5KSVA

Crystal structure of hla-dq2.5-clip2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
180
structure length
180
Chain Sequence
IVADHVASYGVNLYQSYGPSGQYTHEFDGDEQFYVDLGRKETVWCLPVLRQFRFDPQFALTNIAVLKHNLNSLIKRSNSTAATNEVPEVTVFSKSPVTLGQPNILICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unraveling the structural basis for the unusually rich association of human leukocyte antigen DQ2.5 with class-II-associated invariant chain peptides.
pubmed doi rcsb
molecule keywords MHC class II HLA-DQ-alpha chain
molecule tags Immune system
source organism Homo sapiens
total genus 37
structure length 180
sequence length 180
ec nomenclature
pdb deposition date 2016-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00993 MHC_II_alpha Class II histocompatibility antigen, alpha domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5ksvA02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 5ksvA01
4JDTH 4JFFE 3I2CH 5F1NA 1DE4B 4S1QH 3VXUB 1KJMA 4GQ9L 2YKLL 3VFMA 2VISB 3LEXA 1P5VA 2IGFL 1KPRA 3BMVA 5ETUB 4LBEA 3QI9B 4ZOEA 5HHVL 3WHXB 2WWMC 5D7SH 1Q0XL 2H1PH 5JIKA 5HY9B 1V7ML 5HYSA 1AGDB 4Y4HD 3BX7C 3UCRA 1EV2E 2H26A 3V4PL 5BW7C 3WE6A 3ESUF 4OQTH 3LOWA 3OR7A 2XWBA 4H20H 3BPNB 3Q1SH 4IOIA 2NW3A 3TJEL 4Z7QF 4JKLA 1LMKA 2VZVA 5F71A 4ZUVA 4PJGE 4JHAH 4XP5L 4PJCF 3UTTB 5L7XL 4OF5A 3MCKB 4EN3A 3I84A 1EX0A 3GSNA 5DK0B 1LO2H 1EXUB 1RFDH 3CSBA 1KEML 2I9LA 3MV8B 3C6SA 2CRMA 1DBAL 4M8QB 3BO8A 3MRQA 5HYJD 1IEBB 3SKMA 4JN2B 5F3BA 1WC7B 2XPGA 4AEIL 4IRZL 2G5RA 3MYJA 3QDMD 1SM3L 3O6KL 4EVNA 1W0WA 5IFAH 1MI5A 1VGEH 3HZVB 3TBVB 4XVTL 3WXWH 1YEKL 3HC0B 4TNVF 4AMKL 3RWHA 3C8HA 2VXUH 3ALPA 4GRMB 3LIZL 1RV6X 2WINB 5IVOA 3EZ8A 4X4YA 4P9HC 2HTLD 3JWOL 4O00A 2WUCL 2NTFA 4LMQE 5B38G 4LSVH 3OKMA 5JNYB 3AM8A 3BZFA 3TT3L 2HN7B 3OGOE 2DQIH 4XGZB 3ESVF 3ZDYF 3QUZB 2YPLB 5F7YC 2AXFA 1HILB 2L7JA 3THMH 2DQHL 1FVDA 2MQ0A 4MCZA 4F7PA 4XP1L 1IGIL 1U8QB 1UQSA 4O5LL 2BNRD 2R23A 3QWOA 1AFVH 4ZS7H 2OXHA 1UACL 5IB2A 5GJSH 4PP2A 4RAUB 4DW2H 3R06A 3ZYJA 3WNLA 4K7FB 4LEXL 4F7MB 3QISA 1RVFL 1B0GA 2F19H 2Y25A 1IC4L 4NGHL 4GXUM 1AD9B 4LOUD 2UVEA 4GAFB 4V2BA 2G5BB 2J6EA 3A67H 3LB6D 2PW2A 3WN5C 5FIEA 5F9OH 3CFJB 3GHBL 4RMRA 4G43A 4X9FA 3S37L 1UT9A 3HS0B 3LEVH 3C8KA 4JRXE 4FABL 4IHOB 4UAOB 3TT1L 3AREC 4TUKL 4KKLC 3OG6B 3GKWL 3EYUL 1CG9B 1NEUA 3SDCD 2AJ3A 1OCWL 1XGRB 3MGAA 3ARFA 5CZVH 1TETH 1Y6MR 4NQSB 3GMPB 3VGGA 1PGRB 2AGJH 4LLVA 2CDEB 1NDGA 2BRRH 4QHLA 1WZMA 4R0LB 1HOCB 3EOTH 4JZNA 1LVEA 1U8KA 5CP3H 3QNYA 2NLJB 3BZDA 5BVPL 1GL4B 3MV7E 4AEEA 4DKDC 1IILE 4CN4A 1KC5H 4LSPH 5H37H 4LPTA 3KAAA 4FFWC 4CADA 1LD9A 3T4YB 5EIQA 4M6NL 4P2RE 1Q9LA 4FTVA 1CDIA 1AGBA 1ZANL 2NXYC 1RZGA 4PGZA 5GZND 1RD6A 5TF1H 1RIHL 2AQ2A 3D6GA 5KSBA 5E2UL 3BD5A 1I7RA 1L9NA 4QXGH 1I7UA 3O8XB 2VQTA 2IAND 2FRGP 2X44D 1SMOA 2VDKL 1C7SA 4GUPA 2CLVA 3I75A 4MQTB 4YX2H 5D8JL 1RHHA 4XNYH 3VXRA 2Z31A 2MKLC 4C58B 4EUPB 1V3LA 3T09A 1MLCB 4JZJB 1I1FB 5ADPL 1KXTB 4XPHL 3LQZA 3UDWA 4G8EB 1PKQA 2C3GA 4OCNC 1V7NL 2VYRE 5E6ID 4OLXH 2R4SL 3J7HA 5EFIB 1N64L 5HJ3B 2ZUYA 3VXSB 25C8H 3QEQA 2IF7A 1S7WA 1Q0YH 4Y16B 3DGGA 3BKCH 4YUEH 5DJXB 2PO6D 4P2QA 4OFVA 4K8RC 5E5MB 3MLZH 5EN2B 2V2XA 3EOBB 5EBMA 3JWDL 2AI0H 2D7OA 1KB9K 3MNWA 1KPVA 2A9MH 5E56A 1SEBA 3UTQA 2DQDH 2DMBA 4U1GB 2HLAB 4NUGL 5FYKD 4AK1A 3P4LA 1F8TL 1JGLL 3GO1H 4U33A 3MACH 2MHAA 4M6MH 1TVHB 2R2EA 4KK9D 4XC3H 3LKSA 4X7TA 2WZPD 5IMOA 5T1KD 3G6JB 4G42A 5CUSL 4HDIA 4WEBH 4FQIL 4P3WA 3OKYA 1Z6JT 5ICZB 2VO5A 5C09B 4TUOA 5HTSA 1MRDH 1MUJA 3B9KC 3HLAA 1KEGL 3FQTB 4PB0L 2XG5A 1NCUA 4XPTL 4G3YH 5C07E 5IBTH 4PJFA 3BZEA 1K8IB 5HHOB 5CJ8A 3MLTB 2OMBA 4GXVH 1JF1A 1T1WB 3VFGL 5GS1B 4YHIA 2R4RH 4U1SB 4QHMB 1AQKH 1NGQH 5GRUL 3D2UB 3CJJA 4H26B 1OAXL 1IM9A 2FD6H 4TNWF 4LU5L 4PRHE 4R26L 4TQEL 4JFHE 4DKEL 3GI8L 2BVPA 4UU9B 1EH9A 1VADB 1M7IA 3HTLX 1MFCH 5I1LA 2XRAH 3ARGC 5SWZA 1J87A 5FDWB 1FQ9C 3QWRA 3MGOA 4O2EA 4AY0A 5C0FB 4LRNH 3ECBA 3DUUA 4AG4L 3LDBC 1B90A 2ZOKB 3O4OB 1QQDA 4NNPH 5GJTL 5D5MA 2AJSH 4P23C 4XBEL 1CGSL 5BV7H 1IAII 3FO0H 2VIRB 4M1CD 4JB9L 2VRAA 3G5ZA 3LQAL 3BW9B 1O0VA 3DJ9A 3CH8A 2VLJA 3KS0J 4KUCD 4TPRL 5I2IA 1BQUA 1KBGH 2I5YL 3B6SA 5FUCC 5F9WC 3LRSA 1U93A 2P8PA 5AYUH 5B39B 1VKXA 4XVSH 1JNHA 5IMKB 4OBSA 4M93B 5BMFL 2X9WA 5DEZA 3CU1A 5FOBB 4QRUA 5GHWL 4N5UA 2HYMA 4X7SH 2VL4A 2JCCA 5KVEL 3BGAA 1OAUL 1X7QB 1T1ZA 2ESVD 5L9DL 3L5XL 3QAZB 2H8PB 4PTTA 4HXAL 1RZIA 1FBIH 4LEOA 4PJXB 3TIEB 1PVHA 4GAYA 3FQRA 1L6ZA 1FLRH 5E9DA 5I17B 4YPGA 1ROWA 4G8IA 1A6TB 3BPNC 1CLCA 3FB8A 3QHZL 1QSVA 3EYOA 4X7FC 5HHME 4E41A 1NCWH 5DUML 1AP2A 3CNKA 3WBDA 2MOVA 4LCWB 5DJ6A 5INDB 4P4KC 4Z0XB 2VC2L 1HYSD 1FVCB 2A6DB 3OKNB 1FN4B 4L9LC 3NPZB 2D7TH 4RGNE 2EDJA 2AW2A 2F15A 3V0VB 2DOCA 1MRCL 5FGCE 4CMMB 5DWUL 4YWGH 1INDH 2OI9C 1NFIA 5TFSH 1K4DB 1IGFH 2V5RA 4Y89A 1CTNA 4QGTA 5LQBL 5DHVB 3RTQC 3FRPA 3MGTB 1MJUL 2YPVL 1CT8B 3R1GH 1UGNA 1WQVT 4JANA 1FNGA 5LCVL 1YN7A 1XCTB 3NIDF 4U1JB 3TBSA 4JY6B 1KIPB 2R15A 3AROA 1AIFB 4OI9A 4NRZB 1TIUA 4PJBE 3CVIL 1CDGA 5FECA 3IDGA 4PJGA 1YPZB 2B4CC 3BN3B 2AJZA 3N1GC 4DN4H 3GMNB 2C1PA 4YGVB 5JO5B 1H3PL 5I1EH 1SYSB 2DQJL 3ARFD 5J13B 5CWSB 4FQ2H 3ZO0A 3IAGC 5I1KL 4ISVA 1N5AA 1AC6A 3VFUA 4XHQA 2UZYB 3RY6C 1VDGA 2FDBP 3L5IA 5IVZB 4IJ3B 1CS6A 5IIEB 3DETC 3SHSA 3F7VB 4JDZB 5I30L 1A9EA 5IW1B 2NY0B 1TENA 2MKWA 5F3HB 1OAZH 4JPVH 4PRAB 4S1SL 5EOCH 3JVGC 2N4IA 4JN1H 1GGCL 1J8HA 4YBQC 1Q9OA 3VW3H 2DQGL 2IH1A 3NGBC 4PJ5D 5E7FA 5K59F 1AQDB 4FTVD 3VXNA 4HUXA 5EZOL 1Q1JH 1EDQA 2FYYB 2CRZA 5IF0B 1BBDH 3AMLA 4LLUB 2ZWLT 5IJKA 3T0XA 1R3LB 2FZ3A 4ZFFB 4GAGL 1DVFA 2AEQH 2LU4A 2ICWI 5AAWA 1AGCA 1RUKH 3U9PH 2PTUA 3C5ZA 3CD4A 3OF6A 1FFRA 2A74B 4IMLB 3C09B 5FO7A 2B39A 3VXRD 5HGDA 1ND0B 4E0RA 1MIML 3HR5A 1HZHL 5FB8A 4ZOAA 1CE1L 4UMGA 3UJTH 4LVHC 1FL3B 4UQ2A 3QG6B 3O6FA 3PWPA 4C83A 3TWCH 4ENED 3DBXA 4HJGA 5BJTA 3FB6A 4JPWL 1GYAA 5L88H 3HZKB 4FZ8L 3CDYA 1WT5C 4JVUA 4G6KH 4R0LC 3BH8A 1L0YA 1IT9L 1I7TB 4HBCH 5EIVA 1YY8A 1I3GH 1K5NA 5T5NG 1X5LA 1EPFA 3C5SA 3QEQD 3WL9B 1FZKA 4OFYA 2NXZD 4UIMA 4P2QD 2W0KA 1M6OB 2V2TB 2XA8H 3HE7B 4OLUL 3QO0A 4Y5VA 1R24B 1AXTL 5DUPL 2HVKB 3KHOA 5HBBA 1S9YB 1IAIM 3PF2A 5SX4H 2EKSA 2RGSA 4ETQA 5T5FL 1W72A 1J0ZA 1QBML 5DK2B 4M3JA 3MRCA 5FKPA 1FFPB 4OLZH 4I5BB 4PJIB 3FZUD 2P5EB 1D6VL 2AXGB 4OV5A 3U46B 32C2A 4U3CA 1ED3A 1I8LC 1E6JH 1KTRL 3FT3A 3DXAB 4X80L 4YBHA 2HFEB 4GRLD 5D2NE 4N0UE 4JRWA 3H9HA 4UT7H 1E28A 3V6OA 4ZPTB 2A0LD 4JFYB 5E94A 3VD4A 2VDRL 2DICA 5JW5B 4Y5XA 3LN4A 3T8XB 4KQ4H 5JW3H 4UTAH 2VWEC 4L4TB 3RPIA 1AR1C 2UZIL 4P2RA 3SJVA 1CCZA 2CDFA 3R0NA 1NANH 4LLYA 4M43L 1L0QA 3MODH 1ZA6B 2PXYB 3EO9H 4JO1H 1CQYA 4PJAE 3N85L 4DAGH 3BPCA 1A7RH 1ONQB 4LPVA 3DI2B 4XNUH 4NT6B 4ZUTB 3RVTC 3DMMB 4NQTA 1OGAD 4N90E 3BRGC 1UWXH 5SWQB 4DZ8A 2IG2L 5SWZD 5DJZB 1J88A 1HH6B 3QWRD 3HN3A 4G7YL 2WIIB 3PHOB 4TTDD 5D6CA 1U3JA 2EDYA 3EJYC 5EZJA 2I9TB 2O93L 4W68A 4PGEB 5EU4B 1AGEB 1P69B 4GS7C 2RIKA 4MHHI 2QQLL 1GC1H 3CDFA 3LCYA 4ONHA 2NY3C 5C6TL 1DQQB 2X4RB 5IK3A 3BKJH 5IFHH 1HCVA 1E4WH 3MNVB 2P1YA 1PW3A 2VLJD 1RUMH 4NBYB 1NBYA 2L7UA 1U42A 3MUGA 4X5WB 2IMNA 4MNHB 3RIAF 5FHBH 4FXLA 5IGXL 4NKIL 5MERA 5GGVL 1JTPA 1E4JA 3PGDA 1FL6A 1N7MH 1RUAH 3WUWB 1FO0H 3K3QA 4OUUA 3ZE0F 1FFQA 2FJGB 1QSFB 3Q6FB 4TSCL 1GAFH 2PYEA 3PL6C 4NZTL 3RIFK 1MFAL 1RZKH 3X12B 3KWWB 4YXKL 3HNVH 2GJ6B 4HIIB 1FYTA 3GMLA 5JPMA 5ENWB 5AZ2H 3DUSB 5E9DD 4NZJA 1DN0A 1MSPA 2ICEB 4F33B 1FZJA 2ZKHH 5J3HC 1W0VA 3SBWA 2JJSA 2C3VA 5LBSL 4E41D 2Z93A 3MUJA 4NM4H 1NGXB 2VH5L 5GGRY 3RZCC 2P43B 4ZNCD 2X2YA 4OZGF 5C07A 3GMMA 4ZO6A 1S9KC 4P3CL 3VFNB 4UNVA 3RWJB 3BE1H 4NBZB 2BHYA 3D87B 1P2CA 3AXLA 4HWEL 4H8WL 3IF1A 2R69L 4KRPD 2IH3A 1FFOA 3DGCR 3W0WA 1UFUA 5F72S 3WO4C 1MCRA 1QBAA 2J8UB 5DRNA 5DEFA 4C4KT 3QCVH 2AKRA 4KUZL 1N6VA 3EYVA 3CH1A 3G6DL 2YOCA 4KK6C 4PRHA 4ZTOH 3T3PF 4GQPH 3WCYA 5GGTL 2YN5A 4WV1A 4EQ3A 2H41A 2Z4QA 5JIPA 5LXGL 3ULSB 3B5HA 1A7QH 3MRNA 3WJJC 1R5IA 2NY2D 4OGAD 1KIQB 2EXWD 4QRSB 5C08B 3RNQA 4OZ4B 5KS9F 4LLMA 1OWRM 1T0PB 1JN6B 2CDGA 2WBJA 4WNQB 4WFHE 1QNZH 2I25N 1TTUA 1Y18A 1ERNA 4P2YA 4YJZL 1PQZA 3W9DA 5J1AB 4D0BB 3WFBL 1H0DB 4G9DB 4TVPE 2B20A 5FXCH 2WLYA 4QYOB 2DLGA 1JE6A 1A1MA 4XMLL 1BQLH 3U0TA 2YWYA 4U6HB 3I02B 3GJEB 3OBAA 4LLAA 1UZ8B 1FG2B 3MNZB 3MA7B 3V7AE 12E8H 1CR9L 5DMYA 1J8HD 3RA7L 4HWBA 4F9PC 2E7HA 3AS2A 3PWJB 2V17L 4RMSA 1QBLH 1T83A 4PGBA 4WUUB 4NO0B 2ARJQ 4X98A 2YUWA 1JNNH 1YJDH 3JXAA 2Q87A 4L8CB 4NBXB 5H37G 3GMOB 1DVFD 2MPAH 1JZ5A 3SDXA 1HEZB 4FQXB 4XPFH 5ITBH 3C5ZD 3MXVL 5LGHH 1H5BC 2DDQH 5FA3A 4CMHB 1LEGA 4R2GC 5LAXA 3D9AH 4R96A 4JJ5A 1R5WA 4AL8L 4YBLC 1S7RB 2BC4B 5IKCA 3S36X 3O6FD 5CD5C 4HGMA 3QFJE 5A2JH 4RZCA 3MA9H 4U6VH 4ELKB 5J1TC 1JHTA 2W59A 4R7DA 5DUBB 1T1XA 1HYRC 4GLRI 3BSZL 2R2BA 2VQ1B 2RFXA 5IBLC 2NR6D 3GHEL 1KPUA 2XQBL 4PYGA 2OP4H 4QF1A 4OFYD 3HI5H 4OLVH 1JYXA 3I9GH 3A0OA 5GS2D 1MCLA 5KANI 4F7TB 1A47A 2QLVB 4NO2A 3ZTNH 3QIUA 4PJ8B 4TVPH 1VACB 2CK2A 4M48L 2Q7YB 1OPGH 3KYMA 2Y06L 1ZHLB 2ATPB 1GGBL 1EJ6A 5ERWB 5KJRH 1KCUH 3PWUA 3QJHB 5KSAD 3GSXA 1XGTB 5C7XH 3TO4B 2VOTA 4OCYH 4DGIH 4OF0A 2BVQB 4Z8FH 2W0FB 1HINL 2BX5A 3BMWA 3QUYA 3B3IB 4UBDD 3LKNB 3BESR 2VLKE 5DSCB 4HS3B 9CGTA 3M8OH 3QXWA 2DD8H 2H45A 1P9MA 2YD2A 2IPTL 3B2VH 4KAQH 1U58A 4AM0B 5DJ0A 1XF3A 5L0QB 4Z0BH 3SJVD 2C5DC 1CN4A 3O9WC 4Z6AT 3CC5B 1BJ1H 4F2MA 3SKOB 4Z95H 5AG9A 1A9BB 3QDAA 1JPGA 5JDJA 3N9GH 3TJHD 3JV5A 5DD6A 3IDJA 1G7MA 1LP9E 2R29H 3V7MA 4OCSH 3LHPL 1JPTL 5E2VL 1X5KA 3GSVB 5TH2B 3V0AC 3L1OH 3T77B 4I9WD 2P24A 1T0NA 5MEOB 1XF5B 3TFKD 4HKJB 3VMOA 2PTTA 1FNFA 4WDIB 1EMTL 1K6QH 4KJPC 1CLZL 4MLSA 1B4JL 3C08H 3O4LB 5DMKA 4NSKB 4GW4B 3FN3A 3FCTA 3TM6A 1MY5A 4X4ME 1DSFH 4OB5H 2ORBL 4FFZL 2HT4D 2A77H 1JJUA 3L3GB 3NA9L 4XAWH 1OSPH 5DDHA 2ADFL 1ZE3C 4PJ7E 3IETA 1LE5A 1ZHBB 4MNQB 4ZPVA 5T5NF 3QPQC 2Q20A 3K4DA 4C57C 4LCIL 3GBLA 2CIKA 3BWAA 3Q3GB 1J11A 5E2WH 2XY1A 3OZ9L 4Q6IB 3T1FB 5KAQG 2XV6B 3O2WL 5EU6A 3PP4H 4X6FA 1KELL 1I3RA 4B5EA 1ZLSH 3TGXA 4QXTA 2B5IC 2PYED 5JIHA 3WIFB 5HHPA 5H2BA 3SDDA 4JR9L 3STBA 5C0AA 2DB8A 3CFEA 2HWZL 3LS5L 5IQ9B 1BAFH 1FYTD 2OMNA 5FF6B 5ACZB 3V5DB 4M6AA 4K9EH 5D2NA 2UWEA 4HCRH 4CN6A 3WSQL 5ISZB 4ZQKA 4M7LL 1EGJH 2HKFL 4TSBL 1UZ6E 4UINH 1KB5B 4DKFH 4XPAH 4IOFC 1IGYB 3TBYA 1OTUD 5DFVD 1E27B 2XZAH 4PJXF 1Q72H 3W0WD 3EDJA 2Y5TB 3R4DA 2VDPH 3T1WA 4JKPH 4PRPD 1TJGL 1P7KB 5SV3A 2R0LH 2AV1B 1ZGLP 4Y2DD 3V52H 3RGVA 5IFJA 4O4YH 3TA3D 4L29B 3SGKC 5DLML 1H3UA 1REIA 1UA6H 3QHFL 2R2HA 5DD5H 1IMHC 3RL2B 4PRBB 2NY1B 5I1HL 1CXIA 1X5FA 1VA9A 1B6UA 1TTGA 4XCNA 1OF2A 3SQBA 2R0ZL 3KPSA 1CGTA 35C8L 4KTDL 3SDCB 4LSDA 2FWOB 2R9HD 2EZ0C 4FG6C 5JLZA 2QQNL 5KTEL 5IROA 1QZ1A 3EBAA 3O41B 5F6IB 2WBJD 4X6CF 3RRQA 2ILLA 4IRSC 5IB5A 3VMNA 3QFDB 5IB4A 3H42L 3V79C 4NOBA 2X09A 2MQ3A 1LQSR 3MOAH 4KWUA 4UZGA 5EOCJ 2NY4D 2C3HA 1MIEL 1CXEA 1EFXA 3P73B 4LAJH 4D9RD 3WD5H 3ABZA 2JJTC 5B8CB 2DKMA 2VLLB 5CJQL 4MAUH 1DUYA 3TIDB 3H2WA 3P0YH 4R4BA 2BJMH 4J4PA 1A6ZA 2VDLH 3MX0A 1CBVH 3TZVB 3G5XB 2QJDA 2PETA 6CGTA 2CUMA 5CINH 2AJYH 4WHTB 3PWLA 2V2WA 4I18A 3F12A 2IANB 4UDUB 2Y23A 4OZIE 2DJSA 4Y5YB 1E4KC 1NAMH 3GBNH 4HKXB 1CD0A 2YD4A 1TZIA 1IBGH 5JDSA 3EO0B 5EULV 4NQDE 2CJUL 5EU7E 3JTSA 5C0RL 5EBWA 1BZ7A 3SGDH 4NQCB 4PREA 1IGTA 3WFZA 4HH9A 2FB4L 4HULB 1NCDL 4M4RA 5BV7C 4G9FD 5JA9A 5SWSA 3MFFB 4ZMAT 3VWKA 2Z8WC 5E8OA 4GG6F 5E6IB 2AEPH 2V9QA 1YNLH 4DZBA 1NKRA 2OTUB 3TBTA 4HIHB 4D9LL 4HK3J 4YC2C 2JB6A 2PO6B 1CE6A 3S4SB 4JVPA 3T0VA 5D7JA 3IDNB 1IKNA 2E8ZA 3L5WA 2YR3A 4ACPA 4ALAL 3VDCA 2J8HA 4XBPB 1IGML 3MLXL 4MJ6A 3T4AA 4H25B 1DANU 2Z91B 5FFLA 4NO5B 1K8DA 1VCAA 4APQA 3UTSE 5KVDH 1T89A 1R0AH 2JE8A 3R8QA 5F44A 1T5WA 5D9SB 4PLKC 5DMJB 4TNVK 3GGWA 2QHRL 1YYMH 3OG4B 3CZFA 4JPIB 1F13A 3S98A 4F58H 1HHJA 3WYRA 4ODTH 5EA0H 1T2XA 3VWJA 3WIHH 4M62L 3F65A 3L3DB 5MHSD 1JVKA 3QUYD 1I1AA 3KPTA 4E5XA 1F4YH 2A1WL 2EDQA 2DWDB 3NACL 2YEZB 4OCXH 1E4XI 2R2CA 4XCYB 5F1NB 2VZ3A 3Q6GH 1KSRA 1KJMB 1RUPH 3FFCE 5C71A 2X4UB 5EU5B 3VFMB 4ZSOB 1J18A 1KPRB 4JGJA 2DIBA 3NAAH 4LBEB 5F7UA 2EDXA 3OWEA 1EEYA 4IIQA 2DLFH 3QA3B 4KFZC 3VDBA 2BNQE 4PS4L 2X41A 5HYSB 2XN9E 4PJHE 3U6RA 4N8CL 3Q2CA 3DHMA 5E2JA 3P30H 1AXSA 2GITA 2PKDA 3OR7B 4XWGL 3UAJC 3W11C 2NW3B 3ULVE 2BY1A 2F5AL 4R90H 1DQDH 4ZUVB 5CEZE 2P48B 2J4WH 4P5MA 4QRRD 4EN3B 1TJIL 1MCCA 3GSNB 2G2RA 4FXKA 5KVFH 5MENB 4HKBA 1MCFA 2I9LB 5I1JL 3X14A 3C6SB 1G0YR 3ZHLA 1VFBA 1A6UL 2WBWB 3VXTB 3D0LA 3U7AA 2M8XA 1YEIH 1JI1A 3BO8B 3MRQB 1UWGH 3SKMB 2XPGB 2OM5A 4F7CA 2OYPA 1CICC 1VGKA 4HXBH 1A6VL 2J2ZA 1UWEH 1C5DA 2IFGA 5IV2A 1W0WB 1S7XB 1MI5B 5D72L 5E8NA 1HKLH 1KCSH 5IWLA 3FOLA 1X5JA 4S1RH 2GUOB 2IBZX 1IKFH 2EYTA 2VNCA 1UCBH 5IW6A 3PQYE 1JWSA 1MFNA 5EU6D 2V5YA 1NUNB 4NWUL 5I74B 3V5HA 5FHAL 5HVFB 1IFHH 4X4YB 3RJQB 3MLVH 3AS0A 4KPHH 4LSUL 1BOYA 3QXAA 1HK6A 4Y4HC 3FTGB 5ADOH 2OJZH 3SDDD 1YEJL 2BVOA 4G8GE 5C0AD 3ZL4L 3BZFB 3E0GA 4DTGH 1R6VA 4GKOA 1FJ1B 4HLJA 5FUOH 4PTUA 2AXFB 2JB5H 3SCMC 5A1AA 4F7PB 4MCZB 1CLYL 1UQSB 3MLWL 4XPGL 1R5VA 4OTXL 3QWOB 5MEPA 4K71B 3QQ9D 1MHHA 4PP2B 1OW0C 5MP6L 4ZYKA 5IR1A 4CU8A 3R06B 1V8HA 4LCUA 4L8SA 4KKBD 1V05A 5CEZH 4Y0GA 1RIVL 3SE8H 1B0GB 1P7HL 1ZV5A 3FQUB 1F3JA 3TNNA 4ZO9A 5DYOA 3QJFB 1S7SA 5EUOE 4U1HA 4HT1H 1IL1A 2PW2B 3PGFH 1G9EA 3W81A 4OZFH 1FPTL 1AC0A 3QIBB 4G43B 4EI6A 1HSAA 3NABL 4LPUA 4ZD3H 1EEZA 1JNLH 4YDIL 1Y0LA 2W07A 3C8KB 1RZ7H 4YDJA 5HI3C 5I6XB 1QO3A 2Y9RT 3GRWL 2W65B 1T7ZA 5AZEL 3RPKA 2HTLC 1KJ2L 3KPSD 4NN6C 3O2DA 1JPSL 1MCNA 4GKZB 2HJLB 4DQOH 1K2DA 3S35X 2J8UF 4R4FH 3N0PB 5I18H 3ARFB 1T20A 2JELL 5IT2H 4X4MA 3VXME 4LLVB 4L1DA 5IB3B 1NDGB 4G6ML 3IFLH 2JF1A 3ULUF 1QRKA 4J3TA 4JZNB 5EBLB 4OJFL 4U7KA 1U8KB 5E03A 1G6RH 2W9DL 3QNYB 1EFXD 3F7QA 1N2RA 2WNGA 3QUXA 5L6YH 2ENYA 3VRIA 1X6LA 1S5IH 1TDQA 3D25A 4OV6F 4MNGE 4KTYA 2R0WH 3BXNA 1LD9B 4JFEE 3ET9F 5KAQF 1OAYL 4JFOB 1RJLA 4KDTA 1Q9LB 3LSOA 5EO0A 3VI3F 1RZGB 1AXIB 4V1DB 4M5ZL 3LB6C 3E3QC 5KSBB 1KLGA 1J8KA 1VPOH 1I7RB 5JOPD 2F54E 4Q9CA 5E99L 5GQBA 4WY7L 4OCWL 5F89A 4QRPE 1RJYA 5F9JA 1FGNL 3LKQA 2CLVB 1JHLH 4GUPB 4XMPL 3ZDZE 5HPMA 4FQCL 3MLYH 3VXRB 2Z31B 4LPXA 1MQKL 4GBXB 1A3LL 4TNWK 3KLHD 1GC1C 2ARWA 4P59H 5SWSD 3U1SH 1I7ZA 3LQZB 2ZCKH 3HUJB 3RDTA 4S2SA 2X4OA 4WW2A 2DL2A 1GZPA 2J88H 2LU3A 3LD8C 2NNAA 4Z5RA 2EE2A 1OARL 4IRJA 2LVEA 3QEQB 4XP9L 1EHXA 4XI5C 1ZHKA 4Q0XH 1E0OB 3K1DA 4TRPH 3U79A 1WBZA 4PJEA 4RGOL 1JI2A 3EKCA 2V2XB 5D7JD 1DP0A 3MNWB 4WI9A 1SEBB 3UTQB 4EXKA 5FYKU 4LLWB 1IEAB 4ODBD 3LPFA 4KY1L 1QSEA 5E6ZA 1RZKC 4DEPB 5KVMC 5E00A 2MHAB 4RFEA 1U3HD 5GZNC 3V2AR 2R2EB 4OZHA 3LKSB 4X7TB 1FRGH 4APQD 5A3ID 5IMOB 3PV6A 5D7IF 4S0SD 4HDIB 5GRJL 1ORSA 1KT2A 5C9KA 2ZOLA 5L2KA 1N26A 3MRJA 5I1CL 1MUJB 3HLAB 4PV8A 4ELME 4W70A 2D0GA 2EDHA 4YHMH 4U4BA 1IZJA 2IBBA 1MRFL 2VLMD 4PJFB 3BZEB 5CJXA 3GBML 5HHXH 3NFSH 3WFCH 3QDJE 2F8XC 2QADB 2Z8VC 3DSFH 4PJ9A 5E6IC 2Y7QA 2K3TA 2Y07L 5EU3A 1ULVA 5D7LD 3HR6A 1QFWI 1IC5L 3WFHA 3V7AG 1FNSL 1IM9B 1KLFA 3S7GA 4P2CG 2N7BA 5BRZA 1UB6A 1TLKA 4LSSH 3D39A 3JUYA 4KRLB 4J8RA 4LHQB 1GGIH 4GMTL 5JZ7D 5I1LB 5EG6C 4PLOB 5ID1A 5SWZB 1F97A 5E5RB 4O2EB 3KHQA 1OTTD 3MGOB 5FYJD 5B21A 2J5LC 3QXTA 1H3TA 3ECBB 5FYLD 1NFKA 4DOHB 4F37F 1UM5L 4OD1H 1AO7E 1QQDB 4Z76A 4L3EE 4G5ZH 4UB0L 5T1MA 3WKMH 5EORH 2ZP0T 1JF5A 1R3IH 5FGBC 3NIFE 4M7ZC 3G5ZB 4MJIE 5FV1L 1AR2A 1UM6L 3BUTA 4L9DA 4XWOD 4YLQT 6FABL 2RQ8A 5I2IB 3UTPD 3B6SB 1VHPA 2Y36H 3LRSB 1GH7A 4H88L 2P8PB 1AD0A 2VAAA 1VKXB 1JNHB 1X6NA 3NPSC 4N0CD 1NBVL 4P2OA 1WICA 5C0CE 4QRUB 2LV4A 2JCCB 1S7QB 1T1ZB 1J1OL 3AB0B 5JQHC 3BH9A 3T3ME 1QKZL 4QXUL 4CJ0A 1DBKL 2Q6WA 1YJDC 1D5IL 5HVHC 3FQRB 3S35H 3KPNA 4PUBL 1SJXA 4PB9H 5E9DB 3UC0L 5CBAA 1DANT 3HNSL 5C8JB 4YPGB 1XF1A 4M1DH 3H7BA 2MJWA 3WNMA 5JW4M 3I50L 1BGXH 1LE9B 2AK1H 1QFUL 4E41B 3MR9A 3QH3A 4XP4H 2ZSVA 5DJ6B 3ZKND 3G04A 3VXOA 4DUWA 5BS0B 1RZ8A 2A73A 3BP6A 1F6LL 2YXMA 3A6BL 5H8DA 5TDOA 2FX8H 3Q5YA 4P9ML 4KRPB 4W6WB 1NFIB 4M1CC 4GAJL 2NX5A 2BSED 2YBRA 3BGFB 3ZYIA 1N5YH 5DMIL 1H3VA 1QLFB 2BNQA 4JO3L 1FNGB 3IJYB 1FG9C 4QRRE 4M3KB 5ETUA 1YN7B 4OGXL 5EZLB 4Q9RL 1CF8L 1AGDA 5I8OH 3ARDA 3CU7A 5C2UB 3U0WH 1KXVC 3HMXH 3IDGB 4TUJB 2F5BL 4PJGB 1TPXB 2CUHA 3IU3B 1F42A 2VXQL 2FSEA 3I3EA 4HG4K 4RWHA 2Q8AL 2VE6B 1ACYL 2VDMH 4PJDE 2ATKA 2C1PB 5K9JH 1YNKH 4GXUN 5EZIH 3MCKA 2NQCA 4HIEB 2RHEA 2X89A 4OGZA 3AM8C 2AXHA 4UT9H 1EXUA 1NFDE 1MJ7H 4XNZC 4OLWL 4YHZL 4ISVB 1N5AB 5JTWA 1D5XB 3VFUB 1HYSC 5E95B 2W0PA 4QOKE 1T21A 4ZFGH 1WC7A 1D3CA 5I71C 3QUXD 1A9EB 4TOYL 4I2XE 4JFDE 3HZVA 4XXCA 4GRWH 3WFEH 3TBVA 2EE3A 3WDHA 2ITCA 1KIRA 4U31A 1Q9OB 4HPOH 1NMBL 1RQ5A 2IH1B 4K2UL 5DQDH 3WJLA 5DR5L 4JG1L 1WIPA 5FAAA 3VXNB 4HUXB 3VJ6A 5I1IL 2I60H 4GRMA 2XTJD 1BPVA 1LK3L 3OAYK 5I66B 1C5CL 4LNRB 2ED9A 1F58H 1DVFB 4PG9A 1AGCB 4RISH 2WQ8A 5HVWA 4Z7QE 3C5ZB 3DARA 4ODHH 4XGZA 5D1ZC 1MCIA 1MF2H 3QUZA 1DUZA 1I9RH 2YPLA 4PJCE 5FO7B 3U36A 1OB1A 1HILA 4E0RB 1KGCD 2AJVL 4OIBA 2IFFH 4XNXH 5TQ0H 5FB8B 4FQHB 2VKXA 3BDYL 4UQ2B 1YA5A 3O6FB 3PWPB 4JDTL 4C83B 4P5TD 3QDGE 4S1QL 4HJGB 5BJTB 3UP1A 1NLBH 3FB6B 4LPYA 3RDTD 4WO4A 4MA8H 3EHBD 4MS8C 3FN0H 4IRJD 1K5NB 2EXYD 1L4IA 3DV4A 2E27H 3ARBA 2H1PL 4WHCA 4YNYB 2COQA 4F3FA 2CO7B 3H9SE 1JV5A 4Y5VB 3TH2T 2G5BA 4JRXB 3INUH 1EO8L 3CFJA 5EC2B 4H20L 5F7MC 5C0EA 3Q1SL 3MRPA 5IVXF 3CVHH 4JHAL 1QSED 4ETQB 1L0XA 1W72B 2C3XA 4LP4A 2O5XH 3MRCB 5FKPB 1LO2L 5A40E 1CL7L 3MOQA 2V6HA 3RIAK 4EEEA 3D18A 3NMEA 4K9EC 1XGRA 4OV5B 3ZDYE 32C2B 4P46D 1B9ZA 4HAFA 1ED3B 1MELA 5L2KD 1HN1A 3C9NB 3CDCA 2HJFA 1UM4H 3L3IA 3H9HB 3MV7B 1E28B 1CXHA 1U8PA 5JIIA 2GJZA 3L5HA 2C4XA 4KHTH 4XZUA 3UBXA 4ENEC 4Y5XB 2P44B 3BYYA 3LN4B 3WXWL 3UDWC 4F9LA 3RX8A 4K55A 5FCUH 4JFEA 1OP9A 4PJ9D 1PLGH 1CDUA 2UVFA 4YDKH 4P2RB 4LQFH 3ISWA 4LLYB 3QG7L 1BFTA 2C3WA 3T4YA 1CXLA 2NXZC 5DD3H 1ZS8B 4EJ1C 3RWFB 4KXZI 5BRZD 4U0RB 3BPCB 4NHUB 5F1IB 4YE4H 2ED7A 3D39D 1F90L 2DQIL 3O8XA 4ORGB 1EERB 2X4TA 4FQ1L 5F6HJ 1ACZA 3SEPA 4DZ8B 1GXEA 2DTMH 2EH8H 4X0KA 4P4RA 1ZLVH 1NEZA 5EZJB 3X17A 4ZS7L 2O5YH 1MCOL 3FZUC 4EUPA 3HZYA 4X4XB 3MLUH 1A8JH 5GJSL 1MLCA 4N1CA 4EKXA 1CVSC 4ONHB 4ZFZA 4GRLC 2B7DT 5B4MC 5EFIA 2F19L 2UUDK 3FKUS 4HJJL 5KN5A 1NBYB 3VXSA 5HI5D 2WP3O 3MUGB 2IWGA 3MBEA 5DMGD 3A67L 3KJ4B 2DN7A 5F9OL 1Z5LB 3PGDB 1UJ3A 4P2OD 5EN2A 5GS0H 1SBSH 2A9NH 3LEVL 4Y1AE 4K07A 3CK0L 3KYNA 4WUKH 2ADIA 4YDLB 2VDNH 3KYKH 4BJLA 3JV4A 3DX7A 2GY7B 1UKTA 3M45A 1XCQA 1TVHA 3GMLB 4KUCF 1TETL 3FT2B 3G6JA 3QHTC 1W0VB 2P7TA 2C3VB 5J89A 1X9QA 4ELMA 3EOTL 5ICZA 5C09A 5C07B 1Z3GL 5TE7L 4P0DA 5IHUH 1NMCB 1P2CB 3FQTA 3AXLB 3SY0B 4OSUH 5ALBL 3UZVB 1KC5L 3QDJA 5F7LB 4PRIA 2IH3B 1FFOB 1OQXA 3FQNA 3W0WB 5M94B 2NX5D 5HHOA 3BPLC 3Q0HA 3VFPB 2CIIB 3QQ4B 1S7VB 4X9BA 5DEFB 2AKRB 3VXUD 1PEWA 4RGMC 2NZ9D 3CH1B 4QHMA 4PRHB 1Z9LA 4LHUA 5TF1L 3IVKB 3CLEH 4K7PY 4QXGL 3QI9D 4WV1B 1BQSA 1NC2B 1KN2H 5CD3B 4Y19E 1G7PA 1VFAA 5TE4L 4RQQB 2HP4A 1II4E 3ARDD 1R5IB 4LVNC 5KW9H 4J6RH 2HLFD 4XNYL 1R3JA 4NIKB 3RNQB 3TO2A 3L6FA 3C60B 5C0FA 2FJFB 2CDGB 3UTTD 2WBJB 3VXPA 2ZOKA 4D0CB 1JP5A 5IHZA 4Z7NE 4OZFG 2CKBH 1PQZB 4MJIA 3W9DB 4OLXL 4NM8H 4Y4KA 2NY4B 1TQCC 2VIRA 4KVCL 25C8L 4NN7C 3LVEA 4YUEL 1Q0YL 3BKCL 1U8NB 3UMTA 3MLZL 4YHKH 5C0BE 3UO1H 2AI0L 1XGYH 3PDGA 3PP3K 3TV3H 5IMKA 4QRQA 2X7LB 1XF2B 5FOBA 3SO3B 3RJDA 3GO1L 1NGPH 3MACL 1YY9D 2P8LB 4M6ML 4XC3L 3WFDH 3MUY1 4MX7B 4X98B 1I8MB 4EBQH 3O3EB 1LEIA 4JKMA 1N0XH 3OR6A 2HMID 3FAXA 5HHMB 2NY2C 1FLTX 4RFOH 1DCLA 3SDXB 3KYOB 4KJWD 4BQCA 4CRPA 3QUZD 5SV4A 3BJLA 2YPLD 5FA3B 4E42A 5FYLH 1VB9A 4MMZC 4FP8H 5FGCB 5INDA 4R96B 5IBTL 4JJ5B 1R5WB 2W60B 2A6DA 1GZQA 1UH2A 5T3XE 5IKCB 2ITDB 2X1WL 1KN4H 5HHNB 4MAYA 4FMKA 4CMMA 3ZKSD 2R4RL 3T65A 1GIGH 1K4DA 4WO4D 1KJ3H 5E08L 1JHTB 2YK1H 3HG1A 4PPTA 4R7DB 1T1XB 4LASH 1AQKL 1J1PL 1NGQL 5DHVA 1BQHA 1ZVYA 1KPUB 3FT4B 3T2PA 3KR3H 4MZ2A 4QHKJ 3DUHA 1DL7L 1U36A 4QF1B 3ARBD 3WKNA 4X9HA 1AHWB 4PJBB 2NY7L 5JR1H 4JY6A 1MFCL 4NP4L 3MREB 3U4BH 3QIUB 2GCYA 3OJMB 5GGQH 4C4KO 1WAAA 1OQOA 4L4VE 3O3DA 4LRNL 4PJDA 1YPZA 3KYMB 3PIQA 1JTOA 4NNPL 3GMNA 2AAVA 2EDWA 4I77H 4LCYA 2FLRT 1JRHI 3PWUB 4YGVA 5BV7L 3FO0L 5CMAA 3RAJH 3GSXB 1GSMA 1KG0A 1UENA 3MJ9L 5CWSA 4Z77B 2I07A 3AY4C 1ETZA 2ZJSH 4LCCC 4KDVA 2DM7A 4ESKA 5HI4D 2R1YA 5IVZA 4XVSL 3O6FC 3F7VA 4FMFA 4JDZA 1CL7I 4NZUL 1RULH 1U58B 5DJ0B 1QFOA 4TYUA 1TZGL 5ANMA 1I85C 3QUKB 1BWWA 1AQDA 2EDLA 3NIDE 1PYWA 1FLRL 3X11B 1ZLUH 5T3XH 3ROLB 5I73B 1QD0A 4JFQA 5DD6B 3IDJB 4P9HH 4LLDA 1R3LA 3O8XD 1CGYA 4PJFF 1I1YA 1NCWL 3U0PA 4H1LA 4UOJA 3IDIA 3V6BR 5HGHA 4IMLA 4FXGA 2H9GA 4OD3H 2A6KB 3T08A 2D7TL 4W81A 2YN3A 2M1KA 4RFNB 4NFBA 1ND0A 4W6YB 2PTTB 4YWGL 5KSAC 5TFSL 5GGTA 1FL3A 1IGFL 4EOWL 5F1OB 5DMKB 3W9EA 1TZHA 4C59B 1T80A 4UBDC 2P5WE 1IARB 3HZKA 1X5GA 3R1GL 5DDHB 1H3XA 3IETB 3V6OC 1LE5B 1WF5A 3VXSD 2XKNB 5MI0C 3REVA 3MPCA 2CIKB 3BWAB 3MBED 4RMQA 4Y5XC 5D71H 5LWYH 4ODXB 2V2TA 1T4KA 5EU6B 4W4OA 1T7WA 3VG0L 5D5MF 4KROB 5A2LH 5K59E 2HVKA 1S9YA 1I3RB 3FONA 3P11H 4DN4L 4OI7A 5JXED 5F7WC 5H2BB 3SDDB 5C0AB 3RUGA 3ZZ1A 5I1EL 1BLNA 3CFEB 3FO1A 3OX8B 5EPMB 3TJHC 4XC1H 1FFPA 2YZ1A 1QFHA 4FQ2L 4WFGD 3QZWG 5D2NB 3U46A 4N0UB 3VH8A 2UWEB 4HWBL 5LVEA 4ZQKB 5DI8A 5D1QA 1NCNA 4WI3A 5GRXG 5C09D 3TFKC 3UYRL 1G7HA 1YEDB 2HFEA 1PZUB 1Z0MA 3TBYB 4C56E 1GHFH 4L5FH 5HHVH 1G1CA 1Q0XH 1OAZL 4JPVL 4PRID 5EOCL 4D9QD 1IAIH 4BKLB 3M17A 4JN1L 4DFIA 2HT4C 5HHOD 3VW3L 2LABA 3RL1A 4WI2A 5DRXB 1FZOA 3E8UH 3RGVB 1Q1JL 4PJAB 2EDOA 4MDIA 4ONGH 4KVNL 1ZA6A 2D9QB 2QSVA 2IAMA 2DLIA 3RKDD 2R2HB 3MBXL 4LMQI 2AEQL 3V9FA 4BQ9A 1YEHH 3DMMA 3U9PL 1KEMH 5INCB 4XCNB 3KPSB 4JGUA 5JLZB 5DJZA 3AU1B 4IRZH 3UJTL 2LTQC 1T7YA 3PHOA 4DVRH 1KACB 3BEVA 3MRDA 4IDJL 1HNFA 1OAQL 5IB4B 2F53E 5EU4A 1A22B 1FFNA 2JJSC 1AGEA 3ARXA 4XVTH 5L88L 3VG9C 4JGMA 4Y4KD 4G6KL 1YEKH 4AMKH 4YHOH 1FSKC 3MCG1 4HUUA 2AQ1A 3SOBH 3UZEA 2XWTA 1EFXB 4HBCL 3IXAB 1I3GL 5I1DB 1M7DA 4OKVA 1OTUC 3CFBA 3VE0A 3S96A 2XA8L 4KMTL 1DUYB 2WUCH 1XIWA 4Y1AA 3KGRA 4HS6B 1A6ZB 2ZPKH 3GJFA 3TT3H 2WV3A 5L8KB 4Y2DC 4KMLB 3QCUL 4Y4FA 3TA3C 3ZKXB 5LGJA 4DJMA 3PWLB 4GKSA 1C12B 3QNZA 4OLZL 2IMMA 1TZIB 4HIIA 3F7YA 3P77A 5FUCE 3DUSA 3KXFE 2VKWA 1DLHB 3TF7C 1EO7A 4L3AA 1E6JL 3JTSB 5HGBA 5EBWB 3DYMA 3RZWA 2R9HC 4GT7A 4PREB 1LK2B 1IGTB 4HH9B 5DJAA 1DEDA 3QUMA 4M02A 1NGXA 4OM1H 1GVIA 4LCWD 4ODVH 4KI5D 1IC4H 3VFNA 3VWKB 5IMMA 3QIWA 4RBPH 1CD1B 4Q58C 5E8OB 1JYVA 4KQ4L 5JW3L 4UTAL 4MAYD 5IB1A 2Z8RA 4DZBB 4WFEE 2NY4C 1J0JA 5I9QC 2BXZA 3GHBH 4UIKH 3TBTB 3HG1D 3S37H 3HE6B 1CE6B 1CFVL 4Z7VA 1N3NA 1Z9OA 3T0BA 4NUJA 1CYGA 1NAKH 1VEMA 4MXWL 3T2QA 4A6YH 4HZLA 4S1DD 1A7RL 4EXPX 4XNUL 4LDEB 2RAMA 4Y19A 4CVZA 4LIQE 2EH7L 1OCWH 2VN4A 3CFKB 5DD0H 3ZE0E 1BFVH 1BEYH 2DL9A 1AH1A 4QLRA 1MHPH 4DGVL 4MJ6B 4U6TA 3T4AB 5F7FA 2H32H 3MV8E 1T83C 1KIQA 2W0LA 1K8DB 1RK1A 4YHLH 15C8H 4APQB 3GB7A 3V5KA 2ADJA 2YD6A 2N7AA 3EZJB 1T5WB 3FQWB 5I19H 3OAYH 2EEAA 4I48A 1JN6A 4MQ7B 3GGWB 1QPXA 1ZKAA 1KTDA 3BKJL 3CXDH 3VWJB 4NN5B 1KYOJ 1JFQL 4IDLA 4OZGE 3S5LA 4D0BA 1HNGA 1AKJA 5C0GB 4U1NB 1I1AB 5HYQB 4QYOA 4M6NH 2VSDA 2DYPA 4WJ5A 5C0BA 4LSRH 5FHBL 1DBJH 3BQUB 4MD4A 4WTXA 1RIHH 5GGSB 2ID5A 4U6HA 1RUAL 2DBJA 3GJEA 4NCC1 3OGCB 1UZ8A 4N0RA 1ZTXH 1BIIB 1EVTC 3RVVD 1EEYB 4EI5A 3T3PE 3IDXH 4R9HA 5D8JH 3U6RB 3EW3B 3HNVL 5AZ2L 1EK3A 1AXSB 4RSVA 2GITB 1ODAA 4AIOA 2AJUH 4JM4H 3WNKA 2YA2A 1ITCA 2VR9A 2ZKHL 5IM7B 3C8DA 4L8CA 2VDOL 1F6AB 4JO2H 4G8FB 1HEZA 4YHYC 4FQXA 1NH6A 3BE1L 2G2RB 4HKBB 3I6LD 1P84J 3X14B 2VN7A 2E9BA 4LIQH 1S7RA 4CDHA 1XGQB 4F7CB 4YQXH 3QCVL 1CK0H 1IC7H 1VGKB 2IEPA 1KENL 1PX4A 5D7KE 3QUYC 2FBOJ 1C5DB 3BIKA 4NUGH 5IV2B 5DUBA 1F8TH 4ZTOL 3L9RA 5E8NB 3OAUL 5F8RC 4TTGA 2GK2A 1P9MC 2HG5B 1WK0A 4GMSH 5TJWK 3FOLB 1ZT4A 4XPBH 3MCLH 7FABH 5IW6B 3HE7D 1JWSB 4L4VA 5CUSH 2YD5A 3V5HB 4F7TA 3O11A 4QT5A 1ZVSA 4WRLA 5CKGA 1MCDA 3TNMA 1IGJA 5I8KL 2EE6A 5DJYA 2BVOB 4RMVA 2DKSA 1ZHLA 5K9KA 4PTUB 1WISA 1MVUA 1WEJH 3OB0K 2JJWA 3W82A 3L5JA 1XGTA 3Q5TA 1MCPH 1TVBA 3LRHA 3OAZH 1R5VB 1BQLL 2GKIA 2W0FA 2WSKA 1BJ8A 2B2XL 5MEPB 3LKNA 4DWHA 3MLSL 4ZYKB 3BIBX 3O0RL 3ZYOA 4KKAD 5HYFA 4R26H 4U0QB 4LCUB 1OT1A 1MCJA 4DKEH 3FO2A 1IEHA 1JWMA 1F3JB 3TNNB 1FGVH 1QBLL 5E4EB 1S7SB 4U1HB 1IL1B 3CC5A 3KPRE 1JNNL 2IAMD 3JTTB 1YJDL 2DLEA 3F7PC 3SKOA 1LP9B 4EI6B 1HSAB 1IZKA 2BSTB 1EEZB 1Y0LB 1CGSH 3DMMD 3BN9D 2ZUQB 4Q2ZA 4XPFL 5ITBL 5IBUG 2DDQL 4JB9H 4K7PX 5I16B 5AG8A 2VWEE 3SDDC 4YEEA 5T3ZD 3T77A 1A64A 1FNLA 1C1EL 4TPRH 5ICXA 5MEOA 4NNYA 1XF5A 2I5YH 2C7UB 4HKJA 3PG2A 4GW1A 2KL6A 3K1KC 3MV9A 3TEUA 2DQEH 1PDKA 3MA9L 4U6VL 5BMFH 3O4LA 5GHWH 1P5UA 4YK4B 4PJ7B 1ZXQA 2QBWA 1QA9A 3TYGH 5L9DH 1N2RB 2OP4L 1ADQH 3ARVA 3QQ9C 2OSLA 5DZLA 1YZZA 3D25B 3HI5L 3GI9H 4HXAH 4OLVL 3I9GL 1WZ1H 2DQTH 3D5OF 1A4KA 2GK0A 4M9OA 3V95A 4KKBC 4PD4K 3Q3GA 2EDDA 5ESAA 4ZFOL 1XIWD 3CLFL 3ZTNL 5TE6H 1P4BH 4FS0A 3OJDB 3SE3A 1RJLB 4BH8A 3LSOB 5EO0B 4TVPL 1YMME 2DBLH 4J2XA 2KBGA 4Y4FD 1OPGL 2YUVA 2XTJB 5DUMH 2NY6D 5DD1H 1RY7B 3WIFA 1ZLWH 5KJRL 5F7NC 5F89B 1RJYB 5F9JB 5IQ9A 2GJ6D 4BELD 3LKQB 3CDGB 5C7XL 2PW1B 4OCYL 5FF6A 4DGIL 2IQAA 2AK4E 5ACZA 1FORH 1XZ0B 3OQ3B 4XRCB 3DV6A 2P47B 5ISZA 4JY5H 3M8OL 2DIAA 1TJHL 1JUFA 1X5ZA 2DD8L 4RAHA 5HD8D 5C2BH 4HMDA 1WFOA 1I7ZB 1NDMA 4FFVD 8FABA 3QIWD 3RDTB 2X4OB 4WW2B 4EUPH 1IGYA 3V4UL 3B2VL 4KAQL 1GZPB 1LDSA 3VA6A 2X4SA 2NNAB 4Z5RB 3BGMA 5TQ2L 4LQ1A 4IRJB 3VGDA 5CEXB 3S97C 4KKCD 2LE9A 5ILTH 1ZHKB 5J7CC 1P7KA 4KI1A 2CRYA 4Z95L 1DDHB 4EQ2A 1BZQK 5GS0C 2F74B 4ZUSA 4KGJA 4KV5F 2R29L 3G5YA 4BZ2H 4OCSL 4PRBA 5E00B 3L1OL 3KG5A 3HI6L 2GEEA 4OZHB 5MEQA 4OM0H 5C0DA 4I18C 4YHPA 3IKCA 1F3DH 4O2FB 3PV6B 2BFVH 4PLJD 1K6QL 1ORSB 1KFAH 3MRRA 1KT2B 3C08L 1JGVL 3WXVH 1G7IB 3IXTB 5L2KB 1DSFL 3MRJB 3QFDA 4PV8B 1LEKA 2E5EA 4KDWA 5C3TA 3NIFF 1D5BA 1H9VA 4XAWL 1OSPL 2YXFA 3SDAA 1AKJD 2EDBA 3ARGA 4KRNA 4ERSH 2DYPD 1WBXA 1DQLH 4MQSB 4BFGA 2X6MA 4KHXH 4ODWA 4UV4H 4R4ND 3MRMB 4PJXE 5E8DL 2BVTA 2YA0A 4L4JA 4AQOA 5EU3B 5B8CA 4K94H 4S11A 4P23A 2XKSA 4FQPA 4PBXA 3TIDA 5J56B 4GAGH 3WFHB 2OZ4L 5J12C 4GLRH 1ZLSL 2D4DA 2R1XB 2V7NA 3KLSA 3T3MF 4EI5D 5D7JC 4OZIB 3B9EA 1UB6B 2OR9L 4OT1L 1BAFL 1MIMH 1HZHH 4NNXA 4NQDB 4WUUD 4NO0D 2FEEL 4Y5YA 3ARWA 1C8PA 3NFPB 5ID1B 4GRWF 5FYJU 4FNLH 4K9EL 1U3HC 4OF6A 1T04B 2Q8BL 4HCRL 5ACLA 4JPWH 1EGJL 1RJCA 5A3IC 4N9GA 1NGYB 4FQXD 4WU7A 4UINL 4DKFL 4J7RA 5ELIA 4Z76B 1YEFH 1RHFA 1H15A 4WFFD 4X6CE 2XZAL 5T1MB 4UI2A 4PBVC 1Q72L 1BIHA 5AEAA 1I1CA 2QSCH 3BPOC 5J11C 4JKPL 3A6OA 3GRWA 2HTKD 2R0LL 5I1AB 5GRYA 1KJ2A 3V52L 4O4YL 5EH1A 1AD0B 5JOFB 1ZWIA 2VAAB 1HHIB 3E6FB 1JGDA 3IDYC 5T5FH 1UA6L 4P2OB 5DD5L 3WIIH 1HE7A 3IDNA 4MD0A 5GGUA 1MAJA 1FAIH 3LH2H 3BH9B 1FE8L 1UWXK 2VZOA 4IIQC 5A2KH 2Q6WB 3UTSB 4K7PH 3RTQA 1HIMH 3KPNB 5JMRA 1G9MH 5CBAB 2CO6B 1Q9WA 1S7UA 5JZ7C 5IEKA 2BY0A 2DQUH 2W9LA 3S36L 3H7BB 4MXVF 5ALCH 1I9EA 2VDRH 1BMGA 1ZGLB 1OTTC 4XH2A 3TVMB 3MR9B 1NFDF 3QH3B 3MOAL 3G04B 3VXOB 2RJMA 4XB7A 5TDOB 1F11A 3WD5L 1ZAGA 3TESA 1WWWX 2DWDA 2NX5B 3CMOH 4GG6E 2KQNA 2K7PA 4MAUL 2YBRB 5I75C 3P0YL 4XCYA 4JPKH 2BJML 4XWOC 2VDLL 1CBVL 2X4UA 5CINL 5EU5A 2AJYL 2BNQB 4ZSOA 2XN9B 3B8SA 4PJHB 1JGUH 2YHGA 2APXA 5DHVH 2ZCHL 2R8SH 5IHBA 4N0CC 1OHQA 3QA3A 2UWEF 1NAML 3GBNL 5IWLC 5CIPA 4MA3A 1I8IA 1IBGL 3ARDB 3E2HC 4UNTA 1Q8MA 1D7FA 2DIJA 3BJ91 1WUNT 5E70A 2MFNA 2QQLH 2FSEB 5KS9A 1A7BA 1J12A 3MJ6A 4U2YA 1GOGA 2ATKB 1QLEH 1EZVX 5DJ8A 5MENA 3O3AB 2UV3A 1LO4H 4LDLB 3MXWH 3ZKNC 3FJTA 3MV9D 1JGEA 5DVOA 3VXTA 3O4LD 1T21B 3KPOB 1UJTA 3T0EA 4GSDH 4NHCL 2E9JA 2EIZB 3GUTB 1J0KA 1KTLA 4JRYE 1S7XA 4TULL 4NZTH 4MNQD 3N1FC 2R56L 5BO1L 2ITCB 1KIRB 3PQYB 2ERJB 4L8SC 3B9AA 4BSWA 3NIGF 1MHCA 4PJIE 2GUOA 2FIKA 4NKMA 2O5ZH 2P5EE 2VUOA 3VJ6B 2B1AL 1INQA 5EDXA 4HFUH 5E4EC 1T7XA 1IGCH 1R0AL 3P4MA 4HG4J 4XTRD 4LHJB 3FTGA 3DXAE 4FFYH 4HWZA 3G08A 4P3CH 3IJHB 3ROOA 3ZE2F 2E7BA 4PG9B 3SKNB 3LZFL 3VRJA 4RMUA 1YYML 3LKOA 1G7LA 4X7DC 4HWEH 4WENB 2EDFA 4MB4A 1FJ1A 3Q5OA 2R69H 5EA0L 4F58L 4BUGA 1DUZB 3U36B 1OB1B 3BAEH 4JDVA 1AI1L 2M2DA 4OIIH 4L4TE 3QQ3A 4OFKA 7CGTA 3V0WH 3K4ZA 4PFEA 4OCXL 5ISZD 2FH8A 1RIUL 1RUPL 1MCSA 4WO4B 2FJHB 1UYWH 4D8PB 4YK4C 1BD2E 4CL7A 3NAAL 5GIRA 3DV4B 5EUOB 3ARBB 3QUXC 4KJQD 4XBGA 1I8LA 3IKKA 3FQUA 4F3FB 5A43C 1JV5B 3QJFA 3P30L 3L3HB 4PR5B 1A0QL 3AS3A 4YZFF 2GIYA 5C0EB 4HK0B 3QIBA 3MRPB 4KDTC 1DQDL 1HQRA 4HV8A 2NY1D 5FK9A 3WNPA 3UYPA 3PHSA 3WFBH 2W65A 3H9YA 2ZUUA 4OF8A 1YNTA 5KVFL 4GKZA 2HJLA 3D18B 4RRPG 1F2XK 2Q3AA 3GNMH 2BDNL 3MJ7A 2Q76A 1YEIL 1UWGL 1C16B 3A6CH 2HJFB 3L3IB 3WHE1 4HXBL 5IB3A 1UWEL 2VLRA 1W8NA 1U8PB 5EBLA 3SDAD 1CXKA 2GJZB 4GJTB 2XG4A 4P5TC 4KK8D 1K3ZA 4XZUB 3UBXB 2V17H 4K3JH 1QSFE 1VFMA 3K4AA 4U3XA 1HKLL 1KCSL 1T3FA 2WWKO 4JFEB 3EHBC 1KCRH 4S1RL 4JY4B 2A6JA 1UCBL 1YMMA 5KOVC 4HWNA 4PGCA 2EIBA 2EXYC 1CDBA 3RWCB 3MLVL 4JFOA 4NJAL 3TZVD 3U30C 2F54B 4BSJA 5ADOL 3MXVH 2OJZL 2FECI 4V1DA 4QRPB 2GHWB 4AENA 2PN5A 1XR9A 5FUOL 5B3JF 2X4TB 5GZOC 4ZNEA 5JHDA 3OKEA 3FN9A 2JB5L 2DI7A 3I85A 3OJVC 4JFXA 4X0KB 4ZUWB 4P4RB 1NEZB 4MJ5A 5CHNA 4D0DA 2J8UE 4NQCD 1YC8A 3PHQA 5T3ZH 1F4XH 4GBXA 3HZYB 4OFPA 4MD5B 4YFDB 4P46C 3WLBA 4ZFZB 3LMJH 3ULVL 4MXQD 3HUJA 3ULUE 3K80A 5CEZL 2FEEI 4LAQH 2BRQA 2BOCB 3G6AA 5KN5B 5CGYC 3MBEB 1RU9H 2FR4A 4HT1L 2APVA 3RZCA 3PGFL 3DTXA 1E4XH 4PJ9C 5C08E 1UJ3B 4Q97A 4ZD3L 1JNLL 4ONFH 5FEBA 4D94A 1RZ7L 3KYNB 4POUB 2E6QA 1IEAA 3N50A 4LLWA 2QQKH 3VI3E 2ADIB 1NQBA 4LGRB 3JV4B 1CD8A 3ARYA 3DX7B 1XCQB 4R4FL 3RTQD 1A6WH 3NFNA 5DT1H 1HHGA 2OK0H 1CFSA 4ZOCA 5IT2L 1JTTA 1CIDA 2P7TB 1SEQH 3HFML 3IJSA 1AJ7H 4ZTPH 4ELMB 1XR8A 4Z7NF 1N4XH 3GK8L 3IFLL 4K3EL 4C55A 4F15C 1SVCP 4R6UA 5CZKA 3O45A 1I9JH 1G6RL 3WJJA 2ARJB 5L6YL 1WSST 5FKAA 3HZMB 1NBZA 2WUBH 1S5IL 3QDJB 1X5AA 4PRIB 2EEBA 3FQNB 2GTZA 4MYWB 1QPPA 3U7YL 4WUUE 3WDJA 1OD7A 4LSTH 5HI5C 2CH8A 2A6IA 3LHPH 1JPTH 5DMGC 4LHUB 3VGBA 3RBGA 4XP6H 3ME0A 1LDPH 1VPOL 1RSFA 2V5SA 1JYWA 3DROA 3RP1A 4XVUD 5GRVK 1G7PB 1VFAB 3DETD 1MWAB 3C2SA 1JHLL 1EMTH 4MHHG 3ULUH 3MLYL 3MV11 1R3JB 3TO2B 1AO7B 3NCYP 3L6FB 2ZZUT 4FFZH 5D7IE 4P59L 2P8MA 3VXPB 2ADFH 4EN3D 5IHZB 3P9MB 1JPFA 4F57H 2FX7H 4GKNA 4YGAB 3D3VA 4O2CA 4OQTA 5MEND 4MJIB 3OB0H 4Y4KB 4M5YH 2J88L 1FZMB 1QRNE 3T0ED 4BZYA 4M00A 3VGAC 1PZ5A 4TRPL 5C0CB 3MRFA 1H5BA 2WLZA 1MI5D 2YUZA 4JFZH 1C08B 4QRQB 2XY2A 5CAYB 1CU4H 2F58H 2PR4H 4HUVB 1KCKA 1VENA 2NZ9C 3HPLB 1S7QA 5DZNA 4HIXH 3P9WB 3QI9C 4XAKD 1T2QL 4KK5D 3PNWA 1I75A 2V9RA 4NQEA 3WSQH 1LEIB 3SPVA 4JAMA 3T04D 2HKFH 3OR6B 4U1KA 1WWCA 2AV7B 5C8JA 3TN0B 2HLFC 4L8BA 1LE9A 5FV2A 4YHML 4E42B 3ILPB 5JXAH 4QHNA 1YC7A 5BS0A 1GZQB 5D6DA 4GG6A 3HPJB 4MAYB 4JFFA 2AERT 2FGWH 1UXSB 3T65B 3NTCH 2X4QA 4X6DF 3HG1B 1P4IH 2KDGA 5IW3A 1BQHB 5AAMA 1NSNL 3BUYA 1S7TB 1A7NH 3DURB 4HK3N 4O9HH 4JM2B 4UT6L 4WIQA 5JQ6H 4M1GH 1QLFA 3PV7A 4KZEL 3EOYG 4LSSL 2CXGA 3IJYA 5EZLA 3C6LA 1GGIL 1NC4B 4F80A 4Z7WF 4CKVX 2GCYB 2YPKB 1YY9C 1F00I 3QIBD 1H3WM 5DS8B 3O3DB 3WS6C 3H42H 4TUJA 4PJDB 4MWFA 4JVWA 1VSCA 3IU3A 5HYJE 4OD1L 3PIQB 1EHLL 1U41A 3QDME 2IBGA 2VE6A 5E8EA 2IQ9H 1NCCL 4LCYB 2HMIC 3O9WA 4G5ZL 4HIEA 5CMAB 3EDKA 1C5BH 3WKML 3ZT7A 1G9NH 1R3IL 1KG0B 2FBJH 4PJEF 4QOKB 3QUZC 2I07B 5DA0B 4BUHA 1ETZB 1D5XA 4NC2B 5DC0A 2IC2A 4M8VA 4XCEA 2VLRD 2Y36L 1WWBX 4JLRA 3RKPA 2R1YB 3TCLA 4HC1H 5L8LB 2KKQA 2HFFA 2GT9B 4OZHF 3RWGA 5F6HI 4R8WH 5EIIA 1A3QA 4Z78A 5GSVB 3RU8H 3BRDA 4BK4A 5ANMB 2CJUH 4XHJD 3ARBC 5E8PA 3I6KB 1PYWB 3S35L 2MTPA 4PB9L 2FX9L 4LVOB 4X6BB 2BNRE 4V1DD 3GSWB 4M1DL 1EAJA 3BD3A 2QSQA 1KLUA 4JFQB 1O7VA 4KRMB 4Z7OF 4LLDB 3QT2A 5I66A 4LNRA 1BM3H 2K7QA 2AK1L 4NC1E 2JJUA 1I1YB 3LQAC 4PJCB 4Z7UF 4OBRA 3S3PA 3U0PB 4H1LB 4XP4L 5JHDD 3IGAA 1L7IL 3IDIB 1G0DA 5HGHB 4FXGB 2H9GB 4B7IA 1L7TH 4UAOC 1S9WA 1UG9A 2Z31D 3Q48A 3QDHA 2WP3T 1INEH 4C54A 3GMRA 4GBXD 1OY3B 4FQHA 5EOQH 4LARH 4YH6A 3O3BA 3W9EB 2A2QT 3SDYH 1TZHB 2YD1A 3CFDA 2VDQH 3E3QE 1SYVA 1N5YL 1MWAL 5SX5K 4F7EA 3K8MA 3HB3D 2XQYK 5HI4C 4NFCA 3MLXH 1V3JA 1D9KB 3H9SB 3P40A 3REVB 3BKMH 4WCYL 4F9LC 4M6OH 1IQWL 3X3GH 2HRPL 1J9CT 4YNYA 1BVKB 1FDLL 4WTWA 1H3GA 5I8OL 1T4KB 3U0WL 3HMXL 1S5HA 5ID0A 1YN6B 5D93B 1GPOH 3NH7H 4JRXA 1QFWH 5EC2A 4WWID 3FONB 1UADC 2VDML 3ALWA 3ARRA 3RUGB 1BLNB 3FO1B 4M62H 5EZIL 5D2LF 4R7NA 4UT9L 4JQVC 3O8XC 4QEGA 3SGKA 4RNRB 3U7WH 4JFPA 1KV3A 1XF4B 3VH8B 5B39G 3MFGB 4ZFGL 5DI8B 5D1QB 1EO5A 3C9NA 4UNUA 1G7HB 4RMTA 4TSAH 3MV7A 1GGYA 4JZJC 4MQXC 3M17B 1N6QH 4N8CH 3BVNB 3ILQD 4HPOL 1KB5H 2IANE 3RL1B 2PCPA 2QADD 3STZB 4DN3H 2EYSA 1FZOB 4N1EA 4DUXA 1EFQA 2F5AH 3LS4H 4J3XA 4MDIB 2SEBA 3DOSA 2IAMB 4Y16C 1IM9D 1KOAA 1ZS8A 1TJIH 3ZE1F 4UTBL 3RWFA 5FGRA 1F58L 3WHE0 1LNUB 1MCWW 2GSGA 3N1QC 4NHUA 5F1IA 4RISL 5I1JH 2JJTA 4FQQB 3JBG7 1DN2A 4ODHL 5IVXE 4ORGA 4U1GC 1A7OH 4JHBA 5JXEC 2Y4SA 4GW5B 2IFFL 1PKOA 4XNXL 5TQ0L 1NCAL 3ES6B 5KVGL 3BEVB 3MRDB 2ZNXA 2FIRT 5D72H 3UJJH 5T33L 1FFNB 3LKRA 4X4XA 3RFZC 3O6LH 3D3VD 3DIFA 4X9GA 4XNMA 4MA8L 4IOSD 4ZG1A 4UDTA 3FN0L 1A7PH 1QLRB 4HUUB 4DCQA 2XWTB 3FFDA 5FYKE 1M7DB 4WW1A 2E27L 4OKVB 5J8OA 1LO5A 5EUKA 1NCBL 1PAMA 3JV0A 3CFBB 2X9XA 3VE0B 1N6UA 3B5TA 4HJ0C 4K94C 3S96B 3WNNA 5IP4A 1NBQA 1J1XH 3CCHB 5IEHB 4JQXA 1DBML 1NJ9B 3HHRB 1XIWB 4Y1AB 4R2GD 3INUL 4QWWD 1YEJH 3ZL4H 4JREB 4U6XA 1Z5LA 5GS1C 3GJFB 3MJ9A 3CVHL 3NA4A 4Y4FB 1MCWM 5LGJB 2YMXH 4NFDA 2NY6B 2O5XL 3RKDC 3PE9A 3QNZB 4GKSB 1CLYH 3RHWF 1IM3A 1NKOA 3I6GA 4HUNB 1YEEH 4NQED 3EJZD 1ZA3B 4NCDA 3F7YB 4N5EC 2BSSA 3P77B 4GFTB 1FVEA 4HFWB 1NPUA 4J3SA 2E7LC 3FT2A 2AJXH 3MROA 4YAQB 4P48A 5HGBB 2V7HB 1UM4L 3EDEA 1HSBB 4ZAKB 1Q94B 5DJAB 5EC1A 4QHKI 1MREH 3QUMB 4MMXC 3W5MA 5BQ7B 4R97B 3VXQA 5DGQA 3O4OC 5BS0D 4KHTL 2QL1A 5IMMB 3QIWB 3SY0A 5FCUL 2BXYA 1HWGB 4G80B 1PLGL 2XZCH 4JFFD 5IB1B 1A3RH 4YDKL 3HAEH 3UBXI 4LQFL 4QNPF 4WI7A 4KU1A 2CIIA 3QQ4A 3VFPA 1S7VA 4YDIH 4Z7VB 1N3NB 3AAZA 4NUJB 5DHYB 4P49A 1YQVH 1T7VA 4MJ2A 4HZLB 3CX5J 4YE4L 5DRWA 3BISA 5D96B 2DQFA 4Y19B 4CVZB 3IVKA 1Y6KR 4M93C 3C6LD 1NC2A 3QXUA 5I1GH 1HHKB 5K9QI 1F6FB 2VITB 2JELH 4UV7L 5CD3A 5ITFA 1JBJA 2DTML 5F7DB 4RQQA 3VU2A 1XGPB 1G9MC 2EH8L 5FO9B 1RK1B 3QAZC 2EYRB 5FYKH 3GB7B 1CFQA 3V5KB 2ADJB 4OJFH 3LEYH 3C60A 2FJFA 3MLUL 2W9DH 4I48B 3TH4T 1MAMH 1SY6H 1NMAL 4D0CA 1WZKA 1OP5H 1KTDB 3CX2A 3FO9B 1MNUL 3S5LB 4U1LB 2Z9TA 1AKJB 4HD9A 3KNBA 3H6JA 2ESVE 2DYPB 3VGHA 4WJ5B 5C0BB 4MD4B 1JZ2A 1FHGA 1U8NA 4ETYA 5DVLA 2OTWA 5GS0L 2A9NL 5ECJE 2P45B 3MRIA 4OCWH 2X7LA 3S34H 4WUKL 2X1XR 5GSRB 1XF2A 4M61A 1FGNH 4EI5B 2Z0BA 4XMPH 2LU7A 4POZD 4RDQF 1KUMA 4FQCH 2P8LA 3QB7C 4S1DC 4Y8DC 3KPQA 3ZKMD 5J1SC 1CICA 5BVJA 4MX7A 2APBA 2ADGA 1A3LH 5JOEA 1I8MA 2X10A 1U0QA 3O3EA 2GSIA 3QPQD 4LFHD 3KYOA 3TPUA 4K3GA 3OF6D 4FRWA 4NRYB 3PXHA 1ZT1A 3IS0X 4XP9H 4PRDB 2W60A 5M7QA 4Y4HA 4BFEA 1OP3H 5GXBB 2ITDA 3GSNH 4RGOH 5J13C 1A14H 1AE6H 3PWPD 5HHNA 3DX8A 4JE4B 3QNXA 3MSPA 4MA7H 5JUEH 3ZT6A 1KNOA 3BIKB 1UVQB 3L7FA 3QCTH 4KY1H 2WK2A 3L9RB 4IJ3C 3SCMA 3FT4A 2EO9A 2VR4A 3QEHA 4F8TA 1KN2L 4HPYH 1ZT4B 2NY0C 5F7EH 1AHWA 3D0VA 1OGTB 5CSZB 4PJBA 1R3HA 3DRQA 4L4VB 5KW9L 3RVVC 4J6RL 1OW0A 3MREA 3O11B 4JRXD 4QT5B 1ZVSB 4IS6A 5DJCA 1UH3A 3TNMB 5I1CH 3QDMA 4KQ3H 1IGJB 4Q9QH 3F8UB 5DJYB 1JMXA 4KXZH 5C0ND 1EBAA 3O2VH 4H8WC 2XNAA 5DJDB 2FO4A 1MRFH 4N8VB 2CKBL 5K9KB 2HVJA 1MVUB 3BP5A 3PWNB 4NM8L 3WN5B 2DQCH 1M05A 1TVBB 3ARZA 4Z77A 3OKDA 3C09C 4LRIC 4PJ5E 1IC5H 4WGWB 2D7MA 5HDBF 3EDFA 2VXVH 2C4FU 3I3DA 4FTVE 3WUWG 3MV7D 3UO1L 1XGYL 5GPRA 3TV3L 2JIXB 3K2UH 3FO2B 4GMTH 4AYFA 4WTZG 1JWMB 4JHWL 3X13B 1N59B 3G6JF 4P2RD 3WFDL 5F96H 3QUML 3QUKA 5A16A 3VXRE 5KZCB 4NKOA 1PD6A 1N0XL 4K3DH 4NJ9H 2XACC 3X11A 3HE7C 3ROLA 1MJ8H 4RFOL 1D6EB 2J6EH 3S8WA 4UB0H 4Q2ZB 4OAWA 3NCJH 4FQLH 1PKQE 3SKJH 3UJIH 1IAOA 4I3RH 4OGYH 1UM6H 1SJHA 4YXLH 6FABH 3MTRA 4ZODA 3GM0A 5ICXB 4NNYB 2A6KA 2NXYB 1KN4L 3QEQE 3V6FA 2HH0H 4GW1B 3B8YA 3MV9B 3BP7A 4P2QE 1LO3H 1GIGL 3O81A 1CI5A 1KJ3L 2NY5H 4LASL 1S3KL 1QA9B 3KR3L 5I8CA 5T1LA 2OSLB 4BK5A 3HMWL 1A4JB 3BD4A 4KKAC 2PF6A 2XKNA 1A4KB 2GK0B 5JR1L 5ESAB 1U6AL 4I0CC 2VQUA 4PP1C 4BH8B 3CZJA 3HNSH 1XMWA 2RBLA 4IMKA 4ODXA 5GGQL 4CU6A 4CVWA 4FOMA 5DC4B 3U4AA 5CILH 2IAMC 3MMEA 5B38B 2PXYC 3STLA 2HFGL 1CLOH 3W2DH 2Z92B 4I77L 1KXQE 3QBTB 3W5NA 3OX8A 3AUVA 5EPMA 3RAJL 3NVQA 2QSTA 4P9MH 2YS4A 3DMMC 4JKKA 4PJFE 1FO0A 2IQAB 5ICYB 3G9VA 3VFWA 1EEUA 2ZJSL 3E6HA 1GCFA 4N0UA 3HCVA 3DV6B 3FB7A 3OKKB 2KH2B 4C56B 1JUFB 5IHLB 4YR6B 5C07D 4DVBB 1NDMB 8FABB 1YEDA 1RK0A 5FM4A 1KCVH 3RQ3A 3CXHK 4Q9RH 2X4SB 4BKLA 2MMXA 1CF8H 3BGMB 1OGAE 3QP3A 4PD4J 3EGSB 5DRXA 2VXQH 3B9KB 5SWZE 3ZTJH 5T3XL 4PJAA 1LO0L 1ACYH 4PRHD 4DOHE 4ZUSB 4JFHD 4P9HL 3G5YB 4H0HB 1DBBH 5IVXA 1NC2D 4KI5F 5D5ME 2BHUA 2YWZA 3L95A 4OLWH 5INCA 5MEQB 1N0LA 1MJJA 5C0DB 4YHPB 4OD3L 3IKCB 4X4ZA 2VXTL 3VFVA 2VLJE 3AU1A 4B7LA 1N8ZB 2F53B 3C60D 3MRRB 2HRLA 1P1ZA 3BYTA 3SGEI 1LEKB 4HBQA 1D5BB 2PYFB 3SDAB 3ARGB 5HD8C 4G7VH 4FFVC 3IXAA 3BEWB 5I1DA 1WBXB 2XTLA 5C92A 1WAAF 4ODWB 5I1IH 5LWYL 3LDBB 4HKZA 1J5OH 1YPZF 3DPBA 1QBBA 4P23B 5E9DE 4KKCC 1MEXL 4ORZC 4HS6A 2CQVA 3P11L 4U6YA 4MA1B 5DVKA 5FGBA 1EBPA 2V7NB 2D2OA 1ZOXA 4E41E 3HRZA 1CZ8H 1CICD 3QEUA 4NNXB 1C12A 3ULUC 4XC1L 5F9WB 4XMKL 1H8SA 2ZNWA 1J05A 5KBNC 4HGKC 5HHMD 3ZMRA 1DLHA 4N9GB 4WU7B 1LK2A 4PLJC 1FNHA 1FIGL 4RGND 3IDMA 1GHFL 4L5FL 1IVLA 1H15B 3T0WA 1OSZA 1JRHH 1F4WH 1IAIL 1RUQL 1JHKH 1CD1A 2Q86B 1KYOK 1B6DA 1IJ9A 5JHLH 4NZRH 3NCYS 2JJVA 3VD3A 4YO0B 2ZSWA 5E2TH 1EO8H 4CVXA 1KJ2B 2YRPA 3E8UL 4ONGL 1ZWIB 3HE6A 1BF2A 1HXMA 5GGSY 1JGDB 4R4NC 1J0IA 4P4KB 3SCMD 1T5XA 2AABH 1QYGL 4NZDA 4I3GA 4U49A 2P49B 4L9LB 4MD0B 1CL7H 5GGUB 3LPGA 1YEHL 1Q9KB 2DS4A 2OI9B 3CFKA 2Z35A 3K8KA 4RIRB 4EI5C 3QIUD 1OLLA 3RTQB 4WI6A 3RY4A 5C1MB 2EKJA 4DVRL 1ZLVK 1Q9WB 1S7UB 3FB5B 5IEKB 3OMZA 5HGAA 3FQWA 3F6IA 4XH2B 4MQ7A 4X5LA 2GAZA 4ZFOA 4Y2OA 4OZGB 4RAVB 3CAFA 4YHOL 3SOBL 4FQXC 2ESVA 3KVQA 4G6JL 1F11B 1J8HE 1SQ2N 4JG0L 1P84K 4CMHC 3QG7H 5HI3D 1TNNA 5C0GA 43CAA 3QPXL 4U1NA 3MQIA 5HYQA 1NUFA 1G1YA 4JZOA 3DX6B 3GEWB 3BQUA 2IALA 1PEZA 3RUGF 4WU5A 1CDCA 2HTKC 5GGSA 2ZPKL 1NLDH 1F90H 5SX5H 4K8RL 3MOBH 3O6MH 3P4OA 4I4WB 3OGCA 4FQ1H 4PJIF 3LN5B 4XB8A 1BIIA 4LKCA 2W38A 1IAKA 3P4NB 5ESQA 1XGUA 4MJ4A 4RA3A 5CIPB 4HS8L 4MA3B 1I8IB 3X3FL 3ZDXF 1VFUA 2WMPA 1QTYT 1MCOH 3FHQA 4XCFH 1PBYA 5KS9B 2IJ0C 3PWPE 5IM7A 4QRTA 1X5IA 4PJ8C 1F6AA 1U8JB 1I4FB 3NGBB 4QTIL 5IQ7L 4G8FA 4OM1L 4ODVL 4BSVA 2D31A 5DJ8B 1G9NC 2R0KL 3UPRA 4HJJH 1BX2A 4U1MA 2XOTA 3ARQA 5T1DH 2R1WA 4ZO7A 1UB5B 3QFJA 1JGEB 4LL9A 3P9LA 4UIKL 1XGQA 3TO4C 3T0EB 2NCMA 1ZT7B 3CK0H 3OXSA 5D1ZA 1KTLB 1NAKL 5T1LD 4A6YL 2NW2A 4HQQH 1LILA 1MCQA 4LVHB 2HG5A 5DD0L 4IM8A 1BFVL 1BEYL 3RWDA 1MHPL 4BSWB 1MHCB 3V4VL 3VA2C 2FIKB 4NKMB 2ZCLL 3C5JB 1CDYA 5L0QC 3VFOA 1W8OA 5EWIH 2BOBA 1X4YA 1INQB 4YHLL 1QUNA 15C8L 2OL3B 4KROD 3P4MB 5I19L 1WCQA 2LAGB 4HWZB 3G08B 3ROOB 1Z3GH 3N1MC 4HUWA 4HZAA 5TE7H 1EAPB 3VRJB 4XI5D 5CZXD 3LKOB 1WFTA 3V6OE 1G7LB 5ALBH 1URLA 3CXDL 4QY8A 3SE4C 1BVLA 2WBKA 4KGLA 3REWB 4JDVB 2OZ4A 4PJ5A 1DR9A 1M71A 3QQ3B 2NYYD 4WWKA 3SJVE 2VLKA 4YHNA 4LSRL 4G6FD 1DBJL 1I1RA 4OLYH 5J6HB 3VRLE 3BP4A 1LHZA 3OKLA 4KJYA 2C4FT 1BFOA 1ZTXL 5GIRB 4HSQA 5TE4H 4HCRA 3IFNH 4XBGB 1EGJA 3IDXL 3BOVA 3KPRB 1JZ7A 3CPLA 4I9WE 3RGVD 2LQRA 2AJUL 4JM4L 1ZVHA 3JTTA 3DRTB 4N90D 4Q6IC 1LP9A 3SE3C 8CGTA 5GS2H 3RVXD 1HQRB 2BSTA 3CSYA 4HV8B 4JO2L 3HAEG 5FK9B 1FNAA 3RVUD 4PG2C 4KVCH 4XTRC 2CK0H 1YNTB 1MOEA 5I16A 3VD9A 3PUCA 2RB8A 4JQIL 3WNOA 1W0YT 4AT6A 1W72H 4LIQL 5F8QC 4Z7VF 2Q76B 3MJ7B 2C7UA 2DM4A 2XWJA 5BZWA 4YQXL 3S4SG 3W39B 1CK0L 1IC7L 3KPLB 1A1NA 5L2JA 2VLRB 1JK8A 3BHBB 3EFFA 4J1UA 4ZUUB 1J86A 4PJ7A 1FH5H 2P42B 4CU7A 1FAKT 4NC1C 4GMSL 4S0TD 2PYEE 4AQ1B 1T3FB 4N0YH 3S88H 4XPBL 3MCLL 2A6JB 4RWYL 3SQOH 7FABL 1T6VN 4B50A 1FYTE 1YMMB 4PGCB 2ENSA 4GS7B 2DMCA 4I3SH 4KJQC 1GOFA 4J4PD 3OJDA 1WJ3A 2NY3B 3QULA 4LOUC 1EHNA 4GRLA 5AWNL 4K23H 4FZEH 2B4CL 4MB5A 3EIFA 2ZG2A 4L8DA 4AENB 3WEXB 1WLHA 1XR9B 4RCAA 3G5VB 1WEJL 4I0KA 2AK4B 2NY1C 5JHDB 3OKEB 4PBWD 4X9IA 1MCPL 3CDGA 2YD7A 3W0WE 4JFXB 2PW1A 4MJ5B 5CHNB 5DFTA 4D0DB 5E08H 1XZ0A 1E6OH 2B1HL 1MHEA 4PRPE 3SDCC 1J1PH 1OM3H 3PHQB 2WW8A 4XRCA 3PL6B 3WLBB 1NAMA 2IPKA 1DL7H 3N1PC 5F6IC 4KTEL 4AEHH 3U83A 2CLZA 3VWKD 1OGAA 3DVNA 3VD5A 1QVOA 2Y72A 1S78D 5HYSG 2NY7H 5EO1B 3NCCB 1RAMA 2CGRL 3G6AB 4NP4H 3SDAC 1FGVL 4LK4A 4KK8C 3GIZL 5CEXA 2FR4B 3RZCB 3DTXB 3HE6D 3MLRL 1IRAY 2J3SA 1BHGA 1DDHA 5B8CC 1ZLUK 1U8OA 2F74A 1NL0H 5HXMA 4AZ8A 2XXCB 4M7JL 5A2FA 1I3VA 5HDOA 4MA1C 3TZVC 3WO4B 3MJ9H 4HGWA 3NFNB 1CTOA 4HF5H 1HHGB 4U2ZA 1CFSB 4O2FA 4JO4H 4D9RE 4Y5YC 4WFHD 3ETBF 1A2YB 2DQEL 3IJSB 4AIZA 1XR8B 5KOMC 4L3CA 3ALXA 5DQ9A 1G7IA 1UC6A 3IXTA 4M7KL 3IFOB 3O45B 4NZUH 4TVPD 1MPAH 3TYGL 1WIOA 3KJ6H 3VWJD 1ADQL 5FKAB 1T0MB 1CXFA 1NBZB 2OL3L 5CSBA 2C1OA 1TZGH 3GI9L 1DFBL 1Z0NA 4QTHA 2XZQH 1WZ1L 1I1AD 4X8JB 2DQTL 2GTZB 4MXQC 3SKUD 2EDEA 1BJ1J 3BQUD 3MRMA 5TE6L 1P4BL 1RMFH 3WIHA 1UEMA 2DBLL 3D69A 1K85A 1T6WA 2A6IB 3QWQB 3SDXE 2PO6C 5DD1L 1MLBA 2R1XA 1G7JA 2K1MA 3DROB 4OZIA 4G9FE 4M7LT 4KV5E 4NQDA 3ZHDA 3WO3B 4EOWH 2CUIA 3NFPA 3P0VH 1FORL 3BWUC 1T04A 5IESL 4KK9C 4JY5L 4X6CB 2P8MB 5C2BL 1NGYA 5CLWA 1JPFB 1YYLL 2D7NA 4GKNB 5C3LD 2FHCA 3L7EA 3D3VB 4O2CB 4YIQA 5TPWH 2YD9A 3QFJD 1R3KA 2A38A 5ILTL 3VG0H 4UQ3A 1PZ5B 5I1AA 5D1ZD 3SE9L 5CCKH 3MRFB 2E6JA 1H5BB 1P7QB 4PGDA 5CFHA 1B0RA 5JOFA 1HHIA 3CSPA 4R2GB 3E6FA 3F5WB 2I26N 4Q7DA 3CFCH 4YBLB 4ZDHB 1SJEA 4BZ2L 2FCBA 1BVZA 1CGVA 1PG7X 2D9CA 4FQJL 4OM0L 1NUDA 1UEYA 1QR1A 3UTSA 3PNWB 4HWBH 4MS8D 4NQEB 2ZG1A 2A83A 2BFVL 4XVUC 3SPVB 2G60H 4JAMB 3UYRH 5MHSE 4NRXA 1KFAL 4U1KB