5KTDA

Fdhc with bound products: coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
187
structure length
187
Chain Sequence
VNFNLKANTTYLRLVEENDAEFICTLRNNDKLNTYISKSTGDIKSQAEWIRNYKNRENNGEEYYFIIFRSDDQSPIGTVRLYDFHENPKSFCWGSWILNEHKTKYAAVESALLVYEAGFSTLGFEQSHFEVMKGNDKVHSFHLKMGAQKISEDDENIYYIFPKSKYKENKIQYARFLGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FdhC
publication title Structural and Functional Investigation of FdhC from Acinetobacter nosocomialis: A Sugar N-Acyltransferase Belonging to the GNAT Superfamily.
pubmed doi rcsb
source organism Acinetobacter nosocomialis
molecule tags Transferase
total genus 63
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ktdA00
2CNSA 4MJ8A 4CRZB 4JXQA 2PRBA 2HQYA 3PGPA 1I21A 2R98A 3IWGA 5JPHA 1Y7RA 1IYLA 2VI7A 2P6FA 4YFJA 3GYAA 1LRZA 2B4BA 1Q2DA 2VZZA 4OAEA 4X5KA 4UBRA 1KUYA 1UFHA 5IB0A 4KLVA 2GIVA 2B5GA 2VXKA 3P2HA 4KZTA 4NF1A 1S5KA 1U6MA 4CAVA 3PZJA 4ORFA 4Y49C 4QC6A 4KOSA 5EBVA 1R57A 3JVNA 5F46A 2X7BA 2BEIA 5H86A 2G3TA 1S3ZA 1XE4A 4R3KA 2CNTA 2WPXA 2QIRA 4R87A 4KOXA 3T9YA 4L89A 4AB7A 1N71A 2OH1A 3TO7A 3KKWA 3E0KA 5C88A 2IL4A 1RXTA 2ZXVA 3CXSA 1MK4A 1Y9WA 1IICA 1P0HA 4PV6A 3EC4A 4ZBGA 2ARHA 4HKFA 3TCVA 1CJWA 4B5OA 3H4QA 3TE4A 4MY0A 1XEBA 1Z9UA 3R9GA 1Q2CA 1MJAA 3N7ZA 3R1KA 2P6GA 3P2FA 4AG9A 2ZW5A 3ZJ0A 3D8PA 3SXOA 2FL4A 3I9SA 5H84A 3D2MA 3PP9A 3F0AA 3TTHA 2AJ6A 4IUSA 1B87A 2B3VA 2PDOA 1MJ9A 3S6GA 5JQ4A 1Z4RA 3C26A 1QSMA 4NXYA 4KOWA 1NSLA 4M85A 4XPDC 3VWDA 3D2PA 1M4IA 2Q4YA 1M44A 1QSOA 4LX9A 4JD6A 3R96A 2BL1A 4E0AA 1S7KA 4QB9A 3G3SA 3VWEA 3W6XA 3LODA 4R9MA 4XPKA 4QBJA 4UWIA 1I1DA 3QAHA 4FD5A 4DNCA 2FS5A 4I49A 5KTAA 2BUEA 4U5YA 4XPLA 3ZZIA 2JLMA 1M4DA 1L0CA 3R9FA 3DSBA 1TIQA 2QECA 3DNSA 3IGRA 2CY2A 2CNMA 3SHPA 2REEA 4IF5A 2R7HA 5KTCA 4CS0B 5GCNA 1KUXA 1YVOA 3FBUA 1SQHA 2FT0A 3EY5A 4YGOA 2Z11A 3EFAA 4FD4A 4XNHC 3FRMA 4GS4A 2H5MA 1WK4A 1YLEA 2HUZA 2R1IA 4Y49B 4F6AA 4RI1A 2D4OA 2D4PA 2A4NA 2G3AA 3GKRA 4MY3A 3EXNA 4B5PB 2B4DA 4BMHA 2B5GB 3TO9A 4J3GA 1YK3A 5EC4A 4KORA 2J8RA 3FB3A 3FNCA 4KVME 2Q04A 2J8MA 1BOBA 1YREA 2Q44A 5C82A 4KUBA 2Q0YA 3FXTA 4EVYA 3T90A 4E8OA 1M1DA 1S7FA 2FIAA 4FD7A 3UY5A 2PR1A 3R95A 2PR8A 3S6KA 4NSQA 5J8FA 1B6BA 5HH1A 1P4NA 3S6FA 2Y0MA 4HNWB 4M3SA 1I12A 2PSWA 1PU9A 4H6UA 1BO4A 3TT2A 4HNXB 1J4JA 3R9EA 4HNYB 4QUSA 1QSRA 1OZPA 4KOYA 2I00A 1KZFA 5IX3A 2K5TA 2HV2A 4ONUA 1Q2YA 3BLNA 3MGDA 4AVBA 3DR8A 4XPDB 2OU2A 1WWZA 2FIWA 3TOBA 1M4GA 4PK2A 2FCKA 5ISVA 3D3SA 2B58A 1QSNA 2Z0ZA 2Q4VA 1XF8A 4PK3A 3SXNA 3V8IA 4CAWA 2O28A 1XMTA 2Q7BA 4PSWA 2OZHA 1YGHA 2ZPAA 2DXQA 2RC4A 2C27A 3W91A 4RS2A 1VHSA 2NMTA 1IIDA 2VBQA 3G8WA 2P6EA 4K30A 2B3UA 1YR0A 1ON0A 1XIXA 1NMTA 2OB0A 5DWMA 2VZYA 1S60A 1YX0A 3BJ8A 3WR7A 4YRHA 3LD2A 3I3GA 1S7LA 4U9ZA 3FIXA 4JLYA 5I0CA 4PSXA 4MBUA 4XNHB 1NE9A 4UA3A 4II9A 4JXRA 2PQ8A 2VEZA 1MJBA 2ZW4A 4KOVA 1RO5A 4R57A 4B5PA 3TO6A 2EUIA 5F49A 5FVJA 2F5IA 2R8VA 2FE7A 3K9UA 1YVKA 1IYKA 1K4JA 3EO4A 4KUAA 3CXQA 3TFYA 3DDDA 4AG7A 2ZW7A 1VKCA 4F0YA 3CXPA 2I79A 4NCZA 4LUAA 3BJ7A 5IV0A 2B4DB 3S6HA 2Z10A 1V0CA 2VQYA 1KUVA 2ATRA 2JEVA 3GY9A 1IB1E 4OADA 5KTDA 4KVOE 3TOAA 4FD6A 3FYNA 3F8KA 3W6SA 5CNPA 4AVCA 3F5BA 3JUWA 4KOUA 3RYOA 4MI4A 3B8GA 4KLWA 4NEXA 5F48A 2OZGA 2GE3A 4QVTA 3OWCA 4H6ZA 4R3LA 5HMNA 3NE7A 4JWPA 1GHEA 2EVNA 1S7NA 4OLLA 2OZUA 2FXFA 2AE6A 1Y9KA 4CAXA 4AVAA 2P0WA 4H89A 2REFA 2FSRA 2WPWA 4MHDA 2GANA 2QMLA 4KOTA 4UWJA 1Z4EA 4E2AA 4U9YA 1PUAA 4JJXA 2J8NA 5F47A 1QSTA 5E96A 2PC1A 2BSWA 1FY7A 5DWNA 4L8AA 5J8CA 4CRYB 2JDDA 1CM0A 2JDCA 4KVXA 3QB8A 3DR6A 2KCWA 2G0BA 2ZW6A
chains in the Genus database with same CATH superfamily
3D7DA 2PJ6A 4ZI6A 2CNSA 2NYQA 5F09A 3PEIA 4MJ8A 4MXUA 4CRZB 4CGOA 4JXQA 2PRBA 2GLFA 2PE3A 1CPSA 2HQYA 3PB7X 3PGPA 1I21A 2R98A 3IWGA 4B13A 5JPHA 2PJ5A 2CTCA 3B3CA 4P4IA 1CP6A 1Y7RA 4A2ZA 4DJLA 2C6GA 2NSMA 4X3RA 3VH9A 1IYLA 5HVGA 4KSFA 3RO0A 2HB6A 2VI7A 1ZLIA 4F6AA 2AFSA 5AG6A 2P6FA 4MFZA 4YFJA 3GYAA 1CG2A 1LRZA 1X10A 2V77A 3B3TA 2XEGA 2B4BA 1Q2DA 2VZZA 5CBMA 4FUUA 2JEWA 3BI0A 4C2XA 4OAEA 1H8LA 1YW4A 3PBEA 4OIWA 4UBRA 1KUYA 4X5KA 2GLJA 4LQGA 1UFHA 4PXCA 3D7HA 4KLVA 5IB0A 2GIVA 4MFLA 2B5GA 2VXKA 3P2HA 2GFQA 1EE3P 4KZTA 4MFQA 4MCPA 4NF1A 4A33A 4JZ0A 4CPAA 2JBJA 4P4EA 1S5KA 2BO9A 1U6MA 3KQZA 4CAVA 3PZJA 1Y0YA 4ORFA 4UEFA 4QC6A 4KOSA 1RTQA 4IK2A 4Y49C 5EBVA 5JM6A 2O53A 4R7MA 6CPAA 1R57A 3JVNA 1YLOA 5F46A 4MCQA 2X7BA 2BEIA 5H86A 2G3TA 1S3ZA 1XE4A 4PPZA 4R3KA 2CNTA 2WPXA 1ZLHA 3NH8A 2QIRA 3FVLA 1A2ZA 2YGWA 4MFKA 4KOXA 4R87A 3T9YA 5D8NA 4L89A 4AB7A 1XRYA 1N71A 2OH1A 3TO7A 1HEEA 2WSAA 3PRTA 3FMCA 2DPTA 3KKWA 4AXVA 3E0KA 5G1ZA 5C88A 2IL4A 1NSAA 3HUVA 1RXTA 7CPAA 2Z3PA 4C68A 1CX8A 2ZXVA 4UIAA 1Z5RA 1BPMA 3CXSA 1MK4A 4ZX9A 1M4LA 3V7ZA 1Y9WA 3LWUA 2AFXA 1IICA 3HLPA 1P0HA 4PV6A 4OC1A 3EC4A 2YNDA 2ARHA 4OC4A 4ZBGA 3PB6X 4HKFA 4F8ZA 5K8NA 1Z8WA 3TCVA 1QMUA 1CJWA 2AFUA 4B5OA 4Z65A 3H4QA 3S9LA 3TE4A 4MY0A 4LQ6A 1XEBA 2Z3MA 3GIUA 1Z9UA 1TXRA 1YW6A 1ZG8A 1Q2CA 3R9GA 4CYOA 4EFDA 1MJAA 2Q4ZA 3BHXA 3N7ZA 1F2OA 2PJAA 3R1KA 2P6GA 2IQ6A 4UEEA 1IGBA 1IU8A 3P2FA 4AG9A 2CF4A 2ZW5A 3ZJ0A 1VGYA 3D67A 3D8PA 3SXOA 2OR4A 1TKFA 3JRUA 2FL4A 3I9SA 2ZEOA 5H84A 3NA6A 3D2MA 3PP9A 3F0AA 3TTHA 2C6PA 2AJ6A 1B87A 4IUSA 4CGMA 2B3VA 2PDOA 4UEZA 3FJUA 3T8WA 1YQEA 5LRGA 1MJ9A 2PJCA 1LCPA 3S6GA 4CYPA 5JQ4A 2F7VA 1Z4RA 2Z3OA 1QSMA 3C26A 4KOWA 4NXYA 1NSLA 3WC7A 4M85A 3D4UA 4XPDC 2QVPA 2EBJA 3VWDA 3WC5A 1UWYA 5THWA 2YNCA 3D2PA 1M4IA 2Q4YA 4UCNA 1M44A 4PXBA 3S9NA 1QSOA 4OKOA 4LX9A 4CAFA 4JD6A 1R43A 4MHZA 3R96A 2BL1A 4E0AA 1S7KA 4NGRA 1AUGA 4QB9A 3G3SA 3QAYA 2EK9A 4M6HA 4IHMA 3BXMA 4OC2A 3VWEA 3W6XA 3LODA 1Z8LA 4R9MA 5AGEA 1HDQA 3KZWA 4XPKA 2G9DA 4QBJA 4UWIA 1I1DA 3QAHA 2PRQA 1ELLP 2YNCC 4FD5A 2Q43A 4DNCA 1ARMA 4FBEA 4P4FA 3H8GA 4MRIA 2FS5A 4I49A 5KTAA 4CAEA 4R6TA 2DF5A 3LACA 4MCSA 2BUEA 3QNVA 4U5YA 4XPLA 3ZZIA 2JLMA 1M4DA 1L0CA 1ZO0A 3R9FA 3KR5A 1QQ9A 3DSBA 1IOIA 1TIQA 2O4HA 5G22A 2QECA 5A27A 3DNSA 3WT4A 2Z3LA 1BPNA 3IGRA 1XJOA 2CY2A 1YMEA 3B7IA 2CNMA 3SHPA 1TKJA 2REEA 2WYRA 4Q7AA 4IF5A 2PJBA 2R7HA 5KTCA 1Z8XA 3IEHA 4WWVA 4CS0B 5GCNA 1KUXA 1YVOA 3FBUA 3H8EA 1SQHA 3IFEA 2AFMA 2FT0A 3EY5A 2PJ7A 5LYDA 4CYQA 4YGOA 2Z11A 3EFAA 4BD9A 4FD4A 4XNHC 3LMSA 3FRMA 3PB8X 4GS4A 2ZOFA 4CGNA 2ZELA 2H5MA 2C6CA 1PYTB 1WK4A 4R8FA 1TF8A 1YLEA 2HUZA 2R1IA 4Y49B 5AG5A 2ZOGA 4RI1A 2D4OA 2D4PA 2PVVA 2A4NA 4ZX8A 2C1CA 3FEEA 2G3AA 5DS0A 4A38A 4GM5A 3GKRA 3SJEA 4MY3A 3EXNA 4P6YA 4B5PB 2B4DA 4P45A 2B5GB 3TO9A 1DTDA 4BMHA 5HVHA 4J3GA 1YK3A 2AFWA 2EO8A 2YNEA 5EC4A 4KORA 2J8RA 2QYVA 3FB3A 3IIBA 3FNCA 3KASA 4KVME 1R3NA 2PIYA 2Q04A 4B11A 2XEIA 2J8MA 4NGSA 3RNZA 1BOBA 1YREA 2Q44A 2WZNA 3SI0A 5C82A 4P4BA 2PIZA 4KUBA 4P44A 5K8PA 1JWQA 2Q0YA 4MMOA 3FXTA 4NJQA 5LYFA 4EVYA 3IWWA 3T90A 2V8DA 3IJ3A 4E8OA 5LRKA 1M1DA 2PJ9A 2RB7A 1S7FA 2FIAA 4FD7A 4NFRA 2V8HA 4UFWA 3N5FA 2EWBA 3UY5A 2PR1A 2V8GA 5JGFA 4UFVA 2F8HA 1Z8TA 2PR8A 3R95A 3S6KA 4BBHA 2IMOA 4NSQA 5J8FA 1B6BA 5HH1A 1P4NA 3B3SA 3S6FA 5AG4A 4KSIA 4DUKA 2Y0MA 4HNWB 4M3SA 1I12A 2PSWA 1Z2LA 4B6ZA 1PU9A 5D29A 4H6UA 1BO4A 3TT2A 3TX8A 4HNXB 1J4JA 1BAVA 3R9EA 3WABA 4HNYB 4QUSA 2CXAA 1QSRA 1OZPA 1XMBA 1XBUA 4NGPA 3GLJA 3KQXA 3FECA 4KOYA 3CDXA 3K2KA 3RBUA 1IY7A 2BCOA 2I00A 5G20A 1KZFA 4R76A 2K5TA 2HV2A 4ZY0A 2PVWA 5IX3A 4BINA 1DE4C 4OP4A 2ZEDA 4ONUA 1Q2YA 3BLNA 4ONWA 1LAMA 3NH5A 3MGDA 4UCPA 3NH4A 4AVBA 3DR8A 4TWEA 3CPXA 4W9YA 4XPDB 2OU2A 2ZEMA 4YU9A 4CGLA 3VARA 1WWZA 2FIWA 3TOBA 1M4GA 4UFXA 4PK2A 2FCKA 5ISVA 3IWEA 3D3SA 1CBXA 2B58A 1QSNA 2Z0ZA 4CGPA 8CPAA 2Q4VA 1XF8A 4PK3A 4KSAA 3SXNA 4WJBA 4C2ZA 3V8IA 3PB4X 4CAWA 2O28A 1X12A 1XMTA 2PCUA 1LANA 3PFOA 3SI2A 3TC8A 2Q7BA 4GXHA 4PSWA 2OZHA 4UF4A 3H8FA 1YGHA 2ZPAA 2DXQA 3V38A 2EK8A 2GU2A 4OIDA 4F0XA 2RC4A 3GB0A 3D66A 2C27A 3W91A 3FX6A 4RS2A 4G1PA 4NGNA 4P10A 1BLLE 1VHSA 1IIDA 2NMTA 2PJ4A 2VBQA 3G8WA 2Q7SA 5LRJA 2IJZA 3PFEA 3FEDA 3RAMA 2P6EA 1KWMA 1HDUA 3IC1A 2ABZA 4MHYA 4A37A 1F2PA 4K30A 2B3UA 2XEFA 4ZY2A 1YR0A 5AG7A 4C2YA 1Y7EA 1ON0A 2I3CA 1LFWA 4K3NA 1XIXA 1NMTA 1ZG9A 2OB0A 2VZYA 5DWMA 4NJRA 3WC6A 4TNUA 1S60A 1YX0A 3BJ8A 3FH4A 4OMEA 1VHEA 4PQAA 3WR7A 4YRHA 1CP7A 4H2KA 3LD2A 1GYTA 3I3GA 3S9MA 2ZENA 1S7LA 1PCAA 4EWTA 4NGMA 2QJ8A 2ZEGA 1F57A 4P4JA 4U9ZA 3B3VA 4ZY1A 3FIXA 2ZEPA 1TF9A 3K9TA 4JLYA 4X2TA 5BWAB 5I0CA 4PSXA 4MBUA 1OBRA 4XNHB 1NE9A 4UA3A 4II9A 4ZGYB 2V8VA 4JXRA 2PQ8A 1ARLA 3IU1A 2VEZA 1Y0RA 4OC0A 1FNOA 2ANPA 1MJBA 3A9LA 1JQGA 2ZW4A 4KOVA 1RO5A 2AFOA 2ZEFA 3H5ZA 4R57A 4B5PA 3TO6A 2EUIA 2Z3NA 3I1UA 5F49A 5FVJA 4IAVA 4MHPA 3SJXA 2F5IA 2R8VA 2FE7A 3K9UA 1YVKA 1LOKA 3PB9X 2AFZA 4F9VA 3SJFA 2POKA 4MFPA 5HVFA 1IYKA 4B12A 1K4JA 5J1QA 3EO4A 4KUAA 3L2NA 4MCRA 3CXQA 5IB9A 3TFYA 4A39A 4Q38A 4C7IA 3DDDA 2Q51A 4AG7A 3MRUA 2ZW7A 2CTBA 1VKCA 4F0YA 3CXPA 3D68A 4NGQA 3B35A 2I79A 2GREA 4NCZA 1LAPA 4LUAA 4M6IA 4RN7A 4PXEA 5LYLA 3MN8A 2XEJA 3FF3A 3BJ7A 5IV0A 2B4DB 3S6HA 4FAIA 3KHXA 2Z10A 4UCMA 1V0CA 2VQYA 3KHZA 4ZYQA 4A31A 1KUVA 2ATRA 2JEVA 2PJ1A 1IB1E 3GY9A 4OADA 5KTDA 3NE8A 3CZXA 4KVOE 4MHNA 3SJGA 1ZG7A 3KGQA 3TOAA 5EMIA 4FD6A 3FYNA 3NFZA 3VATA 2OOTA 3F8KA 3ISXA 5G21A 2CIJA 2JBKA 3W6SA 4A95A 5K8MA 5CNPA 1IOFA 3KL9A 4AVCA 4RUHA 2DPSA 3F5BA 1TKHA 2RFHA 3B2YA 1AMPA 1Q7LA 4PXDA 3JUWA 4KOUA 4EMEA 3RYOA 3KR4A 4MI4A 3B8GA 4MFJA 2PJ8A 4KLWA 4C7HA 4A30A 4NEXA 5F48A 2OZGA 2GE3A 4QVTA 4X8IA 3DGVA 1ELMP 3JTKA 3OWCA 4H6ZA 4A94A 5K8OA 1AYEA 1YSJA 3PBBA 4P4DA 4R3LA 2ZEEA 3NE7A 4FWUA 5HMNA 4JWPA 1GHEA 2EVNA 1S7NA 3DLJA 4OLLA 2OZUA 1CPXA 3D7GA 4F9UA 2FXFA 2AE6A 3SI1A 4KS9A 2VL1A 1Y9KA 2PJ3A 2ZEHA 4JYWA 4CAXA 5HXDA 4CYNA 4AVAA 2P0WA 1VIXA 4H89A 3KI9A 5LYIA 2FVGA 2REFA 4DYOA 2FSRA 2WPWA 4MHDA 2GANA 2QMLA 4M6GA 2BOAA 4KOTA 4UWJA 1Z4EA 2WUUA 3IO1A 4HPSA 4NGTA 5CPAA 4E2AA 4U9YA 5I4MA 1PUAA 3RZAA 1VHOA 2J9AA 4JJXA 2J8NA 2PJ0A 3IU2A 5F47A 1QSTA 5A28A 2ODFA 5E96A 2HC9A 3ISZA 2PC1A 1XFOA 4Q36A 2BSWA 4B10A 1FY7A 5DWNA 3CT9A 4UIBA 4A32A 2PJ2A 4L8AA 5J8CA 5ELYA 3CPAA 2DEAA 4CRYB 2JDDA 3BI1A 4OC3A 4OC5A 1CM0A 3B3WA 3D7FA 2JDCA 4KVXA 3QB8A 3GUXA 5JH9A 4B14A 2Z3KA 3DR6A 4YWYA 4O23A 2KCWA 2G0BA 1FT7A 1XOVA 2ZW6A
chains in the Genus database with same CATH topology
2CNSA 4MJ8A 4CRZB 4CGOA 4JXQA 2PRBA 2HQYA 3PGPA 1I21A 2R98A 3IWGA 4B13A 5JPHA 1Y7RA 4A2ZA 1IYLA 4KSFA 2VI7A 5AG6A 2P6FA 4MFZA 4YFJA 3GYAA 1LRZA 2B4BA 1Q2DA 2VZZA 4C2XA 4OAEA 4X5KA 4UBRA 1KUYA 1UFHA 5IB0A 4KLVA 2GIVA 4MFLA 2B5GA 2VXKA 3P2HA 4KZTA 4MFQA 4NF1A 4A33A 1S5KA 1U6MA 4CAVA 3PZJA 4ORFA 4Y49C 4QC6A 4KOSA 5EBVA 1R57A 3JVNA 5F46A 2X7BA 2BEIA 5H86A 2G3TA 1S3ZA 1XE4A 4R3KA 2CNTA 2WPXA 2QIRA 2YGWA 4MFKA 4KOXA 4R87A 3T9YA 4L89A 4AB7A 1N71A 2OH1A 3TO7A 2WSAA 2DPTA 3KKWA 3E0KA 5G1ZA 5C88A 2IL4A 1RXTA 2Z3PA 4C68A 2ZXVA 3CXSA 1MK4A 1Y9WA 1IICA 1P0HA 4PV6A 3EC4A 2YNDA 2ARHA 4ZBGA 4HKFA 3TCVA 1CJWA 4B5OA 3H4QA 3TE4A 4MY0A 1XEBA 2Z3MA 1Z9UA 3R9GA 1Q2CA 4CYOA 1MJAA 3N7ZA 3R1KA 2P6GA 3P2FA 4AG9A 2ZW5A 3ZJ0A 3D8PA 3SXOA 2FL4A 3I9SA 5H84A 3D2MA 3PP9A 3F0AA 3TTHA 2AJ6A 4IUSA 1B87A 4CGMA 2B3VA 2PDOA 1MJ9A 3S6GA 4CYPA 5JQ4A 1Z4RA 2Z3OA 1QSMA 3C26A 4KOWA 4NXYA 1NSLA 4M85A 4XPDC 3VWDA 2YNCA 3D2PA 1M4IA 2Q4YA 4UCNA 1M44A 1QSOA 4LX9A 4CAFA 4JD6A 3R96A 2BL1A 4E0AA 1S7KA 4QB9A 3G3SA 3VWEA 3W6XA 3LODA 4R9MA 5AGEA 4XPKA 4QBJA 4UWIA 1I1DA 3QAHA 2YNCC 4FD5A 4DNCA 2FS5A 4I49A 5KTAA 4CAEA 2BUEA 4U5YA 4XPLA 3ZZIA 2JLMA 1M4DA 1L0CA 1ZO0A 3R9FA 3DSBA 1TIQA 5G22A 2QECA 5A27A 3DNSA 2Z3LA 3IGRA 2CY2A 2CNMA 3SHPA 2REEA 4IF5A 2R7HA 5KTCA 4CS0B 5GCNA 1KUXA 1YVOA 3FBUA 1SQHA 2FT0A 3EY5A 4CYQA 4YGOA 2Z11A 3EFAA 4FD4A 4XNHC 3FRMA 4GS4A 4CGNA 2H5MA 1WK4A 1YLEA 2HUZA 2R1IA 4Y49B 5AG5A 4F6AA 4RI1A 2D4OA 2D4PA 2A4NA 2G3AA 3GKRA 4MY3A 3EXNA 4B5PB 2B4DA 4BMHA 2B5GB 3TO9A 4J3GA 1YK3A 2YNEA 5EC4A 4KORA 2J8RA 3FB3A 3FNCA 4KVME 4B11A 2Q04A 2J8MA 1BOBA 1YREA 2Q44A 5C82A 4KUBA 2Q0YA 3FXTA 4EVYA 3T90A 4E8OA 1M1DA 1S7FA 2FIAA 4FD7A 4UFWA 3UY5A 2PR1A 4UFVA 3R95A 2PR8A 4BBHA 3S6KA 4NSQA 5J8FA 1B6BA 5HH1A 1P4NA 3S6FA 5AG4A 2Y0MA 4HNWB 4M3SA 1I12A 2PSWA 1PU9A 4H6UA 1BO4A 3TT2A 4HNXB 1J4JA 3R9EA 4HNYB 4QUSA 2CXAA 1QSRA 1OZPA 4KOYA 2I00A 5G20A 1KZFA 5IX3A 2K5TA 2HV2A 4ONUA 1Q2YA 3BLNA 4UCPA 3MGDA 4AVBA 3DR8A 4XPDB 2OU2A 4CGLA 1WWZA 2FIWA 3TOBA 1M4GA 4UFXA 4PK2A 2FCKA 5ISVA 3IWEA 3D3SA 2B58A 4CGPA 1QSNA 2Z0ZA 2Q4VA 1XF8A 4PK3A 4KSAA 3SXNA 4C2ZA 3V8IA 4CAWA 2O28A 1XMTA 2Q7BA 4PSWA 2OZHA 1YGHA 2ZPAA 2DXQA 4F0XA 2RC4A 2C27A 3W91A 4RS2A 1VHSA 2NMTA 1IIDA 2VBQA 3G8WA 2P6EA 4K30A 2B3UA 1YR0A 5AG7A 4C2YA 1ON0A 1XIXA 1NMTA 2OB0A 5DWMA 2VZYA 1S60A 1YX0A 3BJ8A 3WR7A 4YRHA 3LD2A 3I3GA 1S7LA 4U9ZA 3FIXA 4JLYA 5BWAB 5I0CA 4PSXA 4MBUA 4XNHB 1NE9A 4UA3A 4II9A 4ZGYB 4JXRA 2PQ8A 3IU1A 2VEZA 3A9LA 1MJBA 2ZW4A 4KOVA 1RO5A 3H5ZA 4R57A 4B5PA 3TO6A 2EUIA 2Z3NA 5F49A 5FVJA 2F5IA 2R8VA 2FE7A 3K9UA 1YVKA 4MFPA 1IYKA 4B12A 1K4JA 3EO4A 4KUAA 3CXQA 3TFYA 4Q38A 4C7IA 3DDDA 4AG7A 2ZW7A 1VKCA 4F0YA 3CXPA 2I79A 4NCZA 4LUAA 3BJ7A 5IV0A 2B4DB 3S6HA 2Z10A 4UCMA 1V0CA 2VQYA 4A31A 1KUVA 2ATRA 2JEVA 3GY9A 1IB1E 4OADA 5KTDA 4KVOE 3TOAA 4FD6A 3FYNA 3F8KA 5G21A 3W6SA 4A95A 5CNPA 4AVCA 2DPSA 3F5BA 3JUWA 4KOUA 3RYOA 4MI4A 3B8GA 4MFJA 4KLWA 4C7HA 4A30A 4NEXA 5F48A 2OZGA 2GE3A 4QVTA 3OWCA 3JTKA 4H6ZA 4R3LA 5HMNA 3NE7A 4JWPA 1GHEA 2EVNA 1S7NA 4OLLA 2OZUA 2FXFA 2AE6A 4KS9A 1Y9KA 4CAXA 4CYNA 4AVAA 2P0WA 4H89A 2REFA 2FSRA 2WPWA 4MHDA 2GANA 2QMLA 4KOTA 4UWJA 1Z4EA 2WUUA 4E2AA 4U9YA 1PUAA 4JJXA 2J8NA 3IU2A 5A28A 5F47A 1QSTA 5E96A 4B10A 2PC1A 4Q36A 2BSWA 1FY7A 5DWNA 4A32A 4L8AA 5J8CA 4CRYB 2JDDA 1CM0A 2JDCA 4KVXA 3QB8A 4B14A 2Z3KA 3DR6A 2KCWA 2G0BA 2ZW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNS A;  4MJ8 A;  4CRZ B;  4JXQ A;  2PRB A;  2HQY A;  3PGP A;  1I21 A;  2R98 A;  3IWG A;  5JPH A;  1Y7R A;  1IYL A;  2VI7 A;  2P6F A;  4YFJ A;  3GYA A;  1LRZ A;  2B4B A;  1Q2D A;  2VZZ A;  4OAE A;  4X5K A;  4UBR A;  1KUY A;  1UFH A;  5IB0 A;  4KLV A;  2GIV A;  2B5G A;  2VXK A;  3P2H A;  4KZT A;  4NF1 A;  1S5K A;  1U6M A;  4CAV A;  3PZJ A;  4ORF A;  4Y49 C;  4QC6 A;  4KOS A;  5EBV A;  1R57 A;  3JVN A;  5F46 A;  2X7B A;  2BEI A;  5H86 A;  2G3T A;  1S3Z A;  1XE4 A;  4R3K A;  2CNT A;  2WPX A;  2QIR A;  4R87 A;  4KOX A;  3T9Y A;  4L89 A;  4AB7 A;  1N71 A;  2OH1 A;  3TO7 A;  3KKW A;  3E0K A;  5C88 A;  2IL4 A;  1RXT A;  2ZXV A;  3CXS A;  1MK4 A;  1Y9W A;  1IIC A;  1P0H A;  4PV6 A;  3EC4 A;  4ZBG A;  2ARH A;  4HKF A;  3TCV A;  1CJW A;  4B5O A;  3H4Q A;  3TE4 A;  4MY0 A;  1XEB A;  1Z9U A;  3R9G A;  1Q2C A;  1MJA A;  3N7Z A;  3R1K A;  2P6G A;  3P2F A;  4AG9 A;  2ZW5 A;  3ZJ0 A;  3D8P A;  3SXO A;  2FL4 A;  3I9S A;  5H84 A;  3D2M A;  3PP9 A;  3F0A A;  3TTH A;  2AJ6 A;  4IUS A;  1B87 A;  2B3V A;  2PDO A;  1MJ9 A;  3S6G A;  5JQ4 A;  1Z4R A;  3C26 A;  1QSM A;  4NXY A;  4KOW A;  1NSL A;  4M85 A;  4XPD C;  3VWD A;  3D2P A;  1M4I A;  2Q4Y A;  1M44 A;  1QSO A;  4LX9 A;  4JD6 A;  3R96 A;  2BL1 A;  4E0A A;  1S7K A;  4QB9 A;  3G3S A;  3VWE A;  3W6X A;  3LOD A;  4R9M A;  4XPK A;  4QBJ A;  4UWI A;  1I1D A;  3QAH A;  4FD5 A;  4DNC A;  2FS5 A;  4I49 A;  5KTA A;  2BUE A;  4U5Y A;  4XPL A;  3ZZI A;  2JLM A;  1M4D A;  1L0C A;  3R9F A;  3DSB A;  1TIQ A;  2QEC A;  3DNS A;  3IGR A;  2CY2 A;  2CNM A;  3SHP A;  2REE A;  4IF5 A;  2R7H A;  5KTC A;  4CS0 B;  5GCN A;  1KUX A;  1YVO A;  3FBU A;  1SQH A;  2FT0 A;  3EY5 A;  4YGO A;  2Z11 A;  3EFA A;  4FD4 A;  4XNH C;  3FRM A;  4GS4 A;  2H5M A;  1WK4 A;  1YLE A;  2HUZ A;  2R1I A;  4Y49 B;  4F6A A;  4RI1 A;  2D4O A;  2D4P A;  2A4N A;  2G3A A;  3GKR A;  4MY3 A;  3EXN A;  4B5P B;  2B4D A;  4BMH A;  2B5G B;  3TO9 A;  4J3G A;  1YK3 A;  5EC4 A;  4KOR A;  2J8R A;  3FB3 A;  3FNC A;  4KVM E;  2Q04 A;  2J8M A;  1BOB A;  1YRE A;  2Q44 A;  5C82 A;  4KUB A;  2Q0Y A;  3FXT A;  4EVY A;  3T90 A;  4E8O A;  1M1D A;  1S7F A;  2FIA A;  4FD7 A;  3UY5 A;  2PR1 A;  3R95 A;  2PR8 A;  3S6K A;  4NSQ A;  5J8F A;  1B6B A;  5HH1 A;  1P4N A;  3S6F A;  2Y0M A;  4HNW B;  4M3S A;  1I12 A;  2PSW A;  1PU9 A;  4H6U A;  1BO4 A;  3TT2 A;  4HNX B;  1J4J A;  3R9E A;  4HNY B;  4QUS A;  1QSR A;  1OZP A;  4KOY A;  2I00 A;  1KZF A;  5IX3 A;  2K5T A;  2HV2 A;  4ONU A;  1Q2Y A;  3BLN A;  3MGD A;  4AVB A;  3DR8 A;  4XPD B;  2OU2 A;  1WWZ A;  2FIW A;  3TOB A;  1M4G A;  4PK2 A;  2FCK A;  5ISV A;  3D3S A;  2B58 A;  1QSN A;  2Z0Z A;  2Q4V A;  1XF8 A;  4PK3 A;  3SXN A;  3V8I A;  4CAW A;  2O28 A;  1XMT A;  2Q7B A;  4PSW A;  2OZH A;  1YGH A;  2ZPA A;  2DXQ A;  2RC4 A;  2C27 A;  3W91 A;  4RS2 A;  1VHS A;  2NMT A;  1IID A;  2VBQ A;  3G8W A;  2P6E A;  4K30 A;  2B3U A;  1YR0 A;  1ON0 A;  1XIX A;  1NMT A;  2OB0 A;  5DWM A;  2VZY A;  1S60 A;  1YX0 A;  3BJ8 A;  3WR7 A;  4YRH A;  3LD2 A;  3I3G A;  1S7L A;  4U9Z A;  3FIX A;  4JLY A;  5I0C A;  4PSX A;  4MBU A;  4XNH B;  1NE9 A;  4UA3 A;  4II9 A;  4JXR A;  2PQ8 A;  2VEZ A;  1MJB A;  2ZW4 A;  4KOV A;  1RO5 A;  4R57 A;  4B5P A;  3TO6 A;  2EUI A;  5F49 A;  5FVJ A;  2F5I A;  2R8V A;  2FE7 A;  3K9U A;  1YVK A;  1IYK A;  1K4J A;  3EO4 A;  4KUA A;  3CXQ A;  3TFY A;  3DDD A;  4AG7 A;  2ZW7 A;  1VKC A;  4F0Y A;  3CXP A;  2I79 A;  4NCZ A;  4LUA A;  3BJ7 A;  5IV0 A;  2B4D B;  3S6H A;  2Z10 A;  1V0C A;  2VQY A;  1KUV A;  2ATR A;  2JEV A;  3GY9 A;  1IB1 E;  4OAD A;  5KTD A;  4KVO E;  3TOA A;  4FD6 A;  3FYN A;  3F8K A;  3W6S A;  5CNP A;  4AVC A;  3F5B A;  3JUW A;  4KOU A;  3RYO A;  4MI4 A;  3B8G A;  4KLW A;  4NEX A;  5F48 A;  2OZG A;  2GE3 A;  4QVT A;  3OWC A;  4H6Z A;  4R3L A;  5HMN A;  3NE7 A;  4JWP A;  1GHE A;  2EVN A;  1S7N A;  4OLL A;  2OZU A;  2FXF A;  2AE6 A;  1Y9K A;  4CAX A;  4AVA A;  2P0W A;  4H89 A;  2REF A;  2FSR A;  2WPW A;  4MHD A;  2GAN A;  2QML A;  4KOT A;  4UWJ A;  1Z4E A;  4E2A A;  4U9Y A;  1PUA A;  4JJX A;  2J8N A;  5F47 A;  1QST A;  5E96 A;  2PC1 A;  2BSW A;  1FY7 A;  5DWN A;  4L8A A;  5J8C A;  4CRY B;  2JDD A;  1CM0 A;  2JDC A;  4KVX A;  3QB8 A;  3DR6 A;  2KCW A;  2G0B A;  2ZW6 A; 
#chains in the Genus database with same CATH topology
 3D7D A;  2PJ6 A;  4ZI6 A;  2CNS A;  2NYQ A;  5F09 A;  3PEI A;  4MJ8 A;  4MXU A;  4CRZ B;  4CGO A;  4JXQ A;  2PRB A;  2GLF A;  2PE3 A;  1CPS A;  2HQY A;  3PB7 X;  3PGP A;  1I21 A;  2R98 A;  3IWG A;  4B13 A;  5JPH A;  2PJ5 A;  2CTC A;  3B3C A;  4P4I A;  1CP6 A;  1Y7R A;  4A2Z A;  4DJL A;  2C6G A;  2NSM A;  4X3R A;  3VH9 A;  1IYL A;  5HVG A;  4KSF A;  3RO0 A;  2HB6 A;  2VI7 A;  1ZLI A;  4F6A A;  2AFS A;  5AG6 A;  2P6F A;  4MFZ A;  4YFJ A;  3GYA A;  1CG2 A;  1LRZ A;  1X10 A;  2V77 A;  3B3T A;  2XEG A;  2B4B A;  1Q2D A;  2VZZ A;  5CBM A;  4FUU A;  2JEW A;  3BI0 A;  4C2X A;  4OAE A;  1H8L A;  1YW4 A;  3PBE A;  4OIW A;  4UBR A;  1KUY A;  4X5K A;  2GLJ A;  4LQG A;  1UFH A;  4PXC A;  3D7H A;  4KLV A;  5IB0 A;  2GIV A;  4MFL A;  2B5G A;  2VXK A;  3P2H A;  2GFQ A;  1EE3 P;  4KZT A;  4MFQ A;  4MCP A;  4NF1 A;  4A33 A;  4JZ0 A;  4CPA A;  2JBJ A;  4P4E A;  1S5K A;  2BO9 A;  1U6M A;  3KQZ A;  4CAV A;  3PZJ A;  1Y0Y A;  4ORF A;  4UEF A;  4QC6 A;  4KOS A;  1RTQ A;  4IK2 A;  4Y49 C;  5EBV A;  5JM6 A;  2O53 A;  4R7M A;  6CPA A;  1R57 A;  3JVN A;  1YLO A;  5F46 A;  4MCQ A;  2X7B A;  2BEI A;  5H86 A;  2G3T A;  1S3Z A;  1XE4 A;  4PPZ A;  4R3K A;  2CNT A;  2WPX A;  1ZLH A;  3NH8 A;  2QIR A;  3FVL A;  1A2Z A;  2YGW A;  4MFK A;  4KOX A;  4R87 A;  3T9Y A;  5D8N A;  4L89 A;  4AB7 A;  1XRY A;  1N71 A;  2OH1 A;  3TO7 A;  1HEE A;  2WSA A;  3PRT A;  3FMC A;  2DPT A;  3KKW A;  4AXV A;  3E0K A;  5G1Z A;  5C88 A;  2IL4 A;  1NSA A;  3HUV A;  1RXT A;  7CPA A;  2Z3P A;  4C68 A;  1CX8 A;  2ZXV A;  4UIA A;  1Z5R A;  1BPM A;  3CXS A;  1MK4 A;  4ZX9 A;  1M4L A;  3V7Z A;  1Y9W A;  3LWU A;  2AFX A;  1IIC A;  3HLP A;  1P0H A;  4PV6 A;  4OC1 A;  3EC4 A;  2YND A;  2ARH A;  4OC4 A;  4ZBG A;  3PB6 X;  4HKF A;  4F8Z A;  5K8N A;  1Z8W A;  3TCV A;  1QMU A;  1CJW A;  2AFU A;  4B5O A;  4Z65 A;  3H4Q A;  3S9L A;  3TE4 A;  4MY0 A;  4LQ6 A;  1XEB A;  2Z3M A;  3GIU A;  1Z9U A;  1TXR A;  1YW6 A;  1ZG8 A;  1Q2C A;  3R9G A;  4CYO A;  4EFD A;  1MJA A;  2Q4Z A;  3BHX A;  3N7Z A;  1F2O A;  2PJA A;  3R1K A;  2P6G A;  2IQ6 A;  4UEE A;  1IGB A;  1IU8 A;  3P2F A;  4AG9 A;  2CF4 A;  2ZW5 A;  3ZJ0 A;  1VGY A;  3D67 A;  3D8P A;  3SXO A;  2OR4 A;  1TKF A;  3JRU A;  2FL4 A;  3I9S A;  2ZEO A;  5H84 A;  3NA6 A;  3D2M A;  3PP9 A;  3F0A A;  3TTH A;  2C6P A;  2AJ6 A;  1B87 A;  4IUS A;  4CGM A;  2B3V A;  2PDO A;  4UEZ A;  3FJU A;  3T8W A;  1YQE A;  5LRG A;  1MJ9 A;  2PJC A;  1LCP A;  3S6G A;  4CYP A;  5JQ4 A;  2F7V A;  1Z4R A;  2Z3O A;  1QSM A;  3C26 A;  4KOW A;  4NXY A;  1NSL A;  3WC7 A;  4M85 A;  3D4U A;  4XPD C;  2QVP A;  2EBJ A;  3VWD A;  3WC5 A;  1UWY A;  5THW A;  2YNC A;  3D2P A;  1M4I A;  2Q4Y A;  4UCN A;  1M44 A;  4PXB A;  3S9N A;  1QSO A;  4OKO A;  4LX9 A;  4CAF A;  4JD6 A;  1R43 A;  4MHZ A;  3R96 A;  2BL1 A;  4E0A A;  1S7K A;  4NGR A;  1AUG A;  4QB9 A;  3G3S A;  3QAY A;  2EK9 A;  4M6H A;  4IHM A;  3BXM A;  4OC2 A;  3VWE A;  3W6X A;  3LOD A;  1Z8L A;  4R9M A;  5AGE A;  1HDQ A;  3KZW A;  4XPK A;  2G9D A;  4QBJ A;  4UWI A;  1I1D A;  3QAH A;  2PRQ A;  1ELL P;  2YNC C;  4FD5 A;  2Q43 A;  4DNC A;  1ARM A;  4FBE A;  4P4F A;  3H8G A;  4MRI A;  2FS5 A;  4I49 A;  5KTA A;  4CAE A;  4R6T A;  2DF5 A;  3LAC A;  4MCS A;  2BUE A;  3QNV A;  4U5Y A;  4XPL A;  3ZZI A;  2JLM A;  1M4D A;  1L0C A;  1ZO0 A;  3R9F A;  3KR5 A;  1QQ9 A;  3DSB A;  1IOI A;  1TIQ A;  2O4H A;  5G22 A;  2QEC A;  5A27 A;  3DNS A;  3WT4 A;  2Z3L A;  1BPN A;  3IGR A;  1XJO A;  2CY2 A;  1YME A;  3B7I A;  2CNM A;  3SHP A;  1TKJ A;  2REE A;  2WYR A;  4Q7A A;  4IF5 A;  2PJB A;  2R7H A;  5KTC A;  1Z8X A;  3IEH A;  4WWV A;  4CS0 B;  5GCN A;  1KUX A;  1YVO A;  3FBU A;  3H8E A;  1SQH A;  3IFE A;  2AFM A;  2FT0 A;  3EY5 A;  2PJ7 A;  5LYD A;  4CYQ A;  4YGO A;  2Z11 A;  3EFA A;  4BD9 A;  4FD4 A;  4XNH C;  3LMS A;  3FRM A;  3PB8 X;  4GS4 A;  2ZOF A;  4CGN A;  2ZEL A;  2H5M A;  2C6C A;  1PYT B;  1WK4 A;  4R8F A;  1TF8 A;  1YLE A;  2HUZ A;  2R1I A;  4Y49 B;  5AG5 A;  2ZOG A;  4RI1 A;  2D4O A;  2D4P A;  2PVV A;  2A4N A;  4ZX8 A;  2C1C A;  3FEE A;  2G3A A;  5DS0 A;  4A38 A;  4GM5 A;  3GKR A;  3SJE A;  4MY3 A;  3EXN A;  4P6Y A;  4B5P B;  2B4D A;  4P45 A;  2B5G B;  3TO9 A;  1DTD A;  4BMH A;  5HVH A;  4J3G A;  1YK3 A;  2AFW A;  2EO8 A;  2YNE A;  5EC4 A;  4KOR A;  2J8R A;  2QYV A;  3FB3 A;  3IIB A;  3FNC A;  3KAS A;  4KVM E;  1R3N A;  2PIY A;  2Q04 A;  4B11 A;  2XEI A;  2J8M A;  4NGS A;  3RNZ A;  1BOB A;  1YRE A;  2Q44 A;  2WZN A;  3SI0 A;  5C82 A;  4P4B A;  2PIZ A;  4KUB A;  4P44 A;  5K8P A;  1JWQ A;  2Q0Y A;  4MMO A;  3FXT A;  4NJQ A;  5LYF A;  4EVY A;  3IWW A;  3T90 A;  2V8D A;  3IJ3 A;  4E8O A;  5LRK A;  1M1D A;  2PJ9 A;  2RB7 A;  1S7F A;  2FIA A;  4FD7 A;  4NFR A;  2V8H A;  4UFW A;  3N5F A;  2EWB A;  3UY5 A;  2PR1 A;  2V8G A;  5JGF A;  4UFV A;  2F8H A;  1Z8T A;  2PR8 A;  3R95 A;  3S6K A;  4BBH A;  2IMO A;  4NSQ A;  5J8F A;  1B6B A;  5HH1 A;  1P4N A;  3B3S A;  3S6F A;  5AG4 A;  4KSI A;  4DUK A;  2Y0M A;  4HNW B;  4M3S A;  1I12 A;  2PSW A;  1Z2L A;  4B6Z A;  1PU9 A;  5D29 A;  4H6U A;  1BO4 A;  3TT2 A;  3TX8 A;  4HNX B;  1J4J A;  1BAV A;  3R9E A;  3WAB A;  4HNY B;  4QUS A;  2CXA A;  1QSR A;  1OZP A;  1XMB A;  1XBU A;  4NGP A;  3GLJ A;  3KQX A;  3FEC A;  4KOY A;  3CDX A;  3K2K A;  3RBU A;  1IY7 A;  2BCO A;  2I00 A;  5G20 A;  1KZF A;  4R76 A;  2K5T A;  2HV2 A;  4ZY0 A;  2PVW A;  5IX3 A;  4BIN A;  1DE4 C;  4OP4 A;  2ZED A;  4ONU A;  1Q2Y A;  3BLN A;  4ONW A;  1LAM A;  3NH5 A;  3MGD A;  4UCP A;  3NH4 A;  4AVB A;  3DR8 A;  4TWE A;  3CPX A;  4W9Y A;  4XPD B;  2OU2 A;  2ZEM A;  4YU9 A;  4CGL A;  3VAR A;  1WWZ A;  2FIW A;  3TOB A;  1M4G A;  4UFX A;  4PK2 A;  2FCK A;  5ISV A;  3IWE A;  3D3S A;  1CBX A;  2B58 A;  1QSN A;  2Z0Z A;  4CGP A;  8CPA A;  2Q4V A;  1XF8 A;  4PK3 A;  4KSA A;  3SXN A;  4WJB A;  4C2Z A;  3V8I A;  3PB4 X;  4CAW A;  2O28 A;  1X12 A;  1XMT A;  2PCU A;  1LAN A;  3PFO A;  3SI2 A;  3TC8 A;  2Q7B A;  4GXH A;  4PSW A;  2OZH A;  4UF4 A;  3H8F A;  1YGH A;  2ZPA A;  2DXQ A;  3V38 A;  2EK8 A;  2GU2 A;  4OID A;  4F0X A;  2RC4 A;  3GB0 A;  3D66 A;  2C27 A;  3W91 A;  3FX6 A;  4RS2 A;  4G1P A;  4NGN A;  4P10 A;  1BLL E;  1VHS A;  1IID A;  2NMT A;  2PJ4 A;  2VBQ A;  3G8W A;  2Q7S A;  5LRJ A;  2IJZ A;  3PFE A;  3FED A;  3RAM A;  2P6E A;  1KWM A;  1HDU A;  3IC1 A;  2ABZ A;  4MHY A;  4A37 A;  1F2P A;  4K30 A;  2B3U A;  2XEF A;  4ZY2 A;  1YR0 A;  5AG7 A;  4C2Y A;  1Y7E A;  1ON0 A;  2I3C A;  1LFW A;  4K3N A;  1XIX A;  1NMT A;  1ZG9 A;  2OB0 A;  2VZY A;  5DWM A;  4NJR A;  3WC6 A;  4TNU A;  1S60 A;  1YX0 A;  3BJ8 A;  3FH4 A;  4OME A;  1VHE A;  4PQA A;  3WR7 A;  4YRH A;  1CP7 A;  4H2K A;  3LD2 A;  1GYT A;  3I3G A;  3S9M A;  2ZEN A;  1S7L A;  1PCA A;  4EWT A;  4NGM A;  2QJ8 A;  2ZEG A;  1F57 A;  4P4J A;  4U9Z A;  3B3V A;  4ZY1 A;  3FIX A;  2ZEP A;  1TF9 A;  3K9T A;  4JLY A;  4X2T A;  5BWA B;  5I0C A;  4PSX A;  4MBU A;  1OBR A;  4XNH B;  1NE9 A;  4UA3 A;  4II9 A;  4ZGY B;  2V8V A;  4JXR A;  2PQ8 A;  1ARL A;  3IU1 A;  2VEZ A;  1Y0R A;  4OC0 A;  1FNO A;  2ANP A;  1MJB A;  3A9L A;  1JQG A;  2ZW4 A;  4KOV A;  1RO5 A;  2AFO A;  2ZEF A;  3H5Z A;  4R57 A;  4B5P A;  3TO6 A;  2EUI A;  2Z3N A;  3I1U A;  5F49 A;  5FVJ A;  4IAV A;  4MHP A;  3SJX A;  2F5I A;  2R8V A;  2FE7 A;  3K9U A;  1YVK A;  1LOK A;  3PB9 X;  2AFZ A;  4F9V A;  3SJF A;  2POK A;  4MFP A;  5HVF A;  1IYK A;  4B12 A;  1K4J A;  5J1Q A;  3EO4 A;  4KUA A;  3L2N A;  4MCR A;  3CXQ A;  5IB9 A;  3TFY A;  4A39 A;  4Q38 A;  4C7I A;  3DDD A;  2Q51 A;  4AG7 A;  3MRU A;  2ZW7 A;  2CTB A;  1VKC A;  4F0Y A;  3CXP A;  3D68 A;  4NGQ A;  3B35 A;  2I79 A;  2GRE A;  4NCZ A;  1LAP A;  4LUA A;  4M6I A;  4RN7 A;  4PXE A;  5LYL A;  3MN8 A;  2XEJ A;  3FF3 A;  3BJ7 A;  5IV0 A;  2B4D B;  3S6H A;  4FAI A;  3KHX A;  2Z10 A;  4UCM A;  1V0C A;  2VQY A;  3KHZ A;  4ZYQ A;  4A31 A;  1KUV A;  2ATR A;  2JEV A;  2PJ1 A;  1IB1 E;  3GY9 A;  4OAD A;  5KTD A;  3NE8 A;  3CZX A;  4KVO E;  4MHN A;  3SJG A;  1ZG7 A;  3KGQ A;  3TOA A;  5EMI A;  4FD6 A;  3FYN A;  3NFZ A;  3VAT A;  2OOT A;  3F8K A;  3ISX A;  5G21 A;  2CIJ A;  2JBK A;  3W6S A;  4A95 A;  5K8M A;  5CNP A;  1IOF A;  3KL9 A;  4AVC A;  4RUH A;  2DPS A;  3F5B A;  1TKH A;  2RFH A;  3B2Y A;  1AMP A;  1Q7L A;  4PXD A;  3JUW A;  4KOU A;  4EME A;  3RYO A;  3KR4 A;  4MI4 A;  3B8G A;  4MFJ A;  2PJ8 A;  4KLW A;  4C7H A;  4A30 A;  4NEX A;  5F48 A;  2OZG A;  2GE3 A;  4QVT A;  4X8I A;  3DGV A;  1ELM P;  3JTK A;  3OWC A;  4H6Z A;  4A94 A;  5K8O A;  1AYE A;  1YSJ A;  3PBB A;  4P4D A;  4R3L A;  2ZEE A;  3NE7 A;  4FWU A;  5HMN A;  4JWP A;  1GHE A;  2EVN A;  1S7N A;  3DLJ A;  4OLL A;  2OZU A;  1CPX A;  3D7G A;  4F9U A;  2FXF A;  2AE6 A;  3SI1 A;  4KS9 A;  2VL1 A;  1Y9K A;  2PJ3 A;  2ZEH A;  4JYW A;  4CAX A;  5HXD A;  4CYN A;  4AVA A;  2P0W A;  1VIX A;  4H89 A;  3KI9 A;  5LYI A;  2FVG A;  2REF A;  4DYO A;  2FSR A;  2WPW A;  4MHD A;  2GAN A;  2QML A;  4M6G A;  2BOA A;  4KOT A;  4UWJ A;  1Z4E A;  2WUU A;  3IO1 A;  4HPS A;  4NGT A;  5CPA A;  4E2A A;  4U9Y A;  5I4M A;  1PUA A;  3RZA A;  1VHO A;  2J9A A;  4JJX A;  2J8N A;  2PJ0 A;  3IU2 A;  5F47 A;  1QST A;  5A28 A;  2ODF A;  5E96 A;  2HC9 A;  3ISZ A;  2PC1 A;  1XFO A;  4Q36 A;  2BSW A;  4B10 A;  1FY7 A;  5DWN A;  3CT9 A;  4UIB A;  4A32 A;  2PJ2 A;  4L8A A;  5J8C A;  5ELY A;  3CPA A;  2DEA A;  4CRY B;  2JDD A;  3BI1 A;  4OC3 A;  4OC5 A;  1CM0 A;  3B3W A;  3D7F A;  2JDC A;  4KVX A;  3QB8 A;  3GUX A;  5JH9 A;  4B14 A;  2Z3K A;  3DR6 A;  4YWY A;  4O23 A;  2KCW A;  2G0B A;  1FT7 A;  1XOV A;  2ZW6 A; 
#chains in the Genus database with same CATH homology
 2CNS A;  4MJ8 A;  4CRZ B;  4CGO A;  4JXQ A;  2PRB A;  2HQY A;  3PGP A;  1I21 A;  2R98 A;  3IWG A;  4B13 A;  5JPH A;  1Y7R A;  4A2Z A;  1IYL A;  4KSF A;  2VI7 A;  5AG6 A;  2P6F A;  4MFZ A;  4YFJ A;  3GYA A;  1LRZ A;  2B4B A;  1Q2D A;  2VZZ A;  4C2X A;  4OAE A;  4X5K A;  4UBR A;  1KUY A;  1UFH A;  5IB0 A;  4KLV A;  2GIV A;  4MFL A;  2B5G A;  2VXK A;  3P2H A;  4KZT A;  4MFQ A;  4NF1 A;  4A33 A;  1S5K A;  1U6M A;  4CAV A;  3PZJ A;  4ORF A;  4Y49 C;  4QC6 A;  4KOS A;  5EBV A;  1R57 A;  3JVN A;  5F46 A;  2X7B A;  2BEI A;  5H86 A;  2G3T A;  1S3Z A;  1XE4 A;  4R3K A;  2CNT A;  2WPX A;  2QIR A;  2YGW A;  4MFK A;  4KOX A;  4R87 A;  3T9Y A;  4L89 A;  4AB7 A;  1N71 A;  2OH1 A;  3TO7 A;  2WSA A;  2DPT A;  3KKW A;  3E0K A;  5G1Z A;  5C88 A;  2IL4 A;  1RXT A;  2Z3P A;  4C68 A;  2ZXV A;  3CXS A;  1MK4 A;  1Y9W A;  1IIC A;  1P0H A;  4PV6 A;  3EC4 A;  2YND A;  2ARH A;  4ZBG A;  4HKF A;  3TCV A;  1CJW A;  4B5O A;  3H4Q A;  3TE4 A;  4MY0 A;  1XEB A;  2Z3M A;  1Z9U A;  3R9G A;  1Q2C A;  4CYO A;  1MJA A;  3N7Z A;  3R1K A;  2P6G A;  3P2F A;  4AG9 A;  2ZW5 A;  3ZJ0 A;  3D8P A;  3SXO A;  2FL4 A;  3I9S A;  5H84 A;  3D2M A;  3PP9 A;  3F0A A;  3TTH A;  2AJ6 A;  4IUS A;  1B87 A;  4CGM A;  2B3V A;  2PDO A;  1MJ9 A;  3S6G A;  4CYP A;  5JQ4 A;  1Z4R A;  2Z3O A;  1QSM A;  3C26 A;  4KOW A;  4NXY A;  1NSL A;  4M85 A;  4XPD C;  3VWD A;  2YNC A;  3D2P A;  1M4I A;  2Q4Y A;  4UCN A;  1M44 A;  1QSO A;  4LX9 A;  4CAF A;  4JD6 A;  3R96 A;  2BL1 A;  4E0A A;  1S7K A;  4QB9 A;  3G3S A;  3VWE A;  3W6X A;  3LOD A;  4R9M A;  5AGE A;  4XPK A;  4QBJ A;  4UWI A;  1I1D A;  3QAH A;  2YNC C;  4FD5 A;  4DNC A;  2FS5 A;  4I49 A;  5KTA A;  4CAE A;  2BUE A;  4U5Y A;  4XPL A;  3ZZI A;  2JLM A;  1M4D A;  1L0C A;  1ZO0 A;  3R9F A;  3DSB A;  1TIQ A;  5G22 A;  2QEC A;  5A27 A;  3DNS A;  2Z3L A;  3IGR A;  2CY2 A;  2CNM A;  3SHP A;  2REE A;  4IF5 A;  2R7H A;  5KTC A;  4CS0 B;  5GCN A;  1KUX A;  1YVO A;  3FBU A;  1SQH A;  2FT0 A;  3EY5 A;  4CYQ A;  4YGO A;  2Z11 A;  3EFA A;  4FD4 A;  4XNH C;  3FRM A;  4GS4 A;  4CGN A;  2H5M A;  1WK4 A;  1YLE A;  2HUZ A;  2R1I A;  4Y49 B;  5AG5 A;  4F6A A;  4RI1 A;  2D4O A;  2D4P A;  2A4N A;  2G3A A;  3GKR A;  4MY3 A;  3EXN A;  4B5P B;  2B4D A;  4BMH A;  2B5G B;  3TO9 A;  4J3G A;  1YK3 A;  2YNE A;  5EC4 A;  4KOR A;  2J8R A;  3FB3 A;  3FNC A;  4KVM E;  4B11 A;  2Q04 A;  2J8M A;  1BOB A;  1YRE A;  2Q44 A;  5C82 A;  4KUB A;  2Q0Y A;  3FXT A;  4EVY A;  3T90 A;  4E8O A;  1M1D A;  1S7F A;  2FIA A;  4FD7 A;  4UFW A;  3UY5 A;  2PR1 A;  4UFV A;  3R95 A;  2PR8 A;  4BBH A;  3S6K A;  4NSQ A;  5J8F A;  1B6B A;  5HH1 A;  1P4N A;  3S6F A;  5AG4 A;  2Y0M A;  4HNW B;  4M3S A;  1I12 A;  2PSW A;  1PU9 A;  4H6U A;  1BO4 A;  3TT2 A;  4HNX B;  1J4J A;  3R9E A;  4HNY B;  4QUS A;  2CXA A;  1QSR A;  1OZP A;  4KOY A;  2I00 A;  5G20 A;  1KZF A;  5IX3 A;  2K5T A;  2HV2 A;  4ONU A;  1Q2Y A;  3BLN A;  4UCP A;  3MGD A;  4AVB A;  3DR8 A;  4XPD B;  2OU2 A;  4CGL A;  1WWZ A;  2FIW A;  3TOB A;  1M4G A;  4UFX A;  4PK2 A;  2FCK A;  5ISV A;  3IWE A;  3D3S A;  2B58 A;  4CGP A;  1QSN A;  2Z0Z A;  2Q4V A;  1XF8 A;  4PK3 A;  4KSA A;  3SXN A;  4C2Z A;  3V8I A;  4CAW A;  2O28 A;  1XMT A;  2Q7B A;  4PSW A;  2OZH A;  1YGH A;  2ZPA A;  2DXQ A;  4F0X A;  2RC4 A;  2C27 A;  3W91 A;  4RS2 A;  1VHS A;  2NMT A;  1IID A;  2VBQ A;  3G8W A;  2P6E A;  4K30 A;  2B3U A;  1YR0 A;  5AG7 A;  4C2Y A;  1ON0 A;  1XIX A;  1NMT A;  2OB0 A;  5DWM A;  2VZY A;  1S60 A;  1YX0 A;  3BJ8 A;  3WR7 A;  4YRH A;  3LD2 A;  3I3G A;  1S7L A;  4U9Z A;  3FIX A;  4JLY A;  5BWA B;  5I0C A;  4PSX A;  4MBU A;  4XNH B;  1NE9 A;  4UA3 A;  4II9 A;  4ZGY B;  4JXR A;  2PQ8 A;  3IU1 A;  2VEZ A;  3A9L A;  1MJB A;  2ZW4 A;  4KOV A;  1RO5 A;  3H5Z A;  4R57 A;  4B5P A;  3TO6 A;  2EUI A;  2Z3N A;  5F49 A;  5FVJ A;  2F5I A;  2R8V A;  2FE7 A;  3K9U A;  1YVK A;  4MFP A;  1IYK A;  4B12 A;  1K4J A;  3EO4 A;  4KUA A;  3CXQ A;  3TFY A;  4Q38 A;  4C7I A;  3DDD A;  4AG7 A;  2ZW7 A;  1VKC A;  4F0Y A;  3CXP A;  2I79 A;  4NCZ A;  4LUA A;  3BJ7 A;  5IV0 A;  2B4D B;  3S6H A;  2Z10 A;  4UCM A;  1V0C A;  2VQY A;  4A31 A;  1KUV A;  2ATR A;  2JEV A;  3GY9 A;  1IB1 E;  4OAD A;  5KTD A;  4KVO E;  3TOA A;  4FD6 A;  3FYN A;  3F8K A;  5G21 A;  3W6S A;  4A95 A;  5CNP A;  4AVC A;  2DPS A;  3F5B A;  3JUW A;  4KOU A;  3RYO A;  4MI4 A;  3B8G A;  4MFJ A;  4KLW A;  4C7H A;  4A30 A;  4NEX A;  5F48 A;  2OZG A;  2GE3 A;  4QVT A;  3OWC A;  3JTK A;  4H6Z A;  4R3L A;  5HMN A;  3NE7 A;  4JWP A;  1GHE A;  2EVN A;  1S7N A;  4OLL A;  2OZU A;  2FXF A;  2AE6 A;  4KS9 A;  1Y9K A;  4CAX A;  4CYN A;  4AVA A;  2P0W A;  4H89 A;  2REF A;  2FSR A;  2WPW A;  4MHD A;  2GAN A;  2QML A;  4KOT A;  4UWJ A;  1Z4E A;  2WUU A;  4E2A A;  4U9Y A;  1PUA A;  4JJX A;  2J8N A;  3IU2 A;  5A28 A;  5F47 A;  1QST A;  5E96 A;  4B10 A;  2PC1 A;  4Q36 A;  2BSW A;  1FY7 A;  5DWN A;  4A32 A;  4L8A A;  5J8C A;  4CRY B;  2JDD A;  1CM0 A;  2JDC A;  4KVX A;  3QB8 A;  4B14 A;  2Z3K A;  3DR6 A;  2KCW A;  2G0B A;  2ZW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...