5KTAA

Apo fdhc- a nucleotide-linked sugar gnat
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
178
structure length
176
Chain Sequence
b'VNFNLKANTTYLRLVEENDAEFITLRNNDKLNTYISKSTGDIKSQAEWIRNYKNRENNGEEYYFIIFRSDDQSPIGTVRLYDFHENPKSFWGSWILNEHKTKYAAVESALLVYEAGFSTLGFEQSHFEVMKGNDKVHSFHLKMGAQKISEDDENIYYIFPKSKYKENKIQYARFLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FdhC
publication title Structural and Functional Investigation of FdhC from Acinetobacter nosocomialis: A Sugar N-Acyltransferase Belonging to the GNAT Superfamily.
pubmed doi rcsb
source organism Acinetobacter nosocomialis
molecule tags Transferase
total genus 55
structure length 176
sequence length 178
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ktaA00
2VBQA 4UBRA 1YR0A 4XNHC 4AVBA 1MK4A 2D4PA 3TE4A 4JD6A 3RYOA 2CNMA 2DXQA 1K4JA 2ARHA 2OZGA 2PDOA 5C82A 2ATRA 2B4BA 3D3SA 4E8OA 3D2MA 2IL4A 3PGPA 4JJXA 4PV6A 1IYKA 1S7LA 1Y9KA 2HQYA 4KZTA 1RXTA 5F48A 1NMTA 3I3GA 4M85A 3DR6A 1KZFA 1B6BA 3OWCA 4CAVA 5E96A 1YLEA 2NMTA 1XEBA 4MHDA 4RI1A 2JEVA 5JPHA 2X7BA 4R87A 2RC4A 3P2HA 3C26A 4PK2A 3FRMA 2G3AA 2B5GA 3H4QA 1IICA 4KOWA 5F47A 1U6MA 2BSWA 2JDDA 2P0WA 4GS4A 5CNPA 3FB3A 3FNCA 3SXOA 3LD2A 1S60A 4MY0A 3DDDA 2AJ6A 1YVKA 4MY3A 3EC4A 4H6ZA 2QECA 3JUWA 2VZYA 4E2AA 5IX3A 1BOBA 1QSTA 3R95A 1QSOA 4NCZA 1XIXA 2PR1A 2PRBA 1NE9A 1PUAA 4F0YA 3EXNA 4XNHB 3PP9A 4QC6A 3WR7A 4PSWA 4J3GA 3TOAA 5I0CA 2OB0A 1WWZA 2I00A 4II9A 2VZZA 2PSWA 4YFJA 3IWGA 5ISVA 3F5BA 3B8GA 2OZHA 4XPLA 3QAHA 1P0HA 4JXRA 4H6UA 1V0CA 4XPDC 1YREA 1Z4EA 3TCVA 1I12A 2Q04A 2R8VA 2VEZA 2F5IA 4KLWA 1NSLA 4MI4A 1YK3A 2G3TA 4AB7A 3NE7A 4NSQA 3TO7A 1VKCA 3TFYA 4BMHA 1MJAA 2OH1A 2FXFA 2VXKA 4YGOA 1M4DA 3KKWA 1M4GA 3F8KA 2CNSA 1QSMA 5DWMA 4HNWB 3E0KA 4LX9A 2FT0A 3PZJA 4KOSA 2BEIA 4FD6A 3VWDA 2J8NA 2REFA 4DNCA 2Y0MA 5HMNA 1GHEA 1PU9A 2ZW5A 4AVAA 1BO4A 3VWEA 5JQ4A 2P6GA 3TTHA 3FBUA 1XF8A 2REEA 1S3ZA 4FD7A 1IB1E 4U5YA 1Q2YA 4KOTA 2BUEA 4Y49C 4KUBA 2J8MA 4F6AA 3TO6A 3LODA 1XE4A 1M4IA 1B87A 2P6EA 3S6HA 4ORFA 2FSRA 2PR8A 4B5PB 1FY7A 4CRZB 1I21A 1M44A 2Z0ZA 4EVYA 2FIAA 3G3SA 2R98A 5GCNA 3DR8A 4NXYA 1XMTA 1LRZA 2FL4A 2G0BA 1Z4RA 3GKRA 1S7KA 2PC1A 3CXPA 1N71A 4XPDB 4HNXB 1S5KA 2Q4YA 5KTAA 1IYLA 5EBVA 4KLVA 2GANA 4R57A 3FXTA 3I9SA 4UWIA 1M1DA 1Z9UA 4ZBGA 4IF5A 4U9YA 1YGHA 5IV0A 4X5KA 2D4OA 2GE3A 4JXQA 5KTCA 4U9ZA 4XPKA 3F0AA 3SXNA 1Q2DA 4QB9A 4CAXA 4FD4A 4CRYB 1Y9WA 3G8WA 4H89A 2ZXVA 4LUAA 2WPWA 2B5GB 2CY2A 4AG9A 1KUXA 1S7NA 4KVOE 4AG7A 5EC4A 2Q7BA 1RO5A 4ONUA 2J8RA 4I49A 4K30A 3IGRA 4KOYA 3EY5A 3SHPA 2Q4VA 1YX0A 4L89A 4Y49B 2AE6A 3TT2A 4FD5A 2ZW7A 4MJ8A 4YRHA 2HUZA 5H86A 5J8CA 4NEXA 2GIVA 5HH1A 1TIQA 4KORA 3FIXA 1J4JA 4B5PA 1MJBA 2B4DB 4JWPA 4HNYB 4QVTA 2VI7A 2FE7A 3BLNA 2QIRA 4CAWA 2OU2A 1KUVA 3R9GA 3TOBA 2JDCA 4KOXA 1KUYA 2JLMA 5F49A 3V8IA 2H5MA 2OZUA 3R9FA 4KVME 2Z11A 3EFAA 4OLLA 3T9YA 2R1IA 2VQYA 2Q44A 4PK3A 4R3KA 3K9UA 5FVJA 4KVXA 4AVCA 3S6KA 3D2PA 2B58A 1OZPA 3GYAA 4R3LA 4QBJA 2ZW4A 4UWJA 4KOUA 4L8AA 2ZW6A 1IIDA 2B3UA 2FCKA 3BJ7A 4PSXA 3CXSA 5J8FA 2R7HA 1L0CA 1I1DA 2BL1A 4OAEA 3W6SA 4HKFA 3P2FA 4IUSA 3R1KA 3GY9A 2KCWA 3QB8A 4OADA 3S6GA 2WPXA 2EUIA 2C27A 2A4NA 2I79A 5IB0A 5H84A 3D8PA 3S6FA 1VHSA 2HV2A 2Q0YA 3W6XA 1CM0A 4QUSA 1Y7RA 4CS0B 1QSNA 3TO9A 2ZPAA 1SQHA 1R57A 4UA3A 4MBUA 3CXQA 4R9MA 2EVNA 4RS2A 2K5TA 4KOVA 4M3SA 4NF1A 3ZZIA 5KTDA 5F46A 3MGDA 2P6FA 3EO4A 2B4DA 1WK4A 1S7FA 4E0AA 3N7ZA 3UY5A 1ON0A 3R9EA 1UFHA 3ZJ0A 2FS5A 2Z10A 3FYNA 4JLYA 3W91A 1YVOA 1P4NA 2B3VA 3R96A 2FIWA 1QSRA 2QMLA 3JVNA 2O28A 3T90A 2CNTA 4B5OA 3DNSA 1MJ9A 3DSBA 1CJWA 3BJ8A 4KUAA 5DWNA 5C88A 1Q2CA 2PQ8A
chains in the Genus database with same CATH superfamily
2VBQA 4UBRA 1YR0A 4LQGA 4XNHC 5LYIA 4AVBA 3IU1A 1MK4A 3K9TA 2G9DA 2D4PA 3TE4A 1VIXA 2RB7A 3QNVA 4JD6A 3RYOA 1ZG7A 2CNMA 1ZO0A 2DXQA 4C2ZA 1K4JA 2IMOA 2ARHA 1XJOA 2V8DA 2OZGA 1Z8WA 5EMIA 2PDOA 1DE4C 5F09A 5C82A 3PB4X 2ZEGA 5D8NA 4PXDA 4HPSA 2ATRA 2B4BA 3D3SA 2YNDA 4PPZA 1F2PA 3B3CA 2Z3PA 4E8OA 3D2MA 4UEEA 2IL4A 3PGPA 4JJXA 2IQ6A 3S9MA 4Z65A 4PV6A 1IYKA 3FVLA 1QQ9A 3BI1A 4A94A 1S7LA 3NH5A 1IOFA 3B35A 3KZWA 1Y9KA 2HQYA 4KZTA 1RXTA 4UEZA 5F48A 2O4HA 1NMTA 1XFOA 4UFWA 1JQGA 3I3GA 1NSAA 2Q51A 4M85A 4ONWA 3DR6A 1KZFA 1B6BA 2WSAA 2ZOFA 3OWCA 4CAVA 5E96A 1YLEA 2NMTA 1CPSA 1XEBA 4MHDA 2JEVA 4RI1A 4CGLA 5JPHA 2X7BA 4OC0A 3SI2A 4R87A 2RC4A 2AFOA 2CF4A 3P2HA 3BHXA 1KWMA 3C26A 4PK2A 2DPTA 3FRMA 4FBEA 3PRTA 2G3AA 4CGPA 2B5GA 3H4QA 1IICA 4KOWA 4KSAA 1ZG9A 3HLPA 3WABA 3IWEA 2DF5A 1IY7A 3KR4A 3IJ3A 5F47A 1U6MA 1CP7A 5CPAA 2BSWA 2JDDA 1TKHA 2P0WA 3FEEA 3TX8A 2RFHA 4MFKA 4MCRA 4GS4A 5CNPA 3FMCA 4P4EA 4MCPA 3FB3A 3FNCA 3SXOA 5JM6A 1ELLP 3LD2A 2XEIA 4WWVA 4RUHA 1S60A 4GM5A 4MY0A 1FNOA 2PJ9A 3DDDA 4OP4A 3VATA 3IC1A 2AJ6A 1CPXA 1YVKA 4PXCA 4UEFA 4MY3A 1TXRA 4P4DA 3EC4A 3FECA 4H6ZA 2QECA 1TF8A 2Q4ZA 2VZYA 3JUWA 4E2AA 2PJ3A 3LMSA 5IX3A 4KSIA 1BOBA 1QSTA 2V8GA 4W9YA 3KGQA 4NJRA 1Z8XA 3R95A 4JYWA 4OC2A 1QSOA 4NCZA 1YW6A 1CG2A 1XIXA 2PR1A 1DTDA 2PRBA 1NE9A 1LFWA 1PUAA 2HB6A 2YNCC 4B6ZA 3EXNA 4F0YA 4CYQA 2Z3NA 4XNHB 5AGEA 3PP9A 4DYOA 4QC6A 1M4LA 4O23A 4M6HA 3TC8A 3WR7A 4PSWA 4J3GA 2QVPA 3RZAA 3TOAA 2ZEMA 3SJGA 1UWYA 2OB0A 3WC6A 2V8HA 4NGRA 1WWZA 5I0CA 4A32A 1JWQA 3GLJA 3PFEA 4KS9A 3H8EA 4OC5A 2WYRA 3LACA 4H2KA 2I00A 2VL1A 4II9A 2VZZA 2PSWA 4YFJA 3IWGA 3KQZA 4AXVA 3IIBA 4FWUA 2GLJA 4NGTA 5ISVA 3F5BA 3B8GA 4P6YA 2HC9A 2OZHA 4UFXA 1ZLHA 4OIDA 1LOKA 4XPLA 4BINA 3QAHA 7CPAA 3GUXA 1P0HA 1ZG8A 3B3SA 1V0CA 4H6UA 4JXRA 4XPDC 4A31A 3NE8A 1YREA 1Z4EA 3TCVA 4B14A 1I12A 4NJQA 4ZY1A 2Q04A 5AG4A 2R8VA 4UIAA 4A39A 2VEZA 1XMBA 4R7MA 2F5IA 4KLWA 4JZ0A 1NSLA 4UFVA 2PJ0A 4MRIA 4MI4A 2EWBA 1YK3A 3DGVA 4UCPA 2Z3KA 2PJAA 1AYEA 3KHXA 2EK9A 2G3TA 2PIYA 4AB7A 3NE7A 4C68A 4A37A 2AFUA 2I3CA 3IU2A 4NSQA 3TO7A 5BWAB 1VKCA 3TFYA 4BMHA 2ANPA 1MJAA 2OH1A 2FXFA 2VXKA 1ZLIA 4YGOA 1M4DA 2NSMA 1HDUA 3KKWA 4ZY0A 4TWEA 1M4GA 3F8KA 4K3NA 3RO0A 4MCSA 4MXUA 4BD9A 2CNSA 1QSMA 2CIJA 5DWMA 3VARA 4HNWB 3E0KA 2BO9A 2FT0A 4LX9A 3NFZA 3PZJA 4KOSA 2BEIA 4FD6A 4MFJA 4ZX8A 3PBBA 4UIBA 3VWDA 1Z5RA 2J8NA 2REFA 4DNCA 2Y0MA 3T8WA 5HMNA 1GHEA 1PU9A 2ZW5A 4AVAA 1BO4A 4CAFA 4PQAA 3CPAA 3VWEA 5JQ4A 2P6GA 3TTHA 3FBUA 4MFZA 1XF8A 3BI0A 5G21A 5HXDA 2ODFA 2REEA 2PJCA 1S3ZA 4MHZA 4F9VA 2AFZA 3FX6A 5LYFA 4FD7A 1IB1E 4B13A 4U5YA 5DS0A 1Q2YA 4KOTA 2BUEA 2EK8A 2YGWA 4Y49C 1QMUA 4KUBA 4UCNA 2J8MA 4IK2A 1X12A 3TO6A 4F6AA 3LODA 1XE4A 3B3WA 3NH8A 3BXMA 1HDQA 1IOIA 1B87A 1M4IA 3D4UA 5JH9A 4P4IA 2P6EA 4NGMA 4NFRA 3S6HA 2ABZA 3PBEA 4ORFA 4MHNA 5LRJA 3RNZA 4CYNA 4MFQA 2FSRA 4EMEA 2PR8A 3D7HA 4M6GA 1FY7A 4B5PB 4CRZB 1I21A 1M44A 2Z0ZA 4FUUA 4M6IA 4R76A 2ZEPA 4EFDA 2FIAA 4CPAA 4EVYA 3G3SA 5LYLA 2R98A 5GCNA 3DR8A 4NXYA 5J1QA 2JEWA 1XMTA 1Y0YA 2QYVA 2ZOGA 3KR5A 4PXEA 1LRZA 1Z2LA 2FL4A 1TKFA 4IAVA 4X2TA 4YU9A 2G0BA 1Z4RA 3GKRA 1S7KA 2PC1A 2PVVA 3CXPA 1N71A 4NGNA 3ISXA 5HVHA 1YLOA 3K2KA 1TF9A 4P4BA 1FT7A 4XPDB 5I4MA 4HNXB 1S5KA 2Q4YA 4OC3A 3A9LA 5KTAA 4ZYQA 1IYLA 1LCPA 4P44A 2XEFA 4ZGYB 5EBVA 5HVGA 3FH4A 4KLVA 2GANA 4A38A 3CPXA 2Z3LA 4R57A 3FXTA 4GXHA 5LRGA 3H8FA 3I9SA 3S9NA 4UWIA 1M1DA 1Z9UA 3B3TA 2BOAA 3D68A 2CXAA 3B2YA 4EWTA 4ZBGA 4IF5A 1YSJA 4U9YA 1YGHA 5IV0A 4X5KA 4YWYA 2D4OA 4OIWA 2GE3A 5IB9A 4JXQA 3FEDA 1BLLE 5KTCA 4U9ZA 4XPKA 3F0AA 3SXNA 1Q2DA 2GREA 4RN7A 4QB9A 4CAXA 4FD4A 4CRYB 1ARMA 1Y9WA 3G8WA 4H89A 5K8NA 5G1ZA 2PJ2A 2ZXVA 4LUAA 2WPWA 4MMOA 2B5GB 2CY2A 4AG9A 1KUXA 1A2ZA 1TKJA 5AG7A 1S7NA 3B7IA 4KVOE 4A33A 4CYOA 1XBUA 4AG7A 4F0XA 2GU2A 3B3VA 2CTCA 1YW4A 3ISZA 5EC4A 4MFPA 4Q38A 1R3NA 2Q7BA 1RO5A 4X3RA 1PCAA 4ONUA 2C6CA 2J8RA 4I49A 3IGRA 4K30A 4KOYA 3EY5A 1Z8LA 3D66A 3SHPA 3RAMA 2Q4VA 4DJLA 1YX0A 2PRQA 4L89A 4C2YA 2PE3A 4Y49B 2AE6A 1IU8A 4R6TA 3SJEA 3TT2A 4FD5A 2ZW7A 4MJ8A 1AMPA 4YRHA 4FAIA 2HUZA 5LRKA 3SI0A 3H5ZA 5H86A 5J8CA 2PJ8A 2JBKA 3SJXA 4NEXA 2GIVA 2AFXA 4NGPA 5HH1A 1TIQA 2XEGA 3D7FA 1BPNA 4KORA 3FIXA 1CP6A 1J4JA 3JTKA 3KI9A 4IHMA 5CBMA 4Q7AA 4UCMA 4P10A 1XOVA 4ZX9A 4MFLA 4B5PA 4C7IA 4MCQA 1MJBA 2B4DB 4JWPA 4HNYB 3D7DA 3S9LA 2GFQA 3WC7A 4QVTA 5G22A 2ZENA 4C2XA 2AFSA 2AFWA 2ZEDA 2VI7A 2FE7A 4A95A 3BLNA 4CGMA 2QIRA 3MRUA 2OU2A 4CAWA 3KHZA 1KUVA 3R9GA 2WZNA 3TOBA 2JDCA 4KOXA 1KUYA 2JLMA 2POKA 4TNUA 4DUKA 3PFOA 3NA6A 5F49A 3PB7X 3V8IA 3GB0A 2H5MA 2OZUA 3R9FA 4KVME 2Z11A 3EFAA 2J9AA 4OLLA 3T9YA 2R1IA 2VQYA 4X8IA 2Q44A 4PK3A 4R3KA 3K9UA 5FVJA 4KVXA 2OR4A 3S6KA 4AVCA 3D2PA 2B58A 5JGFA 1OZPA 3GYAA 3IEHA 4R3LA 1GYTA 2ZW4A 4UWJA 4QBJA 5D29A 4P45A 4KOUA 2WUUA 4L8AA 2PJ4A 3DLJA 2ZW6A 2ZEOA 3HUVA 1IIDA 2B3UA 2FCKA 5ELYA 2CTBA 2O53A 2AFMA 2V8VA 3CT9A 2DEAA 3VH9A 1BPMA 1IGBA 3IFEA 3BJ7A 4PSXA 3CXSA 1ARLA 4OC1A 3FF3A 5J8FA 1F57A 5HVFA 2R7HA 1L0CA 2DPSA 1I1DA 4OKOA 5A28A 2BL1A 2GLFA 4OAEA 4G1PA 3W6SA 2PJ7A 4CAEA 1OBRA 3PB9X 4HKFA 3P2FA 4IUSA 3R1KA 4F9UA 4R8FA 3GY9A 2KCWA 3QB8A 4A30A 3KL9A 4OADA 3S6GA 2NYQA 2WPXA 4ZY2A 2EUIA 2JBJA 2QJ8A 2ZEHA 2C27A 3QAYA 3D67A 4OC4A 4UF4A 2A4NA 2I79A 5A27A 5IB0A 3SI1A 5H84A 3D8PA 3S6FA 1VHSA 3MN8A 1LAPA 2HV2A 4CYPA 3LWUA 4MHYA 2Q0YA 3W6XA 1CM0A 1X10A 4QUSA 1VHEA 2C6GA 1Y7RA 3PB8X 4CS0B 1QSNA 2C1CA 3KASA 3TO9A 4B10A 2ZPAA 1PYTB 1F2OA 5G20A 2ZEFA 4B12A 1SQHA 1R57A 1LANA 3FJUA 4UA3A 4MBUA 4A2ZA 8CPAA 3WC5A 2F8HA 1YQEA 3CXQA 4R9MA 3PEIA 2Z3MA 4KSFA 5AG6A 3V38A 2V77A 1EE3P 2EVNA 4RS2A 2K5TA 1R43A 2PCUA 4KOVA 5LYDA 4NGQA 3JRUA 4M3SA 2XEJA 3V7ZA 1CBXA 4NF1A 1VHOA 1Q7LA 3ZZIA 5KTDA 5F46A 3MGDA 2P6FA 2C6PA 3EO4A 2B4DA 2Z3OA 4WJBA 1AUGA 2BCOA 2IJZA 1WK4A 1S7FA 2ZELA 2OOTA 2PJ6A 1BAVA 4PXBA 4E0AA 2PVWA 4NGSA 3KQXA 3N7ZA 6CPAA 5K8OA 4C7HA 3UY5A 1ON0A 4OMEA 3L2NA 3R9EA 3I1UA 4LQ6A 1UFHA 3ZJ0A 4BBHA 2EO8A 3PB6X 2ZEEA 1YMEA 2FS5A 3CDXA 2F7VA 2PJBA 2YNCA 2Z10A 3FYNA 1XRYA 4JLYA 1HEEA 1ELMP 2EBJA 1Z8TA 3W91A 4ZI6A 1YVOA 2PJ5A 2YNEA 3IO1A 1P4NA 4Q36A 4P4FA 2B3VA 1Y7EA 2FVGA 1VGYA 1CX8A 2Q7SA 3H8GA 3R96A 2FIWA 2PIZA 4P4JA 3NH4A 3RBUA 1QSRA 2QMLA 3JVNA 1Y0RA 5K8MA 1RTQA 4B11A 2O28A 3IWWA 3T90A 2Q43A 3N5FA 1LAMA 4F8ZA 5AG5A 2CNTA 4B5OA 3DNSA 4MHPA 1MJ9A 4CGOA 3WT4A 1H8LA 3DSBA 5THWA 1CJWA 3SJFA 3BJ8A 4KUAA 5DWNA 4CGNA 5C88A 1Q2CA 2PJ1A 3CZXA 3GIUA 5K8PA 2PQ8A 3D7GA
chains in the Genus database with same CATH topology
2VBQA 4UBRA 1YR0A 4XNHC 4AVBA 3IU1A 1MK4A 2D4PA 3TE4A 4JD6A 3RYOA 2CNMA 1ZO0A 2DXQA 4C2ZA 1K4JA 2ARHA 2OZGA 2PDOA 5C82A 2ATRA 2B4BA 3D3SA 2YNDA 4E8OA 2Z3PA 3D2MA 2IL4A 3PGPA 4JJXA 4PV6A 1IYKA 1S7LA 1Y9KA 2HQYA 4KZTA 1RXTA 5F48A 1NMTA 4UFWA 3I3GA 4M85A 3DR6A 1KZFA 1B6BA 2WSAA 3OWCA 4CAVA 5E96A 1YLEA 2NMTA 1XEBA 4MHDA 4RI1A 2JEVA 4CGLA 5JPHA 2X7BA 4R87A 2RC4A 3P2HA 3C26A 4PK2A 2DPTA 3FRMA 4CGPA 2G3AA 2B5GA 3H4QA 1IICA 4KOWA 4KSAA 3IWEA 5F47A 1U6MA 2BSWA 2JDDA 2P0WA 4MFKA 4GS4A 5CNPA 3FB3A 3FNCA 3SXOA 3LD2A 1S60A 4MY0A 3DDDA 2AJ6A 1YVKA 4MY3A 3EC4A 4H6ZA 2QECA 3JUWA 2VZYA 4E2AA 5IX3A 1BOBA 1QSTA 3R95A 1QSOA 4NCZA 1XIXA 2PR1A 2PRBA 1NE9A 1PUAA 2YNCC 4F0YA 3EXNA 4CYQA 2Z3NA 4XNHB 5AGEA 3PP9A 4QC6A 3WR7A 4PSWA 4J3GA 3TOAA 5I0CA 2OB0A 1WWZA 4A32A 4KS9A 2I00A 4II9A 2VZZA 2PSWA 4YFJA 3IWGA 5ISVA 3F5BA 3B8GA 2OZHA 4UFXA 4XPLA 3QAHA 1P0HA 4JXRA 4H6UA 1V0CA 4A31A 4XPDC 4B14A 1YREA 1Z4EA 3TCVA 1I12A 2Q04A 5AG4A 2R8VA 2VEZA 2F5IA 4KLWA 1NSLA 4UFVA 4MI4A 1YK3A 4UCPA 2Z3KA 2G3TA 4AB7A 3NE7A 4C68A 3IU2A 5BWAB 4NSQA 3TO7A 1VKCA 3TFYA 4BMHA 1MJAA 2OH1A 2FXFA 2VXKA 4YGOA 1M4DA 3KKWA 1M4GA 3F8KA 2CNSA 1QSMA 5DWMA 4HNWB 3E0KA 4LX9A 2FT0A 3PZJA 4KOSA 2BEIA 4FD6A 4MFJA 3VWDA 2J8NA 2REFA 4DNCA 2Y0MA 5HMNA 1GHEA 1PU9A 2ZW5A 4AVAA 1BO4A 4CAFA 3VWEA 5JQ4A 2P6GA 3TTHA 3FBUA 4MFZA 1XF8A 5G21A 2REEA 1S3ZA 4FD7A 1IB1E 4B13A 4U5YA 1Q2YA 4KOTA 2BUEA 4Y49C 2YGWA 4KUBA 4UCNA 2J8MA 4F6AA 3TO6A 3LODA 1XE4A 1M4IA 1B87A 2P6EA 3S6HA 4ORFA 4CYNA 4MFQA 2FSRA 2PR8A 4B5PB 1FY7A 4CRZB 1I21A 1M44A 2Z0ZA 4EVYA 2FIAA 3G3SA 2R98A 5GCNA 3DR8A 4NXYA 1XMTA 1LRZA 2FL4A 2G0BA 1Z4RA 3GKRA 1S7KA 2PC1A 3CXPA 1N71A 4XPDB 4HNXB 1S5KA 2Q4YA 3A9LA 5KTAA 1IYLA 4ZGYB 5EBVA 4KLVA 2GANA 2Z3LA 4R57A 3FXTA 3I9SA 4UWIA 1M1DA 1Z9UA 2CXAA 4ZBGA 4IF5A 4U9YA 1YGHA 5IV0A 4X5KA 2D4OA 2GE3A 4JXQA 5KTCA 4U9ZA 4XPKA 3F0AA 3SXNA 1Q2DA 4QB9A 4CAXA 4FD4A 4CRYB 1Y9WA 3G8WA 4H89A 5G1ZA 2ZXVA 4LUAA 2WPWA 2B5GB 2CY2A 4AG9A 1KUXA 5AG7A 1S7NA 4KVOE 4A33A 4CYOA 4AG7A 4F0XA 5EC4A 4MFPA 4Q38A 2Q7BA 1RO5A 4ONUA 2J8RA 4I49A 4K30A 3IGRA 4KOYA 3EY5A 3SHPA 2Q4VA 1YX0A 4L89A 4C2YA 4Y49B 2AE6A 3TT2A 4FD5A 2ZW7A 4MJ8A 4YRHA 2HUZA 3H5ZA 5H86A 5J8CA 4NEXA 2GIVA 5HH1A 1TIQA 4KORA 3FIXA 1J4JA 3JTKA 4UCMA 4MFLA 4B5PA 4C7IA 1MJBA 2B4DB 4JWPA 4HNYB 4QVTA 5G22A 4C2XA 2VI7A 2FE7A 4A95A 3BLNA 4CGMA 2QIRA 4CAWA 2OU2A 1KUVA 3R9GA 3TOBA 2JDCA 4KOXA 1KUYA 2JLMA 5F49A 3V8IA 2H5MA 2OZUA 3R9FA 4KVME 2Z11A 3EFAA 4OLLA 3T9YA 2R1IA 2VQYA 2Q44A 4PK3A 4R3KA 3K9UA 5FVJA 4KVXA 4AVCA 3S6KA 3D2PA 2B58A 1OZPA 3GYAA 4R3LA 4QBJA 2ZW4A 4UWJA 4KOUA 2WUUA 4L8AA 2ZW6A 1IIDA 2B3UA 2FCKA 3BJ7A 4PSXA 3CXSA 5J8FA 2R7HA 1L0CA 2DPSA 1I1DA 5A28A 2BL1A 4OAEA 3W6SA 4CAEA 4HKFA 3P2FA 4IUSA 3R1KA 3GY9A 2KCWA 3QB8A 4A30A 4OADA 3S6GA 2WPXA 2EUIA 2C27A 5A27A 2A4NA 2I79A 5IB0A 5H84A 3D8PA 3S6FA 1VHSA 2HV2A 4CYPA 2Q0YA 3W6XA 1CM0A 4QUSA 1Y7RA 4CS0B 1QSNA 4B10A 3TO9A 2ZPAA 5G20A 4B12A 1SQHA 1R57A 4UA3A 4A2ZA 4MBUA 3CXQA 4R9MA 4KSFA 2Z3MA 5AG6A 2EVNA 4RS2A 2K5TA 4KOVA 4M3SA 4NF1A 3ZZIA 5KTDA 5F46A 3MGDA 2P6FA 3EO4A 2B4DA 2Z3OA 1WK4A 1S7FA 4E0AA 3N7ZA 4C7HA 3UY5A 1ON0A 3R9EA 1UFHA 3ZJ0A 4BBHA 2FS5A 2YNCA 2Z10A 3FYNA 4JLYA 3W91A 1YVOA 2YNEA 1P4NA 4Q36A 2B3VA 3R96A 2FIWA 1QSRA 2QMLA 3JVNA 4B11A 2O28A 3T90A 5AG5A 2CNTA 4B5OA 3DNSA 1MJ9A 4CGOA 3DSBA 1CJWA 3BJ8A 4KUAA 5DWNA 4CGNA 5C88A 1Q2CA 2PQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBQ A;  4UBR A;  1YR0 A;  4XNH C;  4AVB A;  1MK4 A;  2D4P A;  3TE4 A;  4JD6 A;  3RYO A;  2CNM A;  2DXQ A;  1K4J A;  2ARH A;  2OZG A;  2PDO A;  5C82 A;  2ATR A;  2B4B A;  3D3S A;  4E8O A;  3D2M A;  2IL4 A;  3PGP A;  4JJX A;  4PV6 A;  1IYK A;  1S7L A;  1Y9K A;  2HQY A;  4KZT A;  1RXT A;  5F48 A;  1NMT A;  3I3G A;  4M85 A;  3DR6 A;  1KZF A;  1B6B A;  3OWC A;  4CAV A;  5E96 A;  1YLE A;  2NMT A;  1XEB A;  4MHD A;  4RI1 A;  2JEV A;  5JPH A;  2X7B A;  4R87 A;  2RC4 A;  3P2H A;  3C26 A;  4PK2 A;  3FRM A;  2G3A A;  2B5G A;  3H4Q A;  1IIC A;  4KOW A;  5F47 A;  1U6M A;  2BSW A;  2JDD A;  2P0W A;  4GS4 A;  5CNP A;  3FB3 A;  3FNC A;  3SXO A;  3LD2 A;  1S60 A;  4MY0 A;  3DDD A;  2AJ6 A;  1YVK A;  4MY3 A;  3EC4 A;  4H6Z A;  2QEC A;  3JUW A;  2VZY A;  4E2A A;  5IX3 A;  1BOB A;  1QST A;  3R95 A;  1QSO A;  4NCZ A;  1XIX A;  2PR1 A;  2PRB A;  1NE9 A;  1PUA A;  4F0Y A;  3EXN A;  4XNH B;  3PP9 A;  4QC6 A;  3WR7 A;  4PSW A;  4J3G A;  3TOA A;  5I0C A;  2OB0 A;  1WWZ A;  2I00 A;  4II9 A;  2VZZ A;  2PSW A;  4YFJ A;  3IWG A;  5ISV A;  3F5B A;  3B8G A;  2OZH A;  4XPL A;  3QAH A;  1P0H A;  4JXR A;  4H6U A;  1V0C A;  4XPD C;  1YRE A;  1Z4E A;  3TCV A;  1I12 A;  2Q04 A;  2R8V A;  2VEZ A;  2F5I A;  4KLW A;  1NSL A;  4MI4 A;  1YK3 A;  2G3T A;  4AB7 A;  3NE7 A;  4NSQ A;  3TO7 A;  1VKC A;  3TFY A;  4BMH A;  1MJA A;  2OH1 A;  2FXF A;  2VXK A;  4YGO A;  1M4D A;  3KKW A;  1M4G A;  3F8K A;  2CNS A;  1QSM A;  5DWM A;  4HNW B;  3E0K A;  4LX9 A;  2FT0 A;  3PZJ A;  4KOS A;  2BEI A;  4FD6 A;  3VWD A;  2J8N A;  2REF A;  4DNC A;  2Y0M A;  5HMN A;  1GHE A;  1PU9 A;  2ZW5 A;  4AVA A;  1BO4 A;  3VWE A;  5JQ4 A;  2P6G A;  3TTH A;  3FBU A;  1XF8 A;  2REE A;  1S3Z A;  4FD7 A;  1IB1 E;  4U5Y A;  1Q2Y A;  4KOT A;  2BUE A;  4Y49 C;  4KUB A;  2J8M A;  4F6A A;  3TO6 A;  3LOD A;  1XE4 A;  1M4I A;  1B87 A;  2P6E A;  3S6H A;  4ORF A;  2FSR A;  2PR8 A;  4B5P B;  1FY7 A;  4CRZ B;  1I21 A;  1M44 A;  2Z0Z A;  4EVY A;  2FIA A;  3G3S A;  2R98 A;  5GCN A;  3DR8 A;  4NXY A;  1XMT A;  1LRZ A;  2FL4 A;  2G0B A;  1Z4R A;  3GKR A;  1S7K A;  2PC1 A;  3CXP A;  1N71 A;  4XPD B;  4HNX B;  1S5K A;  2Q4Y A;  5KTA A;  1IYL A;  5EBV A;  4KLV A;  2GAN A;  4R57 A;  3FXT A;  3I9S A;  4UWI A;  1M1D A;  1Z9U A;  4ZBG A;  4IF5 A;  4U9Y A;  1YGH A;  5IV0 A;  4X5K A;  2D4O A;  2GE3 A;  4JXQ A;  5KTC A;  4U9Z A;  4XPK A;  3F0A A;  3SXN A;  1Q2D A;  4QB9 A;  4CAX A;  4FD4 A;  4CRY B;  1Y9W A;  3G8W A;  4H89 A;  2ZXV A;  4LUA A;  2WPW A;  2B5G B;  2CY2 A;  4AG9 A;  1KUX A;  1S7N A;  4KVO E;  4AG7 A;  5EC4 A;  2Q7B A;  1RO5 A;  4ONU A;  2J8R A;  4I49 A;  4K30 A;  3IGR A;  4KOY A;  3EY5 A;  3SHP A;  2Q4V A;  1YX0 A;  4L89 A;  4Y49 B;  2AE6 A;  3TT2 A;  4FD5 A;  2ZW7 A;  4MJ8 A;  4YRH A;  2HUZ A;  5H86 A;  5J8C A;  4NEX A;  2GIV A;  5HH1 A;  1TIQ A;  4KOR A;  3FIX A;  1J4J A;  4B5P A;  1MJB A;  2B4D B;  4JWP A;  4HNY B;  4QVT A;  2VI7 A;  2FE7 A;  3BLN A;  2QIR A;  4CAW A;  2OU2 A;  1KUV A;  3R9G A;  3TOB A;  2JDC A;  4KOX A;  1KUY A;  2JLM A;  5F49 A;  3V8I A;  2H5M A;  2OZU A;  3R9F A;  4KVM E;  2Z11 A;  3EFA A;  4OLL A;  3T9Y A;  2R1I A;  2VQY A;  2Q44 A;  4PK3 A;  4R3K A;  3K9U A;  5FVJ A;  4KVX A;  4AVC A;  3S6K A;  3D2P A;  2B58 A;  1OZP A;  3GYA A;  4R3L A;  4QBJ A;  2ZW4 A;  4UWJ A;  4KOU A;  4L8A A;  2ZW6 A;  1IID A;  2B3U A;  2FCK A;  3BJ7 A;  4PSX A;  3CXS A;  5J8F A;  2R7H A;  1L0C A;  1I1D A;  2BL1 A;  4OAE A;  3W6S A;  4HKF A;  3P2F A;  4IUS A;  3R1K A;  3GY9 A;  2KCW A;  3QB8 A;  4OAD A;  3S6G A;  2WPX A;  2EUI A;  2C27 A;  2A4N A;  2I79 A;  5IB0 A;  5H84 A;  3D8P A;  3S6F A;  1VHS A;  2HV2 A;  2Q0Y A;  3W6X A;  1CM0 A;  4QUS A;  1Y7R A;  4CS0 B;  1QSN A;  3TO9 A;  2ZPA A;  1SQH A;  1R57 A;  4UA3 A;  4MBU A;  3CXQ A;  4R9M A;  2EVN A;  4RS2 A;  2K5T A;  4KOV A;  4M3S A;  4NF1 A;  3ZZI A;  5KTD A;  5F46 A;  3MGD A;  2P6F A;  3EO4 A;  2B4D A;  1WK4 A;  1S7F A;  4E0A A;  3N7Z A;  3UY5 A;  1ON0 A;  3R9E A;  1UFH A;  3ZJ0 A;  2FS5 A;  2Z10 A;  3FYN A;  4JLY A;  3W91 A;  1YVO A;  1P4N A;  2B3V A;  3R96 A;  2FIW A;  1QSR A;  2QML A;  3JVN A;  2O28 A;  3T90 A;  2CNT A;  4B5O A;  3DNS A;  1MJ9 A;  3DSB A;  1CJW A;  3BJ8 A;  4KUA A;  5DWN A;  5C88 A;  1Q2C A;  2PQ8 A; 
#chains in the Genus database with same CATH topology
 2VBQ A;  4UBR A;  1YR0 A;  4LQG A;  4XNH C;  5LYI A;  4AVB A;  3IU1 A;  1MK4 A;  3K9T A;  2G9D A;  2D4P A;  3TE4 A;  1VIX A;  2RB7 A;  3QNV A;  4JD6 A;  3RYO A;  1ZG7 A;  2CNM A;  1ZO0 A;  2DXQ A;  4C2Z A;  1K4J A;  2IMO A;  2ARH A;  1XJO A;  2V8D A;  2OZG A;  1Z8W A;  5EMI A;  2PDO A;  1DE4 C;  5F09 A;  5C82 A;  3PB4 X;  2ZEG A;  5D8N A;  4PXD A;  4HPS A;  2ATR A;  2B4B A;  3D3S A;  2YND A;  4PPZ A;  1F2P A;  3B3C A;  2Z3P A;  4E8O A;  3D2M A;  4UEE A;  2IL4 A;  3PGP A;  4JJX A;  2IQ6 A;  3S9M A;  4Z65 A;  4PV6 A;  1IYK A;  3FVL A;  1QQ9 A;  3BI1 A;  4A94 A;  1S7L A;  3NH5 A;  1IOF A;  3B35 A;  3KZW A;  1Y9K A;  2HQY A;  4KZT A;  1RXT A;  4UEZ A;  5F48 A;  2O4H A;  1NMT A;  1XFO A;  4UFW A;  1JQG A;  3I3G A;  1NSA A;  2Q51 A;  4M85 A;  4ONW A;  3DR6 A;  1KZF A;  1B6B A;  2WSA A;  2ZOF A;  3OWC A;  4CAV A;  5E96 A;  1YLE A;  2NMT A;  1CPS A;  1XEB A;  4MHD A;  2JEV A;  4RI1 A;  4CGL A;  5JPH A;  2X7B A;  4OC0 A;  3SI2 A;  4R87 A;  2RC4 A;  2AFO A;  2CF4 A;  3P2H A;  3BHX A;  1KWM A;  3C26 A;  4PK2 A;  2DPT A;  3FRM A;  4FBE A;  3PRT A;  2G3A A;  4CGP A;  2B5G A;  3H4Q A;  1IIC A;  4KOW A;  4KSA A;  1ZG9 A;  3HLP A;  3WAB A;  3IWE A;  2DF5 A;  1IY7 A;  3KR4 A;  3IJ3 A;  5F47 A;  1U6M A;  1CP7 A;  5CPA A;  2BSW A;  2JDD A;  1TKH A;  2P0W A;  3FEE A;  3TX8 A;  2RFH A;  4MFK A;  4MCR A;  4GS4 A;  5CNP A;  3FMC A;  4P4E A;  4MCP A;  3FB3 A;  3FNC A;  3SXO A;  5JM6 A;  1ELL P;  3LD2 A;  2XEI A;  4WWV A;  4RUH A;  1S60 A;  4GM5 A;  4MY0 A;  1FNO A;  2PJ9 A;  3DDD A;  4OP4 A;  3VAT A;  3IC1 A;  2AJ6 A;  1CPX A;  1YVK A;  4PXC A;  4UEF A;  4MY3 A;  1TXR A;  4P4D A;  3EC4 A;  3FEC A;  4H6Z A;  2QEC A;  1TF8 A;  2Q4Z A;  2VZY A;  3JUW A;  4E2A A;  2PJ3 A;  3LMS A;  5IX3 A;  4KSI A;  1BOB A;  1QST A;  2V8G A;  4W9Y A;  3KGQ A;  4NJR A;  1Z8X A;  3R95 A;  4JYW A;  4OC2 A;  1QSO A;  4NCZ A;  1YW6 A;  1CG2 A;  1XIX A;  2PR1 A;  1DTD A;  2PRB A;  1NE9 A;  1LFW A;  1PUA A;  2HB6 A;  2YNC C;  4B6Z A;  3EXN A;  4F0Y A;  4CYQ A;  2Z3N A;  4XNH B;  5AGE A;  3PP9 A;  4DYO A;  4QC6 A;  1M4L A;  4O23 A;  4M6H A;  3TC8 A;  3WR7 A;  4PSW A;  4J3G A;  2QVP A;  3RZA A;  3TOA A;  2ZEM A;  3SJG A;  1UWY A;  2OB0 A;  3WC6 A;  2V8H A;  4NGR A;  1WWZ A;  5I0C A;  4A32 A;  1JWQ A;  3GLJ A;  3PFE A;  4KS9 A;  3H8E A;  4OC5 A;  2WYR A;  3LAC A;  4H2K A;  2I00 A;  2VL1 A;  4II9 A;  2VZZ A;  2PSW A;  4YFJ A;  3IWG A;  3KQZ A;  4AXV A;  3IIB A;  4FWU A;  2GLJ A;  4NGT A;  5ISV A;  3F5B A;  3B8G A;  4P6Y A;  2HC9 A;  2OZH A;  4UFX A;  1ZLH A;  4OID A;  1LOK A;  4XPL A;  4BIN A;  3QAH A;  7CPA A;  3GUX A;  1P0H A;  1ZG8 A;  3B3S A;  1V0C A;  4H6U A;  4JXR A;  4XPD C;  4A31 A;  3NE8 A;  1YRE A;  1Z4E A;  3TCV A;  4B14 A;  1I12 A;  4NJQ A;  4ZY1 A;  2Q04 A;  5AG4 A;  2R8V A;  4UIA A;  4A39 A;  2VEZ A;  1XMB A;  4R7M A;  2F5I A;  4KLW A;  4JZ0 A;  1NSL A;  4UFV A;  2PJ0 A;  4MRI A;  4MI4 A;  2EWB A;  1YK3 A;  3DGV A;  4UCP A;  2Z3K A;  2PJA A;  1AYE A;  3KHX A;  2EK9 A;  2G3T A;  2PIY A;  4AB7 A;  3NE7 A;  4C68 A;  4A37 A;  2AFU A;  2I3C A;  3IU2 A;  4NSQ A;  3TO7 A;  5BWA B;  1VKC A;  3TFY A;  4BMH A;  2ANP A;  1MJA A;  2OH1 A;  2FXF A;  2VXK A;  1ZLI A;  4YGO A;  1M4D A;  2NSM A;  1HDU A;  3KKW A;  4ZY0 A;  4TWE A;  1M4G A;  3F8K A;  4K3N A;  3RO0 A;  4MCS A;  4MXU A;  4BD9 A;  2CNS A;  1QSM A;  2CIJ A;  5DWM A;  3VAR A;  4HNW B;  3E0K A;  2BO9 A;  2FT0 A;  4LX9 A;  3NFZ A;  3PZJ A;  4KOS A;  2BEI A;  4FD6 A;  4MFJ A;  4ZX8 A;  3PBB A;  4UIB A;  3VWD A;  1Z5R A;  2J8N A;  2REF A;  4DNC A;  2Y0M A;  3T8W A;  5HMN A;  1GHE A;  1PU9 A;  2ZW5 A;  4AVA A;  1BO4 A;  4CAF A;  4PQA A;  3CPA A;  3VWE A;  5JQ4 A;  2P6G A;  3TTH A;  3FBU A;  4MFZ A;  1XF8 A;  3BI0 A;  5G21 A;  5HXD A;  2ODF A;  2REE A;  2PJC A;  1S3Z A;  4MHZ A;  4F9V A;  2AFZ A;  3FX6 A;  5LYF A;  4FD7 A;  1IB1 E;  4B13 A;  4U5Y A;  5DS0 A;  1Q2Y A;  4KOT A;  2BUE A;  2EK8 A;  2YGW A;  4Y49 C;  1QMU A;  4KUB A;  4UCN A;  2J8M A;  4IK2 A;  1X12 A;  3TO6 A;  4F6A A;  3LOD A;  1XE4 A;  3B3W A;  3NH8 A;  3BXM A;  1HDQ A;  1IOI A;  1B87 A;  1M4I A;  3D4U A;  5JH9 A;  4P4I A;  2P6E A;  4NGM A;  4NFR A;  3S6H A;  2ABZ A;  3PBE A;  4ORF A;  4MHN A;  5LRJ A;  3RNZ A;  4CYN A;  4MFQ A;  2FSR A;  4EME A;  2PR8 A;  3D7H A;  4M6G A;  1FY7 A;  4B5P B;  4CRZ B;  1I21 A;  1M44 A;  2Z0Z A;  4FUU A;  4M6I A;  4R76 A;  2ZEP A;  4EFD A;  2FIA A;  4CPA A;  4EVY A;  3G3S A;  5LYL A;  2R98 A;  5GCN A;  3DR8 A;  4NXY A;  5J1Q A;  2JEW A;  1XMT A;  1Y0Y A;  2QYV A;  2ZOG A;  3KR5 A;  4PXE A;  1LRZ A;  1Z2L A;  2FL4 A;  1TKF A;  4IAV A;  4X2T A;  4YU9 A;  2G0B A;  1Z4R A;  3GKR A;  1S7K A;  2PC1 A;  2PVV A;  3CXP A;  1N71 A;  4NGN A;  3ISX A;  5HVH A;  1YLO A;  3K2K A;  1TF9 A;  4P4B A;  1FT7 A;  4XPD B;  5I4M A;  4HNX B;  1S5K A;  2Q4Y A;  4OC3 A;  3A9L A;  5KTA A;  4ZYQ A;  1IYL A;  1LCP A;  4P44 A;  2XEF A;  4ZGY B;  5EBV A;  5HVG A;  3FH4 A;  4KLV A;  2GAN A;  4A38 A;  3CPX A;  2Z3L A;  4R57 A;  3FXT A;  4GXH A;  5LRG A;  3H8F A;  3I9S A;  3S9N A;  4UWI A;  1M1D A;  1Z9U A;  3B3T A;  2BOA A;  3D68 A;  2CXA A;  3B2Y A;  4EWT A;  4ZBG A;  4IF5 A;  1YSJ A;  4U9Y A;  1YGH A;  5IV0 A;  4X5K A;  4YWY A;  2D4O A;  4OIW A;  2GE3 A;  5IB9 A;  4JXQ A;  3FED A;  1BLL E;  5KTC A;  4U9Z A;  4XPK A;  3F0A A;  3SXN A;  1Q2D A;  2GRE A;  4RN7 A;  4QB9 A;  4CAX A;  4FD4 A;  4CRY B;  1ARM A;  1Y9W A;  3G8W A;  4H89 A;  5K8N A;  5G1Z A;  2PJ2 A;  2ZXV A;  4LUA A;  2WPW A;  4MMO A;  2B5G B;  2CY2 A;  4AG9 A;  1KUX A;  1A2Z A;  1TKJ A;  5AG7 A;  1S7N A;  3B7I A;  4KVO E;  4A33 A;  4CYO A;  1XBU A;  4AG7 A;  4F0X A;  2GU2 A;  3B3V A;  2CTC A;  1YW4 A;  3ISZ A;  5EC4 A;  4MFP A;  4Q38 A;  1R3N A;  2Q7B A;  1RO5 A;  4X3R A;  1PCA A;  4ONU A;  2C6C A;  2J8R A;  4I49 A;  3IGR A;  4K30 A;  4KOY A;  3EY5 A;  1Z8L A;  3D66 A;  3SHP A;  3RAM A;  2Q4V A;  4DJL A;  1YX0 A;  2PRQ A;  4L89 A;  4C2Y A;  2PE3 A;  4Y49 B;  2AE6 A;  1IU8 A;  4R6T A;  3SJE A;  3TT2 A;  4FD5 A;  2ZW7 A;  4MJ8 A;  1AMP A;  4YRH A;  4FAI A;  2HUZ A;  5LRK A;  3SI0 A;  3H5Z A;  5H86 A;  5J8C A;  2PJ8 A;  2JBK A;  3SJX A;  4NEX A;  2GIV A;  2AFX A;  4NGP A;  5HH1 A;  1TIQ A;  2XEG A;  3D7F A;  1BPN A;  4KOR A;  3FIX A;  1CP6 A;  1J4J A;  3JTK A;  3KI9 A;  4IHM A;  5CBM A;  4Q7A A;  4UCM A;  4P10 A;  1XOV A;  4ZX9 A;  4MFL A;  4B5P A;  4C7I A;  4MCQ A;  1MJB A;  2B4D B;  4JWP A;  4HNY B;  3D7D A;  3S9L A;  2GFQ A;  3WC7 A;  4QVT A;  5G22 A;  2ZEN A;  4C2X A;  2AFS A;  2AFW A;  2ZED A;  2VI7 A;  2FE7 A;  4A95 A;  3BLN A;  4CGM A;  2QIR A;  3MRU A;  2OU2 A;  4CAW A;  3KHZ A;  1KUV A;  3R9G A;  2WZN A;  3TOB A;  2JDC A;  4KOX A;  1KUY A;  2JLM A;  2POK A;  4TNU A;  4DUK A;  3PFO A;  3NA6 A;  5F49 A;  3PB7 X;  3V8I A;  3GB0 A;  2H5M A;  2OZU A;  3R9F A;  4KVM E;  2Z11 A;  3EFA A;  2J9A A;  4OLL A;  3T9Y A;  2R1I A;  2VQY A;  4X8I A;  2Q44 A;  4PK3 A;  4R3K A;  3K9U A;  5FVJ A;  4KVX A;  2OR4 A;  3S6K A;  4AVC A;  3D2P A;  2B58 A;  5JGF A;  1OZP A;  3GYA A;  3IEH A;  4R3L A;  1GYT A;  2ZW4 A;  4UWJ A;  4QBJ A;  5D29 A;  4P45 A;  4KOU A;  2WUU A;  4L8A A;  2PJ4 A;  3DLJ A;  2ZW6 A;  2ZEO A;  3HUV A;  1IID A;  2B3U A;  2FCK A;  5ELY A;  2CTB A;  2O53 A;  2AFM A;  2V8V A;  3CT9 A;  2DEA A;  3VH9 A;  1BPM A;  1IGB A;  3IFE A;  3BJ7 A;  4PSX A;  3CXS A;  1ARL A;  4OC1 A;  3FF3 A;  5J8F A;  1F57 A;  5HVF A;  2R7H A;  1L0C A;  2DPS A;  1I1D A;  4OKO A;  5A28 A;  2BL1 A;  2GLF A;  4OAE A;  4G1P A;  3W6S A;  2PJ7 A;  4CAE A;  1OBR A;  3PB9 X;  4HKF A;  3P2F A;  4IUS A;  3R1K A;  4F9U A;  4R8F A;  3GY9 A;  2KCW A;  3QB8 A;  4A30 A;  3KL9 A;  4OAD A;  3S6G A;  2NYQ A;  2WPX A;  4ZY2 A;  2EUI A;  2JBJ A;  2QJ8 A;  2ZEH A;  2C27 A;  3QAY A;  3D67 A;  4OC4 A;  4UF4 A;  2A4N A;  2I79 A;  5A27 A;  5IB0 A;  3SI1 A;  5H84 A;  3D8P A;  3S6F A;  1VHS A;  3MN8 A;  1LAP A;  2HV2 A;  4CYP A;  3LWU A;  4MHY A;  2Q0Y A;  3W6X A;  1CM0 A;  1X10 A;  4QUS A;  1VHE A;  2C6G A;  1Y7R A;  3PB8 X;  4CS0 B;  1QSN A;  2C1C A;  3KAS A;  3TO9 A;  4B10 A;  2ZPA A;  1PYT B;  1F2O A;  5G20 A;  2ZEF A;  4B12 A;  1SQH A;  1R57 A;  1LAN A;  3FJU A;  4UA3 A;  4MBU A;  4A2Z A;  8CPA A;  3WC5 A;  2F8H A;  1YQE A;  3CXQ A;  4R9M A;  3PEI A;  2Z3M A;  4KSF A;  5AG6 A;  3V38 A;  2V77 A;  1EE3 P;  2EVN A;  4RS2 A;  2K5T A;  1R43 A;  2PCU A;  4KOV A;  5LYD A;  4NGQ A;  3JRU A;  4M3S A;  2XEJ A;  3V7Z A;  1CBX A;  4NF1 A;  1VHO A;  1Q7L A;  3ZZI A;  5KTD A;  5F46 A;  3MGD A;  2P6F A;  2C6P A;  3EO4 A;  2B4D A;  2Z3O A;  4WJB A;  1AUG A;  2BCO A;  2IJZ A;  1WK4 A;  1S7F A;  2ZEL A;  2OOT A;  2PJ6 A;  1BAV A;  4PXB A;  4E0A A;  2PVW A;  4NGS A;  3KQX A;  3N7Z A;  6CPA A;  5K8O A;  4C7H A;  3UY5 A;  1ON0 A;  4OME A;  3L2N A;  3R9E A;  3I1U A;  4LQ6 A;  1UFH A;  3ZJ0 A;  4BBH A;  2EO8 A;  3PB6 X;  2ZEE A;  1YME A;  2FS5 A;  3CDX A;  2F7V A;  2PJB A;  2YNC A;  2Z10 A;  3FYN A;  1XRY A;  4JLY A;  1HEE A;  1ELM P;  2EBJ A;  1Z8T A;  3W91 A;  4ZI6 A;  1YVO A;  2PJ5 A;  2YNE A;  3IO1 A;  1P4N A;  4Q36 A;  4P4F A;  2B3V A;  1Y7E A;  2FVG A;  1VGY A;  1CX8 A;  2Q7S A;  3H8G A;  3R96 A;  2FIW A;  2PIZ A;  4P4J A;  3NH4 A;  3RBU A;  1QSR A;  2QML A;  3JVN A;  1Y0R A;  5K8M A;  1RTQ A;  4B11 A;  2O28 A;  3IWW A;  3T90 A;  2Q43 A;  3N5F A;  1LAM A;  4F8Z A;  5AG5 A;  2CNT A;  4B5O A;  3DNS A;  4MHP A;  1MJ9 A;  4CGO A;  3WT4 A;  1H8L A;  3DSB A;  5THW A;  1CJW A;  3SJF A;  3BJ8 A;  4KUA A;  5DWN A;  4CGN A;  5C88 A;  1Q2C A;  2PJ1 A;  3CZX A;  3GIU A;  5K8P A;  2PQ8 A;  3D7G A; 
#chains in the Genus database with same CATH homology
 2VBQ A;  4UBR A;  1YR0 A;  4XNH C;  4AVB A;  3IU1 A;  1MK4 A;  2D4P A;  3TE4 A;  4JD6 A;  3RYO A;  2CNM A;  1ZO0 A;  2DXQ A;  4C2Z A;  1K4J A;  2ARH A;  2OZG A;  2PDO A;  5C82 A;  2ATR A;  2B4B A;  3D3S A;  2YND A;  4E8O A;  2Z3P A;  3D2M A;  2IL4 A;  3PGP A;  4JJX A;  4PV6 A;  1IYK A;  1S7L A;  1Y9K A;  2HQY A;  4KZT A;  1RXT A;  5F48 A;  1NMT A;  4UFW A;  3I3G A;  4M85 A;  3DR6 A;  1KZF A;  1B6B A;  2WSA A;  3OWC A;  4CAV A;  5E96 A;  1YLE A;  2NMT A;  1XEB A;  4MHD A;  4RI1 A;  2JEV A;  4CGL A;  5JPH A;  2X7B A;  4R87 A;  2RC4 A;  3P2H A;  3C26 A;  4PK2 A;  2DPT A;  3FRM A;  4CGP A;  2G3A A;  2B5G A;  3H4Q A;  1IIC A;  4KOW A;  4KSA A;  3IWE A;  5F47 A;  1U6M A;  2BSW A;  2JDD A;  2P0W A;  4MFK A;  4GS4 A;  5CNP A;  3FB3 A;  3FNC A;  3SXO A;  3LD2 A;  1S60 A;  4MY0 A;  3DDD A;  2AJ6 A;  1YVK A;  4MY3 A;  3EC4 A;  4H6Z A;  2QEC A;  3JUW A;  2VZY A;  4E2A A;  5IX3 A;  1BOB A;  1QST A;  3R95 A;  1QSO A;  4NCZ A;  1XIX A;  2PR1 A;  2PRB A;  1NE9 A;  1PUA A;  2YNC C;  4F0Y A;  3EXN A;  4CYQ A;  2Z3N A;  4XNH B;  5AGE A;  3PP9 A;  4QC6 A;  3WR7 A;  4PSW A;  4J3G A;  3TOA A;  5I0C A;  2OB0 A;  1WWZ A;  4A32 A;  4KS9 A;  2I00 A;  4II9 A;  2VZZ A;  2PSW A;  4YFJ A;  3IWG A;  5ISV A;  3F5B A;  3B8G A;  2OZH A;  4UFX A;  4XPL A;  3QAH A;  1P0H A;  4JXR A;  4H6U A;  1V0C A;  4A31 A;  4XPD C;  4B14 A;  1YRE A;  1Z4E A;  3TCV A;  1I12 A;  2Q04 A;  5AG4 A;  2R8V A;  2VEZ A;  2F5I A;  4KLW A;  1NSL A;  4UFV A;  4MI4 A;  1YK3 A;  4UCP A;  2Z3K A;  2G3T A;  4AB7 A;  3NE7 A;  4C68 A;  3IU2 A;  5BWA B;  4NSQ A;  3TO7 A;  1VKC A;  3TFY A;  4BMH A;  1MJA A;  2OH1 A;  2FXF A;  2VXK A;  4YGO A;  1M4D A;  3KKW A;  1M4G A;  3F8K A;  2CNS A;  1QSM A;  5DWM A;  4HNW B;  3E0K A;  4LX9 A;  2FT0 A;  3PZJ A;  4KOS A;  2BEI A;  4FD6 A;  4MFJ A;  3VWD A;  2J8N A;  2REF A;  4DNC A;  2Y0M A;  5HMN A;  1GHE A;  1PU9 A;  2ZW5 A;  4AVA A;  1BO4 A;  4CAF A;  3VWE A;  5JQ4 A;  2P6G A;  3TTH A;  3FBU A;  4MFZ A;  1XF8 A;  5G21 A;  2REE A;  1S3Z A;  4FD7 A;  1IB1 E;  4B13 A;  4U5Y A;  1Q2Y A;  4KOT A;  2BUE A;  4Y49 C;  2YGW A;  4KUB A;  4UCN A;  2J8M A;  4F6A A;  3TO6 A;  3LOD A;  1XE4 A;  1M4I A;  1B87 A;  2P6E A;  3S6H A;  4ORF A;  4CYN A;  4MFQ A;  2FSR A;  2PR8 A;  4B5P B;  1FY7 A;  4CRZ B;  1I21 A;  1M44 A;  2Z0Z A;  4EVY A;  2FIA A;  3G3S A;  2R98 A;  5GCN A;  3DR8 A;  4NXY A;  1XMT A;  1LRZ A;  2FL4 A;  2G0B A;  1Z4R A;  3GKR A;  1S7K A;  2PC1 A;  3CXP A;  1N71 A;  4XPD B;  4HNX B;  1S5K A;  2Q4Y A;  3A9L A;  5KTA A;  1IYL A;  4ZGY B;  5EBV A;  4KLV A;  2GAN A;  2Z3L A;  4R57 A;  3FXT A;  3I9S A;  4UWI A;  1M1D A;  1Z9U A;  2CXA A;  4ZBG A;  4IF5 A;  4U9Y A;  1YGH A;  5IV0 A;  4X5K A;  2D4O A;  2GE3 A;  4JXQ A;  5KTC A;  4U9Z A;  4XPK A;  3F0A A;  3SXN A;  1Q2D A;  4QB9 A;  4CAX A;  4FD4 A;  4CRY B;  1Y9W A;  3G8W A;  4H89 A;  5G1Z A;  2ZXV A;  4LUA A;  2WPW A;  2B5G B;  2CY2 A;  4AG9 A;  1KUX A;  5AG7 A;  1S7N A;  4KVO E;  4A33 A;  4CYO A;  4AG7 A;  4F0X A;  5EC4 A;  4MFP A;  4Q38 A;  2Q7B A;  1RO5 A;  4ONU A;  2J8R A;  4I49 A;  4K30 A;  3IGR A;  4KOY A;  3EY5 A;  3SHP A;  2Q4V A;  1YX0 A;  4L89 A;  4C2Y A;  4Y49 B;  2AE6 A;  3TT2 A;  4FD5 A;  2ZW7 A;  4MJ8 A;  4YRH A;  2HUZ A;  3H5Z A;  5H86 A;  5J8C A;  4NEX A;  2GIV A;  5HH1 A;  1TIQ A;  4KOR A;  3FIX A;  1J4J A;  3JTK A;  4UCM A;  4MFL A;  4B5P A;  4C7I A;  1MJB A;  2B4D B;  4JWP A;  4HNY B;  4QVT A;  5G22 A;  4C2X A;  2VI7 A;  2FE7 A;  4A95 A;  3BLN A;  4CGM A;  2QIR A;  4CAW A;  2OU2 A;  1KUV A;  3R9G A;  3TOB A;  2JDC A;  4KOX A;  1KUY A;  2JLM A;  5F49 A;  3V8I A;  2H5M A;  2OZU A;  3R9F A;  4KVM E;  2Z11 A;  3EFA A;  4OLL A;  3T9Y A;  2R1I A;  2VQY A;  2Q44 A;  4PK3 A;  4R3K A;  3K9U A;  5FVJ A;  4KVX A;  4AVC A;  3S6K A;  3D2P A;  2B58 A;  1OZP A;  3GYA A;  4R3L A;  4QBJ A;  2ZW4 A;  4UWJ A;  4KOU A;  2WUU A;  4L8A A;  2ZW6 A;  1IID A;  2B3U A;  2FCK A;  3BJ7 A;  4PSX A;  3CXS A;  5J8F A;  2R7H A;  1L0C A;  2DPS A;  1I1D A;  5A28 A;  2BL1 A;  4OAE A;  3W6S A;  4CAE A;  4HKF A;  3P2F A;  4IUS A;  3R1K A;  3GY9 A;  2KCW A;  3QB8 A;  4A30 A;  4OAD A;  3S6G A;  2WPX A;  2EUI A;  2C27 A;  5A27 A;  2A4N A;  2I79 A;  5IB0 A;  5H84 A;  3D8P A;  3S6F A;  1VHS A;  2HV2 A;  4CYP A;  2Q0Y A;  3W6X A;  1CM0 A;  4QUS A;  1Y7R A;  4CS0 B;  1QSN A;  4B10 A;  3TO9 A;  2ZPA A;  5G20 A;  4B12 A;  1SQH A;  1R57 A;  4UA3 A;  4A2Z A;  4MBU A;  3CXQ A;  4R9M A;  4KSF A;  2Z3M A;  5AG6 A;  2EVN A;  4RS2 A;  2K5T A;  4KOV A;  4M3S A;  4NF1 A;  3ZZI A;  5KTD A;  5F46 A;  3MGD A;  2P6F A;  3EO4 A;  2B4D A;  2Z3O A;  1WK4 A;  1S7F A;  4E0A A;  3N7Z A;  4C7H A;  3UY5 A;  1ON0 A;  3R9E A;  1UFH A;  3ZJ0 A;  4BBH A;  2FS5 A;  2YNC A;  2Z10 A;  3FYN A;  4JLY A;  3W91 A;  1YVO A;  2YNE A;  1P4N A;  4Q36 A;  2B3V A;  3R96 A;  2FIW A;  1QSR A;  2QML A;  3JVN A;  4B11 A;  2O28 A;  3T90 A;  5AG5 A;  2CNT A;  4B5O A;  3DNS A;  1MJ9 A;  4CGO A;  3DSB A;  1CJW A;  3BJ8 A;  4KUA A;  5DWN A;  4CGN A;  5C88 A;  1Q2C A;  2PQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...