5KTAA

Apo fdhc- a nucleotide-linked sugar gnat
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
178
structure length
176
Chain Sequence
VNFNLKANTTYLRLVEENDAEFITLRNNDKLNTYISKSTGDIKSQAEWIRNYKNRENNGEEYYFIIFRSDDQSPIGTVRLYDFHENPKSFWGSWILNEHKTKYAAVESALLVYEAGFSTLGFEQSHFEVMKGNDKVHSFHLKMGAQKISEDDENIYYIFPKSKYKENKIQYARFLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FdhC
publication title Structural and Functional Investigation of FdhC from Acinetobacter nosocomialis: A Sugar N-Acyltransferase Belonging to the GNAT Superfamily.
pubmed doi rcsb
source organism Acinetobacter nosocomialis
molecule tags Transferase
total genus 55
structure length 176
sequence length 178
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ktaA00
2FE7A 4MY0A 3R9FA 3TOBA 4RS2A 1K4JA 3FXTA 4KOWA 4JLYA 1MJBA 4OAEA 2BSWA 4FD4A 5ISVA 1KUXA 3R1KA 1B6BA 4KOTA 2CNTA 3MGDA 3TTHA 4L8AA 3TO7A 4YFJA 4MBUA 4ORFA 2PRBA 3H4QA 5JPHA 1QSRA 3CXSA 2Z11A 3FRMA 4UWJA 4F0YA 1PUAA 3K9UA 2HUZA 2Z0ZA 3FIXA 3P2FA 4AVAA 4XPDC 4KUAA 2X7BA 1N71A 1S60A 1IICA 1YK3A 4FD7A 4HNYB 2EVNA 1M4DA 4PSXA 4RI1A 3F8KA 4H6ZA 2Y0MA 2BUEA 4NF1A 4HNXB 1MJ9A 2Q4YA 3N7ZA 4XPDB 4KVXA 4NEXA 3JVNA 1I21A 3G3SA 4KUBA 4X5KA 3EC4A 1Y9KA 2FL4A 3E0KA 5EBVA 3EY5A 5KTAA 2AE6A 3D2PA 3PZJA 4PSWA 3OWCA 3DDDA 3FYNA 1J4JA 2ZPAA 5JQ4A 2IL4A 4KOSA 1IIDA 1GHEA 1YX0A 4E8OA 2P6GA 4B5PB 2K5TA 4HNWB 5CNPA 1XMTA 3QAHA 2B5GA 4MY3A 4U9YA 2FIWA 5KTDA 1VKCA 2VI7A 3S6GA 1M1DA 4XPKA 4J3GA 1WK4A 3R9GA 2WPWA 4MJ8A 5IX3A 2ZW6A 3T9YA 1Z4RA 3S6KA 3TE4A 5J8FA 2F5IA 4AVBA 4R3LA 3C26A 5H86A 2R8VA 1S7FA 4UA3A 2OH1A 4EVYA 5H84A 2NMTA 1KUVA 3IWGA 4U5YA 1R57A 5GCNA 1S5KA 4JD6A 1QSTA 2VXKA 2Q4VA 4GS4A 3ZJ0A 4KORA 1L0CA 2R7HA 2J8NA 4B5OA 4NCZA 2VQYA 3CXQA 4H6UA 4II9A 4R57A 2BEIA 2HV2A 2PC1A 1KUYA 2D4PA 1YREA 4I49A 3TO9A 3LD2A 1Q2CA 2RC4A 2Q44A 4LX9A 3T90A 1YLEA 2ZXVA 4K30A 4JXRA 5C88A 1I12A 3VWDA 1S7NA 1NE9A 5E96A 3FBUA 4U9ZA 2GE3A 5C82A 2GANA 5EC4A 1FY7A 3ZZIA 2A4NA 4AB7A 4KLWA 2ARHA 2JDDA 2Q04A 1CJWA 4XPLA 1IB1E 3V8IA 4JWPA 4KOXA 4LUAA 2R98A 2B3VA 3DR8A 4FD6A 4PV6A 3D8PA 1I1DA 1NMTA 1V0CA 3DNSA 1QSNA 2R1IA 1NSLA 5HH1A 1YR0A 4QB9A 2B5GB 2I00A 2FS5A 2JLMA 2G0BA 1YGHA 5F47A 2FIAA 4CAVA 4R9MA 4YGOA 4JJXA 3R95A 3GKRA 1WWZA 1XF8A 2ZW5A 3R96A 2B4DA 3S6FA 1Z9UA 4XNHC 1YVKA 4UWIA 2PDOA 2CNMA 5DWNA 2FT0A 2ATRA 4YRHA 2PQ8A 1BO4A 2EUIA 2G3TA 2OZHA 3D2MA 1YVOA 4R3KA 3NE7A 1U6MA 2HQYA 4QVTA 1S7LA 1XIXA 2OZUA 1RXTA 4R87A 1CM0A 4KVME 2O28A 1IYLA 4KVOE 4QBJA 2REFA 4PK2A 1S7KA 3SXNA 4XNHB 4E0AA 3JUWA 1MJAA 3G8WA 2OU2A 3D3SA 1PU9A 5KTCA 1Y7RA 1QSOA 2REEA 3S6HA 2OZGA 5FVJA 5DWMA 2OB0A 3KKWA 3WR7A 2ZW4A 4QUSA 1XEBA 3EO4A 2FXFA 2CY2A 2J8MA 2ZW7A 3DR6A 4QC6A 4JXQA 4M85A 2FSRA 2B58A 4CS0B 2B4BA 3PGPA 2VZYA 5IB0A 4ZBGA 3W6XA 4CRYB 1Y9WA 2PSWA 2PR8A 4IUSA 4AG9A 3TCVA 4KOYA 2P0WA 2AJ6A 3BLNA 3IGRA 2JDCA 1P4NA 1M4GA 5I0CA 4KZTA 3I3GA 4OADA 2VBQA 3PP9A 1M4IA 5IV0A 5F49A 2QIRA 3EFAA 2Q0YA 4H89A 1LRZA 3F5BA 1RO5A 3GY9A 2I79A 2VZZA 3LODA 1TIQA 3SXOA 4BMHA 1Q2YA 4MI4A 4NXYA 4CAWA 2C27A 2H5MA 4UBRA 1VHSA 3QB8A 2QECA 3TT2A 1OZPA 2KCWA 1UFHA 5F46A 3VWEA 3I9SA 2P6FA 2B3UA 2B4DB 4L89A 5F48A 4AG7A 3EXNA 3BJ7A 1M44A 1QSMA 3FNCA 3W6SA 2CNSA 2GIVA 4OLLA 4NSQA 3R9EA 1P0HA 4M3SA 2DXQA 4HKFA 2BL1A 4AVCA 2D4OA 1ON0A 1SQHA 2G3AA 2QMLA 2Q7BA 1IYKA 4F6AA 3BJ8A 3GYAA 3UY5A 3RYOA 4FD5A 2VEZA 4KLVA 1Z4EA 3CXPA 1S3ZA 2WPXA 2FCKA 4Y49C 4CRZB 5HMNA 1Q2DA 5J8CA 1MK4A 4KOUA 4B5PA 4CAXA 1B87A 3P2HA 4IF5A 2J8RA 3W91A 2Z10A 3TFYA 3TOAA 4Y49B 1KZFA 4E2AA 4MHDA 1XE4A 2P6EA 3FB3A 3TO6A 2JEVA 4KOVA 1BOBA 4ONUA 4PK3A 3F0AA 3SHPA 3B8GA 3DSBA 2PR1A 4DNCA
chains in the Genus database with same CATH superfamily
2FE7A 4NGNA 4MY0A 3KI9A 3R9FA 4GM5A 4A30A 3TOBA 2VL1A 4F9UA 4RS2A 5LRKA 4X3RA 1K4JA 3FXTA 4KOWA 1IOIA 5A27A 4JLYA 1CX8A 1MJBA 2BSWA 2G9DA 2V8HA 4FD4A 4OAEA 1KUXA 3R1KA 5LYLA 5ISVA 1B6BA 2PJ5A 3PB9X 2IJZA 4OC4A 4MCQA 4KOTA 5DS0A 2CNTA 3MGDA 3TTHA 4L8AA 4P4EA 3TO7A 4BBHA 4IK2A 4YFJA 4MBUA 4H2KA 3D66A 3N5FA 4ORFA 4X8IA 1Z2LA 2PRBA 2Q43A 3H4QA 5JPHA 1JWQA 1QSRA 3CXSA 2Z11A 3FRMA 4UWJA 4F0YA 1PUAA 3K9UA 4RN7A 2HUZA 2Z0ZA 3FIXA 3P2FA 4IHMA 4Q36A 4AVAA 4XPDC 2IMOA 4KUAA 1XJOA 2X7BA 1N71A 1S60A 2AFSA 2PJ1A 4UFXA 4MHPA 1IICA 3FJUA 1YK3A 3SJFA 5AG7A 4PXBA 4FD7A 3K9TA 3B3VA 4HNYB 5LYIA 2EVNA 1DTDA 1M4DA 4OC1A 4PSXA 4W9YA 4RI1A 2ZEFA 3F8KA 4H6ZA 4KSFA 5LYFA 4BINA 4ZX9A 2Y0MA 2BUEA 3NA6A 5HXDA 4NF1A 4WJBA 1Q7LA 4HNXB 4MFZA 4JZ0A 2WSAA 1MJ9A 4NJQA 2Q4YA 3N7ZA 4R7MA 4KVXA 4XPDB 4CGMA 5EMIA 5BWAB 4NEXA 4B6ZA 2ZOGA 3JVNA 2ABZA 1I21A 3G3SA 2BOAA 1ZG8A 5IB9A 4YWYA 1IOFA 4KUBA 4X5KA 3KR5A 3B35A 3TX8A 3EC4A 1Y9KA 2FL4A 4LQ6A 3E0KA 3KHXA 4B12A 2AFXA 1YLOA 3H5ZA 5EBVA 1GYTA 1LOKA 1YSJA 4OIDA 3EY5A 3RBUA 2GLFA 2PVWA 3QNVA 1ELLP 5AG6A 5KTAA 2AE6A 3D2PA 2DF5A 4B13A 3PZJA 4PSWA 2CTCA 3CPXA 3OWCA 3DDDA 3KQZA 5K8MA 3FYNA 4NGPA 1J4JA 1TKHA 3CT9A 2ZPAA 1CPSA 5JQ4A 2HB6A 2IL4A 4KOSA 1IIDA 1GHEA 3NH8A 1YX0A 4E8OA 4A39A 5K8PA 3TC8A 3GB0A 4P4FA 4MCRA 3SJGA 4DJLA 1CG2A 2YGWA 2P6GA 5K8OA 5F09A 5G22A 4B5PB 2K5TA 4HNWB 2GREA 4PPZA 5CNPA 4A33A 1XMTA 1LFWA 2JEWA 2PIYA 3QAHA 1CBXA 1CP7A 2B5GA 4MY3A 4U9YA 2FIWA 5KTDA 3LMSA 3D67A 1VKCA 4CYNA 2VI7A 3S6GA 1M1DA 4XPKA 4J3GA 1WK4A 3R9GA 2WPWA 3IJ3A 7CPAA 4JYWA 4MJ8A 4LQGA 2ZW6A 5I4MA 5IX3A 2V8VA 3T9YA 1Z4RA 3S6KA 1YQEA 3TE4A 5J8FA 2F5IA 4UCNA 4AVBA 1XFOA 3KQXA 2ZEPA 3C26A 4R3LA 5H86A 2HC9A 3PB8X 2RB7A 3D68A 2R8VA 1S7FA 3HLPA 4UIAA 4UA3A 2OH1A 4EVYA 5H84A 2NMTA 4NGSA 1BPNA 1H8LA 4KS9A 1KUVA 1AUGA 3IWGA 4U5YA 1R57A 4NGTA 3WT4A 4F8ZA 5GCNA 1VIXA 3LWUA 5THWA 1S5KA 1HDUA 1PCAA 4JD6A 1QSTA 3WC7A 1XBUA 2JBJA 2VXKA 2ZEHA 1X10A 1QMUA 1HDQA 1TKJA 2C6GA 4K3NA 3IWWA 2I3CA 3FX6A 2Q4VA 4GS4A 3B2YA 3ZJ0A 4KORA 4MXUA 3IC1A 4MCPA 2EWBA 3IU1A 1L0CA 2R7HA 2J8NA 3H8GA 4B5OA 4NCZA 2PJ9A 2Z3NA 5G20A 2VQYA 2V8GA 3CXQA 3NH5A 4P10A 4CAEA 1TKFA 3NFZA 4H6UA 4M6HA 1LCPA 2C6CA 4II9A 4R57A 4CYOA 4ZY1A 3H8EA 2BEIA 2HV2A 5CPAA 2PC1A 4CPAA 1KUYA 2D4PA 2BO9A 1YREA 2C1CA 4I49A 4P44A 4UEFA 2XEGA 3VH9A 2QYVA 4C7IA 4MMOA 1RTQA 3TO9A 3LD2A 1Q2CA 2RC4A 3DGVA 2Q44A 4LX9A 3KR4A 3T90A 1VHOA 2CIJA 8CPAA 3GUXA 3T8WA 3FH4A 4EFDA 2GLJA 1YLEA 4TWEA 2ZXVA 4K30A 4YU9A 2PJBA 4JXRA 5C88A 1QQ9A 1I12A 3VWDA 4C2XA 1S7NA 2Z3OA 3NH4A 2GFQA 3B3SA 1NE9A 5E96A 3FBUA 3SJXA 4ZYQA 4O23A 3IEHA 4U9ZA 5AG5A 2GE3A 1EE3P 5C82A 2GANA 5EC4A 3DLJA 4UFWA 1FY7A 1IU8A 2EK8A 3ZZIA 2A4NA 1Z8WA 4AB7A 4GXHA 5D8NA 4KLWA 4P6YA 2ARHA 2JDDA 2Q04A 3B3TA 1CJWA 3BHXA 4P4IA 4XPLA 4CYQA 4CGOA 1IB1E 4PXDA 3V8IA 4JWPA 4KOXA 1Z5RA 4B14A 4DYOA 2Z3LA 4LUAA 2R98A 2B3VA 3D4UA 3DR8A 4OC0A 4A31A 4FD6A 3D7FA 4MFJA 4PV6A 2ANPA 5HVGA 3VATA 3D8PA 1I1DA 2ZENA 3FVLA 1VGYA 1LANA 2AFWA 1NMTA 3BI1A 1R3NA 5JGFA 3CPAA 2XEIA 2J9AA 2ZEDA 4UF4A 3WC5A 4F9VA 1V0CA 4DUKA 4C2YA 5AG4A 3DNSA 1QSNA 2R1IA 1NSLA 2PVVA 2V77A 5HH1A 4NFRA 4P4DA 3RAMA 1YR0A 3B7IA 4QB9A 1BAVA 2B5GB 2I00A 2FS5A 2JLMA 2ZEOA 3SI0A 2G0BA 1HEEA 1YGHA 4ZX8A 3HUVA 1CPXA 5F47A 2XEFA 2FIAA 2WYRA 2DPSA 1F57A 2Q4ZA 4CAVA 1Z8XA 4R9MA 2Q7SA 3MRUA 4YGOA 4MHZA 1LAMA 2IQ6A 4JJXA 3R95A 3GKRA 1WWZA 4ZI6A 2Z3MA 1FT7A 1YW4A 5JM6A 1JQGA 1XF8A 2PJ7A 2ZW5A 4R6TA 3R96A 3RZAA 1TF9A 2B4DA 2AFZA 4WWVA 3S6FA 1Z9UA 4UEZA 1FNOA 4XNHC 3JRUA 1YVKA 4UWIA 5ELYA 4EMEA 3FECA 4A32A 2PDOA 2CNMA 5LYDA 3A9LA 3IWEA 2QJ8A 5DWNA 4CGPA 3PBBA 2GU2A 2FT0A 2ATRA 4YRHA 5D29A 2PQ8A 3B3WA 1BO4A 2EUIA 2G3TA 2OZHA 4FUUA 1IY7A 3D2MA 5HVFA 1YVOA 3IIBA 1A2ZA 4RUHA 3FEEA 4MFLA 3NE7A 4R3KA 1U6MA 2HQYA 1M4LA 4QVTA 1S7LA 1XIXA 2ZEGA 2OZUA 1RXTA 4NGMA 4R87A 1CM0A 1KWMA 4KVME 3PFOA 1YMEA 1IYLA 2O28A 4KVOE 4QBJA 2REFA 4PK2A 1S7KA 3SXNA 4XNHB 4C7HA 1DE4C 4E0AA 4OC3A 4P4BA 2ZEEA 1ARLA 1MJAA 3G8WA 3JUWA 2OU2A 3D3SA 1F2OA 4NGRA 4A37A 1PU9A 5KTCA 1Y7RA 4F0XA 1QSOA 2PJ3A 5CBMA 4C68A 3S9LA 4KSAA 2REEA 1AYEA 3S6HA 2OZGA 3FEDA 2PJ8A 2AFMA 3H8FA 1XOVA 2JBKA 5FVJA 5DWMA 1UWYA 1Y7EA 2OB0A 2OR4A 2QVPA 4KSIA 3KKWA 2V8DA 3WR7A 2ZW4A 4A95A 4QUSA 1XEBA 3EO4A 5J1QA 4FBEA 2FXFA 2POKA 2ZOFA 3QAYA 2DEAA 2CY2A 2J8MA 2ZW7A 3DR6A 4QC6A 4JXQA 4M6IA 4M85A 1LAPA 2FSRA 1X12A 1VHEA 2B58A 4CS0B 3PB7X 2B4BA 1NSAA 2PJ2A 4PXCA 3PGPA 2PJ0A 4B10A 2VZYA 5IB0A 4ZBGA 2Z3KA 1ZG7A 3W6XA 2WZNA 2CTBA 4CRYB 1Y9WA 2PSWA 4FWUA 4TNUA 2PR8A 1ZLIA 4MFQA 3V7ZA 4IUSA 4AG9A 2ZEMA 3TCVA 4MHNA 4KOYA 4FAIA 2P0WA 3SI1A 3ISZA 4UFVA 3KL9A 2AJ6A 3BLNA 4OC2A 3IGRA 2JDCA 3B3CA 1P4NA 4OIWA 1M4GA 4Q38A 3SJEA 2YNCA 5I0CA 4NJRA 4KZTA 3I3GA 3WABA 4PXEA 4OADA 2VBQA 3PP9A 1M4IA 1AMPA 3VARA 5F49A 5IV0A 1Y0RA 2CXAA 2QIRA 2CF4A 1R43A 3IU2A 4ZY2A 3EFAA 3JTKA 3LACA 2Q0YA 4OC5A 4H89A 4P45A 4CYPA 1LRZA 3RNZA 3F5BA 3GIUA 5HVHA 2AFOA 1RO5A 1ZLHA 3GY9A 4ONWA 2YNEA 2I79A 2VZZA 3SI2A 3LODA 1YW6A 4C2ZA 1TIQA 2PCUA 4UCMA 3SXOA 4BMHA 2NYQA 1Q2YA 2ZELA 4MI4A 4NXYA 2C27A 2H5MA 4UBRA 1VHSA 2ODFA 5G21A 4CAWA 2PJAA 3QB8A 2QECA 2EBJA 5A28A 3IFEA 1OZPA 3TT2A 2KCWA 1UFHA 2PJ6A 2DPTA 3VWEA 4X2TA 4CGLA 5F46A 3D7DA 2PJCA 4MRIA 2PIZA 3I9SA 2P6FA 1ARMA 2B3UA 2B4DB 4L89A 2OOTA 3FMCA 5F48A 4AG7A 3EXNA 3BJ7A 1M44A 1QSMA 1ZO0A 1Z8LA 3FNCA 4M6GA 2CNSA 2F7VA 3W6SA 4A2ZA 3K2KA 2PE3A 4ZY0A 2GIVA 3V38A 3NE8A 4OLLA 3CDXA 4R8FA 3PRTA 4MFKA 2FVGA 4OP4A 2Q51A 1ZG9A 3PEIA 4HPSA 4NSQA 4UCPA 3R9EA 2DXQA 1P0HA 4HKFA 4M3SA 4MCSA 2PJ4A 1XRYA 2BL1A 4AVCA 2D4OA 1ON0A 1SQHA 4CGNA 2BCOA 3D7HA 2WUUA 3PFEA 2G3AA 4R76A 2QMLA 5LRJA 1PYTB 5G1ZA 4A94A 3S9NA 5K8NA 2Q7BA 4BD9A 1IYKA 2O53A 3PBEA 3I1UA 4F6AA 3BJ8A 3GYAA 1F2PA 3FF3A 4OKOA 3UY5A 3S9MA 2EO8A 3L2NA 3PB4X 4ZGYB 2XEJA 3CZXA 3RYOA 4EWTA 4FD5A 3RO0A 2VEZA 4OMEA 4KLVA 3IO1A 4PQAA 1Z4EA 3CXPA 1S3ZA 2YNDA 2WPXA 3BXMA 5AGEA 2FCKA 4Y49C 4CRZB 5HMNA 4E2AA 4P4JA 3KGQA 1Q2DA 4A38A 1BLLE 4UEEA 5JH9A 5J8CA 1IGBA 3MN8A 1MK4A 4KOUA 2Z3PA 4G1PA 4IAVA 1ELMP 2YNCC 4B5PA 3D7GA 5LRGA 4CAXA 1OBRA 4UIBA 4CAFA 1B87A 3P2HA 2EK9A 1TF8A 1XMBA 4IF5A 2J8RA 3WC6A 3KASA 3W91A 3GLJA 6CPAA 1Y0YA 3ISXA 4MHYA 2PRQA 2Z10A 3TFYA 3TOAA 4Y49B 1KZFA 3KZWA 4AXVA 1Z8TA 2AFUA 3BI0A 1CP6A 2NSMA 1XE4A 2RFHA 4MHDA 2P6EA 2C6PA 3FB3A 2JEVA 3TO6A 4KOVA 4NGQA 4Z65A 1BOBA 2O4HA 3PB6X 4ONUA 4PK3A 3F0AA 3SHPA 1TXRA 4MFPA 4B11A 3B8GA 3DSBA 3KHZA 1BPMA 4Q7AA 2PR1A 4DNCA 2F8HA
chains in the Genus database with same CATH topology
2FE7A 4MY0A 3R9FA 4A30A 3TOBA 4RS2A 1K4JA 3FXTA 4KOWA 5A27A 4JLYA 1MJBA 4OAEA 2BSWA 4FD4A 5ISVA 1KUXA 3R1KA 1B6BA 4KOTA 2CNTA 3MGDA 3TTHA 4L8AA 3TO7A 4BBHA 4YFJA 4MBUA 4ORFA 2PRBA 3H4QA 5JPHA 1QSRA 3CXSA 2Z11A 3FRMA 4UWJA 4F0YA 1PUAA 3K9UA 2HUZA 2Z0ZA 3FIXA 3P2FA 4Q36A 4AVAA 4XPDC 4KUAA 2X7BA 1N71A 1S60A 4UFXA 1IICA 1YK3A 5AG7A 4FD7A 4HNYB 2EVNA 1M4DA 4PSXA 4RI1A 3F8KA 4H6ZA 4KSFA 2Y0MA 2BUEA 4NF1A 4HNXB 4MFZA 2WSAA 1MJ9A 2Q4YA 3N7ZA 4XPDB 4KVXA 4CGMA 5BWAB 4NEXA 3JVNA 1I21A 3G3SA 4KUBA 4X5KA 3EC4A 1Y9KA 2FL4A 4B12A 3E0KA 3H5ZA 5EBVA 3EY5A 5AG6A 5KTAA 2AE6A 3D2PA 4B13A 3PZJA 4PSWA 3OWCA 3DDDA 3FYNA 1J4JA 2ZPAA 5JQ4A 2IL4A 4KOSA 1IIDA 1GHEA 1YX0A 4E8OA 2YGWA 2P6GA 5G22A 4B5PB 2K5TA 4HNWB 5CNPA 4A33A 1XMTA 3QAHA 2B5GA 4MY3A 4U9YA 2FIWA 5KTDA 1VKCA 4CYNA 2VI7A 3S6GA 1M1DA 4XPKA 4J3GA 1WK4A 3R9GA 2WPWA 4MJ8A 5IX3A 2ZW6A 3T9YA 1Z4RA 3S6KA 3TE4A 5J8FA 2F5IA 4UCNA 4AVBA 4R3LA 3C26A 5H86A 2R8VA 1S7FA 4UA3A 2OH1A 4EVYA 5H84A 2NMTA 4KS9A 1KUVA 3IWGA 4U5YA 1R57A 5GCNA 1S5KA 4JD6A 1QSTA 2VXKA 2Q4VA 4GS4A 3ZJ0A 4KORA 3IU1A 1L0CA 2R7HA 2J8NA 4B5OA 4NCZA 2Z3NA 5G20A 2VQYA 3CXQA 4CAEA 4H6UA 4II9A 4R57A 4CYOA 2BEIA 2HV2A 2PC1A 1KUYA 2D4PA 1YREA 4I49A 4C7IA 3TO9A 3LD2A 1Q2CA 2RC4A 2Q44A 4LX9A 3T90A 1YLEA 2ZXVA 4K30A 4JXRA 5C88A 4C2XA 1I12A 3VWDA 1S7NA 2Z3OA 1NE9A 5E96A 3FBUA 5AG5A 4U9ZA 2GE3A 5C82A 2GANA 5EC4A 4UFWA 1FY7A 3ZZIA 2A4NA 4AB7A 4KLWA 2ARHA 2JDDA 2Q04A 1CJWA 4XPLA 4CYQA 4CGOA 1IB1E 3V8IA 4JWPA 4KOXA 4B14A 2Z3LA 4LUAA 2R98A 2B3VA 3DR8A 4A31A 4FD6A 4MFJA 4PV6A 3D8PA 1I1DA 1NMTA 1V0CA 4C2YA 5AG4A 3DNSA 1QSNA 2R1IA 1NSLA 5HH1A 1YR0A 4QB9A 2B5GB 2I00A 2FS5A 2JLMA 2G0BA 1YGHA 5F47A 2FIAA 2DPSA 4CAVA 4R9MA 4YGOA 4JJXA 3R95A 3GKRA 1WWZA 2Z3MA 1XF8A 2ZW5A 3R96A 2B4DA 3S6FA 1Z9UA 4XNHC 1YVKA 4UWIA 4A32A 2PDOA 2CNMA 3A9LA 3IWEA 5DWNA 4CGPA 2FT0A 2ATRA 4YRHA 2PQ8A 1BO4A 2EUIA 2G3TA 2OZHA 3D2MA 1YVOA 4MFLA 3NE7A 4R3KA 1U6MA 2HQYA 4QVTA 1S7LA 1XIXA 2OZUA 1RXTA 4R87A 1CM0A 4KVME 2O28A 1IYLA 4KVOE 4QBJA 2REFA 4PK2A 1S7KA 3SXNA 4XNHB 4C7HA 4E0AA 3JUWA 1MJAA 3G8WA 2OU2A 3D3SA 1PU9A 5KTCA 1Y7RA 4F0XA 1QSOA 4C68A 4KSAA 2REEA 3S6HA 2OZGA 5FVJA 5DWMA 2OB0A 3KKWA 3WR7A 2ZW4A 4A95A 4QUSA 1XEBA 3EO4A 2FXFA 2CY2A 2J8MA 2ZW7A 3DR6A 4QC6A 4JXQA 4M85A 2FSRA 2B58A 4CS0B 2B4BA 3PGPA 4B10A 2VZYA 5IB0A 4ZBGA 2Z3KA 3W6XA 4CRYB 1Y9WA 2PSWA 2PR8A 4MFQA 4IUSA 4AG9A 3TCVA 4KOYA 2P0WA 4UFVA 2AJ6A 3BLNA 3IGRA 2JDCA 1P4NA 1M4GA 4Q38A 5I0CA 2YNCA 4KZTA 3I3GA 4OADA 2VBQA 3PP9A 1M4IA 5IV0A 5F49A 2QIRA 2CXAA 3IU2A 3EFAA 3JTKA 2Q0YA 4H89A 4CYPA 1LRZA 3F5BA 1RO5A 3GY9A 2YNEA 2I79A 2VZZA 4C2ZA 3LODA 1TIQA 4UCMA 3SXOA 4BMHA 1Q2YA 4MI4A 4NXYA 4CAWA 2C27A 2H5MA 4UBRA 1VHSA 5G21A 3QB8A 2QECA 5A28A 3TT2A 1OZPA 4CGLA 2KCWA 1UFHA 5F46A 2DPTA 3VWEA 3I9SA 2P6FA 2B3UA 2B4DB 4L89A 5F48A 4AG7A 3EXNA 3BJ7A 1M44A 1QSMA 1ZO0A 3FNCA 3W6SA 4A2ZA 2CNSA 2GIVA 4OLLA 4MFKA 4NSQA 4UCPA 3R9EA 1P0HA 2DXQA 4HKFA 4M3SA 2BL1A 4AVCA 2D4OA 1ON0A 1SQHA 4CGNA 2WUUA 2G3AA 2QMLA 5G1ZA 2Q7BA 1IYKA 4F6AA 3BJ8A 3GYAA 3UY5A 4ZGYB 3RYOA 4FD5A 2VEZA 4KLVA 1Z4EA 3CXPA 1S3ZA 2YNDA 2WPXA 5AGEA 2FCKA 4Y49C 4CRZB 5HMNA 1Q2DA 5J8CA 1MK4A 4KOUA 2Z3PA 2YNCC 4B5PA 4CAXA 4CAFA 1B87A 3P2HA 4IF5A 2J8RA 3W91A 2Z10A 3TFYA 3TOAA 4Y49B 1KZFA 4E2AA 4MHDA 1XE4A 2P6EA 3FB3A 3TO6A 2JEVA 4KOVA 1BOBA 4ONUA 4PK3A 3F0AA 3SHPA 4B11A 4MFPA 3B8GA 3DSBA 2PR1A 4DNCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FE7 A;  4MY0 A;  3R9F A;  3TOB A;  4RS2 A;  1K4J A;  3FXT A;  4KOW A;  4JLY A;  1MJB A;  4OAE A;  2BSW A;  4FD4 A;  5ISV A;  1KUX A;  3R1K A;  1B6B A;  4KOT A;  2CNT A;  3MGD A;  3TTH A;  4L8A A;  3TO7 A;  4YFJ A;  4MBU A;  4ORF A;  2PRB A;  3H4Q A;  5JPH A;  1QSR A;  3CXS A;  2Z11 A;  3FRM A;  4UWJ A;  4F0Y A;  1PUA A;  3K9U A;  2HUZ A;  2Z0Z A;  3FIX A;  3P2F A;  4AVA A;  4XPD C;  4KUA A;  2X7B A;  1N71 A;  1S60 A;  1IIC A;  1YK3 A;  4FD7 A;  4HNY B;  2EVN A;  1M4D A;  4PSX A;  4RI1 A;  3F8K A;  4H6Z A;  2Y0M A;  2BUE A;  4NF1 A;  4HNX B;  1MJ9 A;  2Q4Y A;  3N7Z A;  4XPD B;  4KVX A;  4NEX A;  3JVN A;  1I21 A;  3G3S A;  4KUB A;  4X5K A;  3EC4 A;  1Y9K A;  2FL4 A;  3E0K A;  5EBV A;  3EY5 A;  5KTA A;  2AE6 A;  3D2P A;  3PZJ A;  4PSW A;  3OWC A;  3DDD A;  3FYN A;  1J4J A;  2ZPA A;  5JQ4 A;  2IL4 A;  4KOS A;  1IID A;  1GHE A;  1YX0 A;  4E8O A;  2P6G A;  4B5P B;  2K5T A;  4HNW B;  5CNP A;  1XMT A;  3QAH A;  2B5G A;  4MY3 A;  4U9Y A;  2FIW A;  5KTD A;  1VKC A;  2VI7 A;  3S6G A;  1M1D A;  4XPK A;  4J3G A;  1WK4 A;  3R9G A;  2WPW A;  4MJ8 A;  5IX3 A;  2ZW6 A;  3T9Y A;  1Z4R A;  3S6K A;  3TE4 A;  5J8F A;  2F5I A;  4AVB A;  4R3L A;  3C26 A;  5H86 A;  2R8V A;  1S7F A;  4UA3 A;  2OH1 A;  4EVY A;  5H84 A;  2NMT A;  1KUV A;  3IWG A;  4U5Y A;  1R57 A;  5GCN A;  1S5K A;  4JD6 A;  1QST A;  2VXK A;  2Q4V A;  4GS4 A;  3ZJ0 A;  4KOR A;  1L0C A;  2R7H A;  2J8N A;  4B5O A;  4NCZ A;  2VQY A;  3CXQ A;  4H6U A;  4II9 A;  4R57 A;  2BEI A;  2HV2 A;  2PC1 A;  1KUY A;  2D4P A;  1YRE A;  4I49 A;  3TO9 A;  3LD2 A;  1Q2C A;  2RC4 A;  2Q44 A;  4LX9 A;  3T90 A;  1YLE A;  2ZXV A;  4K30 A;  4JXR A;  5C88 A;  1I12 A;  3VWD A;  1S7N A;  1NE9 A;  5E96 A;  3FBU A;  4U9Z A;  2GE3 A;  5C82 A;  2GAN A;  5EC4 A;  1FY7 A;  3ZZI A;  2A4N A;  4AB7 A;  4KLW A;  2ARH A;  2JDD A;  2Q04 A;  1CJW A;  4XPL A;  1IB1 E;  3V8I A;  4JWP A;  4KOX A;  4LUA A;  2R98 A;  2B3V A;  3DR8 A;  4FD6 A;  4PV6 A;  3D8P A;  1I1D A;  1NMT A;  1V0C A;  3DNS A;  1QSN A;  2R1I A;  1NSL A;  5HH1 A;  1YR0 A;  4QB9 A;  2B5G B;  2I00 A;  2FS5 A;  2JLM A;  2G0B A;  1YGH A;  5F47 A;  2FIA A;  4CAV A;  4R9M A;  4YGO A;  4JJX A;  3R95 A;  3GKR A;  1WWZ A;  1XF8 A;  2ZW5 A;  3R96 A;  2B4D A;  3S6F A;  1Z9U A;  4XNH C;  1YVK A;  4UWI A;  2PDO A;  2CNM A;  5DWN A;  2FT0 A;  2ATR A;  4YRH A;  2PQ8 A;  1BO4 A;  2EUI A;  2G3T A;  2OZH A;  3D2M A;  1YVO A;  4R3K A;  3NE7 A;  1U6M A;  2HQY A;  4QVT A;  1S7L A;  1XIX A;  2OZU A;  1RXT A;  4R87 A;  1CM0 A;  4KVM E;  2O28 A;  1IYL A;  4KVO E;  4QBJ A;  2REF A;  4PK2 A;  1S7K A;  3SXN A;  4XNH B;  4E0A A;  3JUW A;  1MJA A;  3G8W A;  2OU2 A;  3D3S A;  1PU9 A;  5KTC A;  1Y7R A;  1QSO A;  2REE A;  3S6H A;  2OZG A;  5FVJ A;  5DWM A;  2OB0 A;  3KKW A;  3WR7 A;  2ZW4 A;  4QUS A;  1XEB A;  3EO4 A;  2FXF A;  2CY2 A;  2J8M A;  2ZW7 A;  3DR6 A;  4QC6 A;  4JXQ A;  4M85 A;  2FSR A;  2B58 A;  4CS0 B;  2B4B A;  3PGP A;  2VZY A;  5IB0 A;  4ZBG A;  3W6X A;  4CRY B;  1Y9W A;  2PSW A;  2PR8 A;  4IUS A;  4AG9 A;  3TCV A;  4KOY A;  2P0W A;  2AJ6 A;  3BLN A;  3IGR A;  2JDC A;  1P4N A;  1M4G A;  5I0C A;  4KZT A;  3I3G A;  4OAD A;  2VBQ A;  3PP9 A;  1M4I A;  5IV0 A;  5F49 A;  2QIR A;  3EFA A;  2Q0Y A;  4H89 A;  1LRZ A;  3F5B A;  1RO5 A;  3GY9 A;  2I79 A;  2VZZ A;  3LOD A;  1TIQ A;  3SXO A;  4BMH A;  1Q2Y A;  4MI4 A;  4NXY A;  4CAW A;  2C27 A;  2H5M A;  4UBR A;  1VHS A;  3QB8 A;  2QEC A;  3TT2 A;  1OZP A;  2KCW A;  1UFH A;  5F46 A;  3VWE A;  3I9S A;  2P6F A;  2B3U A;  2B4D B;  4L89 A;  5F48 A;  4AG7 A;  3EXN A;  3BJ7 A;  1M44 A;  1QSM A;  3FNC A;  3W6S A;  2CNS A;  2GIV A;  4OLL A;  4NSQ A;  3R9E A;  1P0H A;  4M3S A;  2DXQ A;  4HKF A;  2BL1 A;  4AVC A;  2D4O A;  1ON0 A;  1SQH A;  2G3A A;  2QML A;  2Q7B A;  1IYK A;  4F6A A;  3BJ8 A;  3GYA A;  3UY5 A;  3RYO A;  4FD5 A;  2VEZ A;  4KLV A;  1Z4E A;  3CXP A;  1S3Z A;  2WPX A;  2FCK A;  4Y49 C;  4CRZ B;  5HMN A;  1Q2D A;  5J8C A;  1MK4 A;  4KOU A;  4B5P A;  4CAX A;  1B87 A;  3P2H A;  4IF5 A;  2J8R A;  3W91 A;  2Z10 A;  3TFY A;  3TOA A;  4Y49 B;  1KZF A;  4E2A A;  4MHD A;  1XE4 A;  2P6E A;  3FB3 A;  3TO6 A;  2JEV A;  4KOV A;  1BOB A;  4ONU A;  4PK3 A;  3F0A A;  3SHP A;  3B8G A;  3DSB A;  2PR1 A;  4DNC A; 
#chains in the Genus database with same CATH topology
 2FE7 A;  4NGN A;  4MY0 A;  3KI9 A;  3R9F A;  4GM5 A;  4A30 A;  3TOB A;  2VL1 A;  4F9U A;  4RS2 A;  5LRK A;  4X3R A;  1K4J A;  3FXT A;  4KOW A;  1IOI A;  5A27 A;  4JLY A;  1CX8 A;  1MJB A;  2BSW A;  2G9D A;  2V8H A;  4FD4 A;  4OAE A;  1KUX A;  3R1K A;  5LYL A;  5ISV A;  1B6B A;  2PJ5 A;  3PB9 X;  2IJZ A;  4OC4 A;  4MCQ A;  4KOT A;  5DS0 A;  2CNT A;  3MGD A;  3TTH A;  4L8A A;  4P4E A;  3TO7 A;  4BBH A;  4IK2 A;  4YFJ A;  4MBU A;  4H2K A;  3D66 A;  3N5F A;  4ORF A;  4X8I A;  1Z2L A;  2PRB A;  2Q43 A;  3H4Q A;  5JPH A;  1JWQ A;  1QSR A;  3CXS A;  2Z11 A;  3FRM A;  4UWJ A;  4F0Y A;  1PUA A;  3K9U A;  4RN7 A;  2HUZ A;  2Z0Z A;  3FIX A;  3P2F A;  4IHM A;  4Q36 A;  4AVA A;  4XPD C;  2IMO A;  4KUA A;  1XJO A;  2X7B A;  1N71 A;  1S60 A;  2AFS A;  2PJ1 A;  4UFX A;  4MHP A;  1IIC A;  3FJU A;  1YK3 A;  3SJF A;  5AG7 A;  4PXB A;  4FD7 A;  3K9T A;  3B3V A;  4HNY B;  5LYI A;  2EVN A;  1DTD A;  1M4D A;  4OC1 A;  4PSX A;  4W9Y A;  4RI1 A;  2ZEF A;  3F8K A;  4H6Z A;  4KSF A;  5LYF A;  4BIN A;  4ZX9 A;  2Y0M A;  2BUE A;  3NA6 A;  5HXD A;  4NF1 A;  4WJB A;  1Q7L A;  4HNX B;  4MFZ A;  4JZ0 A;  2WSA A;  1MJ9 A;  4NJQ A;  2Q4Y A;  3N7Z A;  4R7M A;  4KVX A;  4XPD B;  4CGM A;  5EMI A;  5BWA B;  4NEX A;  4B6Z A;  2ZOG A;  3JVN A;  2ABZ A;  1I21 A;  3G3S A;  2BOA A;  1ZG8 A;  5IB9 A;  4YWY A;  1IOF A;  4KUB A;  4X5K A;  3KR5 A;  3B35 A;  3TX8 A;  3EC4 A;  1Y9K A;  2FL4 A;  4LQ6 A;  3E0K A;  3KHX A;  4B12 A;  2AFX A;  1YLO A;  3H5Z A;  5EBV A;  1GYT A;  1LOK A;  1YSJ A;  4OID A;  3EY5 A;  3RBU A;  2GLF A;  2PVW A;  3QNV A;  1ELL P;  5AG6 A;  5KTA A;  2AE6 A;  3D2P A;  2DF5 A;  4B13 A;  3PZJ A;  4PSW A;  2CTC A;  3CPX A;  3OWC A;  3DDD A;  3KQZ A;  5K8M A;  3FYN A;  4NGP A;  1J4J A;  1TKH A;  3CT9 A;  2ZPA A;  1CPS A;  5JQ4 A;  2HB6 A;  2IL4 A;  4KOS A;  1IID A;  1GHE A;  3NH8 A;  1YX0 A;  4E8O A;  4A39 A;  5K8P A;  3TC8 A;  3GB0 A;  4P4F A;  4MCR A;  3SJG A;  4DJL A;  1CG2 A;  2YGW A;  2P6G A;  5K8O A;  5F09 A;  5G22 A;  4B5P B;  2K5T A;  4HNW B;  2GRE A;  4PPZ A;  5CNP A;  4A33 A;  1XMT A;  1LFW A;  2JEW A;  2PIY A;  3QAH A;  1CBX A;  1CP7 A;  2B5G A;  4MY3 A;  4U9Y A;  2FIW A;  5KTD A;  3LMS A;  3D67 A;  1VKC A;  4CYN A;  2VI7 A;  3S6G A;  1M1D A;  4XPK A;  4J3G A;  1WK4 A;  3R9G A;  2WPW A;  3IJ3 A;  7CPA A;  4JYW A;  4MJ8 A;  4LQG A;  2ZW6 A;  5I4M A;  5IX3 A;  2V8V A;  3T9Y A;  1Z4R A;  3S6K A;  1YQE A;  3TE4 A;  5J8F A;  2F5I A;  4UCN A;  4AVB A;  1XFO A;  3KQX A;  2ZEP A;  3C26 A;  4R3L A;  5H86 A;  2HC9 A;  3PB8 X;  2RB7 A;  3D68 A;  2R8V A;  1S7F A;  3HLP A;  4UIA A;  4UA3 A;  2OH1 A;  4EVY A;  5H84 A;  2NMT A;  4NGS A;  1BPN A;  1H8L A;  4KS9 A;  1KUV A;  1AUG A;  3IWG A;  4U5Y A;  1R57 A;  4NGT A;  3WT4 A;  4F8Z A;  5GCN A;  1VIX A;  3LWU A;  5THW A;  1S5K A;  1HDU A;  1PCA A;  4JD6 A;  1QST A;  3WC7 A;  1XBU A;  2JBJ A;  2VXK A;  2ZEH A;  1X10 A;  1QMU A;  1HDQ A;  1TKJ A;  2C6G A;  4K3N A;  3IWW A;  2I3C A;  3FX6 A;  2Q4V A;  4GS4 A;  3B2Y A;  3ZJ0 A;  4KOR A;  4MXU A;  3IC1 A;  4MCP A;  2EWB A;  3IU1 A;  1L0C A;  2R7H A;  2J8N A;  3H8G A;  4B5O A;  4NCZ A;  2PJ9 A;  2Z3N A;  5G20 A;  2VQY A;  2V8G A;  3CXQ A;  3NH5 A;  4P10 A;  4CAE A;  1TKF A;  3NFZ A;  4H6U A;  4M6H A;  1LCP A;  2C6C A;  4II9 A;  4R57 A;  4CYO A;  4ZY1 A;  3H8E A;  2BEI A;  2HV2 A;  5CPA A;  2PC1 A;  4CPA A;  1KUY A;  2D4P A;  2BO9 A;  1YRE A;  2C1C A;  4I49 A;  4P44 A;  4UEF A;  2XEG A;  3VH9 A;  2QYV A;  4C7I A;  4MMO A;  1RTQ A;  3TO9 A;  3LD2 A;  1Q2C A;  2RC4 A;  3DGV A;  2Q44 A;  4LX9 A;  3KR4 A;  3T90 A;  1VHO A;  2CIJ A;  8CPA A;  3GUX A;  3T8W A;  3FH4 A;  4EFD A;  2GLJ A;  1YLE A;  4TWE A;  2ZXV A;  4K30 A;  4YU9 A;  2PJB A;  4JXR A;  5C88 A;  1QQ9 A;  1I12 A;  3VWD A;  4C2X A;  1S7N A;  2Z3O A;  3NH4 A;  2GFQ A;  3B3S A;  1NE9 A;  5E96 A;  3FBU A;  3SJX A;  4ZYQ A;  4O23 A;  3IEH A;  4U9Z A;  5AG5 A;  2GE3 A;  1EE3 P;  5C82 A;  2GAN A;  5EC4 A;  3DLJ A;  4UFW A;  1FY7 A;  1IU8 A;  2EK8 A;  3ZZI A;  2A4N A;  1Z8W A;  4AB7 A;  4GXH A;  5D8N A;  4KLW A;  4P6Y A;  2ARH A;  2JDD A;  2Q04 A;  3B3T A;  1CJW A;  3BHX A;  4P4I A;  4XPL A;  4CYQ A;  4CGO A;  1IB1 E;  4PXD A;  3V8I A;  4JWP A;  4KOX A;  1Z5R A;  4B14 A;  4DYO A;  2Z3L A;  4LUA A;  2R98 A;  2B3V A;  3D4U A;  3DR8 A;  4OC0 A;  4A31 A;  4FD6 A;  3D7F A;  4MFJ A;  4PV6 A;  2ANP A;  5HVG A;  3VAT A;  3D8P A;  1I1D A;  2ZEN A;  3FVL A;  1VGY A;  1LAN A;  2AFW A;  1NMT A;  3BI1 A;  1R3N A;  5JGF A;  3CPA A;  2XEI A;  2J9A A;  2ZED A;  4UF4 A;  3WC5 A;  4F9V A;  1V0C A;  4DUK A;  4C2Y A;  5AG4 A;  3DNS A;  1QSN A;  2R1I A;  1NSL A;  2PVV A;  2V77 A;  5HH1 A;  4NFR A;  4P4D A;  3RAM A;  1YR0 A;  3B7I A;  4QB9 A;  1BAV A;  2B5G B;  2I00 A;  2FS5 A;  2JLM A;  2ZEO A;  3SI0 A;  2G0B A;  1HEE A;  1YGH A;  4ZX8 A;  3HUV A;  1CPX A;  5F47 A;  2XEF A;  2FIA A;  2WYR A;  2DPS A;  1F57 A;  2Q4Z A;  4CAV A;  1Z8X A;  4R9M A;  2Q7S A;  3MRU A;  4YGO A;  4MHZ A;  1LAM A;  2IQ6 A;  4JJX A;  3R95 A;  3GKR A;  1WWZ A;  4ZI6 A;  2Z3M A;  1FT7 A;  1YW4 A;  5JM6 A;  1JQG A;  1XF8 A;  2PJ7 A;  2ZW5 A;  4R6T A;  3R96 A;  3RZA A;  1TF9 A;  2B4D A;  2AFZ A;  4WWV A;  3S6F A;  1Z9U A;  4UEZ A;  1FNO A;  4XNH C;  3JRU A;  1YVK A;  4UWI A;  5ELY A;  4EME A;  3FEC A;  4A32 A;  2PDO A;  2CNM A;  5LYD A;  3A9L A;  3IWE A;  2QJ8 A;  5DWN A;  4CGP A;  3PBB A;  2GU2 A;  2FT0 A;  2ATR A;  4YRH A;  5D29 A;  2PQ8 A;  3B3W A;  1BO4 A;  2EUI A;  2G3T A;  2OZH A;  4FUU A;  1IY7 A;  3D2M A;  5HVF A;  1YVO A;  3IIB A;  1A2Z A;  4RUH A;  3FEE A;  4MFL A;  3NE7 A;  4R3K A;  1U6M A;  2HQY A;  1M4L A;  4QVT A;  1S7L A;  1XIX A;  2ZEG A;  2OZU A;  1RXT A;  4NGM A;  4R87 A;  1CM0 A;  1KWM A;  4KVM E;  3PFO A;  1YME A;  1IYL A;  2O28 A;  4KVO E;  4QBJ A;  2REF A;  4PK2 A;  1S7K A;  3SXN A;  4XNH B;  4C7H A;  1DE4 C;  4E0A A;  4OC3 A;  4P4B A;  2ZEE A;  1ARL A;  1MJA A;  3G8W A;  3JUW A;  2OU2 A;  3D3S A;  1F2O A;  4NGR A;  4A37 A;  1PU9 A;  5KTC A;  1Y7R A;  4F0X A;  1QSO A;  2PJ3 A;  5CBM A;  4C68 A;  3S9L A;  4KSA A;  2REE A;  1AYE A;  3S6H A;  2OZG A;  3FED A;  2PJ8 A;  2AFM A;  3H8F A;  1XOV A;  2JBK A;  5FVJ A;  5DWM A;  1UWY A;  1Y7E A;  2OB0 A;  2OR4 A;  2QVP A;  4KSI A;  3KKW A;  2V8D A;  3WR7 A;  2ZW4 A;  4A95 A;  4QUS A;  1XEB A;  3EO4 A;  5J1Q A;  4FBE A;  2FXF A;  2POK A;  2ZOF A;  3QAY A;  2DEA A;  2CY2 A;  2J8M A;  2ZW7 A;  3DR6 A;  4QC6 A;  4JXQ A;  4M6I A;  4M85 A;  1LAP A;  2FSR A;  1X12 A;  1VHE A;  2B58 A;  4CS0 B;  3PB7 X;  2B4B A;  1NSA A;  2PJ2 A;  4PXC A;  3PGP A;  2PJ0 A;  4B10 A;  2VZY A;  5IB0 A;  4ZBG A;  2Z3K A;  1ZG7 A;  3W6X A;  2WZN A;  2CTB A;  4CRY B;  1Y9W A;  2PSW A;  4FWU A;  4TNU A;  2PR8 A;  1ZLI A;  4MFQ A;  3V7Z A;  4IUS A;  4AG9 A;  2ZEM A;  3TCV A;  4MHN A;  4KOY A;  4FAI A;  2P0W A;  3SI1 A;  3ISZ A;  4UFV A;  3KL9 A;  2AJ6 A;  3BLN A;  4OC2 A;  3IGR A;  2JDC A;  3B3C A;  1P4N A;  4OIW A;  1M4G A;  4Q38 A;  3SJE A;  2YNC A;  5I0C A;  4NJR A;  4KZT A;  3I3G A;  3WAB A;  4PXE A;  4OAD A;  2VBQ A;  3PP9 A;  1M4I A;  1AMP A;  3VAR A;  5F49 A;  5IV0 A;  1Y0R A;  2CXA A;  2QIR A;  2CF4 A;  1R43 A;  3IU2 A;  4ZY2 A;  3EFA A;  3JTK A;  3LAC A;  2Q0Y A;  4OC5 A;  4H89 A;  4P45 A;  4CYP A;  1LRZ A;  3RNZ A;  3F5B A;  3GIU A;  5HVH A;  2AFO A;  1RO5 A;  1ZLH A;  3GY9 A;  4ONW A;  2YNE A;  2I79 A;  2VZZ A;  3SI2 A;  3LOD A;  1YW6 A;  4C2Z A;  1TIQ A;  2PCU A;  4UCM A;  3SXO A;  4BMH A;  2NYQ A;  1Q2Y A;  2ZEL A;  4MI4 A;  4NXY A;  2C27 A;  2H5M A;  4UBR A;  1VHS A;  2ODF A;  5G21 A;  4CAW A;  2PJA A;  3QB8 A;  2QEC A;  2EBJ A;  5A28 A;  3IFE A;  1OZP A;  3TT2 A;  2KCW A;  1UFH A;  2PJ6 A;  2DPT A;  3VWE A;  4X2T A;  4CGL A;  5F46 A;  3D7D A;  2PJC A;  4MRI A;  2PIZ A;  3I9S A;  2P6F A;  1ARM A;  2B3U A;  2B4D B;  4L89 A;  2OOT A;  3FMC A;  5F48 A;  4AG7 A;  3EXN A;  3BJ7 A;  1M44 A;  1QSM A;  1ZO0 A;  1Z8L A;  3FNC A;  4M6G A;  2CNS A;  2F7V A;  3W6S A;  4A2Z A;  3K2K A;  2PE3 A;  4ZY0 A;  2GIV A;  3V38 A;  3NE8 A;  4OLL A;  3CDX A;  4R8F A;  3PRT A;  4MFK A;  2FVG A;  4OP4 A;  2Q51 A;  1ZG9 A;  3PEI A;  4HPS A;  4NSQ A;  4UCP A;  3R9E A;  2DXQ A;  1P0H A;  4HKF A;  4M3S A;  4MCS A;  2PJ4 A;  1XRY A;  2BL1 A;  4AVC A;  2D4O A;  1ON0 A;  1SQH A;  4CGN A;  2BCO A;  3D7H A;  2WUU A;  3PFE A;  2G3A A;  4R76 A;  2QML A;  5LRJ A;  1PYT B;  5G1Z A;  4A94 A;  3S9N A;  5K8N A;  2Q7B A;  4BD9 A;  1IYK A;  2O53 A;  3PBE A;  3I1U A;  4F6A A;  3BJ8 A;  3GYA A;  1F2P A;  3FF3 A;  4OKO A;  3UY5 A;  3S9M A;  2EO8 A;  3L2N A;  3PB4 X;  4ZGY B;  2XEJ A;  3CZX A;  3RYO A;  4EWT A;  4FD5 A;  3RO0 A;  2VEZ A;  4OME A;  4KLV A;  3IO1 A;  4PQA A;  1Z4E A;  3CXP A;  1S3Z A;  2YND A;  2WPX A;  3BXM A;  5AGE A;  2FCK A;  4Y49 C;  4CRZ B;  5HMN A;  4E2A A;  4P4J A;  3KGQ A;  1Q2D A;  4A38 A;  1BLL E;  4UEE A;  5JH9 A;  5J8C A;  1IGB A;  3MN8 A;  1MK4 A;  4KOU A;  2Z3P A;  4G1P A;  4IAV A;  1ELM P;  2YNC C;  4B5P A;  3D7G A;  5LRG A;  4CAX A;  1OBR A;  4UIB A;  4CAF A;  1B87 A;  3P2H A;  2EK9 A;  1TF8 A;  1XMB A;  4IF5 A;  2J8R A;  3WC6 A;  3KAS A;  3W91 A;  3GLJ A;  6CPA A;  1Y0Y A;  3ISX A;  4MHY A;  2PRQ A;  2Z10 A;  3TFY A;  3TOA A;  4Y49 B;  1KZF A;  3KZW A;  4AXV A;  1Z8T A;  2AFU A;  3BI0 A;  1CP6 A;  2NSM A;  1XE4 A;  2RFH A;  4MHD A;  2P6E A;  2C6P A;  3FB3 A;  2JEV A;  3TO6 A;  4KOV A;  4NGQ A;  4Z65 A;  1BOB A;  2O4H A;  3PB6 X;  4ONU A;  4PK3 A;  3F0A A;  3SHP A;  1TXR A;  4MFP A;  4B11 A;  3B8G A;  3DSB A;  3KHZ A;  1BPM A;  4Q7A A;  2PR1 A;  4DNC A;  2F8H A; 
#chains in the Genus database with same CATH homology
 2FE7 A;  4MY0 A;  3R9F A;  4A30 A;  3TOB A;  4RS2 A;  1K4J A;  3FXT A;  4KOW A;  5A27 A;  4JLY A;  1MJB A;  4OAE A;  2BSW A;  4FD4 A;  5ISV A;  1KUX A;  3R1K A;  1B6B A;  4KOT A;  2CNT A;  3MGD A;  3TTH A;  4L8A A;  3TO7 A;  4BBH A;  4YFJ A;  4MBU A;  4ORF A;  2PRB A;  3H4Q A;  5JPH A;  1QSR A;  3CXS A;  2Z11 A;  3FRM A;  4UWJ A;  4F0Y A;  1PUA A;  3K9U A;  2HUZ A;  2Z0Z A;  3FIX A;  3P2F A;  4Q36 A;  4AVA A;  4XPD C;  4KUA A;  2X7B A;  1N71 A;  1S60 A;  4UFX A;  1IIC A;  1YK3 A;  5AG7 A;  4FD7 A;  4HNY B;  2EVN A;  1M4D A;  4PSX A;  4RI1 A;  3F8K A;  4H6Z A;  4KSF A;  2Y0M A;  2BUE A;  4NF1 A;  4HNX B;  4MFZ A;  2WSA A;  1MJ9 A;  2Q4Y A;  3N7Z A;  4XPD B;  4KVX A;  4CGM A;  5BWA B;  4NEX A;  3JVN A;  1I21 A;  3G3S A;  4KUB A;  4X5K A;  3EC4 A;  1Y9K A;  2FL4 A;  4B12 A;  3E0K A;  3H5Z A;  5EBV A;  3EY5 A;  5AG6 A;  5KTA A;  2AE6 A;  3D2P A;  4B13 A;  3PZJ A;  4PSW A;  3OWC A;  3DDD A;  3FYN A;  1J4J A;  2ZPA A;  5JQ4 A;  2IL4 A;  4KOS A;  1IID A;  1GHE A;  1YX0 A;  4E8O A;  2YGW A;  2P6G A;  5G22 A;  4B5P B;  2K5T A;  4HNW B;  5CNP A;  4A33 A;  1XMT A;  3QAH A;  2B5G A;  4MY3 A;  4U9Y A;  2FIW A;  5KTD A;  1VKC A;  4CYN A;  2VI7 A;  3S6G A;  1M1D A;  4XPK A;  4J3G A;  1WK4 A;  3R9G A;  2WPW A;  4MJ8 A;  5IX3 A;  2ZW6 A;  3T9Y A;  1Z4R A;  3S6K A;  3TE4 A;  5J8F A;  2F5I A;  4UCN A;  4AVB A;  4R3L A;  3C26 A;  5H86 A;  2R8V A;  1S7F A;  4UA3 A;  2OH1 A;  4EVY A;  5H84 A;  2NMT A;  4KS9 A;  1KUV A;  3IWG A;  4U5Y A;  1R57 A;  5GCN A;  1S5K A;  4JD6 A;  1QST A;  2VXK A;  2Q4V A;  4GS4 A;  3ZJ0 A;  4KOR A;  3IU1 A;  1L0C A;  2R7H A;  2J8N A;  4B5O A;  4NCZ A;  2Z3N A;  5G20 A;  2VQY A;  3CXQ A;  4CAE A;  4H6U A;  4II9 A;  4R57 A;  4CYO A;  2BEI A;  2HV2 A;  2PC1 A;  1KUY A;  2D4P A;  1YRE A;  4I49 A;  4C7I A;  3TO9 A;  3LD2 A;  1Q2C A;  2RC4 A;  2Q44 A;  4LX9 A;  3T90 A;  1YLE A;  2ZXV A;  4K30 A;  4JXR A;  5C88 A;  4C2X A;  1I12 A;  3VWD A;  1S7N A;  2Z3O A;  1NE9 A;  5E96 A;  3FBU A;  5AG5 A;  4U9Z A;  2GE3 A;  5C82 A;  2GAN A;  5EC4 A;  4UFW A;  1FY7 A;  3ZZI A;  2A4N A;  4AB7 A;  4KLW A;  2ARH A;  2JDD A;  2Q04 A;  1CJW A;  4XPL A;  4CYQ A;  4CGO A;  1IB1 E;  3V8I A;  4JWP A;  4KOX A;  4B14 A;  2Z3L A;  4LUA A;  2R98 A;  2B3V A;  3DR8 A;  4A31 A;  4FD6 A;  4MFJ A;  4PV6 A;  3D8P A;  1I1D A;  1NMT A;  1V0C A;  4C2Y A;  5AG4 A;  3DNS A;  1QSN A;  2R1I A;  1NSL A;  5HH1 A;  1YR0 A;  4QB9 A;  2B5G B;  2I00 A;  2FS5 A;  2JLM A;  2G0B A;  1YGH A;  5F47 A;  2FIA A;  2DPS A;  4CAV A;  4R9M A;  4YGO A;  4JJX A;  3R95 A;  3GKR A;  1WWZ A;  2Z3M A;  1XF8 A;  2ZW5 A;  3R96 A;  2B4D A;  3S6F A;  1Z9U A;  4XNH C;  1YVK A;  4UWI A;  4A32 A;  2PDO A;  2CNM A;  3A9L A;  3IWE A;  5DWN A;  4CGP A;  2FT0 A;  2ATR A;  4YRH A;  2PQ8 A;  1BO4 A;  2EUI A;  2G3T A;  2OZH A;  3D2M A;  1YVO A;  4MFL A;  3NE7 A;  4R3K A;  1U6M A;  2HQY A;  4QVT A;  1S7L A;  1XIX A;  2OZU A;  1RXT A;  4R87 A;  1CM0 A;  4KVM E;  2O28 A;  1IYL A;  4KVO E;  4QBJ A;  2REF A;  4PK2 A;  1S7K A;  3SXN A;  4XNH B;  4C7H A;  4E0A A;  3JUW A;  1MJA A;  3G8W A;  2OU2 A;  3D3S A;  1PU9 A;  5KTC A;  1Y7R A;  4F0X A;  1QSO A;  4C68 A;  4KSA A;  2REE A;  3S6H A;  2OZG A;  5FVJ A;  5DWM A;  2OB0 A;  3KKW A;  3WR7 A;  2ZW4 A;  4A95 A;  4QUS A;  1XEB A;  3EO4 A;  2FXF A;  2CY2 A;  2J8M A;  2ZW7 A;  3DR6 A;  4QC6 A;  4JXQ A;  4M85 A;  2FSR A;  2B58 A;  4CS0 B;  2B4B A;  3PGP A;  4B10 A;  2VZY A;  5IB0 A;  4ZBG A;  2Z3K A;  3W6X A;  4CRY B;  1Y9W A;  2PSW A;  2PR8 A;  4MFQ A;  4IUS A;  4AG9 A;  3TCV A;  4KOY A;  2P0W A;  4UFV A;  2AJ6 A;  3BLN A;  3IGR A;  2JDC A;  1P4N A;  1M4G A;  4Q38 A;  5I0C A;  2YNC A;  4KZT A;  3I3G A;  4OAD A;  2VBQ A;  3PP9 A;  1M4I A;  5IV0 A;  5F49 A;  2QIR A;  2CXA A;  3IU2 A;  3EFA A;  3JTK A;  2Q0Y A;  4H89 A;  4CYP A;  1LRZ A;  3F5B A;  1RO5 A;  3GY9 A;  2YNE A;  2I79 A;  2VZZ A;  4C2Z A;  3LOD A;  1TIQ A;  4UCM A;  3SXO A;  4BMH A;  1Q2Y A;  4MI4 A;  4NXY A;  4CAW A;  2C27 A;  2H5M A;  4UBR A;  1VHS A;  5G21 A;  3QB8 A;  2QEC A;  5A28 A;  3TT2 A;  1OZP A;  4CGL A;  2KCW A;  1UFH A;  5F46 A;  2DPT A;  3VWE A;  3I9S A;  2P6F A;  2B3U A;  2B4D B;  4L89 A;  5F48 A;  4AG7 A;  3EXN A;  3BJ7 A;  1M44 A;  1QSM A;  1ZO0 A;  3FNC A;  3W6S A;  4A2Z A;  2CNS A;  2GIV A;  4OLL A;  4MFK A;  4NSQ A;  4UCP A;  3R9E A;  1P0H A;  2DXQ A;  4HKF A;  4M3S A;  2BL1 A;  4AVC A;  2D4O A;  1ON0 A;  1SQH A;  4CGN A;  2WUU A;  2G3A A;  2QML A;  5G1Z A;  2Q7B A;  1IYK A;  4F6A A;  3BJ8 A;  3GYA A;  3UY5 A;  4ZGY B;  3RYO A;  4FD5 A;  2VEZ A;  4KLV A;  1Z4E A;  3CXP A;  1S3Z A;  2YND A;  2WPX A;  5AGE A;  2FCK A;  4Y49 C;  4CRZ B;  5HMN A;  1Q2D A;  5J8C A;  1MK4 A;  4KOU A;  2Z3P A;  2YNC C;  4B5P A;  4CAX A;  4CAF A;  1B87 A;  3P2H A;  4IF5 A;  2J8R A;  3W91 A;  2Z10 A;  3TFY A;  3TOA A;  4Y49 B;  1KZF A;  4E2A A;  4MHD A;  1XE4 A;  2P6E A;  3FB3 A;  3TO6 A;  2JEV A;  4KOV A;  1BOB A;  4ONU A;  4PK3 A;  3F0A A;  3SHP A;  4B11 A;  4MFP A;  3B8G A;  3DSB A;  2PR1 A;  4DNC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...