2CJUH 2Z0BA 5CINH 2BRRH 5LCVH 3VFPA 1XZ0A 3O9WC 2APXA 3OX8B 3UPCA 4LLUB 1ZLUK 5FM5M 1DDHB 2KDGA 5DA0B 4X7CC 2G75B 3VJ6A 3BIKB 1INQA 4UQ3B 2NY5H 2EECA 4ODUA 3V0AC 5I66A 4ELKB 1OCWL 3RVWC 1L7TL 5IB2B 1D5MB 2XXMB 5ENWB 1NMCB 4HIIB 4DZ8A 5C07D 1JTOA 5DI8A 2EZ0C 2ZP0T 1PBYA 3MCKA 5C0GA 4N8VA 4ZUVB 4P3CH 4IOFC 2H32A 2QSCL 5EO9A 2RFXB 5BVJA 3GM0A 5CZVL 4KKBD 3D18B 4G6JH 3S8WA 4I0PD 4IJ3C 5JHDD 3BKCH 4KDTC 1ERNA 2GFBB 1M4KA 4CAGA 5BZWA 2XV6B 1CE6B 2NY3C 1W72B 4G9DA 1MFAL 4HWZA 1KCSL 1YJDL 4BH7B 3QQ9D 2XY2A 1NLBH 4CUCA 1FE8L 4Q2ZA 5CSBA 2VDLH 5CUSH 3BAEL 1GIGH 4OD1L 4ODBD 3VXME 3EDFA 4FQJL 5IJKA 4WUKH 4YFLF 1FFRA 2ZOLA 3G6JF 2QKIA 3CXHJ 2WQ8A 2NW2A 2ZKHL 3NN8A 5HYEA 3FMGH 3LS5H 4YQXL 4KZDH 1DFBL 4BKLA 4P2QE 3U30B 2AVGA 2PXYC 5D2NE 2FWOB 4WFGD 4XMLL 4BUGA 3BZFB 5ICZB 3MODH 1RUML 1UQSA 3I3DA 2AEIT 3WXWH 2E7LA 5I1IL 3SJVB 2PCPB 2DQDH 3CD4A 2IMNA 3BP6A 4YE4L 4G80B 4KMLB 4LGRB 4ZNCD 3EYSH 4XCFH 5MHSD 5KOVC 1PKQE 2JTDA 2C1PB 1RIVL 2A9MH 4NGHL 2Q87A 4IRSA 4ZUWB 4WW2F 1E27A 4XNZC 1XR8A 4BZ2H 1UKSA 4Y2DD 3QG7L 4YC2B 4S0TD 1KIPB 1OGAD 1MHCB 2XKNA 4XVJH 1DVFB 2VL5A 5KSAD 1QSEB 1LO3L 3GMOB 4S2SA 1CZ8H 3RIAF 1CWVA 1PKQB 4NO0D 3ULVH 4KAQL 3VXUA 1A21A 3PIQB 3BYYA 4ODWB 3V4UL 3D3VA 3HI6L 3TCLB 3UTSD 2DQFB 3TJEH 2JK5A 5EU4A 2W92A 1UCBL 2O61A 2VMFA 3I6LE 5D93C 2DL9A 3GMQB 4XXDA 3RL1A 4M6AA 2Y9RT 3T4AA 3IXTB 1H3WM 4JR9H 2EIDA 5IVXE 3C6SB 1JZ8A 4PJCF 1GRWA 4XHJC 3QXDA 4GAYB 5ESAA 4LPCA 2OR8A 1VGKB 2I60L 3LQZA 5F6IC 1QFWL 3PGDB 5CBEB 3O8XC 4YBLB 1LE9B 5D5MF 3TV3H 3RGVA 2Q76B 3K8LA 4WHCA 3M17A 1YMMA 1II4E 2ADJB 4NNYB 2FB4L 4F2MB 4L8SA 3ARZA 3EYUL 5IHBA 5IVXB 5BV7H 1M7IB 1C12A 3BSZL 4H25B 5DJZA 5LGKA 3VCLA 4H1LG 1ZK9A 1CFBA 4Q0XL 4RWYL 2Y4SA 3ZT5A 1T5XB 3RWGA 1FNFA 5CBAA 5C0NC 2X9YA 3O6KL 6CGTA 5FUZH 3WO3B 4V2BA 5EZLA 3STZB 4PUBH 4HEPG 4P5KB 1T0MB 4OLUH 4V1DB 3WFCH 4U7KA 3NACL 4RQQA 2I07A 1U92A 3TIEA 2NLJA 1SBBA 5HHXH 4EI5B 1NMAH 4DN4H 4YBQC 5IHUH 3D48R 2YUWA 4FFYL 4ORZC 1PY9A 2WLYA 4U7MA 3WFEL 1NMCC 2IEPA 4OKVA 2UWEE 2GK2A 3MRDB 4IS6A 1BQHG 2R15A 4UOW0 1FAIL 3BJLA 4MX7A 1FN4B 4PJ8A 1F42A 2DOCA 4WFFD 4Z7WF 1CDHA 2XTJE 1W8NA 4I3RH 3VXOB 3SO3B 5I0ZA 1I7TB 1XIWA 2DJUA 1LEIA 2AQ1A 4OB5H 5CS7A 3QFDA 3ELAT 3ZSSA 4X98B 4F57H 7FABH 1HHHB 2ZZUT 4P2RD 4IRZL 5DZOA 1DLHB 4CVXB 3KLHC 4K23L 4NQXA 2VDOH 4LLDB 5JOPD 3SGKA 5DR5L 4K3JL 4ONHA 1JGDB 5FHBH 1RULH 3D85D 3M1BB 43C9B 1QFWM 5J6HB 5F9WB 3TPUB 3VFRB 3EYFB 3LSOA 1YEIL 2WBKA 2AEWA 3O2VH 4MMXC 1MFDL 4Y5VB 2V7HA 4XBEH 3TT1H 2MCPH 2H9GA 2W07A 3MFGB 3RX7A 3QIWA 1FVCB 1WICA 5KVFH 4K9EH 3E3QE 4NO3A 4Y1AE 4EQ3A 5J12B 1J5OH 3GBMH 5HI4D 3UBXB 2MCG1 4WIQA 1QZ1A 1UH2A 4MWFB 5IF0A 1BWWA 2Z93B 5JPNA 3TO4D 3PF2A 2F8XC 1ONQB 3LDBC 5KVMC 1W0YT 3O9WD 3TIDB 3VI3F 4V2CB 4R4FL 3HI5L 3U2SA 4GRLA 2R2BA 3TH2T 5JA8B 5ACMA 1MCNA 1T1ZA 3U83A 2VLJE 4X7DC 4YC2C 5CJQH 1AY1L 1EEUA 2DLTA 1DVFC 2CR6A 4I77L 4PTUB 4NRZA 3FB8A 5CSZB 5DVLA 4JDTL 5DD3L 1KB9J 3HB3C 1OTTC 2G5BB 3CFEA 2CIKB 5MERB 3QIUC 4U6XA 5HGGS 1INDL 1ORSB 1ADQH 1J1PH 2AABL 1NQBA 2EZ0D 3PJSB 2Y25A 3GNMH 1ZKAA 3U9UB 2VLJB 3OG6B 4QHMA 5JPMB 2XN9D 4MNQA 5D7LA 4YR6B 4IOFD 1KPUB 5AG9A 4Y5XA 2J88L 3QISA 2DQHH 5E8PA 5E9DB 3B9KA 5C0AB 1LO4H 5DTFA 4G42A 4FQXB 3EO9H 3FFDB 2DYPD 5JLZA 4YBLC 3I6KB 3IDJA 4C4KT 2QQKH 3FFCE 2R9HD 3L6FB 3NIGF 1M6OB 2NY3D 5ICXB 3T77B 1QTYT 1CLCA 1RJZB 3N1PC 2QSTA 3LKOB 4JG1H 4OKDA 5IW6B 4HXAH 5BV7B 4AMKL 1ACZA 4XZUA 3A6BH 1QYGH 1T5WA 3EJJX 4R26H 1OARH 3AROA 5EUOE 2IJ0C 1AC0A 3K3QA 1H3PH 2QR0A 1RUAL 2EYSB 2IC2A 2PETA 4OIIH 4EN3C 1NBYB 1I3UA 1UC6A 2O5XL 4JFFA 1JF1B 3BZEA 1U3HB 2E5EA 5E1AA 4IMKC 3JV4B 5E8DH 1MFCH 1MAMH 3ARGC 8FABA 5IMMB 3C5JA 2PXYD 4I0CC 1XGPA 2DI9A 4OGXL 1NJ9A 3W39B 4KY1H 5F1KC 4LPXA 4EI5C 3WHE1 3KNBB 1GAFH 1PDKA 1MOEA 2VNCA 1FNSH 3CFJA 2UYLB 2X4PB 3MA9H 5GS0H 2X9WA 1WWCA 2UY6A 4P99A 4P2QA 1AO7B 1G9MH 2XKSA 4PBWD 3VE0A 4Y8DC 2PYFA 1I8MA 4ZQKB 1R3LB 1ZA3A 4L4TD 5GRXG 3NCFB 4MJ6A 4XMKL 1TJHH 2NY6B 4MD4B 2BFVL 4M8QB 5HYFA 4LCWA 2NXYB 1Q1JL 3SE4A 5HYSB 3W9EA 5CP7A 4PR5A 1UXSA 5E99H 2XTJC 1SBSH 1IM9B 5IOPA 5GRJH 4XGZB 5F9WC 3RWDB 4XHJD 2NY7L 43CAB 5DRNA 1ZEAL 2ZUQC 4DVRH 1YYLH 2DIBA 3NFNB 2MMXA 1Y18B 3O8XD 3OKLB 3RL2A 2X1OA 5CKAA 4LEOA 4PGEB 1HQRA 2QL1A 3U46B 5J12C 3RVXC 5F1NB 5K9KA 2Q7YA 4JFXA 4KDWA 2K7QA 1E4XL 3KHQA 3FONB 1NGZB 3FB5A 5C9JA 4XXCA 4JKPL 3BISA 1URLA 4ELMB 4M1CC 4AM0B 1MRCH 5HYQA 3KPMB 1BIIB 1GOFA 2SEBA 3MV8B 3MV9E 2X89D 5JDSA 3OHXB 1ZS8A 3S5LB 3KHOA 4Z7UA 5BQ7A 4J3SA 2EC9T 3GSNA 4JPIA 3V7MA 1X5AA 4JQVC 3JWDH 4HHAB 5T1KB 5EIIA 1U8NB 1RJLA 3O3AA 4BJLA 2J8HA 5HGHA 2OTWB 4YBQD 5CJOL 4ZFOB 3HMXL 4Z7VB 1EHAA 1CXIA 3TYGH 3UTTE 1FFOB 4LRIA 2WV3A 5D1QC 4P46C 3VGBA 2OL3A 3VFNB 1BEYL 4Y16A 2DQIL 3LAFA 2R2EA 4KROC 1X5HA 5JIKA 1DBKH 3GUTB 1OSZB 1M71B 4OZIA 5GISL 4LSDA 3BDBA 1AGDB 5DQ9A 3MLVH 3RBSA 2YPLE 3R06B 4DTGH 1S7SB 1JGUL 4FQXC 2AK4E 4L9LC 4MQXC 4WEUD 3HFML 3EYQC 4NRXB 5F3HB 5C0RH 2CLZA 1CF8H 1CE1L 4WO4B 2E9BA 3W0WA 3KLHD 1I3GL 1TPXB 1QNZH 3DGGA 3HRZB 1J8HE 5IVNA 3KPNA 3KPRB 3NH7H 4J3VA 3CSYB 4LIQH 4EJ1C 3ZHLA 3IRPX 4HS3B 3VFWA 3V9FA 5E6IA 4F58H 4EUPH 5KSBA 1KT2A 1J8HB 3RWHB 3OXSB 4OZFA 3H42H 1UH3A 3V5KB 4YDJB 1I1AB 3I50H 4CADA 1PX3A 5DJAB 5C0CB 5D1ZA 2HLFC 4K3EL 5DJYA 3R4DA 3WKNA 3VXMD 1LP9E 2J3SA 1CFTA 5DZLA 1H8NA 2F54B 5IMKB 3QWOB 2VO5A 4JZOA 2B2XH 3BKJL 2G9HB 3WFDH 1A3QA 4LMQI 1AGEA 3ME0A 5T5FH 5FV1L 5ILTH 2AQ2A 2EDLA 2OZ4A 2YD7A 5DT1H 4H5SB 1XF4B 5MENA 1MF2H 2XQYK 5HHVL 1P1ZB 2VZUA 3U48A 1LP9B 1OAXH