5KTDA

Fdhc with bound products: coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
187
structure length
187
Chain Sequence
VNFNLKANTTYLRLVEENDAEFICTLRNNDKLNTYISKSTGDIKSQAEWIRNYKNRENNGEEYYFIIFRSDDQSPIGTVRLYDFHENPKSFCWGSWILNEHKTKYAAVESALLVYEAGFSTLGFEQSHFEVMKGNDKVHSFHLKMGAQKISEDDENIYYIFPKSKYKENKIQYARFLGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FdhC
publication title Structural and Functional Investigation of FdhC from Acinetobacter nosocomialis: A Sugar N-Acyltransferase Belonging to the GNAT Superfamily.
pubmed doi rcsb
source organism Acinetobacter nosocomialis
molecule tags Transferase
total genus 63
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ktdA00
4OAEA 1S5KA 1S7NA 2QIRA 1IIDA 1XF8A 2GIVA 5C82A 3I3GA 1IYKA 4UA3A 1Y9KA 3TOBA 4NCZA 3V8IA 3EO4A 2FSRA 3TCVA 2JDCA 4E2AA 2B5GA 2VQYA 4FD7A 2B3VA 2PRBA 2J8MA 3JVNA 1BOBA 1MJ9A 2F5IA 3BJ7A 5ISVA 4KOYA 1PU9A 2VI7A 3P2HA 4H6ZA 4KOSA 1PUAA 3DNSA 1K4JA 1B6BA 3VWEA 4JD6A 1VHSA 2BEIA 1YK3A 1P4NA 4XPDB 3E0KA 3OWCA 3PGPA 4JLYA 2G3AA 4MI4A 5F48A 1Y7RA 4KUBA 2EVNA 3QB8A 3G8WA 2ATRA 5F46A 2HV2A 1KUXA 1S60A 1XE4A 3S6GA 1Z9UA 5JPHA 4F0YA 4KOXA 2ZPAA 2D4PA 1P0HA 2QECA 4GS4A 3GKRA 4CAVA 3EFAA 2FIAA 3DR8A 4KLWA 4ONUA 1I1DA 3F8KA 4JXQA 4NEXA 1Q2DA 2G3TA 3SXNA 1YGHA 1YLEA 3D8PA 4KVME 4IF5A 2R7HA 3W91A 4JXRA 2NMTA 2ZW4A 2WPXA 3T90A 2HQYA 2J8NA 1QSOA 2ZW7A 2REEA 2X7BA 1YVKA 2R1IA 1FY7A 4PV6A 3ZJ0A 2OZUA 2Q44A 1I21A 1QSRA 1WK4A 4PK2A 2ARHA 1UFHA 4HKFA 4MBUA 2VXKA 4HNYB 2Q0YA 2JDDA 3FB3A 4QC6A 5F49A 3P2FA 4YRHA 2ZXVA 4H89A 3FXTA 4CAXA 2D4OA 2QMLA 3PZJA 4AVBA 4R9MA 2RC4A 1Q2CA 4MY3A 1Z4RA 1RXTA 2B3UA 3C26A 3DSBA 2OH1A 5J8CA 2IL4A 1IB1E 2Q7BA 2B58A 4KOUA 4HNWB 4RI1A 4ORFA 1IICA 1Y9WA 1OZPA 5CNPA 1TIQA 3QAHA 1MJAA 3R9EA 1SQHA 3I9SA 5J8FA 3D3SA 3R96A 1LRZA 4FD6A 2P6FA 2FCKA 3TFYA 2VZZA 3TOAA 1XEBA 2PR8A 3GYAA 1YREA 2PC1A 4B5OA 1CM0A 3D2MA 4CRYB 3VWDA 2FL4A 4KLVA 4LX9A 4AVAA 1S3ZA 2EUIA 1M1DA 2B4DA 2CNTA 5HMNA 3TT2A 1ON0A 4RS2A 4CRZB 2B5GB 2G0BA 1XMTA 4UWJA 4ZBGA 1L0CA 3T9YA 5KTDA 1Q2YA 3R9GA 2ZW5A 2BSWA 5H86A 5KTAA 4XPDC 3N7ZA 2R8VA 1GHEA 2Y0MA 1N71A 2BUEA 2J8RA 4R87A 1J4JA 2Z11A 3D2PA 5GCNA 4K30A 4HNXB 5IB0A 4U5YA 2OU2A 2PSWA 4XNHC 4L8AA 3S6HA 2AE6A 1V0CA 3ZZIA 4KVOE 5JQ4A 1M4GA 4B5PA 4J3GA 4BMHA 1I12A 1KUVA 2BL1A 1Z4EA 5HH1A 2H5MA 3S6KA 4EVYA 4R3KA 4QB9A 4PSWA 1BO4A 4Y49C 1B87A 4XPKA 3EC4A 4KOTA 1M44A 1NE9A 3RYOA 3LODA 1MJBA 1S7KA 2Z10A 2VBQA 4PK3A 3TTHA 3WR7A 2GANA 2P6GA 3H4QA 1RO5A 2FT0A 4CS0B 4AVCA 4CAWA 4MJ8A 4JJXA 4NF1A 4M85A 2PDOA 2CY2A 3PP9A 2ZW6A 3FBUA 3CXPA 3B8GA 3IWGA 3SXOA 2GE3A 4U9ZA 2Q4VA 5EC4A 3FNCA 3F5BA 4YGOA 5E96A 2Q04A 4AG9A 4E8OA 4DNCA 1QSMA 3TO6A 4F6AA 3TE4A 2FXFA 2REFA 2I79A 4KORA 4FD4A 1CJWA 2PQ8A 3IGRA 1M4DA 5IX3A 3UY5A 5KTCA 5IV0A 1MK4A 5H84A 1VKCA 2CNSA 3GY9A 4M3SA 3FRMA 3TO9A 3R95A 2HUZA 3G3SA 1S7LA 5FVJA 4UWIA 2OZHA 4L89A 3DR6A 2A4NA 4AB7A 2Q4YA 1QSNA 4MHDA 2DXQA 4R3LA 4H6UA 1M4IA 2JLMA 2B4DB 2VZYA 4UBRA 4YFJA 2FE7A 3DDDA 4NXYA 3R9FA 1YR0A 5I0CA 2PR1A 2B4BA 2FIWA 1U6MA 3FIXA 4KOWA 3EXNA 4OLLA 4QVTA 2VEZA 3R1KA 2KCWA 2P0WA 3BJ8A 3JUWA 2Z0ZA 3W6SA 2R98A 3MGDA 3S6FA 3F0AA 3W6XA 3KKWA 2I00A 4KVXA 4XNHB 1KUYA 4QBJA 1WWZA 4QUSA 2OB0A 5C88A 2C27A 4KOVA 1NMTA 3FYNA 2K5TA 3LD2A 1YVOA 4I49A 2OZGA 2WPWA 3CXSA 1XIXA 3NE7A 4B5PB 4AG7A 4U9YA 4II9A 2FS5A 4JWPA 2P6EA 4XPLA 4Y49B 3EY5A 1NSLA 4KZTA 3BLNA 4NSQA 2O28A 4OADA 4E0AA 4MY0A 3SHPA 3K9UA 4IUSA 1YX0A 1S7FA 4X5KA 4KUAA 4LUAA 1KZFA 5F47A 4PSXA 3TO7A 5DWMA 1IYLA 2JEVA 4FD5A 2CNMA 1QSTA 5DWNA 5EBVA 4R57A 2AJ6A 3CXQA 1R57A
chains in the Genus database with same CATH superfamily
1RTQA 4OAEA 1S5KA 1S7NA 2AFXA 2QIRA 4F8ZA 4Q7AA 1IIDA 4CGPA 2PJ8A 1XF8A 2GIVA 2DEAA 5C82A 2Z3OA 3I3GA 4A94A 1Z2LA 1IYKA 2CTBA 4UA3A 1BAVA 1Y9KA 3TOBA 3KR5A 4NCZA 3V8IA 3EO4A 4ZX9A 2FSRA 2Q51A 4EWTA 1Q7LA 1A2ZA 2ZEGA 3TCVA 2JDCA 1ZG7A 2B5GA 2VQYA 2XEIA 4FD7A 4E2AA 1BPMA 3KHXA 3S9MA 4F9VA 2JEWA 2B3VA 4OP4A 2PRBA 2J8MA 3BI0A 3IFEA 3JVNA 4A30A 4MHZA 1BOBA 5AG5A 2AFOA 1MJ9A 4C2YA 2F5IA 3BJ7A 5ISVA 4KOYA 1PU9A 4R7MA 1CP7A 4LQ6A 2VI7A 4P4BA 3P2HA 4H6ZA 2EK9A 4K3NA 4KOSA 1PUAA 4OC0A 3DNSA 1K4JA 1B6BA 3VWEA 3IWWA 4JD6A 2ZEFA 3S9LA 1VHSA 2BEIA 1YK3A 1Y0YA 1P4NA 3PBEA 4XPDB 4MHYA 3E0KA 3OWCA 1YW6A 3PGPA 2G3AA 4JLYA 4MI4A 4UCNA 3RBUA 3BHXA 1TKJA 3KASA 5F48A 1Y7RA 4KUBA 2EVNA 2PVWA 3QB8A 5LYLA 2CIJA 3G8WA 2ATRA 2F8HA 4OC4A 4FUUA 5F46A 5J1QA 2ZELA 1UWYA 4MFQA 4C2ZA 4NGNA 2HV2A 4R6TA 2J9AA 2ANPA 1KUXA 5HMNA 1S60A 4NJRA 4UFWA 4ZY0A 3FECA 1XE4A 2GREA 4NJQA 3S6GA 1Z9UA 4C7IA 5JPHA 1VHEA 2ZPAA 4KOXA 4F0YA 2D4PA 1P0HA 2QECA 4GS4A 1AMPA 3GKRA 4JZ0A 4KS9A 4CAVA 3EFAA 2FIAA 3DR8A 3PB7X 4KLWA 1YLOA 4ONUA 1I1DA 3F8KA 3H8FA 4JXQA 3FF3A 4NEXA 3SI0A 1Q2DA 2G3TA 2GFQA 4M6HA 4C7HA 4DUKA 3SXNA 1YGHA 1YLEA 3D8PA 4KVME 4IF5A 2R7HA 5JGFA 4TWEA 3W91A 3WC5A 1M4LA 4JXRA 2PJ0A 2NMTA 2ZW4A 3NFZA 2C6CA 5F09A 2ZEOA 2WPXA 2RB7A 3T90A 4MHPA 2HQYA 1LOKA 2J8NA 4C68A 5LYFA 1QSOA 2ZW7A 2REEA 2X7BA 3DGVA 2QJ8A 3JRUA 1YVKA 2R1IA 1FY7A 5LRKA 4PV6A 3FJUA 3ZJ0A 2OZUA 3MRUA 2Q44A 2Z3KA 2Z3MA 1I21A 2ZEHA 1QSRA 1WK4A 3DLJA 4IAVA 4PK2A 4UBRA 2ARHA 1UFHA 3SI2A 4HKFA 4MBUA 2VXKA 1QQ9A 4UFVA 2ZEMA 1LANA 4HNYB 2Q0YA 3B35A 2JDDA 3FB3A 4X3RA 1TF9A 4QC6A 5F49A 4YWYA 3P2FA 4MCPA 3NE8A 3PBBA 3D68A 4P4DA 4WWVA 2PJ4A 2V8GA 4YRHA 3PB4X 2ZXVA 4H89A 2EK8A 1IY7A 3FXTA 4CAXA 2D4OA 2PE3A 2QMLA 3RAMA 3KQXA 3PZJA 4AVBA 5CPAA 1BLLE 4R9MA 2RC4A 3FVLA 1Q2CA 4MY3A 1Z4RA 1RXTA 2B3UA 3C26A 3DSBA 1TKFA 3LMSA 4OC1A 2IJZA 5LYDA 4ZX8A 2PJ7A 2PJ5A 3VH9A 2OH1A 3H8GA 4MMOA 5J8CA 2I3CA 2IL4A 1IB1E 2F7VA 4NGPA 3KHZA 3FX6A 4ZY2A 2Q7BA 4PXDA 2B58A 4KOUA 3FEEA 4HNWB 1HEEA 3NH8A 3FH4A 4RI1A 4CAEA 4ORFA 1ELMP 1VHOA 1IICA 1Y9WA 1OZPA 5CNPA 1CPXA 2O4HA 4PQAA 4PXBA 3WABA 3NH5A 3LACA 4O23A 2XEFA 1TIQA 3D67A 3QAHA 4GXHA 1FT7A 2ABZA 5JM6A 1MJAA 2GU2A 5A27A 4B13A 3R9EA 4LQGA 5K8NA 1IOIA 3IU2A 4UIAA 1LCPA 2NYQA 2Q43A 1SQHA 2PJ9A 3I9SA 5AGEA 5J8FA 2JBKA 3D3SA 1YW4A 4UEFA 1LRZA 2AFSA 3R96A 4FD6A 3JTKA 2P6FA 4P4IA 4B12A 2FCKA 4FAIA 4NGMA 2RFHA 3TFYA 5G1ZA 2VZZA 3KQZA 1TXRA 2YNCC 4P4JA 4EMEA 3TOAA 4OC2A 1CBXA 1CX8A 1XEBA 2PR8A 4UIBA 4FBEA 4AXVA 2PJ3A 3GYAA 1YREA 2PC1A 4B5OA 1CM0A 2IQ6A 3D2MA 1LAPA 3L2NA 2GLJA 4CRYB 4OIDA 3VWDA 2FL4A 2Z3PA 4UFXA 2AFUA 4KLVA 1Z5RA 4LX9A 3ISXA 4AVAA 1S3ZA 2C6GA 2EUIA 1M1DA 3WC7A 3IWEA 3B3VA 4P6YA 4A2ZA 2B4DA 5K8PA 2GLFA 2CNTA 4G1PA 3TT2A 4BINA 1ON0A 2O53A 3B3SA 4RS2A 3WC6A 3KZWA 1YMEA 4PXEA 2B5GB 2G0BA 4CRZB 5HVFA 1XMTA 1ZG9A 1PYTB 4UWJA 3RO0A 5A28A 5HXDA 5D8NA 1XRYA 4X2TA 2XEGA 3HLPA 4ZBGA 1L0CA 2XEJA 3T9YA 5KTDA 1Q2YA 1LFWA 2HB6A 3R9GA 5LYIA 3NH4A 2AFWA 1IU8A 2ZW5A 2BSWA 1ARLA 2JBJA 5H86A 5KTAA 4XPDC 3GIUA 3D4UA 3N7ZA 2R8VA 1GHEA 2Y0MA 1N71A 1VGYA 2BUEA 5AG4A 2J8RA 4R87A 1J4JA 2ODFA 2Z11A 1PCAA 3IC1A 3D2PA 4BBHA 4TNUA 1KWMA 5GCNA 4K30A 4HNXB 4WJBA 4ZY1A 1F57A 4P4FA 4ZI6A 3TC8A 5IB0A 1XMBA 4CGLA 2PIYA 4NGSA 5AG7A 4PPZA 4YFJA 5JH9A 4B10A 4CPAA 4U5YA 4Q36A 4BD9A 2OU2A 2PSWA 2DF5A 3CZXA 4L8AA 4XNHC 3S6HA 2AE6A 1V0CA 3V7ZA 3ZZIA 4KVOE 1ZLIA 1TKHA 3IU1A 5JQ4A 1ZO0A 1M4GA 4B5PA 1CPSA 3H5ZA 4A39A 4J3GA 2QVPA 2OOTA 4CYOA 5HVGA 4BMHA 1I12A 1KUVA 2DPTA 4A38A 4CAFA 2BL1A 2ZENA 1XBUA 1Z4EA 2PRQA 3T8WA 2IMOA 3IO1A 5HH1A 5AG6A 3SJEA 2Q4ZA 2H5MA 2NSMA 3S6KA 2AFMA 4EVYA 2PJCA 1YQEA 4NGTA 4R3KA 4QB9A 4MHNA 4GM5A 2Q7SA 1Z8TA 4PSWA 4DYOA 1BO4A 2BCOA 4P44A 4Y49C 3QAYA 1B87A 2YGWA 3EC4A 4XPKA 5LRJA 4KOTA 1M44A 2WSAA 4MCSA 4X8IA 1QMUA 1NE9A 1ELLP 1NSAA 3RYOA 3B3CA 4CYQA 3LODA 1MJBA 1S7KA 2Z10A 4KSIA 3TX8A 2VBQA 4PK3A 1TF8A 4PXCA 2WZNA 3FMCA 3KR4A 3TTHA 3WR7A 2GANA 2ZEDA 3RZAA 1DTDA 1Z8LA 2P6GA 1IOFA 3H4QA 1RO5A 2FT0A 4CS0B 3B3TA 4AVCA 4MJ8A 4ONWA 4CAWA 4MCQA 3B2YA 4JJXA 4MRIA 4NGQA 4NF1A 4M85A 1GYTA 1X12A 3BXMA 3VARA 1XOVA 2CY2A 2PDOA 3I1UA 4UCMA 1YSJA 3PP9A 1VIXA 2PIZA 2YNCA 2ZW6A 3A9LA 2OR4A 3FBUA 3CXPA 3B8GA 2EWBA 3IWGA 4MFLA 2GE3A 3SXOA 4U9ZA 5I4MA 1H8LA 2Q4VA 2WUUA 2ZEPA 1CP6A 2ZOGA 3QNVA 5EC4A 2V8VA 8CPAA 3FNCA 5DS0A 3SJXA 6CPAA 3F5BA 4YGOA 3D7DA 5E96A 2Q04A 1XJOA 1IGBA 4IK2A 3D7FA 4F9UA 4AG9A 1Z8XA 3D66A 4E8OA 4M6IA 4DNCA 1QSMA 3TO6A 4F6AA 4ZGYB 2FXFA 2REFA 3PB6X 3TE4A 2I79A 4FWUA 4KORA 3V38A 5IB9A 4FD4A 5EMIA 1CJWA 2PQ8A 1ARMA 4KSFA 3IGRA 3KI9A 5K8OA 1M4DA 5IX3A 2CF4A 5G22A 3D7HA 3UY5A 5KTCA 4P10A 1R3NA 1MK4A 5IV0A 2HC9A 5H84A 4A33A 5BWAB 1VKCA 3B7IA 2CNSA 3GY9A 4M3SA 3FRMA 3TO9A 1ZG8A 3R95A 4MXUA 2HUZA 4RN7A 3G3SA 3KGQA 3SJGA 1S7LA 5FVJA 1Y7EA 3GUXA 4A95A 4UWIA 2OZHA 4L89A 1LAMA 1EE3P 4OC3A 3DR6A 4UEZA 3D7GA 2A4NA 2CTCA 4AB7A 4C2XA 2PJBA 2Q4YA 2V8DA 1QSNA 4M6GA 4MHDA 2DXQA 4R3LA 3CPAA 1M4IA 2JLMA 2B4DB 2VZYA 3NA6A 2V8HA 4H6UA 2FE7A 3DDDA 4OMEA 2YNDA 4NXYA 3R9FA 4ZYQA 1YR0A 2FVGA 2WYRA 4MCRA 3PB8X 5I0CA 2PR1A 4A37A 2B4BA 3ISZA 1BPNA 3PB9X 2FIWA 1U6MA 3FIXA 4KOWA 3WT4A 2PCUA 2PVVA 3EXNA 1CG2A 1HDUA 7CPAA 4OLLA 4H2KA 2EBJA 2V77A 4QVTA 2VEZA 3R1KA 3CT9A 2KCWA 2P0WA 1F2OA 3SJFA 3BJ8A 4MFKA 3PEIA 3B3WA 2CXAA 3JUWA 2Z3NA 2Z0ZA 5D29A 3W6SA 1ZLHA 4B11A 2R98A 3MGDA 1FNOA 4HPSA 3S6FA 4CGOA 4YU9A 2BOAA 3F0AA 1XFOA 4UEEA 4OC5A 3W6XA 1R43A 1JWQA 3KKWA 3PRTA 5G20A 2I00A 2QYVA 4KVXA 4XNHB 4A32A 1KUYA 4UCPA 3GLJA 3PFOA 5LRGA 4DJLA 4IHMA 4Q38A 1WWZA 4QBJA 4QUSA 4W9YA 2OB0A 1HDQA 5HVHA 2ZOFA 3LWUA 2ZEEA 4MFPA 4A31A 5C88A 2C27A 3IIBA 4KOVA 3GB0A 1NMTA 1OBRA 4MFZA 5THWA 2PJ2A 5CBMA 4MFJA 3FYNA 2K5TA 2PJAA 3LD2A 4R76A 1YVOA 4I49A 2OZGA 3MN8A 2WPWA 1F2PA 4OIWA 4P4EA 3CXSA 4EFDA 1XIXA 4NFRA 4CYPA 2BO9A 3BI1A 3NE7A 3VATA 4B5PB 3K9TA 4AG7A 3IEHA 1AUGA 3FEDA 3K2KA 4U9YA 4II9A 3S9NA 2FS5A 3H8EA 4JWPA 2P6EA 4JYWA 3PFEA 4XPLA 2EO8A 4R8FA 2VL1A 2YNEA 3EY5A 4Y49B 3KL9A 1NSLA 2PJ6A 1Z8WA 4Z65A 4UF4A 1Y0RA 1JQGA 3HUVA 4KZTA 4CGMA 4OKOA 4RUHA 3BLNA 3RNZA 4B6ZA 4NSQA 2O28A 4OADA 3CDXA 4E0AA 4CGNA 4MY0A 4B14A 4NGRA 3SHPA 3K9UA 5G21A 2G9DA 2PJ1A 4IUSA 4F0XA 1YX0A 1S7FA 2C6PA 4X5KA 3N5FA 2Z3LA 4KUAA 4LUAA 5K8MA 1KZFA 5F47A 1X10A 4PSXA 2DPSA 3TO7A 5DWMA 1IYLA 2JEVA 1DE4C 4FD5A 2CNMA 2AFZA 1AYEA 1QSTA 5DWNA 4KSAA 3SI1A 4CYNA 2POKA 5ELYA 5EBVA 4R57A 3IJ3A 2AJ6A 3CXQA 2C1CA 1R57A 3CPXA 4P45A
chains in the Genus database with same CATH topology
4OAEA 1S5KA 1S7NA 2QIRA 1IIDA 4CGPA 1XF8A 2GIVA 5C82A 2Z3OA 3I3GA 1IYKA 4UA3A 1Y9KA 3TOBA 4NCZA 3V8IA 3EO4A 2FSRA 3TCVA 2JDCA 4E2AA 2B5GA 2VQYA 4FD7A 2B3VA 4A30A 2PRBA 2J8MA 3JVNA 1BOBA 5AG5A 1MJ9A 4C2YA 2F5IA 3BJ7A 5ISVA 4KOYA 1PU9A 2VI7A 3P2HA 4H6ZA 4KOSA 1PUAA 3DNSA 1K4JA 1B6BA 3VWEA 4JD6A 1VHSA 2BEIA 1YK3A 1P4NA 4XPDB 3E0KA 3OWCA 3PGPA 4JLYA 2G3AA 4MI4A 4UCNA 5F48A 1Y7RA 4KUBA 2EVNA 3QB8A 3G8WA 2ATRA 5F46A 4MFQA 4C2ZA 2HV2A 1KUXA 1S60A 4UFWA 1XE4A 3S6GA 1Z9UA 4C7IA 5JPHA 4F0YA 2ZPAA 4KOXA 2D4PA 1P0HA 2QECA 4GS4A 3GKRA 4KS9A 4CAVA 3EFAA 2FIAA 3DR8A 4KLWA 4ONUA 1I1DA 3F8KA 4JXQA 4NEXA 1Q2DA 2G3TA 4C7HA 3SXNA 1YGHA 1YLEA 3D8PA 4KVME 4IF5A 2R7HA 3W91A 4JXRA 2NMTA 2ZW4A 2WPXA 3T90A 2HQYA 2J8NA 4C68A 1QSOA 2ZW7A 2REEA 2X7BA 1YVKA 2R1IA 1FY7A 4PV6A 3ZJ0A 2OZUA 2Q44A 2Z3KA 2Z3MA 1I21A 1QSRA 1WK4A 4PK2A 2ARHA 1UFHA 4HKFA 4MBUA 2VXKA 4UFVA 4HNYB 2Q0YA 2JDDA 3FB3A 4QC6A 5F49A 3P2FA 4YRHA 2ZXVA 4H89A 3FXTA 4CAXA 2D4OA 2QMLA 3PZJA 4AVBA 4R9MA 2RC4A 1Q2CA 4MY3A 1Z4RA 1RXTA 2B3UA 3C26A 3DSBA 2OH1A 5J8CA 2IL4A 1IB1E 2Q7BA 2B58A 4KOUA 4HNWB 4RI1A 4CAEA 4ORFA 1IICA 1Y9WA 1OZPA 5CNPA 1TIQA 3QAHA 1MJAA 5A27A 4B13A 3R9EA 3IU2A 1SQHA 5AGEA 3I9SA 5J8FA 3D3SA 3R96A 1LRZA 4FD6A 3JTKA 2P6FA 4B12A 2FCKA 3TFYA 5G1ZA 2VZZA 2YNCC 3TOAA 1XEBA 2PR8A 3GYAA 1YREA 2PC1A 4B5OA 1CM0A 3D2MA 4CRYB 3VWDA 2FL4A 2Z3PA 4UFXA 4KLVA 4LX9A 4AVAA 1S3ZA 2EUIA 1M1DA 4A2ZA 3IWEA 2B4DA 2CNTA 5HMNA 3TT2A 1ON0A 4RS2A 4CRZB 2B5GB 2G0BA 1XMTA 5A28A 4UWJA 4ZBGA 1L0CA 3T9YA 5KTDA 1Q2YA 3R9GA 2ZW5A 2BSWA 5H86A 5KTAA 4XPDC 3N7ZA 2R8VA 1GHEA 2Y0MA 1N71A 2BUEA 5AG4A 2J8RA 4R87A 1J4JA 2Z11A 3D2PA 4BBHA 5GCNA 4K30A 4HNXB 5IB0A 4CGLA 5AG7A 4B10A 4U5YA 4Q36A 2OU2A 2PSWA 4XNHC 4L8AA 3S6HA 2AE6A 1V0CA 3ZZIA 4KVOE 5JQ4A 3IU1A 1ZO0A 1M4GA 4B5PA 3H5ZA 4J3GA 4CYOA 4BMHA 1I12A 1KUVA 2DPTA 4CAFA 2BL1A 1Z4EA 5HH1A 5AG6A 2H5MA 3S6KA 4EVYA 4R3KA 4QB9A 4PSWA 1BO4A 4Y49C 1B87A 2YGWA 3EC4A 4XPKA 4KOTA 1M44A 2WSAA 1NE9A 4CYQA 3RYOA 3LODA 1MJBA 1S7KA 2Z10A 2VBQA 4PK3A 3TTHA 3WR7A 2GANA 2P6GA 3H4QA 1RO5A 2FT0A 4CS0B 4AVCA 4CAWA 4MJ8A 4JJXA 4NF1A 4M85A 2PDOA 2CY2A 4UCMA 3PP9A 2YNCA 2ZW6A 3A9LA 3FBUA 3CXPA 3B8GA 3IWGA 4MFLA 2GE3A 3SXOA 4U9ZA 2Q4VA 2WUUA 5EC4A 3FNCA 3F5BA 4YGOA 5E96A 2Q04A 4AG9A 4E8OA 4DNCA 1QSMA 3TO6A 4F6AA 4ZGYB 2FXFA 2REFA 3TE4A 2I79A 4KORA 4FD4A 1CJWA 2PQ8A 4KSFA 3IGRA 1M4DA 5IX3A 5G22A 3UY5A 5KTCA 5IV0A 1MK4A 5H84A 5BWAB 4A33A 1VKCA 2CNSA 3GY9A 4M3SA 3FRMA 3TO9A 3R95A 2HUZA 3G3SA 1S7LA 5FVJA 4A95A 4UWIA 2OZHA 4L89A 3DR6A 2A4NA 4AB7A 4C2XA 2Q4YA 1QSNA 4MHDA 2DXQA 4R3LA 4H6UA 1M4IA 2JLMA 2B4DB 2VZYA 4UBRA 4YFJA 2FE7A 3DDDA 2YNDA 4NXYA 3R9FA 1YR0A 5I0CA 2PR1A 2B4BA 2FIWA 1U6MA 3FIXA 4KOWA 3EXNA 4OLLA 4QVTA 2VEZA 3R1KA 2KCWA 2P0WA 3BJ8A 4MFKA 2CXAA 3JUWA 2Z3NA 2Z0ZA 3W6SA 4B11A 2R98A 3MGDA 3S6FA 4CGOA 3F0AA 3W6XA 3KKWA 5G20A 2I00A 4KVXA 4XNHB 4A32A 1KUYA 4UCPA 4Q38A 1WWZA 4QBJA 4QUSA 2OB0A 4MFPA 4A31A 5C88A 2C27A 4KOVA 1NMTA 4MFZA 4MFJA 3FYNA 2K5TA 3LD2A 1YVOA 4I49A 2OZGA 2WPWA 3CXSA 1XIXA 4CYPA 3NE7A 4B5PB 4AG7A 4U9YA 4II9A 2FS5A 4JWPA 2P6EA 4XPLA 2YNEA 4Y49B 3EY5A 1NSLA 4CGMA 4KZTA 3BLNA 4NSQA 2O28A 4OADA 4E0AA 4CGNA 4MY0A 4B14A 3SHPA 3K9UA 5G21A 4IUSA 4F0XA 1YX0A 1S7FA 4X5KA 4KUAA 2Z3LA 4LUAA 1KZFA 5F47A 4PSXA 2DPSA 3TO7A 5DWMA 1IYLA 2JEVA 4FD5A 2CNMA 1QSTA 5DWNA 4KSAA 4CYNA 5EBVA 4R57A 2AJ6A 3CXQA 1R57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OAE A;  1S5K A;  1S7N A;  2QIR A;  1IID A;  1XF8 A;  2GIV A;  5C82 A;  3I3G A;  1IYK A;  4UA3 A;  1Y9K A;  3TOB A;  4NCZ A;  3V8I A;  3EO4 A;  2FSR A;  3TCV A;  2JDC A;  4E2A A;  2B5G A;  2VQY A;  4FD7 A;  2B3V A;  2PRB A;  2J8M A;  3JVN A;  1BOB A;  1MJ9 A;  2F5I A;  3BJ7 A;  5ISV A;  4KOY A;  1PU9 A;  2VI7 A;  3P2H A;  4H6Z A;  4KOS A;  1PUA A;  3DNS A;  1K4J A;  1B6B A;  3VWE A;  4JD6 A;  1VHS A;  2BEI A;  1YK3 A;  1P4N A;  4XPD B;  3E0K A;  3OWC A;  3PGP A;  4JLY A;  2G3A A;  4MI4 A;  5F48 A;  1Y7R A;  4KUB A;  2EVN A;  3QB8 A;  3G8W A;  2ATR A;  5F46 A;  2HV2 A;  1KUX A;  1S60 A;  1XE4 A;  3S6G A;  1Z9U A;  5JPH A;  4F0Y A;  4KOX A;  2ZPA A;  2D4P A;  1P0H A;  2QEC A;  4GS4 A;  3GKR A;  4CAV A;  3EFA A;  2FIA A;  3DR8 A;  4KLW A;  4ONU A;  1I1D A;  3F8K A;  4JXQ A;  4NEX A;  1Q2D A;  2G3T A;  3SXN A;  1YGH A;  1YLE A;  3D8P A;  4KVM E;  4IF5 A;  2R7H A;  3W91 A;  4JXR A;  2NMT A;  2ZW4 A;  2WPX A;  3T90 A;  2HQY A;  2J8N A;  1QSO A;  2ZW7 A;  2REE A;  2X7B A;  1YVK A;  2R1I A;  1FY7 A;  4PV6 A;  3ZJ0 A;  2OZU A;  2Q44 A;  1I21 A;  1QSR A;  1WK4 A;  4PK2 A;  2ARH A;  1UFH A;  4HKF A;  4MBU A;  2VXK A;  4HNY B;  2Q0Y A;  2JDD A;  3FB3 A;  4QC6 A;  5F49 A;  3P2F A;  4YRH A;  2ZXV A;  4H89 A;  3FXT A;  4CAX A;  2D4O A;  2QML A;  3PZJ A;  4AVB A;  4R9M A;  2RC4 A;  1Q2C A;  4MY3 A;  1Z4R A;  1RXT A;  2B3U A;  3C26 A;  3DSB A;  2OH1 A;  5J8C A;  2IL4 A;  1IB1 E;  2Q7B A;  2B58 A;  4KOU A;  4HNW B;  4RI1 A;  4ORF A;  1IIC A;  1Y9W A;  1OZP A;  5CNP A;  1TIQ A;  3QAH A;  1MJA A;  3R9E A;  1SQH A;  3I9S A;  5J8F A;  3D3S A;  3R96 A;  1LRZ A;  4FD6 A;  2P6F A;  2FCK A;  3TFY A;  2VZZ A;  3TOA A;  1XEB A;  2PR8 A;  3GYA A;  1YRE A;  2PC1 A;  4B5O A;  1CM0 A;  3D2M A;  4CRY B;  3VWD A;  2FL4 A;  4KLV A;  4LX9 A;  4AVA A;  1S3Z A;  2EUI A;  1M1D A;  2B4D A;  2CNT A;  5HMN A;  3TT2 A;  1ON0 A;  4RS2 A;  4CRZ B;  2B5G B;  2G0B A;  1XMT A;  4UWJ A;  4ZBG A;  1L0C A;  3T9Y A;  5KTD A;  1Q2Y A;  3R9G A;  2ZW5 A;  2BSW A;  5H86 A;  5KTA A;  4XPD C;  3N7Z A;  2R8V A;  1GHE A;  2Y0M A;  1N71 A;  2BUE A;  2J8R A;  4R87 A;  1J4J A;  2Z11 A;  3D2P A;  5GCN A;  4K30 A;  4HNX B;  5IB0 A;  4U5Y A;  2OU2 A;  2PSW A;  4XNH C;  4L8A A;  3S6H A;  2AE6 A;  1V0C A;  3ZZI A;  4KVO E;  5JQ4 A;  1M4G A;  4B5P A;  4J3G A;  4BMH A;  1I12 A;  1KUV A;  2BL1 A;  1Z4E A;  5HH1 A;  2H5M A;  3S6K A;  4EVY A;  4R3K A;  4QB9 A;  4PSW A;  1BO4 A;  4Y49 C;  1B87 A;  4XPK A;  3EC4 A;  4KOT A;  1M44 A;  1NE9 A;  3RYO A;  3LOD A;  1MJB A;  1S7K A;  2Z10 A;  2VBQ A;  4PK3 A;  3TTH A;  3WR7 A;  2GAN A;  2P6G A;  3H4Q A;  1RO5 A;  2FT0 A;  4CS0 B;  4AVC A;  4CAW A;  4MJ8 A;  4JJX A;  4NF1 A;  4M85 A;  2PDO A;  2CY2 A;  3PP9 A;  2ZW6 A;  3FBU A;  3CXP A;  3B8G A;  3IWG A;  3SXO A;  2GE3 A;  4U9Z A;  2Q4V A;  5EC4 A;  3FNC A;  3F5B A;  4YGO A;  5E96 A;  2Q04 A;  4AG9 A;  4E8O A;  4DNC A;  1QSM A;  3TO6 A;  4F6A A;  3TE4 A;  2FXF A;  2REF A;  2I79 A;  4KOR A;  4FD4 A;  1CJW A;  2PQ8 A;  3IGR A;  1M4D A;  5IX3 A;  3UY5 A;  5KTC A;  5IV0 A;  1MK4 A;  5H84 A;  1VKC A;  2CNS A;  3GY9 A;  4M3S A;  3FRM A;  3TO9 A;  3R95 A;  2HUZ A;  3G3S A;  1S7L A;  5FVJ A;  4UWI A;  2OZH A;  4L89 A;  3DR6 A;  2A4N A;  4AB7 A;  2Q4Y A;  1QSN A;  4MHD A;  2DXQ A;  4R3L A;  4H6U A;  1M4I A;  2JLM A;  2B4D B;  2VZY A;  4UBR A;  4YFJ A;  2FE7 A;  3DDD A;  4NXY A;  3R9F A;  1YR0 A;  5I0C A;  2PR1 A;  2B4B A;  2FIW A;  1U6M A;  3FIX A;  4KOW A;  3EXN A;  4OLL A;  4QVT A;  2VEZ A;  3R1K A;  2KCW A;  2P0W A;  3BJ8 A;  3JUW A;  2Z0Z A;  3W6S A;  2R98 A;  3MGD A;  3S6F A;  3F0A A;  3W6X A;  3KKW A;  2I00 A;  4KVX A;  4XNH B;  1KUY A;  4QBJ A;  1WWZ A;  4QUS A;  2OB0 A;  5C88 A;  2C27 A;  4KOV A;  1NMT A;  3FYN A;  2K5T A;  3LD2 A;  1YVO A;  4I49 A;  2OZG A;  2WPW A;  3CXS A;  1XIX A;  3NE7 A;  4B5P B;  4AG7 A;  4U9Y A;  4II9 A;  2FS5 A;  4JWP A;  2P6E A;  4XPL A;  4Y49 B;  3EY5 A;  1NSL A;  4KZT A;  3BLN A;  4NSQ A;  2O28 A;  4OAD A;  4E0A A;  4MY0 A;  3SHP A;  3K9U A;  4IUS A;  1YX0 A;  1S7F A;  4X5K A;  4KUA A;  4LUA A;  1KZF A;  5F47 A;  4PSX A;  3TO7 A;  5DWM A;  1IYL A;  2JEV A;  4FD5 A;  2CNM A;  1QST A;  5DWN A;  5EBV A;  4R57 A;  2AJ6 A;  3CXQ A;  1R57 A; 
#chains in the Genus database with same CATH topology
 1RTQ A;  4OAE A;  1S5K A;  1S7N A;  2AFX A;  2QIR A;  4F8Z A;  4Q7A A;  1IID A;  4CGP A;  2PJ8 A;  1XF8 A;  2GIV A;  2DEA A;  5C82 A;  2Z3O A;  3I3G A;  4A94 A;  1Z2L A;  1IYK A;  2CTB A;  4UA3 A;  1BAV A;  1Y9K A;  3TOB A;  3KR5 A;  4NCZ A;  3V8I A;  3EO4 A;  4ZX9 A;  2FSR A;  2Q51 A;  4EWT A;  1Q7L A;  1A2Z A;  2ZEG A;  3TCV A;  2JDC A;  1ZG7 A;  2B5G A;  2VQY A;  2XEI A;  4FD7 A;  4E2A A;  1BPM A;  3KHX A;  3S9M A;  4F9V A;  2JEW A;  2B3V A;  4OP4 A;  2PRB A;  2J8M A;  3BI0 A;  3IFE A;  3JVN A;  4A30 A;  4MHZ A;  1BOB A;  5AG5 A;  2AFO A;  1MJ9 A;  4C2Y A;  2F5I A;  3BJ7 A;  5ISV A;  4KOY A;  1PU9 A;  4R7M A;  1CP7 A;  4LQ6 A;  2VI7 A;  4P4B A;  3P2H A;  4H6Z A;  2EK9 A;  4K3N A;  4KOS A;  1PUA A;  4OC0 A;  3DNS A;  1K4J A;  1B6B A;  3VWE A;  3IWW A;  4JD6 A;  2ZEF A;  3S9L A;  1VHS A;  2BEI A;  1YK3 A;  1Y0Y A;  1P4N A;  3PBE A;  4XPD B;  4MHY A;  3E0K A;  3OWC A;  1YW6 A;  3PGP A;  2G3A A;  4JLY A;  4MI4 A;  4UCN A;  3RBU A;  3BHX A;  1TKJ A;  3KAS A;  5F48 A;  1Y7R A;  4KUB A;  2EVN A;  2PVW A;  3QB8 A;  5LYL A;  2CIJ A;  3G8W A;  2ATR A;  2F8H A;  4OC4 A;  4FUU A;  5F46 A;  5J1Q A;  2ZEL A;  1UWY A;  4MFQ A;  4C2Z A;  4NGN A;  2HV2 A;  4R6T A;  2J9A A;  2ANP A;  1KUX A;  5HMN A;  1S60 A;  4NJR A;  4UFW A;  4ZY0 A;  3FEC A;  1XE4 A;  2GRE A;  4NJQ A;  3S6G A;  1Z9U A;  4C7I A;  5JPH A;  1VHE A;  2ZPA A;  4KOX A;  4F0Y A;  2D4P A;  1P0H A;  2QEC A;  4GS4 A;  1AMP A;  3GKR A;  4JZ0 A;  4KS9 A;  4CAV A;  3EFA A;  2FIA A;  3DR8 A;  3PB7 X;  4KLW A;  1YLO A;  4ONU A;  1I1D A;  3F8K A;  3H8F A;  4JXQ A;  3FF3 A;  4NEX A;  3SI0 A;  1Q2D A;  2G3T A;  2GFQ A;  4M6H A;  4C7H A;  4DUK A;  3SXN A;  1YGH A;  1YLE A;  3D8P A;  4KVM E;  4IF5 A;  2R7H A;  5JGF A;  4TWE A;  3W91 A;  3WC5 A;  1M4L A;  4JXR A;  2PJ0 A;  2NMT A;  2ZW4 A;  3NFZ A;  2C6C A;  5F09 A;  2ZEO A;  2WPX A;  2RB7 A;  3T90 A;  4MHP A;  2HQY A;  1LOK A;  2J8N A;  4C68 A;  5LYF A;  1QSO A;  2ZW7 A;  2REE A;  2X7B A;  3DGV A;  2QJ8 A;  3JRU A;  1YVK A;  2R1I A;  1FY7 A;  5LRK A;  4PV6 A;  3FJU A;  3ZJ0 A;  2OZU A;  3MRU A;  2Q44 A;  2Z3K A;  2Z3M A;  1I21 A;  2ZEH A;  1QSR A;  1WK4 A;  3DLJ A;  4IAV A;  4PK2 A;  4UBR A;  2ARH A;  1UFH A;  3SI2 A;  4HKF A;  4MBU A;  2VXK A;  1QQ9 A;  4UFV A;  2ZEM A;  1LAN A;  4HNY B;  2Q0Y A;  3B35 A;  2JDD A;  3FB3 A;  4X3R A;  1TF9 A;  4QC6 A;  5F49 A;  4YWY A;  3P2F A;  4MCP A;  3NE8 A;  3PBB A;  3D68 A;  4P4D A;  4WWV A;  2PJ4 A;  2V8G A;  4YRH A;  3PB4 X;  2ZXV A;  4H89 A;  2EK8 A;  1IY7 A;  3FXT A;  4CAX A;  2D4O A;  2PE3 A;  2QML A;  3RAM A;  3KQX A;  3PZJ A;  4AVB A;  5CPA A;  1BLL E;  4R9M A;  2RC4 A;  3FVL A;  1Q2C A;  4MY3 A;  1Z4R A;  1RXT A;  2B3U A;  3C26 A;  3DSB A;  1TKF A;  3LMS A;  4OC1 A;  2IJZ A;  5LYD A;  4ZX8 A;  2PJ7 A;  2PJ5 A;  3VH9 A;  2OH1 A;  3H8G A;  4MMO A;  5J8C A;  2I3C A;  2IL4 A;  1IB1 E;  2F7V A;  4NGP A;  3KHZ A;  3FX6 A;  4ZY2 A;  2Q7B A;  4PXD A;  2B58 A;  4KOU A;  3FEE A;  4HNW B;  1HEE A;  3NH8 A;  3FH4 A;  4RI1 A;  4CAE A;  4ORF A;  1ELM P;  1VHO A;  1IIC A;  1Y9W A;  1OZP A;  5CNP A;  1CPX A;  2O4H A;  4PQA A;  4PXB A;  3WAB A;  3NH5 A;  3LAC A;  4O23 A;  2XEF A;  1TIQ A;  3D67 A;  3QAH A;  4GXH A;  1FT7 A;  2ABZ A;  5JM6 A;  1MJA A;  2GU2 A;  5A27 A;  4B13 A;  3R9E A;  4LQG A;  5K8N A;  1IOI A;  3IU2 A;  4UIA A;  1LCP A;  2NYQ A;  2Q43 A;  1SQH A;  2PJ9 A;  3I9S A;  5AGE A;  5J8F A;  2JBK A;  3D3S A;  1YW4 A;  4UEF A;  1LRZ A;  2AFS A;  3R96 A;  4FD6 A;  3JTK A;  2P6F A;  4P4I A;  4B12 A;  2FCK A;  4FAI A;  4NGM A;  2RFH A;  3TFY A;  5G1Z A;  2VZZ A;  3KQZ A;  1TXR A;  2YNC C;  4P4J A;  4EME A;  3TOA A;  4OC2 A;  1CBX A;  1CX8 A;  1XEB A;  2PR8 A;  4UIB A;  4FBE A;  4AXV A;  2PJ3 A;  3GYA A;  1YRE A;  2PC1 A;  4B5O A;  1CM0 A;  2IQ6 A;  3D2M A;  1LAP A;  3L2N A;  2GLJ A;  4CRY B;  4OID A;  3VWD A;  2FL4 A;  2Z3P A;  4UFX A;  2AFU A;  4KLV A;  1Z5R A;  4LX9 A;  3ISX A;  4AVA A;  1S3Z A;  2C6G A;  2EUI A;  1M1D A;  3WC7 A;  3IWE A;  3B3V A;  4P6Y A;  4A2Z A;  2B4D A;  5K8P A;  2GLF A;  2CNT A;  4G1P A;  3TT2 A;  4BIN A;  1ON0 A;  2O53 A;  3B3S A;  4RS2 A;  3WC6 A;  3KZW A;  1YME A;  4PXE A;  2B5G B;  2G0B A;  4CRZ B;  5HVF A;  1XMT A;  1ZG9 A;  1PYT B;  4UWJ A;  3RO0 A;  5A28 A;  5HXD A;  5D8N A;  1XRY A;  4X2T A;  2XEG A;  3HLP A;  4ZBG A;  1L0C A;  2XEJ A;  3T9Y A;  5KTD A;  1Q2Y A;  1LFW A;  2HB6 A;  3R9G A;  5LYI A;  3NH4 A;  2AFW A;  1IU8 A;  2ZW5 A;  2BSW A;  1ARL A;  2JBJ A;  5H86 A;  5KTA A;  4XPD C;  3GIU A;  3D4U A;  3N7Z A;  2R8V A;  1GHE A;  2Y0M A;  1N71 A;  1VGY A;  2BUE A;  5AG4 A;  2J8R A;  4R87 A;  1J4J A;  2ODF A;  2Z11 A;  1PCA A;  3IC1 A;  3D2P A;  4BBH A;  4TNU A;  1KWM A;  5GCN A;  4K30 A;  4HNX B;  4WJB A;  4ZY1 A;  1F57 A;  4P4F A;  4ZI6 A;  3TC8 A;  5IB0 A;  1XMB A;  4CGL A;  2PIY A;  4NGS A;  5AG7 A;  4PPZ A;  4YFJ A;  5JH9 A;  4B10 A;  4CPA A;  4U5Y A;  4Q36 A;  4BD9 A;  2OU2 A;  2PSW A;  2DF5 A;  3CZX A;  4L8A A;  4XNH C;  3S6H A;  2AE6 A;  1V0C A;  3V7Z A;  3ZZI A;  4KVO E;  1ZLI A;  1TKH A;  3IU1 A;  5JQ4 A;  1ZO0 A;  1M4G A;  4B5P A;  1CPS A;  3H5Z A;  4A39 A;  4J3G A;  2QVP A;  2OOT A;  4CYO A;  5HVG A;  4BMH A;  1I12 A;  1KUV A;  2DPT A;  4A38 A;  4CAF A;  2BL1 A;  2ZEN A;  1XBU A;  1Z4E A;  2PRQ A;  3T8W A;  2IMO A;  3IO1 A;  5HH1 A;  5AG6 A;  3SJE A;  2Q4Z A;  2H5M A;  2NSM A;  3S6K A;  2AFM A;  4EVY A;  2PJC A;  1YQE A;  4NGT A;  4R3K A;  4QB9 A;  4MHN A;  4GM5 A;  2Q7S A;  1Z8T A;  4PSW A;  4DYO A;  1BO4 A;  2BCO A;  4P44 A;  4Y49 C;  3QAY A;  1B87 A;  2YGW A;  3EC4 A;  4XPK A;  5LRJ A;  4KOT A;  1M44 A;  2WSA A;  4MCS A;  4X8I A;  1QMU A;  1NE9 A;  1ELL P;  1NSA A;  3RYO A;  3B3C A;  4CYQ A;  3LOD A;  1MJB A;  1S7K A;  2Z10 A;  4KSI A;  3TX8 A;  2VBQ A;  4PK3 A;  1TF8 A;  4PXC A;  2WZN A;  3FMC A;  3KR4 A;  3TTH A;  3WR7 A;  2GAN A;  2ZED A;  3RZA A;  1DTD A;  1Z8L A;  2P6G A;  1IOF A;  3H4Q A;  1RO5 A;  2FT0 A;  4CS0 B;  3B3T A;  4AVC A;  4MJ8 A;  4ONW A;  4CAW A;  4MCQ A;  3B2Y A;  4JJX A;  4MRI A;  4NGQ A;  4NF1 A;  4M85 A;  1GYT A;  1X12 A;  3BXM A;  3VAR A;  1XOV A;  2CY2 A;  2PDO A;  3I1U A;  4UCM A;  1YSJ A;  3PP9 A;  1VIX A;  2PIZ A;  2YNC A;  2ZW6 A;  3A9L A;  2OR4 A;  3FBU A;  3CXP A;  3B8G A;  2EWB A;  3IWG A;  4MFL A;  2GE3 A;  3SXO A;  4U9Z A;  5I4M A;  1H8L A;  2Q4V A;  2WUU A;  2ZEP A;  1CP6 A;  2ZOG A;  3QNV A;  5EC4 A;  2V8V A;  8CPA A;  3FNC A;  5DS0 A;  3SJX A;  6CPA A;  3F5B A;  4YGO A;  3D7D A;  5E96 A;  2Q04 A;  1XJO A;  1IGB A;  4IK2 A;  3D7F A;  4F9U A;  4AG9 A;  1Z8X A;  3D66 A;  4E8O A;  4M6I A;  4DNC A;  1QSM A;  3TO6 A;  4F6A A;  4ZGY B;  2FXF A;  2REF A;  3PB6 X;  3TE4 A;  2I79 A;  4FWU A;  4KOR A;  3V38 A;  5IB9 A;  4FD4 A;  5EMI A;  1CJW A;  2PQ8 A;  1ARM A;  4KSF A;  3IGR A;  3KI9 A;  5K8O A;  1M4D A;  5IX3 A;  2CF4 A;  5G22 A;  3D7H A;  3UY5 A;  5KTC A;  4P10 A;  1R3N A;  1MK4 A;  5IV0 A;  2HC9 A;  5H84 A;  4A33 A;  5BWA B;  1VKC A;  3B7I A;  2CNS A;  3GY9 A;  4M3S A;  3FRM A;  3TO9 A;  1ZG8 A;  3R95 A;  4MXU A;  2HUZ A;  4RN7 A;  3G3S A;  3KGQ A;  3SJG A;  1S7L A;  5FVJ A;  1Y7E A;  3GUX A;  4A95 A;  4UWI A;  2OZH A;  4L89 A;  1LAM A;  1EE3 P;  4OC3 A;  3DR6 A;  4UEZ A;  3D7G A;  2A4N A;  2CTC A;  4AB7 A;  4C2X A;  2PJB A;  2Q4Y A;  2V8D A;  1QSN A;  4M6G A;  4MHD A;  2DXQ A;  4R3L A;  3CPA A;  1M4I A;  2JLM A;  2B4D B;  2VZY A;  3NA6 A;  2V8H A;  4H6U A;  2FE7 A;  3DDD A;  4OME A;  2YND A;  4NXY A;  3R9F A;  4ZYQ A;  1YR0 A;  2FVG A;  2WYR A;  4MCR A;  3PB8 X;  5I0C A;  2PR1 A;  4A37 A;  2B4B A;  3ISZ A;  1BPN A;  3PB9 X;  2FIW A;  1U6M A;  3FIX A;  4KOW A;  3WT4 A;  2PCU A;  2PVV A;  3EXN A;  1CG2 A;  1HDU A;  7CPA A;  4OLL A;  4H2K A;  2EBJ A;  2V77 A;  4QVT A;  2VEZ A;  3R1K A;  3CT9 A;  2KCW A;  2P0W A;  1F2O A;  3SJF A;  3BJ8 A;  4MFK A;  3PEI A;  3B3W A;  2CXA A;  3JUW A;  2Z3N A;  2Z0Z A;  5D29 A;  3W6S A;  1ZLH A;  4B11 A;  2R98 A;  3MGD A;  1FNO A;  4HPS A;  3S6F A;  4CGO A;  4YU9 A;  2BOA A;  3F0A A;  1XFO A;  4UEE A;  4OC5 A;  3W6X A;  1R43 A;  1JWQ A;  3KKW A;  3PRT A;  5G20 A;  2I00 A;  2QYV A;  4KVX A;  4XNH B;  4A32 A;  1KUY A;  4UCP A;  3GLJ A;  3PFO A;  5LRG A;  4DJL A;  4IHM A;  4Q38 A;  1WWZ A;  4QBJ A;  4QUS A;  4W9Y A;  2OB0 A;  1HDQ A;  5HVH A;  2ZOF A;  3LWU A;  2ZEE A;  4MFP A;  4A31 A;  5C88 A;  2C27 A;  3IIB A;  4KOV A;  3GB0 A;  1NMT A;  1OBR A;  4MFZ A;  5THW A;  2PJ2 A;  5CBM A;  4MFJ A;  3FYN A;  2K5T A;  2PJA A;  3LD2 A;  4R76 A;  1YVO A;  4I49 A;  2OZG A;  3MN8 A;  2WPW A;  1F2P A;  4OIW A;  4P4E A;  3CXS A;  4EFD A;  1XIX A;  4NFR A;  4CYP A;  2BO9 A;  3BI1 A;  3NE7 A;  3VAT A;  4B5P B;  3K9T A;  4AG7 A;  3IEH A;  1AUG A;  3FED A;  3K2K A;  4U9Y A;  4II9 A;  3S9N A;  2FS5 A;  3H8E A;  4JWP A;  2P6E A;  4JYW A;  3PFE A;  4XPL A;  2EO8 A;  4R8F A;  2VL1 A;  2YNE A;  3EY5 A;  4Y49 B;  3KL9 A;  1NSL A;  2PJ6 A;  1Z8W A;  4Z65 A;  4UF4 A;  1Y0R A;  1JQG A;  3HUV A;  4KZT A;  4CGM A;  4OKO A;  4RUH A;  3BLN A;  3RNZ A;  4B6Z A;  4NSQ A;  2O28 A;  4OAD A;  3CDX A;  4E0A A;  4CGN A;  4MY0 A;  4B14 A;  4NGR A;  3SHP A;  3K9U A;  5G21 A;  2G9D A;  2PJ1 A;  4IUS A;  4F0X A;  1YX0 A;  1S7F A;  2C6P A;  4X5K A;  3N5F A;  2Z3L A;  4KUA A;  4LUA A;  5K8M A;  1KZF A;  5F47 A;  1X10 A;  4PSX A;  2DPS A;  3TO7 A;  5DWM A;  1IYL A;  2JEV A;  1DE4 C;  4FD5 A;  2CNM A;  2AFZ A;  1AYE A;  1QST A;  5DWN A;  4KSA A;  3SI1 A;  4CYN A;  2POK A;  5ELY A;  5EBV A;  4R57 A;  3IJ3 A;  2AJ6 A;  3CXQ A;  2C1C A;  1R57 A;  3CPX A;  4P45 A; 
#chains in the Genus database with same CATH homology
 4OAE A;  1S5K A;  1S7N A;  2QIR A;  1IID A;  4CGP A;  1XF8 A;  2GIV A;  5C82 A;  2Z3O A;  3I3G A;  1IYK A;  4UA3 A;  1Y9K A;  3TOB A;  4NCZ A;  3V8I A;  3EO4 A;  2FSR A;  3TCV A;  2JDC A;  4E2A A;  2B5G A;  2VQY A;  4FD7 A;  2B3V A;  4A30 A;  2PRB A;  2J8M A;  3JVN A;  1BOB A;  5AG5 A;  1MJ9 A;  4C2Y A;  2F5I A;  3BJ7 A;  5ISV A;  4KOY A;  1PU9 A;  2VI7 A;  3P2H A;  4H6Z A;  4KOS A;  1PUA A;  3DNS A;  1K4J A;  1B6B A;  3VWE A;  4JD6 A;  1VHS A;  2BEI A;  1YK3 A;  1P4N A;  4XPD B;  3E0K A;  3OWC A;  3PGP A;  4JLY A;  2G3A A;  4MI4 A;  4UCN A;  5F48 A;  1Y7R A;  4KUB A;  2EVN A;  3QB8 A;  3G8W A;  2ATR A;  5F46 A;  4MFQ A;  4C2Z A;  2HV2 A;  1KUX A;  1S60 A;  4UFW A;  1XE4 A;  3S6G A;  1Z9U A;  4C7I A;  5JPH A;  4F0Y A;  2ZPA A;  4KOX A;  2D4P A;  1P0H A;  2QEC A;  4GS4 A;  3GKR A;  4KS9 A;  4CAV A;  3EFA A;  2FIA A;  3DR8 A;  4KLW A;  4ONU A;  1I1D A;  3F8K A;  4JXQ A;  4NEX A;  1Q2D A;  2G3T A;  4C7H A;  3SXN A;  1YGH A;  1YLE A;  3D8P A;  4KVM E;  4IF5 A;  2R7H A;  3W91 A;  4JXR A;  2NMT A;  2ZW4 A;  2WPX A;  3T90 A;  2HQY A;  2J8N A;  4C68 A;  1QSO A;  2ZW7 A;  2REE A;  2X7B A;  1YVK A;  2R1I A;  1FY7 A;  4PV6 A;  3ZJ0 A;  2OZU A;  2Q44 A;  2Z3K A;  2Z3M A;  1I21 A;  1QSR A;  1WK4 A;  4PK2 A;  2ARH A;  1UFH A;  4HKF A;  4MBU A;  2VXK A;  4UFV A;  4HNY B;  2Q0Y A;  2JDD A;  3FB3 A;  4QC6 A;  5F49 A;  3P2F A;  4YRH A;  2ZXV A;  4H89 A;  3FXT A;  4CAX A;  2D4O A;  2QML A;  3PZJ A;  4AVB A;  4R9M A;  2RC4 A;  1Q2C A;  4MY3 A;  1Z4R A;  1RXT A;  2B3U A;  3C26 A;  3DSB A;  2OH1 A;  5J8C A;  2IL4 A;  1IB1 E;  2Q7B A;  2B58 A;  4KOU A;  4HNW B;  4RI1 A;  4CAE A;  4ORF A;  1IIC A;  1Y9W A;  1OZP A;  5CNP A;  1TIQ A;  3QAH A;  1MJA A;  5A27 A;  4B13 A;  3R9E A;  3IU2 A;  1SQH A;  5AGE A;  3I9S A;  5J8F A;  3D3S A;  3R96 A;  1LRZ A;  4FD6 A;  3JTK A;  2P6F A;  4B12 A;  2FCK A;  3TFY A;  5G1Z A;  2VZZ A;  2YNC C;  3TOA A;  1XEB A;  2PR8 A;  3GYA A;  1YRE A;  2PC1 A;  4B5O A;  1CM0 A;  3D2M A;  4CRY B;  3VWD A;  2FL4 A;  2Z3P A;  4UFX A;  4KLV A;  4LX9 A;  4AVA A;  1S3Z A;  2EUI A;  1M1D A;  4A2Z A;  3IWE A;  2B4D A;  2CNT A;  5HMN A;  3TT2 A;  1ON0 A;  4RS2 A;  4CRZ B;  2B5G B;  2G0B A;  1XMT A;  5A28 A;  4UWJ A;  4ZBG A;  1L0C A;  3T9Y A;  5KTD A;  1Q2Y A;  3R9G A;  2ZW5 A;  2BSW A;  5H86 A;  5KTA A;  4XPD C;  3N7Z A;  2R8V A;  1GHE A;  2Y0M A;  1N71 A;  2BUE A;  5AG4 A;  2J8R A;  4R87 A;  1J4J A;  2Z11 A;  3D2P A;  4BBH A;  5GCN A;  4K30 A;  4HNX B;  5IB0 A;  4CGL A;  5AG7 A;  4B10 A;  4U5Y A;  4Q36 A;  2OU2 A;  2PSW A;  4XNH C;  4L8A A;  3S6H A;  2AE6 A;  1V0C A;  3ZZI A;  4KVO E;  5JQ4 A;  3IU1 A;  1ZO0 A;  1M4G A;  4B5P A;  3H5Z A;  4J3G A;  4CYO A;  4BMH A;  1I12 A;  1KUV A;  2DPT A;  4CAF A;  2BL1 A;  1Z4E A;  5HH1 A;  5AG6 A;  2H5M A;  3S6K A;  4EVY A;  4R3K A;  4QB9 A;  4PSW A;  1BO4 A;  4Y49 C;  1B87 A;  2YGW A;  3EC4 A;  4XPK A;  4KOT A;  1M44 A;  2WSA A;  1NE9 A;  4CYQ A;  3RYO A;  3LOD A;  1MJB A;  1S7K A;  2Z10 A;  2VBQ A;  4PK3 A;  3TTH A;  3WR7 A;  2GAN A;  2P6G A;  3H4Q A;  1RO5 A;  2FT0 A;  4CS0 B;  4AVC A;  4CAW A;  4MJ8 A;  4JJX A;  4NF1 A;  4M85 A;  2PDO A;  2CY2 A;  4UCM A;  3PP9 A;  2YNC A;  2ZW6 A;  3A9L A;  3FBU A;  3CXP A;  3B8G A;  3IWG A;  4MFL A;  2GE3 A;  3SXO A;  4U9Z A;  2Q4V A;  2WUU A;  5EC4 A;  3FNC A;  3F5B A;  4YGO A;  5E96 A;  2Q04 A;  4AG9 A;  4E8O A;  4DNC A;  1QSM A;  3TO6 A;  4F6A A;  4ZGY B;  2FXF A;  2REF A;  3TE4 A;  2I79 A;  4KOR A;  4FD4 A;  1CJW A;  2PQ8 A;  4KSF A;  3IGR A;  1M4D A;  5IX3 A;  5G22 A;  3UY5 A;  5KTC A;  5IV0 A;  1MK4 A;  5H84 A;  5BWA B;  4A33 A;  1VKC A;  2CNS A;  3GY9 A;  4M3S A;  3FRM A;  3TO9 A;  3R95 A;  2HUZ A;  3G3S A;  1S7L A;  5FVJ A;  4A95 A;  4UWI A;  2OZH A;  4L89 A;  3DR6 A;  2A4N A;  4AB7 A;  4C2X A;  2Q4Y A;  1QSN A;  4MHD A;  2DXQ A;  4R3L A;  4H6U A;  1M4I A;  2JLM A;  2B4D B;  2VZY A;  4UBR A;  4YFJ A;  2FE7 A;  3DDD A;  2YND A;  4NXY A;  3R9F A;  1YR0 A;  5I0C A;  2PR1 A;  2B4B A;  2FIW A;  1U6M A;  3FIX A;  4KOW A;  3EXN A;  4OLL A;  4QVT A;  2VEZ A;  3R1K A;  2KCW A;  2P0W A;  3BJ8 A;  4MFK A;  2CXA A;  3JUW A;  2Z3N A;  2Z0Z A;  3W6S A;  4B11 A;  2R98 A;  3MGD A;  3S6F A;  4CGO A;  3F0A A;  3W6X A;  3KKW A;  5G20 A;  2I00 A;  4KVX A;  4XNH B;  4A32 A;  1KUY A;  4UCP A;  4Q38 A;  1WWZ A;  4QBJ A;  4QUS A;  2OB0 A;  4MFP A;  4A31 A;  5C88 A;  2C27 A;  4KOV A;  1NMT A;  4MFZ A;  4MFJ A;  3FYN A;  2K5T A;  3LD2 A;  1YVO A;  4I49 A;  2OZG A;  2WPW A;  3CXS A;  1XIX A;  4CYP A;  3NE7 A;  4B5P B;  4AG7 A;  4U9Y A;  4II9 A;  2FS5 A;  4JWP A;  2P6E A;  4XPL A;  2YNE A;  4Y49 B;  3EY5 A;  1NSL A;  4CGM A;  4KZT A;  3BLN A;  4NSQ A;  2O28 A;  4OAD A;  4E0A A;  4CGN A;  4MY0 A;  4B14 A;  3SHP A;  3K9U A;  5G21 A;  4IUS A;  4F0X A;  1YX0 A;  1S7F A;  4X5K A;  4KUA A;  2Z3L A;  4LUA A;  1KZF A;  5F47 A;  4PSX A;  2DPS A;  3TO7 A;  5DWM A;  1IYL A;  2JEV A;  4FD5 A;  2CNM A;  1QST A;  5DWN A;  4KSA A;  4CYN A;  5EBV A;  4R57 A;  2AJ6 A;  3CXQ A;  1R57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...