5KS9E

Bel502-dq8-glia-alpha1 complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
193
structure length
193
Chain Sequence
QVTQSPEALRLQEGESSSLNCSYTVSGLRGLFWYRQDPGKGPEFLFTLYSAGEEKEKERLKATLTKKESFLHITAPKPEDSATYLCAVALNNNAGNMLTFGGGTRLMVKPHIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DQ alpha 1 chain
publication title Diverse T Cell Receptor Gene Usage in HLA-DQ8-Associated Celiac Disease Converges into a Consensus Binding Solution.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 193
sequence length 193
chains with identical sequence G
ec nomenclature
pdb deposition date 2016-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9E01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ks9E02
4POZD 2I60H 4OZGF 2CRYA 3B2VH 2VXQH 5EUOE 4DN3L 4HZLB 3ZL4H 5J1SC 4QRTA 15C8H 4JFYA 5HI3D 5BQ7B 5JPMA 1L9NA 4JREB 1R3KA 2JIXD 2O26U 3KPRB 4R4ND 5D72H 3RGHA 2PKDA 4Z7WA 5CCKL 5CJOL 3MJ9L 5ECJE 3HLAB 4G7VL 5DJDB 1SJVA 4YDJA 3MCG1 3ARED 4KQ3L 2WQRA 3D5OF 4A2MA 1B6UA 3SGEH 4Z7UF 4K3JL 2FWOA 3WIIL 4ODBD 4NDMA 1PJ9A 1JGEA 5MEPB 2BDNH 1HSBB 4XCYB 1RI8A 4UV7L 1G7HB 4WHCA 2KZ1B 4Y19D 5FO7A 5GGVY 1FNSL 1OCWH 4FQJH 3MJ7B 3K8MA 5JDSA 3FN0H 3FQUA 2NY3B 2K3TA 1RUPH 4OLWL 1QRNB 4X7TA 1KELL 3BO8B 12E8L 4ONFH 1VKXB 4HG4J 3GSVA 3FB5B 1AHWA 5AZEH 4W70A 2W9DL 1M71A 1EV2E 4YXLH 2NY1B 3LKRA 3RVWC 1GGCH 1U58A 4AH2A 1V7NH 2Q8BH 5IQ7H 1XGYH 4C55A 4LLUA 5C0BD 4KHXH 1IKNA 2C4FT 5AYQA 4KV5E 4NHUB 3W81A 4XZUB 5GGRB 3HPJA 1CCZA 1LO5A 1QFWM 3HNTL 5F21B 4NRZB 3ZE0E 1IC4H 4K3HA 2FBJH 4P59H 3R1GH 5EBLB 2HT4C 5E2WL 4NUGL 3HC4H 1DQDH 1ZLUK 4C57C 2BNUB 2J2ZA 5D1QD 5KVGH 4LU5H 3GSXB 3ZTNH 2R56H 5I1CL 5I0DA 1U8NA 3RZCA 1KFAH 1GAFL 1OLLA 2BHYA 1QFWI 4YAQB 3HG1D 2YWYA 4PRBB 5F7KC 4OT1L 2V9RA 2YPLB 2GJJA 1PX3A 3MLXL 1INDH 3MLWL 5GGSA 4HWZA 4JPVH 4NJAH 4EUPA 1G7PA 2EDDA 1DUZB 3WFBH 3P4NA 3BEVA 1RFDL 3CDCA 3QULA 1CXHA 3QQ9D 1OP5H 4WEBH 2BRQA 3LDBC 5IWLC 1H15B 3BP7A 1JPGA 1WQVT 3LQAH 1E4XL 1UXSB 3HE6C 3MRBA 3BQUA 5F6HJ 2XPGB 3BHBA 2D7QA 2E8YA 4PJIA 5I1EH 3K74B 4XMPL 3IDMB 1S7RB 4FQ2L 1GC1L 1FBIL 5K9OB 1U3YA 2F74B 1VENA 4K2UH 5T3XH 3MREB 4N5ED 2HKFH 4Z18A 3V4UL 1KACB 2QTEA 5J57B 3MLPA 1RZFL 3ULVE 4WHYH 5FYJL 2X4PA 5E94B 3MRLB 5CGYC 5JW3L 2IJ0C 3PF2A 4FNLL 5SX4I 1BF2A 5FV2A 1T3FA 3SE9L 4LLDA 2YPKB 1E4KA 2ADIB 2R4SH 3FONA 2R0WL 5C6PB 5HSFA 4Y2OA 1J0ZA 5KZCB 1CLOL 2X05A 5ICXB 3RNQB 4NM8L 5FYLE 4PJ8D 4RMTA 5J6HB 1I1YA 4K94H 4G9DB 4LNVA 2A38A 2WMPA 2DL9A 4HBQA 2J8OA 3DIFA 1MHCB 1H0DB 4JKMA 2HAZA 1HH9A 4ELKA 1UQSA 4IIQB 4D9QD 3T1FA 1JGLL 3PWPB 4OCRH 5D71L 2BMKB 2ZG3A 3UPRA 4IOFC 3NCJL 4MD4A 2D7TL 2CGRH 3BI9X 5HTSA 3EYFA 4BSVA 1S8DB 3KR3L 1W72B 3WDJA 2ZP0T 2FZ3A 5F72S 5KBNC 5CIPB 5MEOA 3G08A 2Z93B 1RJYA 2GJ6A 4Z0BL 3VFNB 5HPOA 1FFRA 4RX4D 2NY7L 4IRSB 3ES6B 4YHYB 5HHMD 1QD0A 4CVXA 2V2TB 5K59E 4KK6C 1EMTL 1WIOA 2YK1H 2RJMA 1AKJB 1YMMB 4YHKL 4EI5A 1F3JB 3W5MA 1T1ZB 4GQPH 4PJHF 4X6FB 4XP6L 2YD6A 4N90D 3DUUB 3EFFA 1I8MB 5C7XH 1A5FH 1Q8MA 1NCTA 3C60C 3HB3C 4DKAA 2LAAA 5KANG 1EJOH 1I7UB 4CN4A 3ET9F 4OZIB 4RGMC 3L3IA 4JRXE 1R3JB 3T3ME 3CXDH 1FC1A 5GRJL 3TBWB 4K8RH 2HVJA 3ARZA 1TQBC 2Y7QA 3O45B 1TCRB 1CU4H 4K55A 1SBBA 5DD1H 1AD9A 4BUGA 1UGNA 5EUOB 4AMKL 3L3GA 1U93A 4MA7L 5AD0B 5FDWB 1P7KA 3MRQA 2VDNH 1MJJB 4WWID 2R1YA 4M6NH 1YEIH 4AEEA 2VN7A 3LKQB 1W72L 2BCKB 1Q94A 3OZ9L 1NCBH 2JCCA 4PG9A 5INCA 1PQZB 2Z8SA 4Q9QH 3ZDXF 4XHJD 4P2RE 4ZFGL 1X5HA 3C9NA 3SEPA 3BAEL 4XCEB 2ESVA 1BVKA 2P47B 4CRPA 4G8EB 4DAGH 4MNQD 3NBNA 4Z5RA 3DYPA 2XZQL 2UV3A 4WDIB 4HUWA 2H3NA 4M93B 4M62H 1TPXB 3KPNA 2EKSB 1S9WA 1U0QA 1UA6H 3KLSA 3TPUA 4Y4HD 5HY9A 4E5XA 1KIQA 2GYSA 4HUXB 1D5ZA 1A14L 4UILH 3H0TB 4PJ9A 2FIRT 5GGTA 4WU5A 3QT2A 5BZWA 1OF2B 4JHZA 3V52L 1FZMA 1UWGH 3FT2A 4DKEH 4XH2B 5JXAH 1F90L 4JPKH 3CFEB 4NZTH 1WEJL 4GAJL 3WNOA 3IU3A 3RGVD 4PRNA 5C6TH 5EFIB 3AXLB 3DSNA 3U4AA 1JWUA 1KC5L 3HC3H 3B8YA 3G6DH 2OR7A 4ZO8A 2DYPD 1J12A 3CSGA 4RA0C 4Y5YB 3Q1SL 5DFVC 1UB6B 5DZNA 4P46D 43C9B 2D7PA 2F5AL 2YA0A 2VAAB 4ISVB 3O3DB 4BH7B 4WGVB 1AGDA 1IBGH 3S97C 3C08L 3INUL 3CCHB 1MIEL 4PJGF 4ZXBD 4J4PC 1U95B 2ATPA 1W2KT 2ENSA 1ZT4B 1CGTA 4GG6E 5SWZD 5EUKB 3QO0A 3CFBA 3R0NA 3V6FA 4JY6A 2P8PB 4G6KL 4Y4FA 4X6CF 4MWFB 4W81A 2H32H 1MFCH 1FE8L 3QDJA 2GSGA 1HEZA 3PP3K 2HFFB 5IB2A 4KHTH 2ZUQC 3O11B 1AO7E 5FHBL 5C0CD 1S7WB 3UJJL 5FUOH 2BHZA 2YD8A 4PGDB 2YD3A 1JE6A 5D1XD 1RZ7H 1FQ9C 4QY8A 1QBML 1P5VA 3T1WA 5IEHB 5HVGB 3T0ED 4PREA 3FN9A 5C0JB 3KDMA 4JFHE 1PBYA 3VG9B 3NPZB 5C0AD 2BFVH 3CLFH 4HUUB 4U1NA 4P49A 1NDMA 1MCKA 1ZHKA 5A2LH 3PWVA 4DK3A 5HHQB 2AJSH 3KLHD 3BYYA 3X17A 3QIUA 1H5BA 4S1RL 5T3XD 1MJ8H 4H1LG 2AJYL 2ATKB 4EN3B 1M05A 1HILA 3DROA 3TP4A 4ODUA 1IC5H 2ED8A 5IW1B 1OWRM 3IS0X 2P42B 3DETC 2IH3A 2Q8AH 3RY6C 1IQWH 4D0CA 3L3HB 4Z7OE 5JW4N 1DBAH 4Z7WE 4NQUA 2IWGA 1OSZA 2I07B 5SWSD 3ULUC 3JWNC 3CFJB 3R4DA 2P8LA 4L9LA 3M07A 4M7KL 4X99B 2YSSA 2FDBP 3GSRB 3VWJC 3CFKA 3TJEL 5C2BH 4JN2B 3ELAT 2ZSVA 1F2XK 2GI7A 1S7VA 4U1MA 5I66A 3FQNB 1IGIH 3QPXH 1HSAA 2F15A 1ED3A 2LQRA 3T4YB 3F8UB 4UT6H 2DQIH 5KG9A 5E6IA 3GUTA 1O5DT 1DANT 4L8BA 5DRXA 1JP5A 4JO1L 1UZ8B 4HAGA 4AT6B 4J1UA 4M5ZL 2C1OB 1MCOL 1F4XL 3MGAA 5T1KB 2J8UE 4DGIL 1NFIB 1K6QH 3MRMA 3WUWB 2OM5A 2ZNXA 3LKNA 1UEYA 1HKFA 3M17A 4PLJC 4WV1B 4C58B 4ZYKA 5JR1H 2AXGB 4PJAF 4DK6A 1BEYL 4FXGA 4LARL 5F96H 2FJGB 3VG0L 3KPSA 1DVFB 1A3RH 1ZWIB 2GSIB 1MFBH 4HIIA 3ESUF 4U2YA 1OPGH 4NN7B 4AEHL 3DOSA 1OW0A 3ULVL 5AZ2H 3I9GH 3QCTL 4QEGA 3DBXB 3FFCA 1OTUD 4JFFA 3CNKA 1JHLL 2NY5L 4O9HL 2V2WB 4K7PX 3D48R 1GPOL 3O81A 3DGGB 4K07A 1OP5K 1A6TB 4O2EA 1BM3H 4DZ8A 3PUCA 5C0NC 4KQ4L 1ACYL 3U6RA 5ISZA 1IEAB 1NC2A 1RJLA 1BLNB 2OXGA 4JRXB 2ICEB 4K8RD 5DYOB 1CFBA 3BDBA 4HKZA 4WRLA 1T20A 5IMOB 3WKNA 3TCLB 5M7QA 1F3RB 4PP1D 1RUQL 4BA8A 1FV1A 4ZFFA 4M1CD 1F8TH 1HNGA 1OTTC 3B6SA 3SDAD 5DJXB 1BOGA 1FNGB 1E4JA 3CX5K 5B39G 1Z9SA 4PTUA 5MENE 2Q6WB 1XIWA 1ZVSA 2CIIA 1QYGL 2FX8L 3V0WL 1J5OH 4TNWK 1C5CH 4PRID 4PGEA 2R0LH 4P2RB 1CE6B 2XXMB 3MYJA 3PWNA 4JFPB 1M7DA 4V1DB 5IW6B 1A8JH 1VACA 2VXVH 4NO2B 4FA8A 1A9BB 4YHLL 2R23B 4JFOB 1L6XA 2ZOKA 4YHPA 3LHPH 3GMLA 3OR7B 5DJZB 4DOHB 3BISA 2CMRL 2IG2H 3BIBX 5ALCL 1YECH 3TZVB 5B3NA 1UVQA 3FRUA 4J3XA 4KRPB 5I6XB 4CN1A 2C3GA 3GSNB 5IBTH 5DVMA 3LAFA 4OFPA 3SE4A 2X70A 3JTSA 5IB3B 1F5WA 5BS0A 3RVUC 1KCUL 1EGJA 5KVEL 5C09A 3NAAL 3LRSB 4PG2C 1P69B 3MNVB 4YR6B 1C16A 1Q9LB 1D9KA 2X4QA 5L88H 1K4CB 2EDFA 5D7IA 1DBBH 4LHQB 1YEDA 1RZKC 4YEEA 2HLAB 4RMVA 2D03H 3ABZA 3MLVL 5EIQA 1AQDB 2WQ8A 2W60A 1MLBB 1YN7A 4QRSA 1N6QH 1SHMA 2ICES 1MF2L 2VDRL 3PABB 4U1LA 3LKOA 2YEZB 3TGXA 3QAZC 5E8EB 2IPUG 4QTHB 4JANA 4HXAH 4YZFE 4LKCB 3DYMA 5ALBL 4MAYA 1YY9C 1JGUL 4MNGA 1NANI 4JFQA 2GJZA 2L7UA 1TENA 1JWSB 3QJHB 2H45A 4S1SL 3VXMD 1I7RB 2NXZD 1X5AA 3K2UL 3BZ4A 4F58H 2YD9A 3CDFA 3OBAA 1KF9B 1NL0H 2ZG2A 2HT3C 1AR2A 4W6YB 4JZJA 1T89C 2NY4B 4OZFA 2XY2A 4D0BB 3PNWB 5HHOD 1A7PL 4O51B 1AFVL 1BOYA 5HXMA 3IJHB 2GKIA 5DSCA 4FQHA 2IQAA 4LSSL 5ACZB 2SEBA 1U3HD 3GSNL 4AL8L 1HHJA 5DT1H 4OUUA 1AO7B 3ZHLA 3U7WH 5CBEA 3MV9B 3QFJA 4YQXH 1CI5A 5ERWA 1UEMA 4UU9B 4NBXB 4AIZA 4QHUA 4PY8I 2LTQB 1QLRA 3E1F1 2VLJA 1L0QA 2AERT 4HQQH 3G6JB 5TDOA 4BM7A 5CJQL 5GJSH 3BH9A 4RWHA 2WINA 5TFSL 4BK4A 1KPRA 3JWDC 4NO3B 4YEFA 3VW3H 4EIZC 4WIQA 2EYRB 1N8ZB 3C6LB 5IVZB 5C0BE 1M7IA 3NIDE 4OKDA 3QXVA 1IE5A 2QKIA 2IFFH 4LKXA 2M8XA 4DUXA 5T1LD 2H9GA 3MRFA 1EAPA 1X5GA 3LKPB 3PWJA 4NSKA 3IFOA 1F4WL 1R3KB 3HZKA 4Z7WB 4Z95H 5JHDA 2IGFL 4DKFL 4GAFB 1U8LB 1BQSA 2N4IA 2AEQH 3EYQD 3BRGC 5J6GA 3H9HB 3MACH 4OZGA 4YDJB 2NYYC 4OLYL 1JZ2A 2GK0A 1KLFA 2F53D 3HG1E 1SVCP 1HCFX 1A7RH 2X1XR 1QKZL 5E6YA 3LIZH 4I0PC 2ESVE 3MUZ1 1YEKL 1FLRH 2FWOB 2WV3A 2QLVB 4L5FL 4P23A 1BECA 4F15C 2IPTH 4NDMB 1JGEB 4NZUL 5J1AA 2A77H 4I18A 4ZDHA 3UTTD 2VISA 4KXZI 2DQTL 1B6DA 5FO7B 3C5ZC 3N1FC 4NNPH 2YS4A 5I1DA 2J8UB 5FYJU 4P0DA 3X13A 3JVGA 1OAZL 5JDSB 1DQMH 2VXSH 3F7PC 3FQUB 4GUPB 4KKNA 2PTVA 4X7TB 1QPXA 2VRAA 3IAGC 3GSVB 4HXBH 5FM8A 1YEHH 3DUSA 4R2GD 2HMIC 1AHWB 1BFVL 3EJYD 1S5HB 3OKNB 2O5YL 1M71B 3H3PH 3LKRB 5I30L 2XTLA 4LSQH 5J13B 1U58B 4HGMA 4JFXA 5IKCA 2XTJD 4XVSH 4LLUB 4F7CB 3K81A 4OCSH 4YXHH 3EYUH 4LHUG 4LVNB 1CWVA 3MGOA 3HPJB 3S36H 4K7PL 1X5LA 4DTGH 5EPMA 2FSEA 2YRLA 5D2NA 2HFEA 35C8L 2IAMC 3SKUD 5FHAH 4WUUE 4N0UE 4JDVB 1I8KA 1MFNA 3B5GA 3RU8H 3SGJA 3V8OA 3OKMA 4LIQE 2HH0L 3L3JA 4ERSL 3QDGE 4F7TA 2FEDC 4IOIA 5DRZA 1C5DA 2J7LA 3BSZL 3RZCB 1U8MA 2Z31B 1U8NB 4EXKA 5JNYB 2FCBA 3PHOA 2IBGA 3L9RA 4WEUD 5IHLB 5C8JA 3P73B 4ELME 3GRWA 1PW3A 4M4PA 3S5LB 1Y6KR 3VXOA 1T5WA 2EDQA 5L2KA 1QACA 5F9JA 4U05A 2JK5B 4QF1A 3OV6A 2W59A 3C2SA 4TRPL 3SKJL 5HVHC 5T5NF 2VZ3A 4D9QE 5GGSB 4HWZB 3RP1A 1PX4A 3BMVA 2ORBL 4ONHA 3SDDA 1NDGA 1GZQA 5IB4A 3P4NB 5IFHH 4Y4KA 1UWXK 4H25A 1F4HA 3QULB 4I13B 1A7NH 2OL3H 1MEXH 1LILA 3LZFL 4Y5VC 1VEOA 3ALPA 1FHGA 3MRPA 3IDJA 5HYFA 2F58H 5IW3A 1HWGB 3DXAD 3SBWA 3WIHL 2V9TA 3BP7B 3I3BA 1JPGB 3MRBB 2FLRT 3MNZA 3RI5F 5IUSA 1N2RA 2LV4A 3L95A 4PJIB 5HHME 5FK9A 3TWCL 1XH3A 3UBXA 2XN9A 3GMOB 4FQCL 3G5ZB 4MVBC 1CLZL 4HIXH 2PO6A 3SE3A 1OQXA 1MHPL 5IFAL 1BF8A 4HIJB 3ZHKA 4N90E 4D0DA 2BOCB 3B3IA 4NC2B 2BJMH 2X4PB 4Y0GA 4RMRA 3MTRA 3ZHDA 1F97A 1PDKA 4YDKH 3MMEB 4TSBH 1T3FB 2VZVA 3ARFA 4LHJB 1QOKA 3EAKA 2AV7A 2AK1H 1QR1A 3I6GA 4APQA 2AKRB 4K3DL 2DQUH 3EYVA 5KSUA 4ALAH 2X9WA 3FKUS 4KJPD 5AEAA 1KB9J 4GLRH 1KNOB 1M6OA 3CAFA 1UACL 4KWUA 1I1YB 4EBQL 1FNHA 4Z7QF 3DIFB 5AUMA 1CICC 4BFIA 1NGZB 4NJ9L 5GRZA 1WCQA 4LQFH 4ELKB 4AENB 1UQSB 5FYKU 2NTSP 4OLXH 4M7JH 5DQ9A 2DLFH 3MX0A 2PXYC 2CDGA 3O3AA 4NN6B 1REIA 4ODVH 4BSVB 3F7RA 2D7MA 2FZ3B 5AAWA 3K2MC 1L6ZA 2Q86A 4XI5C 1S5IH 5MEOB 2OK0H 5B3JE 5GZOD 2PF6A 2B8OT 1BFTA 4WHDA 1RJYB 1T7VA 2GJ6B 3QYCA 3MXWL 4WEMB 4Q6YA 5D6DA 3KPSE 4F9LC 3EYSH 3ARDA 2YA2A 1QLFA 2F8XC 3HHRB 4CVXB 5ACMA 1H8SA 4GW4A 3TYGH 3HE7D 1HHGA 4DEPC 3BGAA 1FVDA 4EI5B 3OXRA 5MEQA 2RGSA 1A4JB 4JGMA 1KBGH 4H20L 3BKCL 1QSEA 1T4KA 4HZAA 4OZ4A 7FABH 1NMCC 3EFDH 3BGFB 3KNBB 3TVMA 3WXVL 3EFFB 4KMLB 1MAJA 5EU4A 3AAZA 3I02A 1IAIH 4JQVC 4JKWA 1JWMA 4JN1H 3L3IB 3TBVA 3P11L 2V17L 4OZHE 4PRHA 4JRWA 2HVJB 2DN7A 2ZNWA 2Y7QB 2VDLL 2ZCHL 4LLYA 1GGYA 3WS3A 1AD9B 4HT1H 4PJHA 3VGAC 4IRJC 1HOCA 3L3GB 1U93B 3HI1B 3SE8L 4QGTA 3PIQA 4OFVA 3JSSA 3MRKA 3B9KD 1XF2A 3DX8A 1YY8B 3RQ3A 1T04A 3T09A 2A6DA 1Q94B 3KAAA 5DJ2A 2QADC 1KTRL 1AD0A 1JCKA 2JCCB 3RVTC 4A6YB 4S0SD 3VXNB 3FQXA 2BY2A 4R96B 1JN6A 3C9NB 4Y2DA 4LCCC 3S96B 3RA7L 4XCCH 2FECL 2ESVB 4HEME 4JLRB 1BVKB 4X7EC 3IB4A 3STLA 3IKCA 4MXWH 3VFUB 3U83A 4G7YH 4FS0A 3V6OA 4Z5RB 1X4ZA 1BAFL 5EIVA 1R5IA 2H3NB 3QUKA 1ZGLP 1U8JA 4JREC 1WBXA 3TPUB 4E5XB 5BRZA 1FL5A 4U0RC 1KIQB 3RIAF 3LB6D 3MV7A 3QCVL 5C0AE 1D5ZB 3RKDD 3U30B 4PJ9B 1R24A 4IOFD 3NVQA 5C09E 4WU5B 1NBYA 5BZWB 1FZMB 3FT2B 1VCAA 3RX8A 4GRLD 4LAQL 4L4JA 4Z7VF 3O6ML 4PRNB 5T3XE 2BVEA 1HQRA 4OFYD 2AJ3A 3DVNB 4MX7A 4NKDB 1KEMH 5KVDH 3CC5A 4YX2L 4U6VH 1WVZA 2BRRH 4KK6D 4F7PB 1OL0A 1IC7H 1N7MH 1AGDB 1FN4A 1NAKH 4WUUB 4N0UB 4A6YL 3VFGH 1TTUA 5EC1A 5SWSE 3U9PL 2ARJA 2A9NL 4P4KD 3F65A 2ATPB 1JTTA 1YUHA 3VXRD 3OSKA 5HDBF 5K9QI 2EIDA 2R8SL 3CFBB 3QDGB 3V6FB 4JY6B 1JF6A 2OSLA 2X4SB 1IAOA 2NY1C 1MWAH 4Y4FB 1U8IA 4YHNA 2G2RB 1HQ4A 2R0ZL 2EE6A 3R0MA 4JFED 5D7SH 1HXYA 4OSUL 1FCGA 1E6JL 3QXAA 3SKNA 1YNTA 4URTB 1HEZB 3QUXB 1HI6B 4PJGA 1GC1C 4ORGA 5I9QB 2A83A 5IB2B 2LU3A 2R1XA 4NKOB 4LCWD 4LVEA 3ARBA 4XP1H 4V2CB 3GBLA 4HWNA 3QFJE 4NQVA 5FOBA 3MLUL 3IFPA 4S2SB 5GGTL 4MLIA 4X6CA 5F89B 4TVPH 4PREB 1NFDE 1L7IL 1JF5A 5IBUB 3GSOA 3MCLL 5FEBA 3ARYA 1U8PA 2DM4A 4GO6B 5HHMB 3D9AL 3W0WA 1I3UA 1ZHKB 3PWVB 4MCYA 4GAGL 2O5ZH 1I1AA 3QIUB 1H5BB 4N0YH 5DGQA 1YN6A 3RPIA 3TO4D 3LMJH 5F7EL 2AJUL 2P49B 3W9DB 4H5SA 2VLKA 1PFCA 3RY5A 4KZDL 1HILB 3DROB 4HV8A 4ODUB 3WHE0 5LWYH 1KTLA 3AMKA 1G9EA 5E5UB 4LIQL 2A9MH 2I26N 2IH3B 4YE4H 3KVQA 4M03A 1X4YA 1OD7A 4D8PA 4O2FB 2WBJA 3GKZA 4M48H 1JZ5A 1DBKH 2P8LB 3GI9H 5ID0B 2QSTA 2EYSA 4L9LB 4Q7DA 4U3HA 2WP3O 1LE9A 3SY0A 2YSSB 1YEJL 3KPMB 3CVIL 4HBCL 1UJ3B 2CLVA 4NQED 2ZSVB 4WW2F 3DMMD 1S9VB 2X4UA 4U1MB 5I66B 1HSAB 1J9CT 5DHVH 5IT2L 5DK0A 5E6IB 4FRWA 4L8BB 5DRXB 1ORSA 3TESA 1OAUL 4YUEH 4LFHD 4RFOH 4J1UB 5E56A 4PRIE 1UKQA 1N64H 4YWGL 5I1HH 3MRMB 4XPFH 1G9NL 5J4MA 1RMFH 3M17B 3KYKH 4ZYKB 4GRWF 4JO3L 4WTZG 1DFBL 5D2LF 5IVNA 2K1MA 5CEZH 3HRZA 1PLGL 32C2A 1FGNH 3RIFF 5EU6D 3RDTD 4X4YB 2XY1A 4MA3B 3KPSB 1AY1L 2J88H 1GL4B 5TF1L 1NC4B 3L7FA 1WAAA 1N59A 4HIIB 2EYTA 1OM3L 5IVXE 4RBPK 3GGWA 1IKFH 4EOWH 3O4OC 5GSRA 2DTMH 4IIQC 3MNWA 3FFCB 5CINH 4P5TA 4OV5A 4JFFB 4PJAA 2H2PD 1FFPA 4N9OB 4PJ5D 1ACZA 1E27A 2YZ8A 3RUGF 5IMKA 4QNPE 2VXTL 2Q87A 4F57H 4WCYH 1KJVA 3EO1A 4JCMA 3U6RB 1T66D 5ISZB 5JHLL 1NC2B 1R5WA 1CR9H 4RCAA 2C5DC 5D72L 4HKZB 1AI1L 3OHXB 2NNAB 1D6VH 1J86A 3D85D 5GRWA 4MMZC 3E8UH 1FV1B 5L2KE 5FGSA 2BXZA 1NCNA 5GIRB 3B6SB 3VXME 1ZEAH 3VGGA 1KJ2A 4UQ2A 3KYNA 2G5RA 2V7HA 5CD5D 4PTUB 1XIWB 5FDYA 4BZ2L 1XZ0A 5I8OH 3VXPA 4PGEB 2JIXA 3PWNB 5HHOE 3LCYA 4X8JA 1VACB 1OVZA 4F2MA 1OCWL 4FQJL 1LO3H 5H35A 3BKMH 3QB7C 5IROC 2ZPKH 2ZOKB 5BZDB 3GJFK 1CFQA 2CK0L 3AREA 3GMLB 3ULSA 3QEUA 4PRDA 3ARGD 1HH6A 5D1XB 4OFKA 2A6KA 3EHBC 1XMWA 4Z9KB 1IM9A 5MP6H 1F11A 3FRUB 2ZZUT 1JZ8A 5E6ZA 4ONGL 4KK8D 3C5SB 5DJ8B 2X70B 3QH3A 1V7MH 5BS0B 1MFEL 3CGTA 3S34L 4KHXL 4Y19A 3GJEA 1QTYT 5C09B 3PGFH 1EO8H 5DUPH 4PJFF 1BD2D 1FFNA 2DL2A 2M26A 1B2WH 2X4QB 3MRRB 4PLJD 5D93B 1YMHA 4QXWA 2HRPL 5B8CA 3GZKA 5D7IB 3W2DL 1F00I 1YEDB 2VTFA 1IC4L 2FBJL 2VXUH 4G3YL 2W60B 2VH5H 4OM0H 4QRSB 4Z0XA 4YK4C 3C8KA 3AS1A 3CSBA 4U1LB 4LLVB 4M43H 1TPXC 4R4BA 3ARXA 5KVGL 3L3KA 4JANB 4P3WA 5C0FA 1J8HA 1TVDA 4LU5L 3OPZH 1EZVY 3ZTNL 2YC1A 1KFAL 5T5FH 4MNGB 1N4XH 4JFQB 1AGCA 2R69L 3JWOC 5AWNL 2VL4A 5I8CA 5TJWK 1ZANL 4PJXF 3GJFA 4QOKA 3MBED 5JIPA 3BZ4B 4NQTA 1INDL 3TBYB 4F3FA 5HDQL 3WN5A 1CD8A 4JHWH 4QHNB 2BC4A 3HAEG 4LK4A 1R3IL 3LSOB 2YHGA 4GRMB 3T08A 4WEBL 3I75A 3VE0B 4CN6A 1T1YA 1GZPA 3UTTE 5DSCB 4Y5YC 5HGHB 2IQAB 3MRIA 1CFSA 2CDEB 2SEBB 3LQAL 4OUUB 4S11A 3OAYH 5EO0A 3GIVA 1NAMB 3GIZL 4LP5A 3QFJB 5ERWB 1OTTD 5I1EL 4TVPD 2VQ1A 3K4AA 5E4EB 4X9FA 1QLRB 2VLJB 4LVOB 1NBZA 4PP2A 1JIBA 1WZMA 2OR9L 1OGAD 4MZ3A 4MB4A 4ZFOA 5T3XL 4YPGB 4YLQT 3MFGB 1EIBA 4WU7A 3T65A 2HKFL 2WINB 4HPOH 3MA9H 1KPRB 4QRPD 5GGUA 2PTTA 3MROA 3BUYA 1DQJB 2I9TA 4XHQA 2XTJE 3QIWA 4QHLA 4DVRL 5DD5H 1NUNB 4MXVE 3QJFA 3VH8G 4L8SC 2QKIB 1T6WA 2AJZA 2YKLL 3WNMA 4LKXB 4HIHA 4MZ2A 1X5ZA 2R4SL 1XGPA 2H9GB 4YFDB 3MRFB 4CNIA 1EAPB 3PWJB 3AU1A 3NMEA 5F88A 1ADQL 4OI7A 2GT9A 3DPBA 1P9MC 4NWUH 4JQXA 4Y5XA 5BV7B 3HZKB 1YEEH 3VG9C 3H7BA 2ZUXA 2B1AH 5JHDB 4FTVD 4K94L 3RVUD 4HD9A 1PZUB 3UTOA 4NQCD 4DW2L 3G5YB 5J6GB 3MLRH 2GK0B 1JPSH 1SEBA 1VFBA 4G9FD 4K71B 5JW5B 5JW4M 3UTSD 4CDGC 1WK0A 2CGRL 1NAML 3MODL 4MCZA 4P23B 3AS0A 3V6OE 1BBDH 1EX0A 5J1AB 1AIFA 1CK0H 3PE9A 3BN9C 2VISB 4FQXB 3FB8A 3VRIA 5BW7A 3ULVC 4I3SL 2VLRE 4HHAA 4TUOA 5I8KL 2NY5C 1T7XA 1HHHB 4ZD3L 1DLFL 5BRZE 3O6FA 2F5BH 3CFCH 3DXAE 4U6YA 2ZWLT 4YNYB 5TE6L 5CEZD 4JAMA 1MCCA 1H3GA 4OF7A 1T80A 1E28A 2YK1L 3KPTA 3R06A 43CAA 4J3TA 2DKSA 1SM3H 1QR4A 1FYTD 1TZHB 3DUSB 3KS0J 3UDWA 3QWQB 4LCIL 1YYLH 3MJGX 3ESVF 2GQHA 1N5AA 5K9JH 4GKNA 4P3DA 2MHAA 2V7NB 4JFXB 5IKCB 5ADOL 1KCRL 1NCDL 5EG6C 2X1PA 5CEYA 9CGTA 3DI2B 1EJOL 4QXUL 5BV7L 5C07A 1P7QA 1EDQA 5EPMB 4U6XB 2FSEB 4ZAKC 5D2NB 2HFEB 4U7MA 2UYLA 4DN3H 3G9VA 4JVUA 3T0WA 1A1OB 5JDJA 4WV1C 5DD1L 3I85A 2GUOA 1UM5L 1YPZE 1I8KB 3RBSA 1HKLL 1A1NA 3OKMB 2APWA 2DQFA 2VDNL 3L3JB 1DVFC 2MQCA 2DDQL 4F7TB 3R8QA 4IOIB 1IEHA 5A3IC 4Q6IA 1NEUA 1U8MB 1DBJL 5CJOH 4OLUH 2XA3A 4NN7C 3MJ9H 3ZTJH 1EHNA 1FL6A 5C8JB 5A40E 4AZ8A 1NJ9A 3T3PF 2C3VA 1QSFD 1ND0A 3VXOB 1T5WB 4KQ3H 5L2KB 1EPFA 1OTSD 3IDYB 3RPKA 3VXMB 4AK1A 4PUBH 4K3JH 4ONHB 2NXZB 3FMGL 3WIIH 2HG5B 1NDGB 1GZQB 4TQEL 3SDDB 5IB4B 1X5KA 5C70A 4Y4KB 1Q9WB 4DAGL 3T0DA 4DVBB 2EZ0C 2H32B 2C1PA 1JK8A 2FR4A 4EQ2A 4UV7H 4UOJA 4PJEE 5EZJA 2BVUA 3IDJB 1FNSH 5C08A 5HHOB 5E4IA 2X9XA 1B4RA 4TYUA 4NNXA 5IHZB 1U8KA 2VDOL 1CL7L 4XGZB 1LDPL 2NYYD 3BWAA 1N2RB 1Z3GH 3L95B 5FK9B 3UBXB 3QHFL 3QDHA 3MPCA 4UILL 4OLWH 3DO7A 2X42A 1INEL 1KELH 2XIDA 12E8H 2QSQA 4JFDD 5BO1H 3BPCA 4IBLT 3RVVD 2APFA 4YHZL 2APBA 2UWEF 1UWGL 4DKEL 3TBTA 4JPKL 2C7UA 2PO6B 5E9DD 3D25A 3LKSB 4WJ5A 2EKJA 2IALA 3B9DA 4PV8A 1A9EA 1GOHA 3K46A 4D0DB 3HC3L 4JM2D 2NX5A 4LBEA 3B3IB 3TO2A 4WI4A 5DFTA 3HNTH 3WFHA 3WSQL 3MLTB 1D5IL 1IRAY 2AK4D 4XNZB 4HMEA 3BXNA 1TCMA 3F6IA 2AV7B 1I7TB 3I6GB 1IBGL 3GRWL 1DEEB 1FJ1B 3EYVB 5KSUB 1RZGA 3F62A 2GIYA 2BNRE 4GBXA 3J8F7 1QLEH 5T1LB 1ZHNA 2PN5A 3V5KA 5I1CH 2HFGL 2C9AA 5I6XC 3VFTB 3QEQD 3FB7A 1L0YA 3P0GB 1S7TB 2VWEE 1XGUA 3A6BL 4I2XA 3BZFA 5AUMB 4BFIB 1ZHLB 3P3YA 1UYWL 2CR3A 2WBKA 1M7XA 3MLXH 5DQ9B 3MLWH 5F6IB 3HZVA 4WWKD 1EEYA 3JZ7A 4HKBA 2CDGB 2DQDL 3O3AB 2MSPA 1IAKA 1RFDH 4QYOA 5E99H 2R1WB 2QBWA 5SWZA 2F54A 4F80A 3GHBL 3RWDA 4MJIA 3ARDB 1QLFB 1WAAE 4XVJL 5DR5L 4GW4B 4X9IA 3CLFL 5FO8A 1CZ8L 1HHGB 2EEBA 3BIAX 3RWIA 2BNQA 5J12C 1FVDB 1TVBB 4FQ2H 1GC1H 5MEQB 2I9LB 3OAZH 2FEEI 3SHSA 5C0CA 1TJHL 1EBPA 2BVQA 1VERA 1MJ8L 1T4KB 4X9HA 3GB7B 2EDBA 2NY4C 2EDTA 4X6BA 3AAZB 1RZFH 5D6CA 2LFGA 4FFWD 1JWMB 3Q3GA 4J3SA 5FYJH 3NA4A 4N8CL 3DX9B 2VDQL 3BEWA 4OI8A 4FNLH 1Q9OA 5DF0A 3LPWA 4LLYB 4LSDA 5ETUA 3SE9H 1PEWA 4H26B 4PJHB 1ZXQA 4L8CB 1ZTXL 4R97B 2P5EA 4P5MB 2LTQC 4I3RH 1CLOH 4HKJA 5F1NA 3PIQB 4NM8H 1ETZA 1QBAA 2AVGA 3MRKB 3STBA 3JTTA 3X12A 2DQCH 3DX8B 3VXRE 1IGIL 1T04B 2A6DB 5DJ2B 3SDCA 1AD0B 4C54A 3EZ8A 1YC8A 3ZYZA 3KS0H 3FQXB 1PKQE 1JGLH 2GTWB 2CKBA 5D71H 4JG1L 3GKWL 3AM8A 1JN6B 4Y2DB 3NCJH 4LLAA 5TH2A 3STLB 3IKCB 4PJ7E 1MCWM 3NIGE 3KR3H 3Q5TA 3TEUA 4Y16D 5JR1L 4UB0H 4XTRD 4J6RL 4NT6B 4C56A 1V05A 1R5IB 2VLRB 2NY7H 4JHAH 1R5VA 2B5IB 2PYEE 5I1AA 4UT9L 5BRZB 1FL5B 1XF4A 3DXAB 4OQTH 3QNZA 1R24B 4OIIL 3RY4A 2Y6SC 3I9GL 2PXYD 2ZUUA 1DQQA 1NBYB 1KCVL 3ILQC 2E3VA 1RZJL 1G7IA 2XXCB 3HUJA 3S36X 5F1SA 4U1JA 1HQRB 3QHZL 2VUYA 1U42A 5I73B 4MX7B 1H3VA 3ZDYE 1F58L 2E7MA 4RQQB 3CC5B 3E3QE 5F44A 1V3LA 4IMLB 3VRLE 5D7KD 1BIIA 1CF8L 4MD5A 2BOBB 5JZ7D 3OGCB 4AMKH 3Q0HA 2R2HB 2ARJB 4MA7H 4Z7VA 4RNRA 5TE7L 1YUHB 3QDMD 5IMMA 4DKDC 1AHWC 1F8TL 4YBQC 2NY2C 4NQEE 1W72H 1IAOB 2E9WA 2OI9B 1U8IB 4YHNB 5IR1B 1V3KA 5J13C 1TITA 1HQ4B 2AI0L 4WO4C 5CIPH 4LLQB 1NUDA 1J10A 3QXAB 1T5XA 3CMOL 1YNTB 4XT1C 4ZFGH 5FCUL 2A83B 3BAEH 4NNYB 2R1XB 3MXVL 3O2DA 4IRJD 4MAUL 4NQVB 3IS1X 3ULUF 5KOMC 3TFKC 5KSAD 4N8VB 3CPLA 3LHPL 2XZQH 4M3JA 1B90A 5FCSH 1NCCL 3P9MA 3IYLW 3BZDA 4PJEB 4B7LA 2BSSA 3FCTA 1NLDL 5EU6E 1YECL 2RQ8A 4FQIL 4RWYH 2QADD 1SMAA 2GTZA 1X5JA 2WNGA 3RZCC 3TJHC 2Z31C 2DM3A 3MLYL 1U8PB 1IGFH 1Q1JH 1I4FA 5IBTL 1A14H 2APVA 4CUCA 2IFGA 4JKKA 3W0WB 4F7EA 3MA7B 5EA0L 3ZZ1A 5JW4Q 4MCYB 5CJXC 4H0HB 4PR5B 4WTXA 4DGYL 1A02N 1F90H 4M61B 1YN6B 3VI4F 1WEJH 4GAJH 1PEZA 3RPIB 4GKSA 3NCMA 4H5SB 5E2JA 2VLKB 2D9CA 3G5XA 4QT5A 5DD6A 4PD4K 5DTFA 4PJ5E 4HV8B 3KPRD 5C3TA 2EDEA 5EBMA 1N6QL 4H1LA 2F5AH 4LDOB 3UPCA 5ID1B 5JXEC 5D7JA 1JPTL 4D8PB 3VRJA 3I6KA 1QZ1A 4LPWA 3C08H 5KS9F 3TBSA 1MIEH 3OX8A 3RIFK 1LE9B 4XNQB 3SY0B 3D69A 5J3HC 1A0QL 4FQPA 2BNRB 2CLVB 1CDGA 3JV4B 3TN0D 5K9KB 2X4UB 2VZOA 4P2QA 3GEWB 1U3JA 2DQHH 4TUJA 5DK0B 5H8DA 1OB1A 5JMOC 2JB5L 1FE8H 4E0RA 2HP4A 1DN0A 1MAMH 1ZV5A 1T1WA 4WGWB 4DN4H 4OD2A 2NY3D 4JEGB 2ICWI 3CK0L 4G8FB 3KJ4C 3UJJH 4Z77B 4NYLA 1QRND 2W9EL 1E4KC 4YQXL 3HRZB 4JY4B 1GGTA 2YXFA 2G9HA 2NY1D 3L7FB 3K1DA 5HI3C 5D7LD 4G8GA 2FATL 1OWWA 1P4IL 3MYZA 3GGWB 4ETQA 5GSRB 5D2LA 4P5TB 4S1RH 3ME0A 5DD3H 1QNZL 3D2UA 4CAGA 4XX1G 2AJYH 2PYFB 1E27B 1BD2E 1IGYB 2IFFL 4XXCA 3TC9A 3SCMA 2W65A 5KANI 1BZ7A 4X4XB 5FYJD 1KJVB 1T83A 1DDHA 4JRYE 2DF3A 1R5WB 4ODSL 4HWEL 4WNQA 2FX7L 3VFRB 5E08L 3MRJA 3NABH 2MNUA 4TPRL 2AW2A 4LMQE 4U31A 5TDNA 4P9HL 1V3MA 2A6IA 2JELL 3M8OH 3FO9A 4KK9C 3MACL 4KROB 3RUGA 3TJEH 2VL5B 4EI5C 1V8HA 1EK3A 3PGCB 1INQB 1NGWB 2WIIA 4X4ME 3MLSL 1KJ2B 5KVMC 3P4LA 3B9EA 3LIZL 3BGFC 3HFML 1XAUA 3KYNB 4KDVA 4UQ2B 1OOAA 2IPTL 4NCC2 4DFIA 1EUTA 1XZ0B 4JO1H 4KVCH 8FABA 2I25N 3VXPB 4M5ZH 5IESH 1MCOH 1F4XH 5SWQA 3CZFA 3HZMA 3S3JA 4DGIH 4X8JB 4F2MB 4RZCA 5I17A 3STZA 3DARA 4R3SA 3UAJD 4PJ7B 1IZKA 4JO4H 1G1CA 3NZ8A 2IPUK 2XKNA 1LO2L 4P2OA 1CFQB 3VI3E 5FECA 2F53A 4CU6A 3QEUB 4LARH 1A1MA 4PRDB 5DK2A 1HH6B 3VG0H 4AG4L 1D5MA 4K23H 4PJCE 2QQLL 4TVPE 2A6KB 1IM9B 1I7ZB 1VFUA 2PYEB 5D1QC 3N1GC 5HGAA 1A7BA 1Q9KA 4AEHH 4PY7A 1DLHA 3QH3B 3JXAA 4I9WD 5DO2C 4Z78A 5GXBB 4MMXC 3QCTH 3GJEB 1JHLH 2NY5H 4BH8A 1PGRB 3S36L 1KXQE 4RAVB 1YMHB 1LE5B 4J3UA 4ZO9A 5JOFA 4RGNE 4D9LL 1GGBH 3TO4B 4KDTA 4KQ4H 4CMMA 5CZKA 4Z0XB 3EOAA 4WFHE 1HCVA 3C8KB 2AV1A 3QXUA 1KJ2L 3QQ9C 4ENEC 3BUTA 3D3VD 1J8HB 2YC1B 2VB5A 4PJFA 1G84A 5F7WC 5FO9A 1RUQH 1AGCB 3PWPD 4FTVE 3L6FA 4QCIA 3U30C 4UDTA 3K80A 2YN3A 5I8CB 1T22B 3GJFB 2BVOB 1KXTB 4KKCC 3FQTB 4F3FB 4X83A 1YZZA 3QXTA 1VDGA 4F37K 1IM3B 3DMMB 4G9FE 4NBYB 2FX8H 1MH5A 5IFHL 3V0WH 1A6VH 2R2CA 4N5EC 2DI7A 3WFEH 4IRSD 3I75B 5CEXA 1T03H 3I6LD 2UZXB 2WWKO 3L5IA 3MRIB 5ESAB 2YA1A 3BP4A 1CFSB 4YGAB 3A67H 1AKJD 1YMMD 3EO9L 2E7LA 4NZJA 1I9IH 2BNQE 3ZKMD 4HC1L 2EH7H 4LCUA 5CEZE 4OM1H 5C86A 1JUFA 2Y72A 5ALCH 5EDXA 4PP2B 3VA6A 2EDWA 4XB7A 5EU6B 1FYTE 1U9KA 3CH1A 4ZFOB 4Y4FC 4BSWA 4HIXL 3GMPA 2V2XA 1CS6A 4PJ8C 4G42A 2N7BA 4H88L 2HJFA 5GGUB 2PTTB 1L0XA 3MROB 4Q2ZA 5KVEH 1D5XB 4Q58C 2I9TB 3IDNA 2ZSWA 3NAAH 1K2DA 2Z92A 3QUXC 4HKXA 5I9QC 1TXKA 1RIUH 2K9UA 1ZLVK 5IVOA 5EIIA 4HIHB 2XRAL 1CN4A 1XGPB 4CNIB 4PJ5B 3EHBD 4F9PC 1MF2H 2DWDA 2VDRH 2VSDA 3AU1B 5F88B 3E6FA 2JJVA 4Y5XB 4MA1B 2XZCL 4KTEH 3SJVA 4OFIA 3H7BB 3LS5L 5K9QG 5ALBH 1G9NC 4P3CL 3BZEA 1JGUH 5DEFA 3FT4A 4HX1B 2W0LA 4X6DE 1XGQA 3BD5A 5J06A 4LQFL 1L7TL 1QSFE 3QIUC 2R0KL 1VFBB 4Y1AD 1FSKB 4MCZB 4PFEA 3RBGA 4ODVL 4P4RA 4C56E 4RAHA 1S5IL 3VRIB 1EXUA 1VEPA 3CVHA 3VFPB 5LQBL 2GCYB 1X44A 2DIJA 4HHAB 4LSSH 4TUOB 5E70A 5C0EA 4PRPA 4ZFOL 1A6AA 2M2DA 2EXYD 5EZOL 1HN1A 4NRYA 4AL8H 5DMYA 1D5BA 3BMWA 4U6YB 1F6AB 3TYGL 4JAMB 1IL1B 4XPTH 1E28B 3R06B 1NGXB 1UJ3C 3N1PC 3BVNA 1CXKA 4JB9H 4ORZC 1S7QA 3ARGB 2I5YL 5FUCE 3HUJE 5D1ZA 1WWWX 2YRPA 3LN4A 4GKNB 3FHQA 4P3DB 2MHAB 5E6IC 1DQLL 5TFSH 3THML 3VJ6A 5E9DE 1Z9OA 4C83A 5CEYB 1IAIL 5CLTA 2NY0B 2ERJC 4GW1A 2E9IA 4JN1L 1TETH 1P7QB 1BBJA 5SX4H 5I19L 2H41A 5JOPE 4O02L 5GS3A 3FRPG 4AM0A 1VSCA 1GHFH 2CJUL 5CFHA 4HT1L 1AQKL 2AK4E 5HYJA 2D4DA 4LHUA 3TNNB 4FFZH 1F4WH 1T0MB 4JRYB 2ZG1A 3DVGA 4NIKB 4N68A 4Q6IB 4OF5A 1RHFA 4DKFH 4W6WB 2OP4L 2J3SA 4JO2L 4NO0A 1FL6B 5F7DA 4UINL 3HC0A 3QEQE 3MR9A 4MD0A 4Y4HC 5IWLA 2C3VB 3IDXL 5FA3B 3HE6A 1ND0B 4AYFA 4LGRB 3AY4C 1EA9C 1KENL 5BXFA 5IG7A 4ODHL 3PHQA 5C3LD 1JMXA 4L5FH 1C08A 1MUJB 4NZUH 5DRWA 1HNFA 3RGVC 2C1PB 1JK8B 1MRCH 2GAZA 2FR4B 1KGCD 2DQTH 4OGXL 5D5MF 2EDOA 3FT3A 5E1HB 2H26A 5C08B 4C4KT 4QHMA 4J7RA 3VWKD 1CQYA 1OAZH 4NNXB 1U8KB 3PXHA 1PYWA 4P46C 3BWAB 5E2VL 5JLZA 3ZE1E 1NH6A 1AC0A 1W0VA 1I75A 4PJCB 4EN3D 5F3HA 4ZXBC 1KIPB 2O5YH 1ES0A 4ZNCD 3GMRA 5I30H 5A43C 3D25B 3BN9D 4LF3A 3PV6A 3QNYA 4WJ5B 2IALB 4PV8B 1A9EB 4FZEH 3LH2L 2NX5B 5FM4A 4GH7B 1W8NA 1NCWH 3TO2B 3WFCL 3SPVB 4K7PH 1J05A 4I0CC 5ITBL 3X11A 3BYTA 1ONQB 2VSCA 3RWHA 4MQXC 3WJJC 35C8H 1ZA6A 1SY6A 5IF0A 2BRRL 3VMNA 3NTCH 3BXNB 1WTGT 2UWEA 5L9DL 1N7ML 1NAKL 4RGNB 5HJ3A 1B9ZA 1UM6H 4ZS6C 1KIRA 1DZBA 5D1XC 4ZOAA 4ERSH 1UENA 1ZHNB 3D0LA 4P2QE 3ETBF 1DUYA 4P5KA 5I1LA 4M7ZC 1J1XH 2VJXA 3LQAC 1QBLH 4OFYA 5DDHA 2AXFA 1G9ML 5I0ZA 3OR6B 2ITCA 3VD5A 5T1KD 1KYOJ 1KJMA 2IBZY 1AP2A 1P7HL 4ODTL 4TRPH 4ZQKB 1CXFA 1T2XA 4OD1L 2J1KA 2DQJL 1A6ZA 4HKBB 3P9LA 3KLHC 1BVLB 4XP1L 1MFAH 4QYOB 2W9LA 4G9FB 4CGTA 5INDB 1VFMA 1NEZG 3LN9A 3LZFH 3ZKXB 2F54B 4HCRA 4RAUA 1QQDA 5MI0B 2O5XL 4IEFB 4MJIB 4HSQA 4XNMA 3REVA 4Z76B 3C60A 3SGKA 4I3GA 5I2IA 4F33A 4JFEA 1FZOA 5FO8B 4OGZA 3TWCH 3GSUB 3BGMA 3RWIB 2BNQB 4FQCH 2MKLC 2ZJSL 3IFLL 3QUYD 1WSST 4IJ3B 4LCWA 5F7YC 1K3IA 5KSVB 2O5ZL 1ZGLA 2BVQB 4UIMA 3B2UC 1AH1A 1N0XL 4N1HB 1WIPA 4K94C 5F1IA 4JRXD 4DCQB 2VZSA 4X6BB 5EO1A 2OMBA 1LD9B 5D6CB 3ZKND 1NCUA 5LWYL 1GGIL 2A9ML 1Q9OB 1MCJA 2CIKA 4OD3L 4NO5B 5ETUB 1FZKA 3N0PB 1F42A 3E6HA 3FOMB 1YNLL 5H94A 4L4TA 1DBKL 4K3DH 2P5EB 3DGCR 5E4EC 5DUML 2ED7A 4LVOC 3B9AA 1FH5H 5BMFL 1UACH 4EUPH 3X12B 4EBQH 3QZWG 1C8PA 2WBWB 1LEIA 3O2WL 3Q2CA 3SDCB 4N0CD 4P2RD 1HK6A 3V5DA 4V1DD 2EEAA 1SJHB 2CKBB 2EDXA 3VMOA 1AXSA 4OBRA 1QSFB 6CGTA 2X4RA 3RJDA 5IM7A 4DZBB 1OTUC 1XCQA 3ORJA 5TH2B 4XPFL 4XRCA 1XGRB 2MWCA 2FD6L 1AE6L 4G43B 1UH4A 3TZVD 3U0TA 5CEZL 5H37H 3UYRL 4C56B 1FGNL 3MXWH 2ILLA 4KJQC 4KRPD 3WLBA 5BV7C 3T77A 4Z8FL 1TJGL 1R5VB 2VIRA 5I1AB 2NR6C 3KLDA 1LO4H 3T8XA 4CL7A 4K8RC 1XF4B 2EDHA 1AR1D 5DRNA 3QNZB 4LRIC 3QRFM 3OKOA 1IKFL 1K5NA 4HH8A 1R3LB 1DQQB 4WY7L 3B83A 4PP1C 1EHAA 5L0QC 4J4PA 2NW3A 3WXVH 3HUJB 4P23C 4GG8B 4HJ0D 3SDAC 1SYVA 2LU4A 3QNXB 1WIUA 1XF1A 2IMNA 4XBGB 4FQXC 2PW1A 2V17H 3P11H 2NW2A 4XPAL 3KPRE 1VFOA 2BY3A 5DVLA 4HLJA 2VDLH 2ZCHH 3IJYA 3BIKA 2VDML 1IVLA 4PJBF 4Z7VB 3SE8H 3WFDL 4RNRB 2CKBL 1T0NB 5IMMB 2CDFB 5IBLC 2NY4D 1ZEAL 2Q1EA 3S5LG 4XC3L 4CVZB 3O41A 4KJYA 5J11B 1IAMA 5GSVA 3HI5L 4YHIA 3V4VL 1FAIL 1T5XB 1L4IA 5HGGS 1AO7D 3RA7H 2O61A 4NCC1 4LNRA 3MV9D 1MVUA 4BKLA 3QUMA 1LO3L 1RVFL 4ZUVA 1LP9F 1XCTA 2QQNH 1BAFH 2VABB 1QRNE 4FG6D 5E8DL 5F7UA 3W5NA 1ZK9A 3FCTB 1KCSL 1UC6A 3QEGH 5MP6L 2E27L 4ZPVA 1K4DA 2CXGA 4GFTB 1I4FB 3RY6A 1NUGA 3QEHA 5D7LE 3C6LD 4XAKD 4F7EB 1VFAA 3LV3B 3VDAA 3IDYC 3PGFL 1U91A 3IETA 2YOCA 2NXYB 4LAQH 3KPQA 5BJTA 3ISWA 1B2WL 2NXZC 3O6MH 3BKJH 3VWJA 4HJGA 5AYUH 1AGBA 3G5XB 4QT5B 1Q72L 1T1XA 3DX6B 4Y4KC 2X4TA 2EDKA 4KVNL 3SOBL 5FF6A 5GQBA 4H0IA 2XWTA 5FYJE 4LPVA 4YX2H 3SDXE 4U1KA 1P84K 4YDVA 4H1LB 1Y0LA 2P5WA 5L8KB 5D7JB 5LCVL 3TT1L 4ZNEA 4L3CB 3I6KB 3TLRA 4LSTH 4I5BB 3BW9A 3U9PH 3TBSB 5T5FL 3U0PA 1U3HC 2A9NH 1QFUL 2H8PA 3D69B 2R4RH 2QQQA 4WVRA 3O4LE 3O2DL 2R8SH 4XP4H 5JO5B 1Z9MA 1EVTC 4P2QB 1S9XA 4L29A 3C2AH 1AXIB 2FYYA 4RFNC 4TUJB 3EYOA 3VFWA 4RMUA 3NFNA 3E2HC 4UAOB 4JQIL 1BFOB 2HKHL 3H9YA 1ZGLM 1MCNA 3GHEL 2CR6A 1E4WL 4PV9A 3UXFA 5KS9A 1T1WB 1JNJA 4UV4L 4OD2B 3WO4B 4XNZC 4OGAD 5IFJA 3QRGL 4NYLB 5GGTH 3TA3B 3WFZA 5ESVA 3VGHA 5IB5B 4P9MH 1QO3A 4G6ML 3OKEA 1L7IH 1J87A 1CVRA 4OF0A 1JTOA 3MCLH 1SQ2N 2DTSA 4HWBA 2IBZX 4WTZA 3SO3B 4IS6A 3D9AH 5GRVK 4ETQB 1U8HA 4HPOL 1KIUA 1WZKA 3PGDB 4I9WE 3EYQC 2ZUYA 2BXYA 2CLRA 3T0XA 1FL3A 4MQSB 4OZIF 1OAXL 1J1PL 5F6IC 5F7EH 2AJUH 2ZUVA 4BK5A 2WM0A 4KZDH 8CGTA 1G7LB 3SCMB 1BZ7B 5EUOF 2QHLA 1DDHB 2J4WH 4LIQH 1MPAL 3RZCD 2Z31D 2E6QA 4KZEL 4WNQB 2AP2A 2Z35B 3U36B 2FO4A 4OAWA 1YEEL 4X7DC 3SDYL 1NANH 4QRPA 2A6IB 3D3VE 3FO9B 2BERA 4PGJA 1YEJH 3CVIH 4HBCH 3RUGB 2BVYA 1WT5A 1CG9A 4TNVF 3CH8A 1JPSL 4YHML 5EU3A 4U1IA 5IT2H 4HLZG 1KLGA 2OTWA 4KGJA 4GLRI 2OCFD 8FABB 3DV4B 1CK0L 1F6FB 2XTJC 3T3PE 1MQKL 5SWQB 3CZFB 3HZMB 1TNNA 1Z6JT 2PNDA 4YWGH 3FQRB 3I6LE 4RZCB 5B39B 1RZJC 3IDGA 5I17B 4JCLA 3STZB 4NQCA 5GS0H 2Z4QA 4JO3H 5KTEL 1DFBH 4PG2A 5J3HD 3NZ8B 2XKNB 1PLGH 4P2OB 5DK2B 3HS0A 3HMWL 3WYRA 3B5TA 1D5MB 1AY1H 2X89A 1SM3L 5KSAB 5TF1H 4G6AC 5JQHC 2EIZA 5HGAB 1Q9KB 2EDJA 3MRHA 1CGXA 1DLHB 3ZDZE 5FYKE 3FFDB 3QA3A 3CJJA 2NY6B 3TYFB 4JPIA 4PJDE 1U92B 5IHBA 1G0XA 3GO1L 4RISH 5F1KC 3JUZA 4KV5F 4BH8B 5FKAB 3OKDA 3PP3H 3P4MB 3MZGB 1RPQA 2UWEE 1NGQL 4NCDA 2VXTH 1A6WL 3ZE0F 3V6OC 3UZEA 4CMMB 5EN2A 3EOAB 1KTDB 1N0LA 5JHLH 5FOJA 2B39A 2P45B 3IF1B 1T89A 2QR0A 1K8IA 4PLOB 2B5IC 1UZ6E 3VMPA 1AI1H 4YFLF 4UNVA 3F7YA 5D70H 2XWBA 4OLUL 4RRPG 5FO9B 4QCIB 2Y07H 2ID5A 2MOVA 4EDXA 1S7XA 5FM5M 1EHXA 3NCCB 4XBEH 1OSPH 4ZUTA 4PUBL 1JHTB 3VCLA 3TN0B 2GJ6D 4BZ2H 4Y1AE 3BPLC 5I73C 1LNUB 2VO5A 5CEXB 4ZODA 1JNLL 4JHBA 3BP4B 4KK9D 1RV6X 3DNKA 3HAEA 4EI5D 4M1DL 2ENYA 2CK0H 3UJIL 1Z3GL 4MXQD 1GGUA 2AEWA 3D18B 4LPTA 1G7QB 4R0LC 5BO1L 5DWUH 4Q97A 1N3NB 3P30L 4KUZL 3QO1B 5EU7E 4KJPC 3DI3B 4ONGH 5L8LB 2OI9C 2CXKA 4BSWB 2YBRA 2V2XB 4LEXH 4G42B 2CRMA 1X3DA 1MFEH 3S34H 4CJ0A 2HJFB 5D7LB 4Q2ZB 2ZSWB 1K2DB 4B0MM 3ULVF 4ZFZA 2B4CH 2HRPH 4NQXA 3W2DH 5JIHA 4BJLA 4UBDC 4G3YH 2IANA 5HGBA 1DJSA 4XNYL 4I0PA 1OAKL 4OF8A 3RWEA 2DWDB 1KB5A 3VH8A 1QLEL 4AEIL 3SDXB 5IHUH 5GZOC 3SJVB 5DO2D 3TIEA 4NHCH 4LCYA 3BZEB 1I9JL 3SQOL 3C5ZA 4L4VA 2R69H 1SYSA 1MI5A 3NIFE 4H0GA 4BZ1H 5LKNA 4G8IB 5AWNH 1FP5A 3HE7C 4LMQI 1ZANH 2ESVD 1GXEA 2CRZA 3O4LB 3KYMA 5HDQH 3BP5B 2HTKC 3EOBA 3BPOC 1R3IH 5T5NG 4P4RB 5E99L 4ENED 1EXUB 3CVHB 5C0RH 1BX2A 4U0QB 1BQHA 1KGCE 4PRPB 1AGFA 1A6AB 4NRYB 1D5BB 4WHTA 4PJ9D 4O2CA 3TH2T 3GIZH 4QRUA 2E6PA 4FMFA 3VXSA 5K59F 4KJWC 3OAUH 2IAMA 3AC0A 3BVNB 3OG4B 5J56B 4KKCD 1G6VK 5EOTA 2J5LB 4TSCL 4LGSB 1YDPA 1S7QB 2OR9H 4E9LA 5LBSL 1Q0YL 5D1ZB 2EECA 4RA3A 2VWEC 2W0FB 3MJ8A 1PY4A 1J7VR 3B9KC 4WTWA 3VJ6B 4P9HC 3S8WA 3FO2A 3DTXA 3EDEA 5EWIL 3KXFE 4U2ZA 2FHCA 2W92A 4DVRH 3MV8E 4K9EL 4MNHA 3NCYS 4ZS7H 3O3UN 2YRZA 3VGEA 1QEWA 4WUUD 4MA8H 3RHWF 3T3MF 2YKLH 4AM0B 4C59B 5HYJB 1N6VA 4MHHI 1FC2D 3PL6B 5GHWL 2QL1A 4LHUB 3ROOA 3D0VA 3QDGD 1ADQH 4I3RL 1QSZA 3BESR 4Y4FD 5E5MB 3S98A 1H3WM 3DVGB 2DQCL 4OZFH 4NO0B 4DW2H 3QDJD 5F7DB 4QGYA 3HC0B 3D3VB 3MR9B 3QUXD 1QSVA 2G60H 3CVHL 3HE6B 3UZVB 3LB6C 4PGBA 1WZ1L 5IG7B 5GZND 2Y1VA 5ENWA 4ZUWB 3RKDC 1LDSA 3VD7A 5I1GL 4MDIA 3LEYH 1NAMH 3MODH 1KYOK 1C08B 3ARQA 4GRLC 4U6HB 4MQ7B 5DRWB 4NPYA 4UB0L 4K7PY 1IGML 2GAZB 4I3SH 1IQDB 5E7FA 1MCHA 3FT3B 2H26B 4FZ8H 5I8KH 1XF5A 4ZD3H 1DLFH 5GS0D 4CVUA 4JHAL 2N56A 5TE6H 5HBBA 5JLZB 4OQTL 4GAYA 1UWEL 3QIUD 4KROC 3CU7A 1W0VB 4X7FC 3DX7A 5HVFB 2QJDA 5F3HB 1EERB 4P4KC 1HE7A 4LCIH 1CFNB 2Z8VC 2Z8RA 1RJZA 1YNKL 5D5MA 4AIOA 4N1CA 3GMRB 1FDLL 5ADOH 1KCRH 3DECA 1NCDH 4OLEA 3H42L 5I75B 4MYWB 4PJDB 4QXUH 1CYGA 5BV7H 3WCYA 3M1BA 2R39A 1J05B 1CICA 1C7SA 5F1OB 2P5WE 3X11B 5ELIA 3RWHB 1BJ1J 1ZA6B 1FRGL 4ZNEE 3ZE2E 2UWEB 1UM5H 1C5BL 3VXQA 5ADPL 5E00B 1F4AA 4WHYG 1KIRB 1HKLH 1ERNA 3NACL 1FIEA 4RFEB 2DDQH 5FUZH 2FJHA 1BMGA 5E6ID 3PG2A 4OJFL 4GG6F 3IDIB 1CDBA 1DBJH 2XNAA 2D7OA 4OI9A 5I1LB 5A16A 3U7YL 1TQCB 2COQA 4F9LA 2AXFB 2Z9TA 3H2WA 2ITCB 3B9VA 2IPKA 1FO0B 1JYXA 1KJMB 1AP2B 3O0RL 4V1DE 3FMGH 2CUHA 4CADB 3P9LB 4TQEH 2X41A 4KI5D 2IBBA 4MQTB 1G0DA 5DA0B 3TO4C 4Y1AB 3KPSD 3PQYA 4HK0A 3QDMA 1BZ9A 1C1EL 4DOHE 1NC4D 5TDPA 1QQDB 3REVB 3E3QC 3C60B 4UOW1 4JQVA 4RWYL 3OMZA 2V5MA 2VDOH 1CL7H 3RWGA 4F33B 5I2IB 1LDPH 5KVFL 1FZOB 1RU9L 1TLKA 1TZIA 5FYKL 1IGFL 1Q1JL 3FFCD 2MQ3A 3QHFH 2W0KA 3BGMB 4JFFD 2FGZA 1INEH 1EJ6A 4Y88A 5GGSY 4LASL 4ZSOA 4YHZH 4QRQA 2QSVA 1ITBB 1SY6L 4UIMB 1AJ7L 1QRKA 1U36A 3DMMC 5ISZD 3CDGA 1NC2D 5HYQA 2NPLX 5EO1B 1KCKA 4J8RA 4UDUA 1NUFA 2CO6B 4HF5L 1F6LL 4NKIL 3WSQH 3C5JA 1D5IH 3U4EA 1VADA 2CIKB 3QQ4A 4F8QA 4Y8AA 4Z7OF 2OTUB 1A22B 4Z7WF 2HYMA 5H94B 3GRWH 4L4TB 2B7DT 1FO0L 1I3RA 1XFPA 3UTZB 2JB6B 4TSAL 4AEFA 1RK0A 4NZDA 1NSNL 2HFGH 1DL7L 4RDQG 4L8DA 3R8BB 1XIWD 3RDTC 3SGDH 5D96C 3A6BH 5DI8B 2DQHL 2A73A 5BQ7A 2OBGA 3S7GA 5IMLA 3V5DB 5IIEA 1ZHBB 4HCRL 2XI9A 1UYWH 1PZ5A 4MQXD 1URLA 1MAML 3NOIA 3UTQA 4J3VA 3MCKA 5KN5B 2EO1A 1AXSB 4DN4L 4IDLA 5DJDA 2DQDH 3OKYA 4ZS6D 2J8UF 3MV9E 2H2PC 4U4BA 5DJ6B 3RWCA 1GIGL 1BJ8A 3U0TB 2E7BA 4JZNB 3GHBH 5TQ0L 3I3DA 2YD2A 4MA1C 3G6JE 2Q3AA 1HSBA 1T66C 4XVJH 4FQLL 1CXIA 5DR5H 5BS0D 2VKWA 2J6EA 1CZ8H 1G7HA 3QHTC 2OJEA 3QWRA 2APXA 5C09D 3WLWC 3VWKB 3OKOB 2YN5A 1D9KD 3G04B 3T2NL 1CXEA 1K5NB 4XAKE 4M00A 4QRRA 4GQ9L 1TJHH 4QWWC 5DD3L 1FSKC 3BO8A 5TGBA 4UTAL 1SEQH 5HHXL 2EE3A 2EE9A 1SYVB 3FB5A 3CFIC 4HH9B 1UWXH 4YDIH 4NC1E 5CD5C 5BW7C 1GJIA 3KXFB 4N8CH 3MV8B 2NW2B 1IGTA 2VDQH 1D6EB 4Z7NE 3DHMA 1T0PB 2ZCLL 3BIKB 2KQMA 2AQ3A 2JJSC 4XZUA 3NABL 5GGRA 1ZTXH 2ZUQB 3HZYA 5T3ZE 3M8OL 4NRZA 1RY7B 3B2UD 3X14B 5DMGD 1NBQA 5GJTL 2BP3A 1CBVL 3ARGC 4EVNA 2ADGB 3JUYA 2GITA 2BNUA 1KLUB 1N5YL 4BFBD 1TIUA 3O41B 3FTGB 1JTPA 5DMIH 5GSVB 2A1WL 4YHIB 4KVCL 1J0KA 4KK8C 1Z2KA 2NY0C 4PPTA 4JG1H 3GKWH 5IESL 4PJBA 4HDIA 3V6ZB 2O61B 1RUKL 4Z6AT 3QFJD 5CP7B 3D39A 3QUMB 1CD1B 2YPLA 4MB5A 4ZUVB 1UKSA 2VLJD 1XCTB 4JO4L 4J6RH 3V7AG 2W91A 5HYSG 1BJ1H 4K23L 1IZJA 1FVCA 3VXTA 3PWUB 3HNSL 1V3JA 1MRDH 4Q6IC 4UT9H 4PBVC 3QEHB 4OIIH 1UXSA 5GS1A 2X1OA 4N8PA 5F93C 3BD4A 1LP9A 1XT5A 2XPGA 1KCVH 4N9GB 1U91B 3IETB 3WUZA 1ZA3A 3MOQA 4KAQH 1RZJH 3FAWA 3QUYB 5HGDA 2MCPH 5F9WC 3VWJB 5I71C 1AGBB 2IANE 3MBEC 1T1XB 3QHZH 2X4TB 4KJQD 4KPHH 1GGBL 2FRGP 4OLZL 3VFVA 1F58H 3MREA 4LEOB 2NR6D 3QIBA 5JHDD 5KJRL 2RBLA 1Y0LB 2P5WB 4M02A 1CF8H 4YZFF 1LEKB 3IRZA 3NZHL 4L4VE 1MI5E 4KK5C 3Q5OA 2H8PB 5TE7H 3QI9B 2EE2A 3OJDB 2ADIA 3DURA 4P23D 2D31A 2HTLC 3QUML 4LOUD 2X44D 3VFWB 2AI0H 4FQXD 1RSFA 4GXUN 5ICXA 2CK2A 5J6HA 4NQSA 3CMOH 1A6VL 4G9DA 3WFEL 1XEDA 4TULH 1BIHA 5FCUH 4LPCA 3MFFB 1T03L 1P6AB 3MXVH 1CDCA 4MAUH 4EDWH 2DBJA 5IFJB 1KT2A 2DAVA 3A67L 3BRDA 1A21A 4IMKC 4PJIE 4RGNC 2BSTA 5ESVB 1I9IL 4ESKA 5IBLD 4FQQB 1NCCH 1QO3B 2EH7L 2J12B 4NKMB 4OM1L 1NLDH 3OKEB 1B0RB 4FQIH 4J3OC 3KYOA 1LHZA 2OQJB 3MLYH 3S35H 3SKOA 4IS6B 3VU2A 1U8HB 3ARSA 3KLAB 2M1KA 4LL9A 5EA0H 3O8XB 2CLRB 3DVFA 4DGYH 1RIUL 5GPRA 1YMMA 1JRHH 3NIDF 4QTIL 1F3JA 4M7LT 3NCFB 2ZCKL 3VD9A 5MI0C 3DUUA 2KH2B 1MJ7L 4KKLC 5LGKA 4KTEL 4OAWB 4WW1A 1A7QH 1JPTH 4OZIA 1CDUA 2C3XA 2VR4A 1QFWL 5L2KD 4NWTL 1U3ZA 3MUHL 3IU4L 4X9GA 1T2QH 1EFXA 1A0QH 1TCRA 1CG9B 4CKVX 4IJ3C 3QUZA 5EUOA 1KPVB 3SDDD 5EU3B 5IROA 3CMGA 2NTFA 4U1IB 4Y4KD 3T4AB 5AD0A 5FDWA 3ECBA 4ACPA 1KLGB 2VE6A 3WD5H 2JB5H 5IK3A 4E41A 4KGLA 1MIML 2A74B 3DWTA 2GJ6E 1B0WA 3OXSB 2E8ZA 3EIFA 3CK0H 2F8VA 3IDGB 2W9EH 4KI1A 2PCPA 1ZLWH 5D4QA 4XPTL 4GW5A 3HRPA 4G8EA 2PO6D 4XVTH 4PB9H 1ORQB 4JB9L 3TH3T 2EIZB 3WJLA 2FATH 3WDIA 1P4IH 1FNLA 4M6AA 3QA3B 5I15L 4JPIB 1NCAH 3RL1A 5DJAB 5CSBA 1E4XI 1EHLH 3ARFD 3QXDA 2XQBL 4HULB 1TETL 2UVEA 3H0TA 1QNZH 5C9KA 4OTXL 1VB9A 1OTSC 1UADC 3U48A 1JGDA 3CXHJ 1GHFL 5CMAA 4XH2A 3CFEA 4QRTB 1R0AH 4JFYB 4AQOA 2B1HH 4ODSH 5EFIA 4HWEH 5JPMB 2NZIA 4FFZL 2FX7H 2QR0B 1K8IB 3DRQA 5E08H 4TPRH 4P9HH 5CWSA 3U4BH 2XWBB 2JELH 2JCCE 4Y5YA 4DFHA 5CGTA 5EOQL 43C9A 2VAAA 3N06B 3O3DA 4JPWL 4BH7A 5GRVL 4ELMF 4EDXB 5CSZA 1OGTA 1S7XB 1NBVH 1JZ6A 3MLSH 1KN4L 4ZTPL 1S7SA 2Y36L 5FUCC 3HFMH 3RVVC 3WBDA 3VFOA 1OAQH 3O2VL 4V2BA 1RZKL 1B88A 4HK3J 3HKFA 3ARDD 1MRCL 1F13A 4JM2C 2DM7A 1CFTA 4N8VG 2DQGH 3GM0A 3HAEB 2HFFA 4PLKC 4L8SA 1LO2H 3O11A 4BUHA 4Z7UA 4XWOD 2PUQT 4AG4H 2QQLH 3K1KC 4UQ3A 4PGDA 1CD9B 2C3HA 1XF3A 2X6MA 5DS8A 5IEHA 5D9SA 2YBRB 3QG7L 5J11C 5CKGA 5C0JA 4G6JL 4AH2B 2R29H 1K9TA 5EOCJ 3X3FL 4FZEL 1C12A 1NCWL 2JJUA 4ZFZB 1X6NA 1TTFA 2PETA 1LO5B 1MCIA 4NQXB 1FNEA 1QVOA 5EU5A 3NTCL 5FGRA 4D9LH 4YDLC 4WWKC 2IANB 5T3ZL 3BT2H 2WAHA 4JG0H 1UM6L 4FXLA 4G6AD 2ATKA 3VH8B 1KJ2H 2YUZA 2BVPA 2DD8L 4R9HA 1IT9L 4FFVD 1MCSA 3ZT7A 3A0OA 5IW1A 2KKQA 3X3GL 3TIEB 3O6LL 1J1XL 1QBLL 3C5ZB 4L4VB 1MI5B 4JM4H 2FH6A 4Y2DD 3QDJE 2P8MA 4RBPH 1U8OA 3S37X 3KPPA 5ILTL 3JWDL 3QPQC 3KYMB 4EUPB 1G7PB 3EOBB 4JGJA 4GSDL 4M6ML 3BEVB 1MFAL 2VLRD 3ALWA 1DCLA 1BX2B 1MCPH 5E2TH 5B3JF 5BRZD 4FFWC 4P99A 3RHWK 2Q7YA 3MV7D 5D7JC 4PRAA 5DUBA 4AT6A 3EO9H 3BQUB 3I2CH 4O2CB 3RTQA 1WBYA 4QRUB 3BHBB 1B4JL 3VXSB 4HC1H 4ZAKA 1P4LA 1NFIA 5E8OA 4YBHA 3WUWA 1FORL 3ZMRA 5EOTB 4WV1A 4WI2A 1YDPB 1YQVL 1VHPA 4NKQB 5JUEL 4NBZB 2VYRE 3V8CA 3DUHA 4H88H 1DVFA 3FO2B 4MJ6A 3ARUA 2GSIA 5IOPA 1WJ3A 5HYIA 4U1SA 1YEGL 1PAMA 3WO4C 3Q5YA 3UEZA 1PD6A 3G5VA 4OZHF 3DBXA 2XRAH 4LLDB 3GK8L 3HCVA 3FONB 2QV2A 3TA3C 5FGCE 2V2WA 2BZDA 3ROOB 3D0VB 5CJBA 4R6UA 4Y16C 3DGGA 3GJFH 1I8LC 5TQ2H 2XZCH 4XTRC 1FH5L 1KTKE 1IGJA 3LS5H 1A6TA 1JZ4A 1H3PH 1X9QA 3FRPA 4XNUH 3HR5A 1HINL 4L3EA 5C2UB 1AGEA 4LSVH 4P3CH 4JRXA 1MCWW 3HMXA 3I84A 2EC9U 1W0YT 5DYOA 1FYHB 3AUVA 1HH9B 1L7TH 3T1FB 5ENWB 1A6UL 5I1IH 5IMOA 4UBDD 2R0KH 3UPRB 2O93L 2VNCA 4MD4B 4EEEA 3MGTA 3EYFB 2D7NA 1H8OA 3V5HA 3SCMC 1I1CA 1J11A 1FNGA 2D2OA 4KI5E 2EIEA 3G08B 5LQBH 3T2PA 2Q6WA 5F3BA 2E9BA 5EZOH 3N50A 2YD4A 3W0WD 1CE6A 1LO4L 4R7NA 1G6RA 4JFPA 4N5UA 3MRCA 4GAYB 2CPCA 4MJ2A 5CS7A 1A9BA 5JZ7C 3FFCE 4JFFE 3DX7B 2R23A 4JFOA 2HTKD 3CLEH 2I5YH 2VLKD 1RJZB 5D5MB 2E7CA 1DQLH 3THMH 3S3PA 3WE6A 2AEPL 4HPYL 3IJSA 4CU7A 2Y23A 3H6JA 3SQBA 3MUY1 5ISZE 2VC2L 3GSNA 3M1BB 5CSGA 2I24N 5I19H 2WBJD 5H2BA 1CICB 3VXUA 2D0FA 4O02H 4HGKC 3DO3A 3GBML 3FO1A 1M1SA 1ZT1A 4RMQA 2CJUH 4KJWD 1AQKH 3LRSA 4KUCD 2BNRD 5LXGH 5A2FA 2FHBA 1P7KB 3MRQB 3FL7A 2R1YB 5KSAC 4HJJL 4ZOBA 2HFTA 1P2CA 1G0YR 2OP4H 4JO2H 4LGPB 5A16B 4UINH 5E8EA 4PG9B 5INCB 1LEGA 4YFLI 2X2YA 2BSED 3IDXH 3EJJX 2IPKB 1KENH 3WIFA 1BVZA 4L3AA 4OCWL 4ODHH 3CSYA 3W9EA 4DEPB 3QJHA 1JWSA 4M5YL 3DRTA 4U3XA 1NGYA 5EOCH 4GG6A 4XNXH 2ARWA 2QQNL 1DEDA 4LFHG 1BZ9B 4OGXH 2EC8A 2X4NA 25C8L 4HUWB 4LDEB 3KPNB 2UY6A 2B0SL 1S9WB 3PNWA 3QEGL 1NFDF 5HY9B 3WV0A 4YBLB 2NLJA 4R26H 5DJCA 5E2VH 4FXKA 4S10A 5BS0E 1NEZA 4P5TD 5DC0A 5ABDE 5DVKA 5ACZA 3DJ9A 1AO7A 4ZSOB 4QRQB 4HIEA 3VGAB 1KV3A 5JA9A 4UU9A 2OMNA 4CMHB 5I18L 1BP3B 5D7IE 3IU3B 5C0IA 3BKJL 4FP8L 1VEMA 3TN0C 5J89A 5AYUL 3LD8B 2DS4A 3CDGB 4X6EA 4JVPA 4E42A 1JWUB 2MKWA 3LH2H 4J8RB 4UDUB 3WFCH 1YJDL 1OP9A 2D0HA 5ITBH 4OKVA 4NQDA 4XX1E 1X5FA 1VADB 4NO3A 3QQ4B 1MCFA 5DLMH 5L9DH 1S3KH 2EYRA 1N8ZA 4KROD 1ZLWK 2E7HA 2NY3C 4LSTL 4MNGE 2XQYG 1NPUA 4NFCA 4RDQF 1I3RB 2JJTC 3BDYL 2R4RL 4NN5B 4ZG1A 1RK0B 3QO0B 4XP4L 5J9PA 4L8DB 2WUCH 3IVKA 3LKPA 2A73B 3N1QC 3C2AL 1G9MH 3FOLA 3V0VA 4E41E 5B38G 5IMLB 5IIEB 3S37L 1OARL 2VQTA 3QDJB 1PZ5B 4ODTH 1U8LA 4U0RB 2GSGB 4OD1H 3UTQB 5JW4R 2DQJH 3MCKB 1S9YA 5LVEA 3H9HA 3QZWA 4S1QH 3O9WA 2DJSA 3RWCB 4QY8B 3EUUA 3NCEB 3NN8A 1IM9D 3L5HA 4P9ML 1NGPL 2VLJE 2O5XH 2PYED 2CRIA 4K9EC 5L7XL 4WUKL 3KDMB 3F7VA 3UYPA 1MCBA 5F9AC 2OJEB 4U1NB 3EOTL 4RGOL 3TT3L 3IFLH 2J8UA 2V5YA 2ZJSH 5IVXF 1NDMB 2FX9L 2VLLA 3NA9H 3O6KL 4B41A 4GUPA 1GRWA 4QRRB 1I3VA 5EBGA 4FABL 5C0GA 4IOSD 1N0XH 1SMOA 5TGBB 4XPHH 3V7MA 1IJ9A 1M05B 4OCXL 1S5HA 4HFWA 4WFGD 3U0WL 3OKNA 5A2JH 3LN5A 4QNPF 5GISH 3WIHA 2P46B 1IC1A 1GGIH 2J4WL 1J8HD 3LEVL 1IGTB 4WO4A 4D0CB 4JDZA 3P40A 4OD3H 4X5XA 4F7CA 5JHDE 2I27N 1OSZB 1YNLH 1HXMA 5JQ6H 1VESA 1WTLA 4LLWA 4U1HA 3HZYB 4OZGE 3QDAA 3P4OA 5FGCB 3CZJA 3QFDA 4QOKD 4YHOH 5DUMH 2DQEL 3UAJC 5A2IH 3ILPA 3CFKB 5BMFH 2DMKA 4JDVA 2J5LC 4QHKJ 1S7VB 4EVNB 3MSPA 1ED3B 3MJ6A 3OJMB 5D1ZC 2GITB 2GY7B 3O2WH 5KG9B 3A6CH 3AROA 1KEGL 2VQUA 3GUTB 1MY7A 1MFDL 4XC1L 5E2UL 2Z31A 4J2XA 5JNYA 2VDPH 3ZLQC 4U7SA 4PJBB 4HDIB 4G5ZL 3RL2A 3FJTA 3P73A 4DWHA 1LWRA 3D39B 3S5LA 1DP0A 2J6EL 2FD6H 5CJXA 5GS0L 5F7LB 2JK5A 3LKNB 2XZAL 2Y06L 2QSCL 1AE6H 4Z7UE 3Q6GL 3PL6C 2WK2A 4W6XB 3UYRH 4FXGB 4Z8FH 1TJGH 4UTBL 5DJ0A 3IXAA 5MENA 1FVCB 4ZO6A 3VXTB 4I48A 5E8NA 3V4PL 3WS6C 3NFSH 4Q0XL 3UO1L 1UCBL 1P53A 3MRGA 3QIWD 5JXEA 3EDDA 5GS1B 5CILL 1LP9B 4WY7H 3VGBA 4RISL 1ZA3B 4OIBA 4LVHB 4PD4J 5D2NE 3LPGA 1GCFA 3GMOA 5HGDB 4CW1A 3GBNH 3G5ZA 2AJVH 3K3QA 1WF5A 3H9SA 4O2EB 3VFVB 4DZ8B 3M45A 4MHHG 4XPAH 1RJLB 3AFLA 3QIBB 5F97E 4HIJA 4BELD 4JE4B 4IRSC 2BOCA 3WLWD 1A4KA 2VDMH 4YHYC 2KL6A 5F7FA 3W11C 1NLBL 5D70L 3RX5A 1T20B 3K7UA 2DLHA 1NMAH 2BHUA 3WFDH 2CKBH 3MMEA 4QWWD 2Y07L 4ZFFB 3QQ3A 2DM2A 2KUTA 3DURB 1LGVA 3ZKMC 2Q7NA 2D31B 1BOGB 2AKRA 3BH8A 4XBEL 1OSPL 3BKYL 1I3GH 4XC3H 3TM6A 1EEQA 1JVKA 1KNOA 3HI5H 1ZVSB 2CIIB 3V4VH 1FAIH 4NQSB 5I75C 2VLMD 4QXGH 5DD0L 1JL8A 2ITDA 5DURB 3O6FD 3MYJB 2EH8L 1M7DB 3EBAA 1NGZA 3O4OB 2DIAA 4AENA 1H3XA 1KT2B 1RVFH 3P0YL 2XN9E 2BSTB 4YHPB 2C3WA 3DSFL 2HLFC 5E8DH 1EVUA 1KCSH 4XWGL 2KPNA 4NFDA 5SX5H 5DWUL 3KYOB 1UVQB 2WWMC 2E27H 1TQCC 3SKOB 2NY0D 1MNUL 4OFDA 3JTSB 5C07D 4LEXL 1RIVL 3AVEA 1P7QD 2HWZL 4NGHH 1YEFL 2Z0BA 1C16B 1D9KB 4MXVF 3F12A 4TTDD 3S4SG 5ITFA 2B4CL 2F9BT 2YPVH 5JIIA 1A4JA 1Q72H 4GMSL 4D3CL 4J23A 2YD1A 4KMTH 4KVNH 5DHYA 3SOBH 5AG8A 4JRYD 2WANA 1YN7B 3KNBA 4UT7H 3GSWA 5KSBF 3CXHK 5DC4B 4M93C 3LKOB 2Z8WC 3T0AA 5LCVH 4WW1B 5L6YL 5IHUL 4OF3A 4L3EE 3TT1H 3SGKC 3IT8D 1OAYL 1UB5A 2E9JA 4MAYB 4NHCL 5C0BA 2EXYC 4P48A 2GJZB 1QFUH 1EFXB 4BZ1L 4LP4A 3LPFA 5C6WH 2NCMA 3QUZB 3O2DH 4M6OL 5E0QA 2RR3A 2NTFB 3HI1A 2AGJL 5EU7C 3ECBB 2VE6B 2XACC 2KZWA 5IK3B 4JZJB 4OZFB 4E41B 4JQIH 2HKHH 4JR9L 3GHEH 4IM8A 4S0TD 1YY8A 5C08D 1E4WH 3EOYG 5D1QA 4JKPL 1MCDA 4UV4H 4ZO7A 5C0RL 4FQHB 2QHRL 4A6YA 3VXNA 2P4AB 4KK5D 3QRGH 1HHJB 1BPVA 5FIEA 2IEPA 3HG1A 5CBEB 4R96A 1E6OL 3S96A 2PCPB 1PSKL 5I1KL 1EGJL 4AIZB 4QHUB 3MUGA 4GW5B 1U8QA 4JLRA 1FIGL 1HIMH 3OAUL 4G6MH 2HTLD 4J3WA 3VFUA 1QSEE 5TDOB 4YK4B 2NX5D 3BH9B 4X7CC 4HGWA 5GRUL 1WICA 3RL1B 3NFPA 2EXWD 4OLVH 4PGZA 3ZO0A 4H1LH 5CKAA 3QXDB 3VXUE 1M7IB 1J1PH 1OAXH 4ZS7L 4PRHE 4RGND 4MA8L 1JGDB 4PJHE 3BWUC 5DFWH 4WI5A 4WFHD 5CMAB 4GBXD 5IJKC 5I1JL 2OYPA 1NMBH 1QP1A 2A0LC 1MPAH 4IDJL 1YPZF 4NSKB 3IFOB 4KZEH 1K8DA 1ZSDA 3DRQB 1CE1L 3DVNA 3SDYH 3L3OA 4NKDA 5CWSB 1FG2A 3VWKC 1T6VN 4OZGB 4F7PA 2R2BA 5E03A 2G60L 2C4XA 4YHMH 5CSZB 1OGTB 4WUUA 4N0UA 1EUUA 2JLLA 4O58L 1PY9A 1S7SB 1BQHG 1JHKH 3VFOB 3JV6A 3LEYL 3MRNA 4RRPA 4EN3C 5LGJA 2F54D 4U33A 3QDGA 4MJID 3ARPA 2AABL 2IF7A 4KKLD 4I18B 4ZDHB 2FBOJ 2X4SA 1MQKH 4F7MA 2G2RA 3REWA 4PJ8A 3ZDXE 4ZUSA 2YUXA 4FZ8L 4PJEF 4ELMA 5I1DB 1CFTB 2BNQD 1XR8A 3X13B 5KTEH 2NZ9D 3QUXA 1HI6A 3MV7E 4L8SB 4Z7UB 4GRWH 4NKOA 4PB0L 1KJ3L 1RZ8A 1MRFL 2EICA 3HMWH 4UQ3B 4S2SA 5BOZG 3JWOL 3OF6D 1X5IA 2V5SA 4XMKH 1XF3B 5LAXA 4F9PA 5DS8B 5F89A 1FZJA 5D9SB 5J0BA 4MS8D 2OZ4A 1ZLSL 3ZT6A 4R8WH 4HW6A 4XAWH 4UI2A 4KKAD 1C12B 3GO1H 4GMTL 4RX4A 3MGOB 4NQDE 3UP1A 3H7LA 1RULL 1FNEB 1QVOB 5J7CC 5EU5B 1NGQH 2P5ED