5KSWB

Dhodb-i74d mutant
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
262
structure length
262
Chain Sequence
MPKLQEMMTIVSQREVASNIFEMVLKGELVEEMDLPGQFLHLAVPNASMLLRRPISISSWDKVAKTCTILYRIGDETSGTYEISKLQSGAKIDVMGPLGNGFPVDEVVSTDKILIVGGGIGVPPLYELAKQLEEKNCQMTILLGFASEKVKILEKEFAELKNVSLKIATDDGSYGTKGHVGMLMEEIDFEVDALYTCGAPAMLKAVAKKYEQLERLYISMESRMACGIGACYACVEHDKEDENHALKVCEDGPVFLGKQLLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Isoleucine 74 Plays a Key Role in Controlling Electron Transfer Between Lactococcus lactis Dihydroorotate Dehydrogenase 1B Subunits
rcsb
source organism Lactococcus lactis
molecule tags Oxidoreductase
molecule keywords Dihydroorotate dehydrogenase
total genus 71
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2016-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
B PF10418 DHODB_Fe-S_bind Iron-sulfur cluster binding domain of dihydroorotate dehydrogenase B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.240.10 Mainly Beta Ribbon Dihydroorotate dehydrogenase B (pyrk subunit); domain 3 Dihydroorotate dehydrogenase, electron transfer subunit 5kswB03
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 5kswB01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 5kswB02
1E64A 1QX4A 3ZZTA 1BJKA 3JQPA 2OK8A 2BMWA 1YJNB 2PLFA 5JBQA 1KK2A 1FNBA 3ZC3A 1B2RA 1QUEA 4LBWA 3CMEB 1R5BA 2CRVA 3LRXA 1G7SA 4M2LA 1DDGA 1QH0A 1VQ4B 3LYUA 2OTLB 2DETA 2NPFA 2BM0A 3JQQA 4MYUA 4ZV4A 1D1NA 1CQXA 5DSZA 3QFRA 1SM4A 2BGJA 1GJRA 1IJFA 1QGZA 2ZITA 1HA3A 4G1VA 4Q7JB 1CNEA 4B43A 3WBJA 4P6VF 3CCLB 2HCJB 1Q82D 4RD4A 1G7CA 1EP1B 3MHPA 4YAFA 2QMUA 3ES9A 2BPOA 1KC8D 2B5OA 1UMKA 3LVBA 3I56B 1AMOA 1WDTA 1E63A 3QFTA 2QN6A 3FPKA 3CMAB 3G6EB 4B44A 1ZM9A 1GR1A 1D8TA 5TY0A 4U9UA 2GQFA 3I55B 3AVUA 3PENA 4MYTA 4YALA 1QGAA 1N0UA 4RD0A 1OB2A 2BSAA 3SJZA 1AIPA 4TMWA 1ZUNB 4ZGNB 4B47A 2DY1A 1GAQA 2X3UA 2YWGA 1TUIA 2BV3A 3CRZA 3QE2A 4TN1A 5EMNA 3CB4A 1FRQA 4G5GA 5GV8A 3CCEB 1IB0A 4RCZA 1G7RA 1H85A 4RD6A 3QFSA 3WNDA 3CC7B 3V76A 2E1RA 1U2RA 1JA0A 4M1KA 5THXA 4YAUA 4ZCLA 4EH1A 4Y9RA 1VQ7B 2EFGA 3W5HA 3WNCA 1VQOB 4B3XA 2GPJA 1VQKB 4M4SA 2DEUA 1QVFB 1JNYA 1OGIA 4PC2A 1JJ2B 1R5OA 1ZM2A 5H59A 1FNMA 1K73D 1ZM4A 3W2HA 4Y7CA 2OTJB 3ZBUA 3OZWA 1NJID 3AGPA 3CCSB 3U6KA 1W87A 3CCJB 3QFCA 1BX1A 4ZGQB 3P27A 1EFUA 3B78A 3VO2A 3VNUA 1VQ8B 4FN5A 5TV2A 4H9GA 4TMTA 3ZZUA 1VQNB 1F60A 2DCUA 1EP2B 3ZBTA 3CCVB 4TMVA 2XEXA 4P3YA 4AF6A 3MMPA 1NDHA 3AVVA 4M0LA 3CCMB 3FJOA 5TR9A 2D74A 3AVWA 1GO2A 1FDRA 3W2GA 3AVYA 2DERA 4C43A 3OW2B 2FX3A 1F20A 3LO8A 1GAWA 4HE6A 1TLLA 4Y9UA 1TVCA 2QTLA 1QUFA 2BF4A 1KK3A 1QFZA 2QDXA 1W35A 1VQLB 1M1KD 1OB5A 1YJ9B 1BQEA 3CW2A 3CD6B 1KJZA 2R6HA 4QFMA 4LBYA 4AF7A 1DARA 3U2QA 3AVTA 2QTZA 1Q81D 5FA6A 4DQLA 3W2EA 1JB9A 1FNDA 4RD3A 3CXCB 1VQ9B 4K1XA 3CCQB 4HE5A 1S72B 3VMFA 2QEXB 2PMDA 4ZCMA 3W2FA 4RD2A 4DQKA 5AN9A 4TMXA 1A8PA 2RC5A 2AHOA 4ZCIA 4YHBA 1Q7YD 3E1YE 4PGOA 1JA1A 2QA4B 1EFTA 1GVHA 1FRNA 1YHQB 3E20A 2YWFA 1Q86D 2VNIA 3CCUB 4YAOA 2VNJA 4B48A 1XB2A 4RJLA 3CC2B 3CC4B 1ELOA 1S0UA 4LC0A 2VYQA 4TMZA 2BN4A 3J81k 1DG1G 2PIAA 3OZVA 4PC1A 3G71B 1K9MD 3W5UA 2C77A 1KK1A 3MCAA 1BX0A 1FNCA 4C0SA 4PC3A 1N8RD 1KRHA 3JQRA 4N3NA 1G7TA 5HXBA 1D2EA 3CPWB 2B7BA 3W5VA 3VNVA 3P26A 1TTTA 2YWHA 4PC6A 1OGJA 1ZM3A 1B23P 2VNKA 3CCRB 1IJEA 4NCNA 1QG0A 3QSYA 1R5NA 2XNJA 3WBKA 2VZLA 1N0VC 4LBZA 5GV7A 2J7KA 4M53A 3U6BA 1YJWB 4R71A 1QVGB 1K8AD 4F7DA 1KD1D 1CNFA 2HMAA 2EIXA 1VQMB 1XE1A 2YWEA 2B7CA 1EXMA 1DDIA 4AC9A 1EFCA 4RCYA 1J9ZA 4IW3B 5H5JA 4PC7A 2CNDA 3OZUA 1YI2B 1I7PA 1H42A 4G1BA 1VQ5B 1QFYA 4YAWA 4BPRA 5KSWB 4FWTA 1E62A 4FK8A 4N3GA 1EWYA 3A1FA 2RC6A 2OK7A 3VO1A 1VQ6B 1KTVA 4B4DA 1EP3B 3AGQA 1SKQA 3AVXA 3WXMA 3G4SB 2C78A 2HDNB 3OJWA 2BM1A 1YITB 4UAJA 4ACBA 1QGYA 3B8HA 3ZZ0A 3WY9A 3WYAA 1KK0A 4LBVA 3OJXA 1W2BB 2BGIA 2VNHA 4J0QA 3WNBA 1VQPB 1M90D 3B82A 2BVNA 4RD1A 1QFJA 1W34A 3I1FA 4WQMA 2XNCA 4NBSA 1KQSB 4QHYA 4ACAA 1YIJB 3W2IA
chains in the Genus database with same CATH superfamily
5DHAA 4B76A 1MC4A 4GX2A 2OO3A 3KV1A 3HLTA 1Q6ZA 1QS0A 3C5CA 3I6QA 4TWJA 1G3MA 2R8BA 3H83A 3QUTA 5DH9A 2DHRA 4ZAZA 5TMEA 3EX7C 3U4AA 1QAQA 1BVRA 1YUBA 2F67A 1AQUA 5EG5A 2H16A 2I3BA 3O4FA 5DB4A 3WK5A 4FFLA 4DZZA 4UHDA 2OFWA 5KAMA 5IYQA 4OI1A 3T5PA 1QUEA 2D8MA 4XJVA 2AWOA 1X7YA 3V7FA 2YZKA 2EF1A 3DGEC 1QG6A 4YRIA 1T2CA 4AVYA 4GP7A 5T57A 4ZI7F 1XMXA 3MRXA 2YS7A 1P8AA 3LYUA 3T6KA 1I32A 1YAHA 2A4MA 1VKHA 3PCTA 3U3MA 1KFJB 1KQOA 4HLUA 1FX1A 4YRDA 4M46A 1JYFA 5FBLB 1QKJA 3ZE8A 2OBBA 3W8DA 4MDHA 5GVRA 1H5QA 2D2XA 1GJRA 3F67A 4MOWA 4DIKA 3V2GA 5DCUA 5HIIA 3EEOA 2IA5A 2H1WA 1M1NB 3BXOA 2XF2A 3AJ9A 1A9RA 3IPCA 4BB5A 1FMCA 1P6QA 3IAFA 3INYA 1DZIA 4F6RB 5IJ0B 3KYDA 2IYEA 3G59A 4D74A 2LCFA 4EJ0A 2VP0A 2J07A 4P6VF 1A72A 1K89A 4TXHA 2P6UA 3GLGA 5AJVB 1ETUA 1GP2A 2JFQA 4GKBA 3NBAA 4B33A 4YIHA 1TUGA 3IUJA 3KQUA 4F97A 1PNQA 3E1SA 3KDAA 2AEFA 5U1PA 3MM4A 3ZNPA 2BF7A 2IKSA 3QE4A 4C3UA 1D6MA 3M6AA 2XTAA 1SBCA 2R96A 3Q8XB 4GRDA 4RF2A 1JEYA 2ZB8A 1O96B 4S0ZA 4RESA 5K45A 1OLUB 1ZK2A 1W52X 1VHJA 3KFXA 3LVBA 4J91A 3WSTA 3IAM6 3FWZA 3BGSA 2EDCA 2P9EA 3GAMA 4FMCB 1CDZA 2YVAA 3LUKA 3UK7A 3WGGA 1UPUA 1ZAKA 1W2HA 5D01A 1RIFA 2QTRA 1DO0A 4GLFA 3LDFA 4S24A 4AWXA 2AKAB 3AHJA 4B71A 1OXBB 4C6HA 3A1DA 4GE0A 2EWVA 3LF1A 3VR2D 4M21A 1IXRC 4LN1A 1W0JD 3V33A 1GNTA 1X3SA 3M89A 2QAJA 3ZWAA 1YDFA 1KWKA 4BVAA 1EDDA 1I6LA 1WNFA 2ID8A 3HB1A 3PNMA 3W06A 1U1CA 3KM0A 1WOYA 3O83A 5I51A 1L4YA 3SYNA 3OT4A 2J59A 3IA7A 1P31A 4LTMA 3BIXA 4M36A 3RUFA 2OCKA 3MUNA 1M6VB 1T15A 2UUAB 1ESNA 4N5HX 4NOJA 1XNQB 4U9UA 3EY4A 4PBRA 2EYQA 2Y1LA 3U60B 1XZHA 2W6MA 4TTTS 3EZ2A 5SY6A 3RO7A 1NHWA 2QLBA 1OFVA 5EP1A 4KH1A 3HY6A 3UG6A 3U1TA 2I91A 3IIIA 4BKUA 1ESCA 1Z7YA 1II8A 2YKGA 1OIWA 1P62B 1P2GA 1ABFA 2IY9A 3IUMA 2P69A 4RFSB 4CLRB 5E1BA 3PQ6A 3RODA 4EGQA 4F4UA 1KEUA 3EARA 1U0NA 2CHGA 5K6AC 3EGOA 2BSAA 1PG2A 3EHDA 1JHOA 2PYDA 3H3JA 4IDHA 1V7QA 3EUAA 3KHKA 4BO8A 1HRDA 1QO9A 2EZ9A 4NSNA 4ZAXA 2B2XA 4NMXB 1NC1A 3RGGA 1NXOA 1SR8A 3IEMA 1GARA 1LH0A 1B0AA 3T3GA 1A98A 3ZTTA 3CRZA 5CVEA 1JV2B 4TYMA 1PJ4A 3CV3A 5KX5A 4MV9A 4FW9A 1PLKA 3D2BA 1OTXA 2J0EA 2JRCA 2K5UA 3OZBA 1KI1A 1XLTA 2FOXA 3TQTA 4DA6A 1P7VA 1KEEA 2R97A 1TW3A 1Q0RA 2W48A 4EPWA 3SSNA 1YMUA 1RQRA 1JH8A 1ULZA 4WBNB 3U81A 1PWZA 1XPOA 1ODCA 3I72A 5JD4A 3OSUA 4YI3A 4QPJC 5C52B 3K5WA 3NH6A 4KQ9A 3L9WA 3P2IA 5FL3A 1RXCA 4AYXA 1HYGA 1QE5A 2XY4A 4HWKA 1GFSA 2I7CA 3D8SA 3SMQA 5J4HA 1HI9A 2Z2ZA 3NO4A 4TV9A 3STUA 3ZOKA 4Y9RA 1EBFA 3TR0A 3IHLA 5LIRA 2ZM6B 2RHOA 3KJNA 2QN2A 4YI5A 1VBNA 3I6BA 4KXWA 1KL7A 1O95A 1U99A 1BE0A 2GBPA 2J32A 3PP8A 3UBMA 4CM1A 4DZRA 1R0RE 2WQ7A 2WPDA 2GCIA 3D6UA 3EXFA 3AVPA 2UYCA 5JRDS 1DX9A 1ZGZA 1Q0PA 3WFIA 1YA8A 3FYTA 4AZ3A 4PTZA 3U3JA 3VKWA 3FNIA 1MH9A 5BN5A 4E1AA 4YLGA 1GRVA 2HBRA 2O6LA 1G6HA 2W2NA 1NI4B 1ZK1A 4P83A 4JOQA 3IVRA 5AVVA 1N05A 1SOUA 2LXNA 2NV0A 1AC5A 4NENB 2VRWA 3Q3AA 4P92A 3W2HA 4RYDA 2NWQA 3CG0A 3ZEAA 2FSSA 1DJNA 2JFPA 2GN0A 3PHLA 4MCJA 3B6MA 3LWDA 4LOJA 2O5RA 4FNOA 4NU6A 1J9EA 5FPTA 2YIVX 3DA8A 4EBBA 2VQFB 4MUXA 4FD3A 1U6KA 3PRJA 2VRNA 1JH9A 2NIPA 5MF6A 1OUMA 2FH5B 1Z6GA 2WNSA 1VMIA 3DPSA 1U8YA 3EDYA 4E14A 1UDRA 1ZL0A 3ENNA 4OHVA 2PLRA 4PYQA 4P81A 1L5YA 4GYKA 2X8BA 4NBRA 1US8A 4TWZA 2IUYA 5CA1F 1XDSA 1U7HA 5BT8A 3N8IA 4QOFA 1RQPA 1Q3KA 5H9VA 3P71T 1AUPA 4XLAA 1LI5A 3LIIA 3PITA 1ZCFA 4J7AA 4V2UA 3QF4B 2GBFA 3D6VA 5LQUA 1UBFA 3ORHA 4QXOA 4DJAA 2JJ1A 1WZ2A 1TAUA 2VF5X 2WHPB 1YONA 1QIHA 3VOTA 5KSOA 1YQUA 4QSMA 2MCFA 4AMUA 1J8FA 2FW7A 4RMJA 3U4QA 2NUBA 4TTIA 4G25A 2BR4A 2C9DA 1VPWA 1UJ4A 2ZRDA 4O4LF 4V0OA 5AJYA 3UV7A 1M2OA 4HAUA 1FSGA 4IDAA 1Y0RA 1EFVB 3BWBA 4CZ2A 4A8JC 1E5LA 3AO0B 5FJIA 1HG0A 5TQJA 3K20A 4WZEA 3NU1A 3DLBA 1V3QE 4OXXA 5AVKA 4OATA 2BGLA 3FFBA 1C0KA 4K86A 1MEJA 2HK9A 3NTUA 3GGGA 3HYLA 4DBVO 2DECA 3R09A 4B17A 3AP3A 3L0ZA 5JCXA 4QICA 2Q46A 2QIPA 5I9IA 1QSGA 4PYNA 4U9IS 1L5WA 5EWLA 3HWWA 1P0IA 4L51A 1P1BA 1E1YA 4HTAA 2OBSA 2NPIA 4YCJA 2M6KA 3FMGA 4IIFA 3EGDB 4DQDA 4LFAB 3DO6A 2FMXA 4F6LA 1GEGA 3QPUA 2PUTA 4MW2A 4ZO6A 4YNBA 5JZOA 1KP9A 3QU2A 1ECBA 2H8KA 2Y0CA 5T3UA 5TF4A 3BE6A 3SJBA 2B0CA 3I6YA 4EZBA 3EQ6A 2HF7A 2IYNA 3D4NA 4RYLA 1GG2A 1IY0A 4QD3A 2ZTVA 2MINB 3K5IA 3NLLA 4CQLB 2HPHA 4LBYA 5ER6A 4ZC1A 4CQMD 5IPFA 3WL5A 4JKIA 4G24A 2P3QA 4DW8A 4QYSA 3JVUA 3MCWA 3BJEA 2R0QC 3H0KA 2V8OA 1W6RA 5AVTA 2ZUUA 3IHKA 1P6XA 2NX2A 2JJ2A 1F0YA 3LUGA 4IHAA 3RF7A 5F2NA 4HFRA 4DEYA 3LF2A 1VQ9B 1RVV1 1PG5A 1VDMA 4ZEVA 4B82A 4NE7A 4K6OA 2Z8ZA 3CUUA 5J4YA 3CCQB 3R1IA 4IH1A 3VMFA 2K7ZA 4I1UA 3H3XA 4ZRDA 3ZWBA 1M2VB 5GJCA 5IK2A 1UM9B 3CX8A 3IP8A 4X1YA 2ZIUB 3H99A 1F8FA 3UICA 1ABBA 1FS4A 1HC7A 1KAGA 2V3VA 3FUWA 4ZICA 1DLJA 3MINA 3IXLA 2YN0A 2AGVA 2RGBA 1Z82A 2EFHB 3GCXA 3NX4A 3ONNA 3OOJA 4YAKA 1QPBA 1XRNA 3OUZA 2H7YA 4J7XA 2HMWA 3I2GA 3ZY2A 1OJ7A 4AJPA 2OZKA 1I4LD 5AVQA 1ZVMA 3SEJA 1ZVQA 1YJAA 3OHPA 3P4UA 3VC7A 4EHNA 5DCLA 3EXHC 2IZ1A 3C3AA 5DGIA 1VSTA 4LHZA 1PL6A 2Q21A 5F73A 2D1FA 1VOTA 1Q83A 5EWJB 4ZPXA 5EIOA 2QPTA 1Y6FA 4YAOA 5HG0A 3FYUC 1G18A 4XWAA 3TBFA 3I2FA 3D81A 3PFFA 4UDOA 1VSUA 1VPLA 5HUHA 1I24A 4Q4HB 4UHCA 1WUIS 1G6Q1 3ICEA 2YJZA 1TDJA 2PMEA 1T3TA 1EQ2A 3BFJA 3KVRA 4MA0A 4JOSA 3ZDDA 1JDUA 1YR2A 2B7LA 2OBFA 2FQ1A 3QHQA 3F49S 4WA7A 3KG2A 4M86A 1N1GA 1JHXA 2F3TA 2WI8A 4I8XA 2ONZA 4S0XA 1G6KA 4X0EA 2OBRA 1C3JA 3GIDA 3ILSA 1VLZA 1XZJA 5F4BA 4ZRNA 4WFIA 1ZR4A 3MCAA 5ANRB 4LWOA 1R3DA 4FDLA 1UMCB 1I7LA 4C4ZA 3ZDXB 1QOPB 4XX1A 5AUQA 4PYLA 3RU7A 5F9MA 5DWVA 3SEQA 3GF4A 3PHCA 3O9VA 1TE2A 3AKCA 2O05A 3QM1A 3HUDA 4G81A 5A5EA 3BAZA 5IG2A 4WESA 2BMEA 2XGGA 4K88A 1NM5C 2PL9A 2Q4EA 5DLQC 5HIMA 1J1UA 1OLXB 3HZOA 2DTDA 4X7MA 2B4KA 4BNMA 1CULC 2X6QA 2IS4A 3LLSA 5C8YA 2H0AA 3VRHA 5BYKA 2ODWA 5A3JA 1K86A 2NU7B 2XUGA 4MWDA 3OKFA 1EP9A 3OOWA 1OXVA 1A95A 3E7WA 3S29A 1U2ZA 1BMDA 2OXRA 3LPCA 1DAGA 3K0CC 4WKBA 1UDXA 5B6IA 2Y0PA 2P8SA 4ARUA 4KGXA 5EHQA 2VHQA 5FH9A 5IBRA 3UW1A 4DA7A 5F4MA 1VJRA 2AQHA 5CTAA 1BU5A 1VHWA 2UZIR 1WPRA 3MZ0A 1PR6A 1E2LA 3GD5A 3M9XA 5C1PA 2YHIB 4Q01A 2GD1O 3K35A 4Q66C 1Q1NA 3CLUC 4XQFA 1DMSA 2JIBA 2K2WA 2G08A 1CJVC 1QK4A 3EMVA 4LFCB 3UWMA 4EG0A 5GGYA 5BRNA 2FPRA 4R2JA 3EFEA 5D86A 1G9SA 5IDWA 2Q1UA 2ZCJA 4GL2A 4O59O 3QUBA 2ILTA 3FN4A 2ET6A 1OB0A 2NSYA 4RM3A 3WIEA 1QG2A 2JHPA 2AW5A 1CF4A 2UAGA 1HWYA 3AV0B 3LUCA 4KW7A 1FS6A 1LNSA 2J5RA 3M1AA 5HK9A 2ODEA 1CUHA 3IVGA 3OQHA 1SBIA 2BH2A 4AC9A 3T7DA 4KRFA 1YJ8A 4L3OA 4BLSA 5K5EA 4Q1BA 2E5LB 1PJ7A 2GEDA 5EERA 1B6GA 3Q40A 5TX7A 3BT7A 3VKGA 2VQ6A 2C5FA 1MIHA 1T5DX 3OTHA 3VJLA 4PC7A 2WC1A 1UKEA 2FKAA 1YI2B 3D43A 3Q9SA 4YAIA 2J3MA 4PZZA 5B55A 3B20A 1O57A 4D8TA 2BCEA 4QYWA 1YJCA 5FTLA 4JVOA 5FWAA 4AWBA 3L8GA 3RF6A 3ZVRA 3G9TA 4UMDA 5B7GA 2P2LA 2Q2QA 2E7ZA 3W5CA 4NQRA 4IAOA 4RTMA 4C7OA 3GGOA 2B4RO 1VHDA 4GQIA 5JNTA 1M67A 2Q5LA 4FR2A 4UU8A 4AZ3B 1DADA 3TSZA 4DDKA 2VP5A 5JE8A 3ANYB 2BKLA 1EWYA 4G5FA 2J8ZA 3QQ5A 1RAEA 2PS3A 1E5VA 3MAGA 2JFWA 2W6JD 3H1PA 3O8LA 1FP4B 1A04A 1SXJC 2A0YA 4R6XA 4TQUS 2BW0A 3KOMA 2CY0A 3KR0A 2I7DA 4PLFA 3CZ4A 2QS9A 1WQ3A 3P0RA 1ZMTA 3IMKA 1UXGA 5DYGA 2ZXIA 2X8JA 2FE1A 2EP7A 3RTAA 4EYGA 4W5QA 4QM7A 4JZKA 2Z43A 4LXYA 4WXYB 5DHUA 1OV6A 4KODA 4TV9B 1D6SA 1RAHA 2EAUA 4HB3A 4DXAA 4E5PA 1OFHA 1T36A 3OJWA 4UAJA 1CS0A 3OCVA 5HRUA 1XAHA 4DLKA 1SKYE 3QBJA 3WICA 4D0SA 3PFGA 3LTNC 4B3MB 1ZI9A 1NBOA 4PANA 5GAJA 5CT5A 3WA7A 2Z6BD 2ACVA 4RH0A 4RV4A 5C3MA 3I62A 3KB6A 1MV8A 1YU6A 1RRFA 1S8FA 5LBUA 4P25A 4QHSA 3GVKA 4PXAA 1SD2A 5DM4A 1JDNA 3OBBA 1N2CE 4OBWA 4TKLA 3RAJA 3IL2A 2FZWA 4GGPA 4MLZA 1KIMA 3A37A 2GJ8A 3V7UA 1YBVA 1RBZA 3WYGA 4AN4A 2UZ3A 2XNCA 1M74A 2UVPB 1GWNA 2H57A 3KBOA 5AVUA 3S8EA 2DQSA 1A4RA 4ACAA 4JUAA 1KDVA 5I4IA 5IP5A 4HLQB 4TS9A 2GN9A 2I54A 4FM9A 2BFAA 5KTOA 4PG7A 4B46A 3QKTA 5FP0A 1IK6A 2A5JA 4EQ6A 1CUCA 1DC3A 2CXPA 3ZZNA 3IKLA 3MQ2A 4Y0AA 4MDEA 4OF4A 1U11A 3MJCA 3DBHB 1RHQA 1DRVA 4D81A 1KK2A 1FDSA 1DTWA 4IMJB 3B9QA 1PO7A 2HXSA 1G8FA 1Y1QA 2WABA 2QKYA 4PO9A 3VPAA 4EBFA 4ER0A 2PM8A 1Y7PA 1WBBA 1CJMA 1KRWA 2PMFA 2V7QD 4RMGA 3SAJA 3DMDA 1U0SY 3R6GA 4LYFA 2ZRJA 1ZKDA 1CP2A 3W3ZB 2CLMB 4C7JA 3WRYC 4ALKA 3WKCA 2OTLB 1LWOA 2O3JA 2ORED 4YMHA 1U8ZA 1VM6A 3KEQA 4F06A 4KHPB 1D1NA 3A4VA 1IM5A 3ZK8A 2ZXUA 3QEAZ 2ZJ7A 5BQ5A 2PSSA 4L8FA 4L50A 1DWOA 1T8TA 1D3AA 3EZ9A 3CWQA 3NH9A 4F2WA 3EXEB 5E6SB 3OECA 5ITZB 3A6DA 1DT3A 3GEEA 1QIGA 2FFRA 3V2IA 3UHOA 2V4UA 4UTRA 2JIZA 1RPTA 2VHJA 2VNSA 2DZDA 3AP2A 4IDGA 2AC2A 2OSBA 2Y1XA 1XVIA 1ODJA 4ARIA 4ZAFA 3I05A 1E89A 2M6LA 5L7YA 4MPJA 4X06A 2VA9A 1Z2OX 4ZXFA 4ENSA 5JWRA 4XPIB 4PZCA 5H80A 2PNJA 2WQ6A 5DNWA 5HE9A 3DEAA 1XJQA 4OHOA 2OMKA 1NURA 3OOSA 1JU3A 4DCJA 3BL8A 1XTPA 1LPOA 2QMUA 2FVYA 4BCBA 2BL4A 2FG5A 1AGPA 3ABSB 3OF3A 1OWPA 4CKXA 5CB4F 4R1MA 4MIEA 4RETA 3UFXA 1M33A 2O5EA 3KEOA 4HB2A 3V48A 4D4GA 1SRRA 5KOIA 5JOQA 1SK9A 5BUQA 3REGA 2HOQA 4WTOA 1A8SA 4WKCA 1CR4A 1C41A 2WYOA 3ZD9A 4D4KA 3VISA 1SVUA 3PC6A 3PC8C 3JVDA 1MR3F 1Y5LA 4KIFA 5DTJA 4IJVA 4XEUA 5FI1B 3KVOA 4XGQA 1XQ1A 1PWEA 1D0VA 4RSGA 4B8WA 2ZK7A 3KQWA 2ZPAA 5LDDC 5IC5A 4ZHSA 1V16A 2GPSA 2BEUB 4TKUB 2OHJA 3WLFA 5GPBA 3RRNA 1LS6A 1P2SA 1ZEJA 2X15A 2HWYA 2G9ZA 3BA1A 2D9RA 4JC5A 1JS1X 2WRZA 2GI4A 1ZGAA 3F47A 3FDZA 2YV2A 2VNAA 5JT1A 5LMZA 3FPLA 3UFBA 2X86A 2PX4A 2H48A 4TRRA 5F3RA 1XCMA 4ZODA 1E5TA 2V6GA 2JAXA 2PT7A 4GI1A 3RE1A 2E4AA 3P5SA 2VBFA 1E0AA 2G0NA 2QXTA 3FOBA 4BRSA 4KWEA 4IOMA 1PSDA 2IY7A 3QHPA 4LQDA 2NYAA 1E7SA 3L77A 5DT2A 5LCXA 1AGXA 1KS9A 3L8MA 3Q7RA 1X7WA 1EX6A 1IBRA 3ASUA 4HPXB 4XIIA 3U17A 4AB1A 1C7RA 3NGXA 4MR7A 5ED0A 2JFVA 2JIDA 1PFKA 4RD0A 5A62A 1W5TA 3N7TA 2RH5A 2YWCA 2ZL5A 1RJFA 2PD3A 4INAA 1DCMA 3BUSA 3C7TA 4ER7A 4LJ5A 2Q3FA 2XCOA 3T7IA 1W9HA 3DKPA 1VZ2A 3K3PA 4XUEA 1AUXA 4EB6B 2IHZA 4WDRA 4Y6LA 1UXIA 4C0KA 1F17A 4RXUA 1JAYA 1BE8A 1Z4MA 3VUEA 5KSZA 5E7IA 1NV8A 2JGMA 4M0UA 2ZWIA 5DW0A 3EFHA 4CMHA 2YR0A 4TN1A 1JDBC 1BX3A 1SVOA 3NTOA 2C4TA 3A8IA 2GILA 4JUFA 1YB4A 5L3ZA 3CCEB 2BFFB 2AYYA 3CIFA 1M6WA 3G1WA 5LD2B 4K6KA 1G7RA 4OGWA 2VBGA 1A3CA 2N3ZA 1LZKA 2R48A 3M2PA 5LDGA 4I9GA 5IZ4A 2IXTA 2J41A 4AJNA 5KQRA 2QRHA 3K0AB 2C2OA 5IM4F 2Y99A 3CKKA 5EIXA 4R8VA 2OEPA 3V3TA 4Q3BA 3VOBA 1V45E 2HRQA 5BSTA 5FFNA 3GT0A 2WM8A 3H7AA 3P2EA 4NI5A 1CR1A 1CR2A 4D02A 4H7FA 1EHCA 1ZIDA 3MJRA 2OXTA 3ULKA 4LF5B 1D2MA 5DNVA 2CLFB 2A0WA 3FUVA 4HDMB 3ZV4A 3LWBA 2VSOA 3QH4A 4NP6A 3O91A 2PR7A 5F3WB 2ZATA 3IT0A 1H5NA 2PT9A 5JAUA 3ROFA 4NABA 2GZ1A 1INLA 1KO1A 1YKGA 4RKRA 5CYPA 4DM4A 1N78A 4J90A 4NJMB 3WXBA 1VQKB 4Q9LA 1YS1X 1IATA 2QMYA 4RHCA 1FL9A 5T4EA 2QD4A 3ESQA 2A5YB 1OGIA 4G3XA 5D3QA 3RIXA 1OV4A 5TGZA 4F3YA 5EL0A 5SICE 3CVUA 4B3FX 1U8AA 4CLDA 2CD7A 5HS4A 2XMCA 221PA 1P5ZB 3VZSA 3A28A 2JLCA 1VHOA 5TS2A 1HEIA 1J21A 2F3RA 2OBMA 2QQFA 4JL5A 5IZCA 1RJ9B 5EXPA 1LF0A 3ZBUA 1YULA 1QPZA 3GJ0A 2FFQA 2ZIEA 2J3JA 1C2TA 4YDSA 4CM6A 1IWOA 1NMXA 3LXRA 4PS1A 3DVSX 3O94A 3D8BA 3WOHA 2AI1A 3CNQS 3DYVA 4B3DA 3TVTA 1XELA 2CUNA 3CVOA 4I4TA 2L82A 4NS4A 3UKDA 3GN1A 3BDIA 1PW7A 3ZDZB 4PR0A 3Q6IA 3OQOA 4ZGQB 3PE4A 3QUCA 1Z6ZA 1D09A 5DHTA 4DMMA 1OBVA 4PNPA 5EP4A 2I87A 2Q9BA 1MU0A 3Q7EA 4QFDA 3CX3A 4DBZA 1E98A 1QIEA 5KQSA 4PINA 2FOIA 3CPEA 4FN5A 2KS6A 3F8WA 1N1EA 4X1KA 3UMRA 4PYJA 1E6EA 1DDOA 3GFRA 2Z95A 1KGSA 3E2IA 4I46A 4E12A 4WA8A 5AD1A 2CDAA 2O2SA 4AKEA 2HV9A 3WQHA 4BNIA 1VQNB 1QDEA 2BEJA 4EKIA 2COUA 4D3DA 4ER5A 4PF1A 3GFFA 2DHDA 1Y8CA 4REMA 5DW3A 1V37A 4RM0A 5ER9A 3CCVB 3K0AA 1L1FA 3S1LA 3THOA 3MTDA 4RW0A 1A5ZA 2YMPA 3EF3A 4J9UE 3QGMA 2PXHA 1XCOA 3A04A 4OHCA 4ZT6A 3VYVA 4RDHA 4WMLA 2QJFA 3LCCA 4LY9A 1R37A 5DLEA 4DRXA 4ZCTA 4FS3A 2W2VA 3JQDA 3M6WA 3W2GA 3IHWA 1I01A 3KJZA 3PF9A 4GBGA 4K8OA 1VL6A 4GBJA 1I4TD 1OH7A 5IVKA 2ZJBA 2ZI3A 1EDEA 1EIWA 1S7GA 1U2TA 4NEGA 3PPYA 4MYCA 1M75A 2ZBRA 4GPIB 4R6WA 2IEGA 2R1TA 2Y92A 5TARA 2PUHA 2ZZKA 4FDAA 1ENPA 1GN8A 1PFVA 5LZ8A 1KIFA 4XL9A 1M1YA 2YIJA 1NMYA 5CJ2A 3WOVA 1TEHA 2W2MA 1Z5GA 4DK0A 4DTIA 2NZXA 2DH6A 3KFLA 5KYYA 4YXWD 3HR7A 5DN6A 3MGCA 1CB0A 4NZZA 3AI7A 2ABWA 4R40A 5BUCA 5KYTA 4QFMA 1TTQB 1ESDA 2C9BA 3G5LA 2ODAA 3IGFA 3QXHA 4HY3A 2PUVA 3PXGA 1H2ZA 3AR3A 2WJ4A 2ZTHA 4IDBA 3K09C 3ZE9A 3RKRA 1VCIA 4QVJA 3CH5A 5M04A 1TRKA 2WU4A 3EC1A 3ISTA 5F1KA 4F4DA 4OJYA 2AJBA 3ABOB 4MW5A 4MI3A 5CGZA 2Y1WA 1GKLA 4HWOA 4IL5A 4MAFA 4R5MA 3B1YA 4FC6A 4OI0A 4D9MA 4Y6PA 2JCYA 1UZUA 4LV8B 4H4CA 5C8YB 1P1FA 4OJMX 1R4ZA 1WLSA 3U37A 3AB7A 3CWZA 4HE5A 1KI9A 4HN9A 4NEHB 3RYIA 3IR7A 4JR0A 3EPPA 3V9AA 3BB3A 4EFDA 4OFWA 2R6AA 1MEOA 4G5YA 2WUEA 1R3UA 4HDRA 4LKRA 2EGGA 2ZDQA 4Q4AB 2SHKA 5J5CA 1NXWA 1SVIA 4WDQA 2ZI9A 1C0IA 1FLVA 4B45A 1SXJA 4DSNA 3MF4A 2D6FA 1UMCA 2YIDA 4JXXA 2PXCA 2HXGA 1TGYA 2X1LA 4WKNA 5CB6A 3W7VA 2GTIA 2QYHA 1H2YA 1LK0A 3DV0A 3EOAI 5J5AA 4E7PA 3C1AA 1ISRA 4XVUA 1KFEB 4ZMRA 1WCXA 3HJUA 4DNQA 1JKJA 1R0XA 2FQQA 2QSUA 1E1RA 2XE7A 1L5GB 2XA9A 1GL7A 1FRNA 4NS1A 4M9UA 2BKXA 3FA2A 4AN1A 3ICPA 3FTNA 2I3GA 3EULA 5DGXA 1B3RA 4KVGA 5I9TA 4DSOA 4U02A 5FL7A 1IZ9A 1EVIA 5HQJA 2JLWA 1HK7A 2WVHA 4HX9A 5DHPA 1N2ZA 2YC2C 5EIHA 5F1PA 1YGPA 1OVGA 3W6OA 2VHCA 1YHYA 2Q6KA 4LZOA 3O7MA 2D0OB 3L0SA 2D7JA 1GZ4A 4GLBA 3R4VA 4Q9NA 1T4DA 1NJ5A 2ZAIA 1SCJA 1OF1A 1Y1KE 2VL7A 1NLMA 2DFKB 2XNKA 3CUSA 3OC0A 3RS7A 3TTUA 3UN1A 4YRRA 3WJAA 4LF9B 1NTRA 3SFTA 2KE5A 1A9QA 3QEKA 4OA8A 3BMQB 3KT0A 2WY2D 4TOIA 2EQBA 2H4ZA 2QQGA 3CLVA 4Q15A 5J4LA 3K6JA 3KSDO 2H18A 4JI5B 2A1IA 4RA6A 3N7AA 2Z09A 2C1XA 3NWOA 2ZVDA 3H65A 1YZVA 2FQWA 1NW5A 1V35A 3IAXA 3DFKA 1T4GA 4I1OA 4P3KA 1RABA 5JY6A 2WTBA 3P9QA 3ITKA 4O29A 1F5NA 3F1LA 4NV1A 2V7BA 2WTMA 4IZIA 2JGIA 2P9BA 2YICA 4XWYA 5JXWA 5KQGA 3W5VA 3T7CA 1JG2A 3OZDA 1RKBA 3A05A 1EI9A 1NVXQ 2QRKA 1H6CA 4PPGA 4FBMA 3EWIA 4YR9A 4P0PB 3NWEA 1WHSA 5I3CA 5G1PA 4I6JA 1E3EA 3N3AC 1NVDA 4WLUA 1YBHA 5FB3A 3ZWVA 5DYYA 4MVJP 1HL3A 3CCRB 3CF4G 4WZTA 4Q3EA 3RASA 1RMQA 3Q85A 4WZKA 3OX2A 4P3PA 1H66A 4JHXA 1BTOA 1UKYA 3MS7A 4ZHQA 2DXIA 3LOQA 3LCMA 1MX3A 1RYMA 5D3MB 4BV8A 1GNVA 1JSCA 1TCVA 4LA4A 4P80A 4XFJA 3U44B 1ZOSA 2NPOA 1OMOA 3F9CA 3L1KA 4Q18A 3HWSA 4YRFA 2C7PA 3HP1A 5DIZA 4H6WA 1ECJA 1X1QA 4M8KA 2WIDA 1PNVA 3MTAA 4CF5A 3VPFA 4BFUA 4CEIB 3D7KA 5AK6A 5SZIA 3KT6A 2V3CC 4F7DA 3ID6C 1C8KA 1KS2A 4W1RA 2J9GA 1XL1A 3T15A 1KH3A 1OYWA 1WOPA 5LQDA 3F4BA 1QB7A 3A4YA 4FEGA 4MRRA 3DMTC 3DVAB 3G5MA 3M49A 1LC3A 1VQMB 2BMVA 1GTRA 4PHHA 4X7DA 3KCNA 1JWAB 1RNLA 3CLHA 4JLAA 1DBSA 1RJEA 4W5WA 3OMLA 4ZYXA 2MMCA 2QLFA 1N3IA 2I9KA 4HZUB 4OL0A 2IS6A 4RK5A 1LLQA 4ERNA 2FNAA 2WZQA 2X42A 3KAPA 1DOHA 4K46A 2CLOB 4UM5A 3UXEA 4FSDA 2QTAA 1RSZA 2FWJA 4I55A 4TTSA 1KPIA 2Q99A 3BTUA 3NT5A 3V80A 2VDWA 2O48X 4MVJM 4B7XA 1CF2O 1Z6QA 4IQ8A 4OBXA 1C4OA 4D0GA 1JYSA 3M81A 2VSXA 2YJGA 5FO1A 4MK4A 1Y4AE 1KVSA 2QR3A 4D99A 4REOA 4UVEA 2PBLA 1FFWA 1ZYUA 1EX9A 3ONVA 2YVUA 3WK6A 1I6KA 2EYUA 2FQYA 1Z2CA 2L18A 2CV2A 1ZGCA 1NQTA 4ZYUA 1Z16A 2P9TA 3UZUA 1C1DA 4V1CI 4NU5A 4I5EA 4Y3UA 3WYFA 1W8IA 3B1VA 3WLTA 2OHXA 2WVAA 5FUXA 5ALUA 1QP0A 1B74A 2FN8A 2RC6A 1TLTA 4TYQA 2ZIZA 3T12A 3N2ZB 1VQ6B 1C3OA 4DY4A 1GL6A 1L2TA 3DTTA 1JG6A 3FHLA 3ZKWB 1EXNA 1SK8A 1HTWA 3R7WA 1PS0A 1P7YA 3HDTA 2O7SA 3SR3A 3F4LA 4OHPA 4QKQA 1EP3B 3ZJUA 4UNPA 1C81A 4P4SA 4JBIA 3P9NA 3OE7A 2CLIB 4I81A 2GK6A 4DPLA 1C5KA 3AXSA 1Y7HA 3IEXA 2BUAA 3UA4A 3I23A 1ZW6A 3ZXYA 3HBJA 2YJ4A 3MJSA 1QRSA 3FOWA 2OBXA 2PTHA 1JL3A 5IANA 3K0HA 1WXIA 3ILYA 5JSHA 2XUQA 1QHIA 4PZLA 4YRAA 1I51A 3GBVA 1TQHA 3PTZA 3ZQKA 1AGYA 3UCXA 4C05A 3P94A 2Z3VA 1Y34E 1E8NA 1VQPB 1GZ6A 2J7PA 3L7DA 5DEIA 2QMHA 5TXGA 3R3YA 1MKYA 3ASVA 4KLCA 3K2BA 5BQ3A 1X80A 1JEQB 1WABA 4JLMA 4IIHA 4MR8A 4PLCA 1H22A 1KQSB 1P19A 1RHMA 3P9CA 3S7TA 2GJRA 3ETJA 4L78A 3C8DA 5D6OA 2HT6A 3T1HB 4EABA 3EEIA 3HV2A 2X8AA 4HGOA 4JI1B 4RV9A 3VYUB 2QGGA 2HV8A 4NMLA 4HK4A 4P3NA 4NE2A 5JALA 5EKTA 1Z88A 3DM9B 5B3KA 2R11A 4RS4A 1E6KA 5JBQA 1QU3A 4QBIA 2AYZA 1KZLA 4A8PA 1VE3A 2OXCA 4RDCA 5EN4A 3LHFA 4NCAA 3ZY5A 2C4MA 3ZC3A 5JCPA 3U62A 1OBHA 3GNLA 2GM3A 4LBWA 1V9SA 4IJ5A 1E58A 1HETA 1SCAA 5LA6A 2FF5A 1YIDA 1SXHA 3N6VA 4M1QA 1WXHA 2VT3A 3PXEA 1DJOA 4YFVA 4QRDA 3L8CA 1JIIA 4ARCA 3KWMA 2BM0A 1QB8A 4OPSA 4IP0A 3ZHXA 1GVNB 2YMQA 3PGXA 2IIVA 3LK7A 1WPCA 3VR4D 1VG1A 4LXQA 3STXA 3I12A 2PKWA 3PPIA 4NYMQ 1S7CA 2P3MA 1W88B 3M5WA 3VYWA 2NYRA 4O4LA 1M66A 2XB9A 4YCBA 3I2YX 2YYSA 4AS2A 1CVLA 4BFTA 5A4DA 2X5KO 3FDJA 2F1LA 3OP1A 4HCJA 2YHAA 2YMLA 3GMDA 4QUIA 3NUZA 4C5AA 3TLZA 4HKTA 2V7QA 2CF4A 3F3KA 1CNEA 4ZDJA 2JJ1D 4O4IF 4B6SA 2JHGA 2AUNA 4K9DA 2VDQB 4ZIRB 4ND7A 5LN1A 4HAZA 4YHHB 1T2DA 3C5VA 1I1OA 1WIWA 3NC1C 4L0MA 1Z6PA 1CERA 2O2ZA 3L4SO 4NEQA 1KP2A 4DJDC 1SXQA 4P3OA 5LJIA 3PD1A 1YQDA 3QITA 1FIUA 2A57A 2VJPA 1LY1A 1Z22A 3N2EA 4DABA 3DZCA 1Y0BA 4MI9A 4BKPA 3SF8B 1O96A 4FYWA 1AO3A 2HQBA 4QDXA 3G6WA 3TM4A 1TXGA 2DWPA 4A03A 4ZJUA 4Z3KA 1P4AA 1U3VA 4DVJA 1PJ5A 1XP5A 4QPZA 1E3DA 1UPCA 2XMDA 4PE5B 1ZP6A 3BB1A 1MRZA 4G86A 4H0FA 4WCVA 4XLZA 5ALLA 2QLNA 4PYIA 4C4PA 1KH1A 3IQFA 2B34A 2EZTA 1NQVA 1N75A 1UK7A 1YOVA 5K03A 1AQYA 1RFGE 1IUKA 3EVCA 5BYAA 4QV2A 2PEZA 3DUFA 2Y1GA 3IEUA 4IS2A 2P6OA 3V4SA 3WQSB 3N6XA 2F43A 1OYVA 2B78A 1JKJB 2HLDD 3FRIA 4DAEA 3OQIA 1ZM9A 2BJWA 3SP1A 2AF3C 1IZZA 1YJ5A 3JARB 1UJCA 3QOWA 3V8MA 4DOMA 5C4MA 4R9NA 3GVPA 1JFFA 1Z07A 4I0WB 2GCOB 4WJKB 3RUCA 2GQFA 3HU2A 4YP9A 4E1VA 5TE9A 1N34B 1PJ8A 2EOAA 2JJQA 3SLGA 1NJGA 1TEZA 2CXOA 3EVAA 2VJDA 3W5DA 4OP7A 3ZUGA 4MYDA 3ZH9B 4GSKA 3FF1A 1CUEA 3NOXA 1EINA 2X22A 3EHEA 4LDZA 1UDCA 4HSGA 4LOAA 4P4NA 5AJXA 3M4NA 3U48A 2HQSA 3CISA 3QWBA 4N8DA 4BL5A 1EVKA 3BIOA 3TLGB 5AKLA 3V97A 4JGIA 4KWHA 4TMWA 4HMOA 1T8YA 1L0BA 2EFYA 4HQOA 3SJUA 4YRZA 3G1UA 5KNDH 1ABEA 2DY1A 1IB6A 1JU4A 3ACCA 3SC6A 2GASA 3AEUA 3H5RA 4KGZA 4F2HA 2J5XA 2GM5A 2O8BA 5CH5A 2D3WA 5EINA 4U6SA 3WBFA 3ZYCA 4M8NE 2BLLA 3T1OA 2V7VA 1XZCA 4ETMA 1L7PA 1VFNA 1LNQA 1XTIA 2G07A 5E9JA 5I6DA 4TTAA 3SXJA 2YC4C 3UYLA 3HJHA 2J6CA 4DYHA 1DKLA 3RWMB 1LX7A 1PAUA 1R4MA 2OCIA 2CSXA 1QRAA 5LOVB 4RTNA 2A9OA 2PH7A 1RWMA 2HNKA 3ELBA 4RMHA 2AF4C 1CU1A 3Q2IA 1HDYA 4GZ5A 5KMGA 3OHMA 3TFOA 1EK0A 2D54A 3F6EX 4TZKA 2OP1A 5JU6A 2YXPX 2OOSA 1XRSB 5IAOA 4NJOA 4Q34A 3KSRA 3AHDA 4PXYA 4D4MA 2B9VA 3I2JA 4BO0A 4CM9D 2WZNA 5F64A 5JSZB 3ADPA 1P3DA 4YAEA 5B2ZA 4BQSA 2R8XA 4GL4A 3DT6A 1FJXA 3HB0A 1JT2A 3NJRA 4R8RA 4ASUD 3AUJB 4OAQA 4ED9A 3W5HA 5CBKA 3CZCA 5AI0A 3UWSA 2C2BA 5C34B 2PTGA 2QMEA 1TU4A 1VQOB 4D42A 3ZGZA 1N3LA 1AGNA 1H4TA 1XHEA 2HU8A 2R4QA 3FZGA 2R8EA 4WNAA 5LUBA 3S5UA 1YBAA 2NNWB 4P8RA 2VDOB 5KSPA 2O52A 3VZCA 4Z9AA 4IQFA 2PJRA 3KHTA 5J63A 5K1ZA 2QI9C 1N2EA 1U1EA 4IQGA 4PICA 2VBSA 1RM3A 3U7QA 4DSTA 2FRXA 1NRWA 4Y7DA 1U94A 4DR7B 3GVCA 5ICCA 1FNMA 1HKHA 2BM8A 2MHCA 2EFEB 4QBGB 5AJUA 3EW9A 2ZUTA 5I7WA 4ILEA 3PXUA 4D45A 4OG2A 2NAFA 1NJID 1L4UA 1V6SA 3TTVA 1YQ9A 4RIIA 1L4EA 1PS8A 1EGAA 2LDXA 1U7XA 1IY2A 2ZSBA 1E69A 4L5JA 3SBDA 4N54A 1R8JA 3U6KA 2WVGA 1L7XA 4BNVA 1U63A 1TIKA 3VAZA 1R88A 1IDN1 4LDQA 4Z6KA 5F23A 2XVAA 2F8TA 1M2KA 4HATA 5CD9A 3K4PA 1EK1A 2IYSA 3B6IA 3TEMA 4LJ4A 4A7PA 4Q9AA 1M2GA 2GO7A 4GEKA 5K6AA 4OTZA 3VZBA 1UP7A 2BP7A 3QOFA 1KMNA 1MG5A 2QK4A 2ZBQA 3HLYA 4MW7A 1AKUA 2VATA 4QASA 4AJ1A 1V41E 1CQJA 1DVRA 1T9KA 2JJ8A 3JWEA 1LEHA 4I7EA 4XN3A 2WWFA 2FP3A 5JPIA 3UT5A 4QTTB 3TLYA 4Z4FA 4Q03A 4DDMA 3B13B 3HWX1 3CVWA 4X97A 3DOEA 1RJGA 4PFJA 4K2AA 4C1BA 3O3NB 3MMPA 1T3HA 2IDKA 4TWAA 1NYTA 3UHPA 5T8KC 2BCJQ 3FYUB 4HDOB 4OPMA 4Q7QA 4JVSB 2ZRAA 3U44A 1WHTA 3BWMA 4I50F 1QRDA 3ONYA 3QVKA 2A0KA 2CJXA 1ADBA 3INTA 4M1MA 2OD2A 5C37A 2VQEB 4HH4A 3MTIA 4BUJA 2IYZA 3LXMA 3JQ7B 4G23A 5HK8A 4BE9A 1Q0TA 5B58T 3DLPX 4QEDA 1TLLA 5DSXA 4DCGA 3AZPA 4GNKA 1JPUA 3T35A 3V9PA 4IDOA 5M3BA 4P3IA 3P5BA 3U3RA 4DSZA 4F5EA 3DMPA 3FOZA 3NVMB 1Z38A 3WTCA 4X66B 1AGRA 1NIJA 2PS0A 1R4AA 5DGCA 3HXTA 1WZUA 2HA6A 4F1JA 1Y1LA 4HNRA 4KRGA 4KR9A 4ANFA 1O9HA 4D3ZA 3LNNA 3SX0A 2IGBA 4QG3A 5IJ9A 5B7PA 5MN6A 3MJDA 2N75A 5JXJA 3BQ9A 2WYUA 4DLLA 1TF7A 4D8UA 3SYLA 5JW6A 3AHHA 4I1SA 5L3SB 1MF7A 3HXQA 3KT3A 2JH3A 1Y1TA 4MQLA 1AG9A 2B92A 1JRLA 1SOWA 3DLIA 1CHNA 3EF1A 3OCJA 4HFJA 1GG8A 1TKBA 2GK3A 3OVMA 4MKGA 1BKYA 1OE0A 4Z86A 3HO1A 2QG9A 5CX1A 2OL4A 1XOIA 5CVJA 3NDBB 2CZQA 4M9CA 3QX8A 4ZMSA 5FOSA 2GAOA 2FP4A 3PWTA 4H3SA 2Z9BA 2G3YA 3CTMA 1DKNA 1J9GA 1YE8A 1JF8A 3FDZB 4JYMA 3LXXA 3RVPA 3CH4B 5B58C 4G0XA 3SIPA 3A1UA 1Y9JA 3ZHUA 3LU1A 1Z2DA 1LTQA 2PDAA 3GBSA 4Q3LA 2G1UA 4EUNA 3KPVA 2JIPA 2G9NA 2A78A 4L6AA 3BC9A 1A0OA 1YT5A 2I34A 4JCOA 5DLPA 3BC1A 3NETA 2AB0A 2ZE5A 3BZUA 3O47A 2E9SA 3HHEA 3TPCA 4A82A 3OURA 2J45A 2ZQZA 4L8GA 1I4DD 4TSFD 1NDQA 1IVSA 4RGVA 2GA9A 5TPZA 3F6YA 4AG3A 4MVWA 5K3SA 5IJ9B 2O57A 1RT9A 1C9DB 1LSSA 1ZNYA 2VT2A 2KVOA 3DMRA 4JJEA 2HMYB 1Q22A 1T9HA 2WD9A 4N8EA 3FIJA 2W2TA 2F9LA 3E7DA 3CVYA 1NRKA 4E5UA 3BILA 3ZGOA 1JPVA 4G09A 4JJKA 4BNNA 2R7MA 2XGJA 3T06B 1CC1S 2CLLB 4X9XA 3RVKA 4BOYA 3CC4B 3T9FA 4NHOA 1ZIXA 3RVOA 2HWKA 3KKNA 2IS1A 4IQ4A 2C2GA 3FH0A 3M4JA 5EMHA 3RI3A 3UMCA 4OPOA 3P45A 1PI3A 3J81k 4ML3A 2XCSB 1G5HA 2R8ZA 3ZE1B 3W5UA 4CLOB 4NV3A 3MGBA 1YR8A 1PWXA 4RBNA 3CX6A 3KWFA 4E5MA 2ZAOA 3GYGA 3PVSA 1OROA 4IZ6A 1B15A 3A6KA 1NW3A 2B6HA 3AG5A 3N58A 5AM1A 3NTVA 2D06A 1E4EB 1K66A 2WYHA 4N12A 4IXWA 2LCQA 1G1AA 2CJWB 4OSOA 5ITVA 3SKVA 4EI8A 2XDAA 1F4LA 2H4YA 1O6BA 2F48A 2Z2IA 3QE3A 1A5AB 5DM2A 2G6TA 5A9TA 1M34A 3IVXA 2XB8A 5EJ4A 4DLUA 2DPLA 3MWDB 1R6VA 4N8SA 1V1RB 1K7CA 3SJCA 3CPWB 3BMNB 3MS2A 1IHMA 1P9OA 3L6CA 3QQPA 3KKMA 3LNTA 4MVXA 4I9FA 4QGSA 3KXPA 4LGVA 4XYLA 1DPGA 2XIQA 4KXFB 4CI0B 1W46A 5BWOA 2VHTA 5JLAA 2H0RA 3Q8WA 3GLIB 4PC6A 1MABA 3GA0A 4ZDKA 5LXTB 4B1FA 4CT0A 3AUTA 1NLYA 3EVBA 3VFDA 3PC3A 2BAGA 3ECCA 4WLFA 2FN3A 3FRHA 4WOBA 2O8EB 1QG0A 1QVWA 2A84A 2OESA 2Q3CA 2QVGA 2GRAA 3QSYA 2KI5A 3G8YA 1A8UA 1GPBA 3OO0A 4TXMA 1WAMA 4HR7A 3U4DA 3THRA 5B2FA 4AKSA 5CEEA 2G0AA 1DAIA 2JKVA 3QEJA 3M33A 1I6WA 3LT0A 3PPVA 1YVUA 5KTYA 4D79A 4DMLA 1ANKA 3TQOA 4GNRA 4FBGA 4YDHB 1RLIA 1B6RA 3E15A 1AS0A 1XN1A 2A59A 3H9QA 3PX3A 1XTJA 1DBIA 5JIBA 3NHBA 1KF0A 3FCOA 4G0ZA 2JF0A 2X5XA 4CGYA 5B7NA 3G3EA 4L4SA 5KSYA 4XEHA 3ADCA 1V9CA 2O8CA 1VLOA 2ZG6A 1E3TA 4X1KB 3BB4A 5CK5A 3EXHA 1SIBE 2FRDC 2L69A 4Z1MD 2F55A 2GCNA 4KX5A 3UIEA 2ENWA 3B52X 3V8VA 2GOYA 5ESDA 1E2HA 1WX1A 3FMIA 3LCRA 3R2JA 2O8FB 1B26A 1DE0A 4URZR 1GAEO 2AN5A 5HIKA 1CEYA 5HVNA 3FYUA 2WKRA 3ILVA 4XDZA 1EJ0A 4JJ6A 1JT9A 1VG9B 5IC6A 5MN4A 3UGTA 2W9XA 1E2IA 5CYFA 1S3IA 3HRKA 2HHCA 5C7LO 2IZZA 1YHNA 4N3BA 1VL0A 5L9AA 1X8LA 2FEOA 3GUZA 1P9LA 4XD7D 1YZGA 3TJRA 3U19A 1H42A 1TC1A 5DOZA 1ML3A 4UPEA 1XNHA 4YREA 1UJBA 4ICIA 5DULA 1VMDA 2W2XA 4TV8F 3E3LA 4CMBA 3WMXA 4DV3B 4YGYA 3HH8A 4DMKA 1SB9A 2PHZA 3W90A 3ZNOA 1E99A 1XMVA 3TAUA 1VF7A 2HRCA 1H2HA 5TIIA 13PKA 4GI5A 2QA5A 5FWNA 1P81A 1L5QA 2X41A 1IXZA 1VHQA 2ZYVX 5L7TA 4XR6A 1TMGE 4J3NA 4DFDA 1W36D 2B6NA 1ODFA 3PUXA 4JKYA 3MBOA 1X1AA 4XWTA 3UANA 4R3WA 2G9VA 1KXZA 4M3NA 1R4NB 1BFUA 2HT1A 1DMRA 1AK2A 3AKZA 3NCHA 2CBZA 2IYRA 3FZQA 4IFTA 3VO8A 2FUNB 3JTEA 3PBKA 1XQYA 1U0LA 5DLDA 2CUZA 1UJNA 4JGGA 3RSFA 1OD6A 3FDXA 2XV1A 2VXBA 2LBPA 1NZJA 3EEQA 4HVAA 4GPAA 4LOKA 4R83A 3LA6A 4BTLA 2YOGA 3RTCA 2ACWA 1YXMA 2N1BA 3RS8A 3B8HA 1AHHA 1DJPA 2VTBB 3L6RA 4J2OA 2JLZA 2PU5A 3BBPA 1WXEA 1OSNA 2BEWA 3PHIA 4X1OA 3RS0A 3BZWA 4AY4A 1CJKC 3I52A 5A6SA 3M6XA 5KU1A 1BROA 2ZTUA 3OIWA 4KQGA 4PG4A 4X3PA 1FMFA 5IAEA 2MDTA 5JYEA 3ER9A 3S2UA 1SCBA 1E2KA 2EGUA 2OCXA 3BDAA 2DUNA 4NPCA 5BN5B 4ARSA 1W34A 3A2NA 5AK3A 3PHBE 4QGGA 4B6GA 4DLAA 3QWFA 2JGKA 5DNYB 1CK4A 3V8QA 4D3YA 4OX9Y 2H29A 4DKXA 3IKTA 1BG6A 4EA6A 3L6BA 1A2OA 2VFAA 5F98A 4MPRA 3GCGA 3FLEA 2HDWA 1C7IA 1YC5A 2XWQA 3UQZA 1WW2A 2VDMB 3ZWPA 2PUWA 4PNEA 4HVTA 4Q9IA 1I18A 2JIQA 3OPYB 4KH0A 2YHBA 3RUHA 2PLFA 1VJTA 1X38A 2BTQA 5T4FA 5JS7A 3R76A 4U7DA 1QM5A 2HTFA 3M6LA 1U1FA 5KYNA 2XGSA 1RS0A 3EVTA 2JIZD 4IIJB 3E58A 4R98A 1BDHA 4QAJA 1GCUA 3PNKA 3IMCA 1CDDA 1NF9A 2WQZA 2XZLA 4KK3A 1E94E 2FR0A 5CFNA 3T3OA 5J58A 2Q6LA 1W1WA 3AT1A 4RK6A 3IOEA 1O5IA 1SCUA 4EITA 1VQ4B 3K09A 2NPFA 1NOJA 2JKZA 3C48A 5BSRA 2GHIA 3F1KA 1CJBA 1EPUA 1ZJZA 4H35A 3UH0A 5AVOA 4MUYA 4L72A 1P2FA 2WFAA 2Q0SA 1DXYA 1P2TA 1X7DA 3ND7A 3OZTA 3R9KA 1MLDA 2O0KA 4HEA6 3GNTA 3TVDA 5CFMA 2WM3A 4Y6RA 2A0FA 2X8LA 4L6IA 1DEAA 2PGNA 3HY4A 4BTEA 1JAIA 3AU9A 3AFHA 3LUAA 2H1HA 3PXXA 4XW2A 3USZA 2WWGA 2ZZQA 1PSZA 1Y4ZA 3ESXA 3L6EA 3A1PA 3NFRA 2PUDA 1JG4A 1FBTA 1KO5A 2QN7A 2WPNA 3A0UA 3H8WA 4PCVA 4MSUA 3GHHA 3I4FA 4GX5A 4JYPA 4QO8A 1O9BA 2IXEA 2G71A 2JB9A 1L5OA 1GUYA 1NL3A 1Z7GA 1HOXA 1PJ3A 1TJ3A 3MELA 2AFRA 4E0FA 1ZXLA 1T8UA 3PU6A 1RTKA 4EUKA 3QV1A 4F11A 2SCUA 2D5CA 2BY4A 1VLYA 3PRKE 4DE5A 1U7TA 4R84A 2OYNA 3DBOB 1EP1B 1H5UA 3OKXA 2RKBA 1CXZA 2OAQ1 4PLHA 4Y1FA 3KHSA 3S27A 3F7NA 3Q5GA 3I92A 4DCNA 2NU6B 1EFHA 4OHBA 2W98A 2ZRKA 3PI6A 5J9FA 3T3MB 3ES9A 3A0RB 2ZBPA 3B8EA 3MIZA 1J09A 1KVQA 1QQ6A 3HGQA 3UAXA 3HCBA 2EP5A 3V8NA 3I56B 1GQ2A 1ZN2A 2VAMA 3SM3A 3WHIA 3KUCA 3RYFB 2ZETA 3T8YA 5JI3E 4I50B 1W5BA 4R2WA 5MFZA 3UPTA 3RAEC 2PUCA 1UQUA 4RAOA 3VH4A 3KLBA 5HUQA 2XDWA 1E63A 1WTCA 3VYSB 3DDCA 4DLNA 4F5WA 1NE2A 4IGAA 4WXHA 3L4KA 2BKUA 1Z36A 3SC3A 1SA0B 2ZYHA 4B2IA 4BVJA 1KE2A 1NBEA 3X1ZA 3RG8A 4QT4A 3C6ZA 2X2PA 3U4HA 1EGMB 1YDHA 3WV5A 3V34A 3NAZA 1ZBQA 1PGQA 2VF8A 4EHFA 3N87A 2Y1FA 2HQOA 4OQLA 1K88A 2C61A 2QZ4A 4N65A 4BMZA 1IBSA 3P2OA 3I55B 1FS5A 4ND5A 1JR3E 4WEOA 3CQ9A 3DEKA 4WINA 4LJSA 3PDHA 4RH1A 3W8NA 1X7ZA 5LLTA 5LWHA 3EG5A 1NSYA 1RHKA 2ZAMA 3G2IA 3GFQA 3TUZC 1JAHA 3DR3A 5FLEX 4JX8A 2KM1A 2HR1A 2H59A 1U5CA 7MHTA 1I1NA 2IYOA 1N0UA 4UM7A 4EEXA 5JZVA 5LOVA 3SKYA 2YXDA 5A9RA 2FQXA 3Q5EA 1E79A 3QEMB 3RIGA 5JFGA 1IY1A 2FSUA 4HGNA 1QP7A 2GYWA 3T7KA 3F78A 1X0XA 4ZGNB 4U7HA 4B75A 3EPKA 1S2DA 3PHJA 3CTPA 3VX3A 1ZU5A 4REQA 5FV4A 1TJPB 3HEBA 3C7AA 4U0KA 2IP1A 2VYVD 2ATVA 3A1VA 3FI9A 3GBPA 3QLVA 5IEJA 1IWBB 4HUQA 4JJ8A 4FFBB 5IYZB 1J0CA 2J9XB 4REQB 4UTXA 2DCMA 1GGHA 1RQ7A 4XQCA 1T2EA 2RI0A 2A86A 1PJAA 3OQJA 4ENUA 3SEZA 2V7XA 1AE1A 1O4WA 1Z33A 2ORWA 3N8GA 1QHXA 5HKBA 1T6NA 2MSNA 3CZAA 4H7KA 2EX0A 3VVCA 2GEBA 1M2OB 2BGUA 4AJLA 4P4TA 2GMWA 4XDGA 4EL0A 1GG9A 1F2TA 3D3NA 4U1RA 1VCMA 3F6CA 5EC8A 4HNVA 4QYIB 1YB7A 1HOTA 3Q7TA 2WFLB 1GA1A 3AKYA 3G5AA 2GJKA 2L0XA 5IYNA 1LJUA 3II6X 4NATA 2MTBA 4TS1A 1XU4A 3FWNA 4COOA 3DBLA 2QMOA 1Z8DA 2OC4A 3E5HA 1NR1A 5AXAA 1HZZA 1K5HA 2CFSA 4FI3F 3LFUA 3X1XA 4D7AA 3CKLA 2CZGA 1M2HA 4RF4A 3P9KA 1EFVA 3ZXXA 5DSTA 3SIWA 3H5LA 3NEAA 5FUWA 4UOQA 1SIOA 2IEYA 4QUJA 3T3HA 4Z0PA 1YIAA 4DV5B 1FRFS 1JNYA 4PC2A 1T0PA 2NQ8A 1HE4A 1D1TA 2QUIA 2HJHA 4PX2A 4DV2B 4RY2A 5BOVA 1YRAA 2QRUA 4S35A 4DLWA 5LZ5A 1E3QA 3QF4A 1YRBA 3KZOA 2QF7A 5THKA 3W78A 1FQJA 3VGPA 5B2EA 2J6IA 2EBUA 3HCOA 2GJSA 3IULA 1TKCA 2NTJA 4GMDA 4HGRA 3VR5H 4IYRA 5KDOA 2QRLA 1ZESA 4NG5A 3G02A 3GIWA 4DADA 1PJTA 1REQA 1FRZA 3GEPA 5FNVA 3V2HA 1F8UA 4MGYR 3S4YA 1FFXB 1ZZEA 2XA2A 2A7XA 2C58A 4ZVQA 4Z54A 9LDTA 4BBPA 2AT1A 1KY4A 2WKSA 3IP9A 5DBIA 2IBTA 4CLXA 1JSRA 4C78A 4JYCA 3EF0A 2M98A 2R7LA 4OH1A 1U0JA 2B8EA 3FTEA 3QE0A 2J9YB 3VO2A 1TOAA 3A6ZA 3THYB 2DWCA 3DZFA 4GLLA 3KAKA 4TXJA 1LF5A 3E27A 1KQPA 4ZA2A 5JWHA 2FWIA 2IEAA 4HP8A 1IEXA 4ROSA 5E1MA 3K70D 1C7JA 3R5TA 3RTGA 2ACEA 4BNWA 4BQRA 3G9QA 5FOUA 5JDCA 4FKBA 4TLCA 1FSPA 1IN6A 5CLLA 2JBHA 4AP5A 3I9V1 1CUSA 3T4UA 1ODLA 4PAMA 2EW1A 1Q1EA 2IV3A 4BNXA 1OXKB 4TZ0A 3WIDA 1WBDA 4GLJA 4IWNA 2GVNA 1N6PA 2OQ2A 3PTLA 1J2YA 4MZXA 4XFDA 3IAEA 3KKKA 4CV3A 1FSFA 4TLBA 3NTQA 1U02A 2FG7C 1IEVA 2OZLA 4EJ6A 5BOSA 5BPFA 3CA8A 3DBLB 3E03A 3MERA 4PONA 4RXMA 3W5IA 3G05A 1KDOA 1O89A 1Z5WA 3DL0A 1T8SA 3WLPA 3PIDA 1PKXA 1I3MA 1XQ6A 2OG1A 4INJA 4IJ6A 5AKYA 1VA4A 3SF0A 4F2GA 3VU9A 1QUFA 1LJLA 3C1OA 5GOZA 1Z47A 5I7UA 3FPSA 2X76A 1LDBA 1HMPA 2IFTA 3T61A 2UDPA 1PJ2A 2FHSA 2VBCA 3Q10A 2GVDC 4YY3B 1W4RA 4YLEA 5EMJA 4BFYA 3Q8LA 3CX4A 4WZBB 5DV9A 2CB0A 4ZI3A 4OOVA 2EW2A 2I4NA 4J8PA 3CW2A 4WEQA 4MUKA 3WI7A 4DLYA 3PNQA 4C07A 3GP3A 3CLSD 3DE6X 3B7WA 2QVYX 4KRYA 5J47A 4IFBA 4KQCA 1R74A 4F91B 1X87A 3IHTA 4DR1B 3BFXA 1KEWA 1NN1A 4WW0A 3N2LA 1LNZA 2JG3A 1UXHA 2ONKA 4HNAA 3W2EA 1QONA 2G5CA 1AKTA 4N9QA 4QYXA 5B57C 5JAOA 3K1YA 4NFSA 2I4IA 5ALKA 1NF2A 2AFIA 5AHRA 2WF8A 4QUKA 3E5RA 3IAS1 2BRUA 5K51A 4ETNA 3JVVA 4RPHA 2G6BA 1X7XB 2GT1A 3HCFA 4QUHA 4L8WB 4X7PA 2REXB 3O92A 5B1IA 1SKAA 2WP0A 5M34A 1N2IA 1PQWA 3EZ7A 1R9GA 2H2WA 2WYIA 3KZXA 4R2IA 3EGXB 3HPRA 2DBVO 1H8HD 1VYTA 3ZGVA 5IT9A 2WSBA 2ZI5A 4KVZA 4L2IA 2WTAA 3PICA 1JEOA 1NPTO 2IGTA 3F3MA 3FLBA 2H17A 1UM8A 1XX6A 3NHJA 3GMSA 3HVJA 5CW1A 3CZMA 1ACJA 2OV1A 3W2TA 4A8TA 4RQAA 1WPGA 5JV5A 5LLSA 1XTSA 4DY6A 2QAGC 1JA1A 2YS6A 5BPHA 3LOUA 4BGIA 1ZS9A 1Z29A 3H1TA 5TT0A 1ZISA 2A5DA 1P5HA 2ONCA 4CM7A 3COVA 2JGAA 1Q5PA 2Y76A 4GYYA 1E1QA 1RCFA 3GAZA 4P7FA 3AF3A 1XA4A 5CFOA 1XD9A 5AICA 1YCFA 3WR5A 5IN5A 4FFDA 2RB5A 4MP6A 1JHMA 3AI2A 4MLDA 2CXXA 4HRAA 3HXLA 5F4ZA 3FUTA 1D9XA 5KHAA 4EPXA 4M1SA 5FQNA 2WSMA 4LC0A 4TL6A 4U7PB 4NNOA 2QD5A 1JXMA 4HAVA 3TZKA 4DA8A 5ELMA 5FOWA 4K26A 3LC0A 3M6IA 1VKRA 4GQAA 4WK0B 3N8DA 4DUPA 1P61B 1KSGA 3ASRA 2WIGA 3DV0B 1RLTA 1XWIA 3PD0A 4KNWA 1Q17A 1TT7A 1YFZA 4ENRA 4ZVLA 2WTUA 1UBKS 1S8NA 3AERB 1TIBA 3MCTA 5AI9A 3W9YA 2AC7A 3A4MA 1FFYA 4XVHA 3RSLA 3CB2A 5CM9C 1O8BA 1FSSA 2G9QA 4NARA 5DYNA 1ZIOA 3TIXB 4DA0A 3AJEA 1BYIA 3ZY4A 2JCVA 4GXQA 3TOZA 4E7OA 4EGJA 2WSLA 4L3WA 3F90A 5AJZA 3MTQA 3QBTA 3ROGA 1Z73A 1CRLA 4EO4A 3DR5A 5JJLA 3ZHVA 3OM0A 2DPHA 3WB2A 3O8OA 1KZYC 1VIVA 4R2KA 4A36A 1IVNA 3NWPA 3CUEF 4MMYB 2W93A 3CX7A 1G4AE 4UU0A 1VG8A 3ZI4A 1IU9A 4CCYB 4DLTA 4K7JA 5JS8A 3GJ5A 4KDCA 1ZM3A 1ZSYA 1L8QA 3L93A 2BZSA 5AW9A 3VX4A 2AI2A 4QM6A 3B1WA 1U9ZA 3NFYA 4P5PA 4NCNA 1Z4IA 3H1EA 4F0JA 4ZT5A 1N33B 3M6UA 4JLKA 3ZZMA 1OZAA 1SOVA 2HTEA 1I6MA 1Q7BA 2FAXA 2PRKA 5L53A 2E37A 5IDYA 4ROXA 1YB5A 2F62A 3UKOA 3JRXA 1KKLA 5FI5A 2HA4A 2P7IA 1RWQA 5JNUA 5HCNA 1N7GA 3BCFA 1D1PA 2YWRA 3AJDA 3WYBA 5LVAA 1ARZA 3WIOA 5EMKA 3A3PA 3MWDA 5GV7A 4RMIA 3ZHBA 5AKHA 4L0CA 2I80A 1SHJA 2C4NA 2XLBA 1KR5A 1P4SA 1XAGA 5F7JA 2ORYA 4DDHA 4ND4A 4ZCQA 5KTNA 3DVLA 1SUDA 4HEQA 6REQA 2DPYA 3L1HA 5CBPA 1BCSA 4KVFA 3DDSA 3TLKA 5CNJA 2C5HA 2HYIC 3HJFA 3LDUA 3GRCA 2CJYA 5CDHA 5KYGA 2GNOA 1OYYA 3AILA 1J49A 2PWBA 3ZDQA 2DUWA 1BLIA 1EFCA 1G16A 2C84A 4JJAA 2AOVA 1GAJA 1CJTC 1N92A 3TUJC 3WMRA 3WZMA 4RVCA 1U4NA 2AUMA 3DSRA 3GJQA 3A1EA 4Q24A 3MS4A 3LLMA 1AQNA 1JR4A 1MO3A 1XXHA 2RGYA 5LNK1 2IX3A 2ICAA 3CESA 2X9LA 3UAOA 4EJ2A 4ISCA 1KMHB 1JHUA 3DE2X 4DLZA 2OYCA 3WGMA 3AY7A 2VF2A 4MVJG 1QFYA 4RQBA 4DWJA 1M1ZA 4TT8A 4DLSA 2B21A 1VJCA 3T4XA 1FQKA 4O08A 3QKIA 3O9MA 4KPGA 3A9RA 2YBEA 4AYTA 3EXIB 3GY0A 5HKOA 3IEVA 3GFSA 4R1NA 4A0SA 3Q2OA 3ZE2B 4QDKA 5TQVA 3GDGA 2PZGA 4WY5A 4PBTA 4ALNA 1SULA 4BLQA 1QPGA 2YNMA 1JSLA 4P31A 5D5PA 3SZ3A 1J8YF 3DE0X 1KTVA 1D4FA 2KHZA 1UINA 3BGWA 3U1VA 1SKQA 2HK8A 3ZV5A 1SHUX 1RRPA 4C21A 3KB1A 5HRAA 1RJ9A 1Z3CA 1I2CA 2QGFA 2XNHA 3OTQA 5DBOA 3OT1A 2HA5A 2BM1A 1BYUA 3P2JA 3N2GB 1TPZA 4TT3D 4X7BA 4LOIA 4MRMB 4C7OB 2X0DA 2ECPA 3GH1A 4B85A 3U40A 4IIXA 3W5JA 4KZPA 4WWHA 2HSDA 4BRUA 3OPQA 3KKZA 4QDUA 1B6SA 2AN9A 1Z75A 3KLPX 3QTTA 5EJFA 3WRVA 3VZPA 1L1RA 3HTXA 2WHQA 3NGMA 4WNIA 4NLLA 3WB0A 3A25A 3CF2A 1YNSA 5CB4B 3QE9Y 3JQGB 2RGXA 3O31A 5KX5B 1DS6A 2XUJA 1DAHA 3FOCA 4QLOA 2NTVA 4XJXA 4Q6WA 2FEAA 4NR0A 3NNNA 4BQPA 4C2AA 2O07A 4CIYA 3DJFA 4HS4A 1RQLA 3ETGA 2JLYA 3QKSB 3NIFB 4RZHA 5JG7A 4EW3A 3C2QA 1J25A 1X6VA 2AX4A 4CG3A 3EZ6A 4B3TB 1VIAA 5JANA 1MO2A 3T51B 3OJLA 5CFQA 4LYEA 2B9EA 2HF2A 4EELA 3AINA 4L74A 4BMCA 1FZTA 4H7IA 1THZA 1RM4A 3Q7SA 5CB8A 2JCSA 3B36A 4H6XA 1PCXA 2Z8XA 1Q57A 3EISA 3LC7O 5DJ5A 5TPZD 3VPGA 3LRXA 5EKDA 2LV8A 2AD5A 1E92A 1QTRA 2WG1A 3GRAA 3Q7PA 1IC6A 3L7BA 4G56A 2XRMA 3W4JA 2D3LA 1ISJA 4FS8A 2V98A 4JUDX 3AHGA 5C8VA 1YRWA 4Z8YA 4EO9A 2Q3BA 5HZAA 3TFQA 5EJGA 1SC4A 2Q3LA 4FHDA 1Z0KA 5DSZA 1K4YA 2FWBA 1MQ8B 2FJPA 1KY3A 1H23A 1R0LA 1XG5A 3FNEA 3HA3A 1ZINA 2GCPA 3QVJA 4JT8A 3QUAA 1Q19A 1SC1A 4TL7A 4MVJH 4UVIA 5GWXA 1WD7A 3AIKA 5E9WA 5EYPB 4CKYA 2A4KA 3OT1B 5E6RA 1JPJA 4MP3A 1W25A 3ELWA 4MS4B 3ROQA 2QHXA 3K1AB 3OKPA 4YRLA 3DAPA 1LV8A 1TVKB 1JJFA 2MJLA 4PSVA 2GEUA 4OREX 2BD0A 5INTA 5LB4A 1Q82D 4FOPA 1NYLA 3OLYA 2IYVA 2AEEA 2OCLA 1TJ4A 5ABPA 3T4PA 4AG6A 1YD7A 2CLDX 3HGMA 4MV3A 2X6YA 3R20A 2B1IA 2X9NA 3AY3A 4C7BA 4GYWA 5J59A 2I99A 1WB5A 4GM4A 4FZJA 2FW0A 1C8BA 1HZZC 2XOKD 1NZDA 1HH4A 2XTMA 3K31A 3OWOA 2WLSA 1G63A 4NVRA 1ZOOA 4QWWA 2GSDA 4BNYA 4LSZA 1BA3A 3TLJA 4CRWB 4YRNA 1HR0B 1U0BB 1FYWA 4GDFA 4L9WA 2F3PA 3RAPR 2BWJA 4B3SB 1KMHA 3IMFA 3WJ7A 4D41A 3MJHA 4DNRB 2ZW9A 3K6KA 4TLAA 1XXHB 2CLKB 1QGOA 2OAGA 1A9TA 4PTLA 3E8XA 5BURA 3FPKA 4KX3A 3N2KA 3BHJA 2QTHA 3UC9A 1MA0A 3TGWA 1IHXA 3OLVA 3BX1A 2WR8A 1EWTA 1BS2A 2H52A 2W0MA 3A70A 3KCQA 3KRTA 1ZXXA 3Q72A 4UMFA 1F8XA 1GCOA 3C8MA 4ZI7B 3HUFA 1CUYA 4MNTA 1MZPA 5FPPA 2QUZA 5KINB 1YZYA 4IUDS 3OZXA 2PGLA 1P7ZA 4HQRA 3FB4A 3ILXA 4ZKDA 5JAIA 2VUUA 3ZHSA 5BMVB 4BNHA 3OE1A 2ECFA 4MAAA 6REQB 1P0QA 4I66A 2CF6A 4HDSB 2WSYB 4LZLA 1PT7A 1ZI6A 2DF8A 3AP1A 3GUYA 4YYEA 4YV2A 2E4UA 2C57A 3JSXA 1HTBA 3AR7A 4QGBA 1V71A 2HRZA 1E8MA 1R5JA 4HDQB 1NDUA 4S1VA 3FTPA 5GONF 1S3GA 4AMZA 4CUZA 1EIZA 4K8RB 3V00A 4YPOA 1T5EA 1VIYA 2CMKA 3Q9LA 4I55F 3EPRA 4D0LB 3RK0A 4DWVA 2Z3WA 3VKFA 1V0FA 4MW4A 3WWEA 4UZUA 4XWKA 5FTJA 4WNCA 2IBSA 3CSDA 4OJTA 1J24A 2WD7B 1OX4A 5A9SB 4H1HA 4NIMA 5H68A 4OQZA 2J67A 1QYRA 5A89A 4QJBA 5HF9A 2PLNA 3FCEA 1WCIB 2BFCB 1YR7A 3MUOA 2TS1A 3ERCA 3PJFA 4GM0A 2CBGA 4FFVA 1YCGA 4OK3A 4I8DA 1NBMA 1FDOA 1GL3A 3I8OA 1YBFA 5B3JA 4X60A 4MJLA 1XVVA 2I7XA 4E30A 4XVRA 5JQGF 1JTEA 1JW9B 1HV8A 1S2LA 5C51B 4EKNB 1M0EA 3PDIB 3LPDA 2MSWA 4M1KA 2IU0A 2NN3C 1YQXA 1E77A 3H9CA 2VK4A 2AJCA 1IHYA 1PK7A 2QNBA 3ISXA 3HL4A 2FPUA 3O95A 5KHOC 4IDDA 4AZ0A 3EOBI 2GEJA 2R65A 3L6DA 4Z53A 1RWVA 5AVYA 3GDWA 5CJPA 1NTOA 5JZ9A 4KEAA 3TG2A 1QE0A 4RA9A 2LCIA 1SCIA 4D82A 3SNHA 2PO5A 5ADHA 1TD9A 3B3GA 4MWSA 1OWLA 2NSHA 3DBRA 5IBPA 2R8PA 2N42A 2OAEA 1YI1A 3JATB 4HJXA 4D0NA 1RYDA 4L9SA 1P6UA 5BSEA 1R5OA 4UEQA 2R60A 1OTYA 5JHHB 2ZYGA 4C0WA 3B9BA 2M32A 4PR3A 4GI3A 3FPFA 5FWYB 2GF9A 1GQQA 5LYYA 3N0RA 1CRPA 1AV7A 4LYJA 2R2GA 2VJAA 3GT4A 1AO0A 5HBRA 2H4XA 2Q2OA 2P3LA 3GFPA 3ZCRA 2E18A 1UBGA 3DFUA 4XYBA 1MXHA 1QCCA 2KQUA 5H8WA 2NZ8A 2Z5VA 3IR6A 2IUUA 3FJYA 4P84A 4AJEA 3TQRA 4YJ3F 5AVSA 2IOHA 2PMCA 3A6LA 2BBTA 3WIVA 2OGUA 3K8OE 2C9ZA 5HTOA 3LECA 1TVKA 1U4OA 4FFRA 2FN9A 4FHZA 4GMGA 2ZYAA 3QFCA 3K4QA 4OB7A 3SM9A 1K7SN 1LGYA 2XXJA 5I7OA 1WW3A 5IDXA 1WQ4A 3RJTA 3KJQA 3O84A 3NASA 3BCRA 5JEDA 4OB8A 5JDIC 1T4CB 1X1TA 3MWLA 1J06A 1KYTA 2J4FA 3Q41A 2W71A 3FOFC 5TQ2B 3I6MA 4K9RA 2V65A 1NBWB 4BLPA 5AQ1A 2PKRA 2LP4Y 3F9RA 1RWPA 4N3AA 4ZU3A 4HBZA 1Y5IA 3HCAA 1F60A 4JFAA 2DG2A 5IABA 1XWWA 3C3WA 4DVGA 1PEKE 1G8KA 4URVR 4QARA 2F1HA 4HWGA 2ZWVA 2OM6A 3JWGA 2EKPA 2NT3A 4UQOA 2IPMA 1KEPA 1RYEA 4M0LA 2XE4A 3FMOB 4CFSA 3HBMA 4Z2YA 1P9RA 5CDTA 3FJOA 1RCUA 3SE7A 4CUJA 4OKSA 1VRWA 3VDNB 2WB4A 4HWSA 3HKEA 3NTLA 2YQ5A 2IVZA 3IPXA 4TV8A 5LQAA 3RRYA 1Y0YA 2W6CX 1F38A 2EHDA 3ZJYA 5BVGA 1NP7A 3C3BA 5LA6B 1JDBB 1JBKA 1XK6A 3EXFB 1ZH6A 1LI4A 3UK0A 4ETIA 2H7VA 3L0BA 2V45A 1XMOB 4XOPA 5HCIA 2A9PA 3DTYA 2DPXA 1D2HA 3LT1A 1G20A 4QVKA 4RE5A 1KK3A 3W9BA 4DILA 1Q44A 3V42A 4PAAA 1S2GA 1WMFA 2CSUA 1SZJG 3PQ2A 4NICA 5BNWA 4LX8A 2H31A 3RHSA 1BXRB 2FSVA 3BK2A 4YN3A 4XLLA 3DWEX 4AVZA 4FGSA 3VNSA 1N5LA 1UC9A 3CCFA 3SQWA 5DEOA 4Q47A 4AZVA 4Y2RA 4OFZA 5JBIA 3HM2A 2NUAB 4A0HA 4QUDA 3ZD7A 1GLNA 3RRFA 4DMFA 1U8TA 2BI4A 3B12A 1WVIA 1SKMA 4RLZA 1O4VA 5DMHA 1C3VA 4RX1A 5TRDA 1N6OA 4RSMA 4KB5A 5IN4A 1MEEA 5IWCA 3IT1A 2ZZMA 2R6JA 1JB9A 1KERA 2P0YA 2QM0A 1SCNE 2X0RA 4DG5A 1K6EA 1YUMA 2X4IA 1KHHA 2X0NA 1FUKA 3MMNA 3ORYA 5GMOA 5TF0A 2ZJ1A 5HRCA 1FU8A 3IBGA 1HE2A 4K1XA 4F4JA 4WJLA 2EG5A 2VT7A 3A6FA 4CV1A 4GR9A 2PMDA 1MO4A 3NQ41 1D5WA 1D6NA 1TQDA 2JGFA 4XTCS 3GVJA 4Y2VA 2Z98A 1JECA 1G55A 2IE0A 5MHTA 1FFBA 1QU2A 3H13A 2DU8A 1XROA 4HXEB 2FFBA 2ZSIA 3Q6RA 2AS0A 1Z68A 4DQKA 2A5GA 4FLMA 2DKOA 3TRKA 2FPWA 1UZMA 3UJAA 2VHUA 1GYPA 3I2HA 2AHOA 1C3OB 1D0SA 2OB2A 4ZCIA 1Y3AA 1I2DA 3D5EA 1E5DA 3E9MA 3LMKA 4YHBA 5FOTA 4CUKA 1PTJC 1ENZA 1OFUX 1UK8A 3PSHA 4C5CA 1ULBA 4C01A 2QE6A 1E1CA 5EE3A 1ILWA 3Q0IA 4AJOA 3ZKAA 3TKLA 5HUJA 3O3MB 5EPUA 1Q86D 1HYQA 1UBNA 5KC8A 3CO5A 2WIAA 1B2LA 1N9KA 1R64A 3HN2A 1UFRA 2I3DA 3EDOA 3L18A 4URFA 4GUAA 3OWXA 2C82A 5AIAA 5LPNA 3VBEA 5HDBB 1GUAA 3TW0A 3GEHA 3IIKA 3PE6A 4X6XA 1A8HA 3UNXA 3WDLA 2VHVA 1L4KA 2FTKE 2HSZA 1TEVA 4QU9A 4RACA 3L0DA 3SF8A 1JKFA 3KOYA 4JBYA 2OENG 1M6NA 2YVLA 3BA6A 4NBTA 4RJTA 4JBGA 3VBCA 3CRNA 1T5OA 2WUDA 3DULA 3IP7A 1A9SA 3F2VA 1VJ0A 1V5IA 1CCWA 1OLUA 2CNLA 2G1KA 3CRRA 1MZVA 3ME5A 4JJFA 4Z51A 1WOSA 4U7GA 3LY8A 2GAAA 4AKGA 3MCVA 5ED4A 1FNCA 1BQ4A 1MAVA 5ULLA 1EGQA 3OPVA 4HF7A 3HDGA 2VPYA 4I4LA 5SYAA 1N6KA 3RJ9A 4IUCS 5C7YA 5TDHA 3BH6A 2D1RA 3NRBA 1M2VA 2ZR8A 3IE0A 1MT0A 4F93B 1CUIA 4NJEA 3KEMA 4G2NA 2RONA 1UC5B 1VC2A 2NM0A 1U80A 5KJ1A 3SPXA 3NM6B 3D59A 4JODA 3GLFA 3A7EA 4WZZA 2PAFA 2ZWMA 1UEJA 3KQLA 1ZGGA 1XNGA 2QTNA 2FSIA 3TDMA 1IVYA 4UCQA 3BGDA 5AVRA 3OX4A 3TL3A 2F8LA 5PNTA 1E2DA 1WA5A 3B6JA 3Q7IA 5F1YA 2CLCX 3QXGA 4ZVRA 4BQQA 5CXUA 4W9NA 3R7NA 3SVLA 5EUMA 1XSEA 1AF7A 1IPFA 4LG1A 1LCIA 5JNVA 2AKYA 2C2XA 4KQXA 5KB3A 4JMLA 1T43A 2QN9A 3PNYA 4US2R 1EAMA 3QEMA 5IVPA 3PLAE 4HDCA 1MB2A 3DZHA 1SH7A 1RZ3A 4MI6A 3P0FA 5G40A 5G4KB 4EG6A 1ISFA 4LBZA 4ZXPA 1V8FA 2IH4A 1NVWQ 1Z25A 4RKFA 2HC9A 3WMFA 1HE8B 1XRJA 3EPLA 4CMCA 4DKJA 1T2FA 4ESEA 3G0IA 1JBEA 3VC3A 3SQNA 3KVNA 2CEAA 4KACA 1N1MA 3LO5A 2E1PA 2WWIA 4M8SA 4PX5A 4UBOA 1KO8A 2XB2A 3TE7A 4ASUA 1EB8A 3CURA 3DMTA 3LPLA 3UGQA 5KTSA 2YN4A 3QLUC 2IJGX 5FWXA 3WADA 4RH3A 1QHHA 1P4MA 4MDFA 2IZOA 3TBKA 1XTKA 5F51A 5K0FA 5H02A 3UXMA 5IHXA 2R5FA 1V4NA 1BRTA 3I2KA 3P9RA 3THSA 1T5SA 3KKEA 3TW8A 3WYEA 5ADWA 4RGYA 3BVPA 3SVTA 1J9ZA 3W04A 4F5DA 5G53C 4J4TA 1XVUA 5AJHA 1L4NA 3JQAB 4ALLA 1R50A 2C9OA