5KTDA

Fdhc with bound products: coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
187
structure length
187
Chain Sequence
VNFNLKANTTYLRLVEENDAEFICTLRNNDKLNTYISKSTGDIKSQAEWIRNYKNRENNGEEYYFIIFRSDDQSPIGTVRLYDFHENPKSFCWGSWILNEHKTKYAAVESALLVYEAGFSTLGFEQSHFEVMKGNDKVHSFHLKMGAQKISEDDENIYYIFPKSKYKENKIQYARFLGKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Investigation of FdhC from Acinetobacter nosocomialis: A Sugar N-Acyltransferase Belonging to the GNAT Superfamily.
pubmed doi rcsb
source organism Acinetobacter nosocomialis
molecule tags Transferase
molecule keywords FdhC
total genus 63
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ktdA00
4KLVA 5F47A 1YREA 4XPDC 4FD4A 4M85A 1GHEA 2OZHA 3JUWA 1MJAA 4FD6A 4AB7A 4RS2A 2B5GA 4NF1A 5F48A 4XPKA 2B3VA 1S7LA 3H4QA 1S60A 4UBRA 3TO6A 2Q4YA 1TIQA 1YR0A 4H6ZA 2I00A 3W6XA 3DR6A 4MJ8A 4F6AA 2ARHA 2P6EA 4JLYA 1FY7A 1S5KA 2KCWA 4DNCA 3F5BA 4E0AA 3VWDA 4B5OA 2IL4A 3I3GA 2VEZA 2OB0A 4U9ZA 4R9MA 4H6UA 5H86A 3FXTA 4AVBA 2ATRA 4II9A 3S6HA 5HMNA 2FS5A 2Q7BA 1KUXA 2PQ8A 2J8MA 4IF5A 4MBUA 3S6GA 5C82A 2OZUA 5IV0A 1CM0A 1IICA 1NSLA 2JEVA 4E8OA 3D3SA 2G3AA 2PR8A 4YFJA 3R96A 3TFYA 3ZJ0A 5J8CA 2PDOA 2NMTA 4PSWA 1M1DA 5GCNA 4LUAA 2EUIA 3T90A 2FCKA 3F0AA 5C88A 5IX3A 4MI4A 1CJWA 3VWEA 3D2PA 2F5IA 3JVNA 4ORFA 3V8IA 3G3SA 3EFAA 2WPWA 1M4IA 4KUBA 4PK2A 3W6SA 2CNMA 1PU9A 1S7NA 1Y9WA 1S7KA 4K30A 4B5PB 4FD7A 3RYOA 4QB9A 5F49A 4R3KA 1YK3A 3D2MA 3DR8A 3OWCA 5EBVA 4UA3A 4KOTA 1QSOA 2ZW4A 4AG7A 3ZZIA 4CRYB 4XNHB 1OZPA 4JJXA 2VXKA 2FXFA 1XE4A 5HH1A 1QSRA 1XMTA 1YX0A 2D4PA 2Q0YA 4UWIA 2J8NA 2C27A 2AE6A 1U6MA 2AJ6A 2CNSA 3G8WA 4CAWA 1J4JA 4LX9A 2PC1A 4KZTA 2Q4VA 4OLLA 3R9GA 2EVNA 5KTAA 1Z4EA 3EC4A 4CRZB 3GY9A 3TTHA 1BOBA 3TCVA 4UWJA 2FSRA 4Y49B 1KUVA 3FRMA 5JQ4A 3K9UA 3DNSA 2REEA 2B4BA 1LRZA 1YVOA 2FIAA 3R9EA 2R7HA 2CY2A 4QUSA 2Q04A 4Y49C 3R1KA 1XEBA 2B3UA 4MY3A 3SXOA 1Z9UA 3TOAA 4J3GA 2VZYA 2B4DB 3BLNA 2P6GA 2Z10A 3FNCA 3CXSA 4AVAA 4AVCA 4KOXA 1QSNA 4CAVA 2VZZA 4GS4A 2J8RA 3LD2A 3PZJA 5H84A 1L0CA 4XNHC 4U5YA 2P0WA 3WR7A 4X5KA 5ISVA 2BL1A 3TO9A 4JD6A 4M3SA 4NSQA 2A4NA 3T9YA 2R8VA 3N7ZA 3P2HA 2OZGA 5CNPA 4KOSA 2DXQA 4R3LA 2G0BA 4L8AA 4QC6A 1QSMA 1MJBA 1VKCA 4EVYA 4HNXB 3EO4A 4R57A 1MK4A 3CXPA 3IGRA 2PSWA 3BJ8A 2ZW7A 2ZW5A 1XIXA 4KOYA 1M44A 4NXYA 3EXNA 4JXQA 1WWZA 3GYAA 1B87A 1QSTA 2BUEA 3FYNA 1I12A 2OU2A 3FBUA 1I21A 3SXNA 3CXQA 5J8FA 4PSXA 1BO4A 2WPXA 4KOUA 4CAXA 3I9SA 3DDDA 4L89A 2O28A 1P0HA 4KVME 2BEIA 1KUYA 2X7BA 3IWGA 4NEXA 2FL4A 2JDDA 2ZXVA 2GIVA 3KKWA 2JLMA 3R9FA 3S6KA 2FIWA 1RXTA 2G3TA 2QIRA 3QAHA 3TE4A 1Q2CA 2HV2A 5IB0A 2VQYA 1UFHA 4KORA 2PR1A 4E2AA 3S6FA 4CS0B 5I0CA 1Y9KA 4XPLA 5KTDA 1Y7RA 2JDCA 4I49A 1V0CA 3FIXA 3PGPA 4RI1A 1YVKA 1R57A 1XF8A 2CNTA 5DWNA 4IUSA 3TT2A 3TOBA 1NMTA 2HUZA 1YLEA 4PV6A 3D8PA 4HNWB 2RC4A 1VHSA 4YRHA 4KVXA 4H89A 4HKFA 3PP9A 3EY5A 4QVTA 3W91A 2HQYA 1MJ9A 2B4DA 3MGDA 5E96A 4AG9A 1Z4RA 4BMHA 3C26A 1I1DA 5DWMA 5EC4A 2I79A 2H5MA 2B5GB 3BJ7A 2PRBA 2GANA 1N71A 2D4OA 3SHPA 4JWPA 2QECA 1IYLA 4NCZA 4OAEA 2ZW6A 4MHDA 3R95A 1M4DA 3TO7A 4ONUA 2VI7A 5FVJA 1IIDA 4KOVA 1Q2DA 3GKRA 2Z11A 1P4NA 4PK3A 4ZBGA 3B8GA 1IYKA 2B58A 4OADA 3P2FA 1SQHA 2P6FA 1PUAA 4MY0A 5F46A 2K5TA 4JXRA 2Z0ZA 4KOWA 2Y0MA 2GE3A 3FB3A 4YGOA 1IB1E 4XPDB 2BSWA 1ON0A 3E0KA 4QBJA 4KLWA 2R1IA 2Q44A 4KUAA 1S7FA 4R87A 1S3ZA 4U9YA 5KTCA 1K4JA 3QB8A 4HNYB 1RO5A 2FE7A 2FT0A 2ZPAA 2VBQA 1B6BA 5JPHA 4KVOE 4B5PA 2OH1A 1KZFA 1M4GA 1YGHA 4F0YA 2QMLA 3DSBA 3LODA 3UY5A 4FD5A 1NE9A 1WK4A 2REFA 2R98A 1Q2YA 3F8KA 3NE7A
chains in the Genus database with same CATH superfamily
3PBEA 3QAYA 3HUVA 4MCPA 4KLVA 3SI2A 4NGQA 4NGNA 4B14A 5F47A 1YREA 3D7HA 3PB9X 5JM6A 4CAFA 3IEHA 4XPDC 3T8WA 4FD4A 4M85A 3N5FA 1HDUA 1GHEA 2OZHA 2PJ3A 4TWEA 4AXVA 2Z3KA 4H2KA 5DS0A 2V8HA 3JUWA 1MJAA 4FD6A 4MCRA 3S9LA 4AB7A 2Q51A 4RS2A 2B5GA 4NF1A 5F48A 4XPKA 2ZEMA 1BPNA 1GYTA 2B3VA 1S7LA 3H4QA 1ZG7A 1S60A 2Z3OA 4UBRA 3TO6A 2Q4YA 4PXCA 3SJFA 1TIQA 1TF9A 3NH4A 1YR0A 2ZOGA 2ZEEA 4OIWA 2IQ6A 4H6ZA 2I00A 3W6XA 2PVVA 3DR6A 4O23A 4MJ8A 4NGTA 3RBUA 4F6AA 3ISXA 4OC2A 5AG4A 2ARHA 1XOVA 2P6EA 4R76A 1DE4C 1FY7A 4IAVA 4JLYA 1VIXA 4WWVA 1VGYA 1S5KA 5HXDA 2YNEA 2PJ2A 3H8EA 4A37A 5JH9A 1XBUA 3KHZA 5LRGA 2KCWA 4DNCA 3IJ3A 4GM5A 4UFWA 3D4UA 4P45A 4P4EA 3F5BA 4CGNA 4CYOA 1QQ9A 4OC1A 1AMPA 3FEDA 2QYVA 3SJXA 3GUXA 4E0AA 3QNVA 3VWDA 2IL4A 3I3GA 4B5OA 2VEZA 2F7VA 2OB0A 3PB6X 4ZX8A 4U9ZA 2C1CA 4MFQA 4R9MA 4ZX9A 4CPAA 4B11A 4H6UA 3PB4X 5H86A 3FXTA 4AVBA 2ATRA 2AFUA 3S6HA 4GXHA 2FS5A 2Q7BA 2XEFA 5HMNA 4II9A 1KUXA 2PQ8A 5K8OA 5F09A 2ZEHA 2J8MA 3IU1A 4IF5A 2VL1A 4MBUA 4OC4A 1OBRA 1ELLP 3S6GA 4X2TA 4KSFA 4Z65A 5C82A 1BLLE 2OZUA 5IV0A 3WC6A 4MHNA 1CM0A 1IICA 1NSLA 2JEVA 1A2ZA 1Z2LA 4E8OA 4A31A 1H8LA 3PEIA 3RO0A 3D3SA 2G3AA 2PR8A 4UEZA 3B3SA 3R96A 4YFJA 1RTQA 3TFYA 2BO9A 3ZJ0A 5J8CA 1QMUA 2PDOA 2NMTA 4PSWA 1ELMP 4MFLA 1M1DA 5GCNA 4LUAA 2EUIA 4R8FA 3T90A 2GREA 3SI1A 2FCKA 4MCQA 5G1ZA 3F0AA 2JEWA 3B7IA 5C88A 5IX3A 4MI4A 3K9TA 4P4BA 1CJWA 3VWEA 3D2PA 4EFDA 2PJ6A 3GLJA 4NFRA 1VHOA 5LRKA 4UCPA 2F5IA 2ZEOA 4NJQA 3JVNA 4ORFA 3V8IA 3G3SA 3EFAA 4UCMA 1M4LA 2WPWA 3FMCA 1M4IA 5LYIA 3RAMA 2GFQA 3WC5A 4RUHA 4F9UA 1PYTB 4KUBA 4PK2A 3W6SA 4MFZA 4NJRA 2CNMA 4LQGA 1PU9A 4P4DA 4PXEA 1HEEA 1S7NA 3FX6A 3D66A 2CF4A 1Y9WA 1S7KA 5CBMA 4K30A 4B5PB 3CPXA 4FD7A 3RYOA 4F0XA 3JTKA 1FNOA 2XEIA 4MMOA 4QB9A 5F49A 4R3KA 4ZI6A 5ELYA 1YK3A 3D2MA 4OC5A 3FECA 3SJGA 3DR8A 4ZGYB 3OWCA 5EBVA 2F8HA 4Q36A 4UA3A 2WSAA 4PXBA 4C2ZA 4KOTA 1QSOA 2HB6A 2CIJA 2ZW4A 4P4FA 4AG7A 3ZZIA 4CRYB 4MFJA 4XNHB 1OZPA 4JJXA 2VXKA 2FXFA 1XE4A 5HH1A 1QSRA 3L2NA 2EK8A 1XMTA 1YX0A 4OC0A 5BWAB 2D4PA 2Q0YA 3B35A 1F2PA 1YMEA 4UWIA 2J8NA 4B6ZA 2C27A 2AE6A 1TXRA 1LOKA 1U6MA 5A28A 1CP6A 2AJ6A 3DLJA 3B3TA 4Q38A 2CNSA 3G8WA 4FBEA 4CAWA 1J4JA 3JRUA 4LX9A 3WABA 2PC1A 3FH4A 4UFXA 4KZTA 2Q4VA 3KGQA 4OLLA 4FWUA 3R9GA 5LYLA 3B3WA 4NGPA 2EVNA 5KTAA 2JBKA 3DGVA 4DYOA 1Z4EA 3PFOA 1LFWA 1ZLHA 4W9YA 2Z3NA 2EBJA 3EC4A 3GY9A 5G21A 4CRZB 1ZG9A 3TTHA 3KASA 1BOBA 3TCVA 4UWJA 4DJLA 3NE8A 3FVLA 2FSRA 4Y49B 1KUVA 3FRMA 1CG2A 1YLOA 5JQ4A 3K9UA 4ZY2A 3DNSA 4IHMA 6CPAA 2REEA 1F2OA 3KR4A 2B4BA 1BPMA 1LRZA 1PCAA 1YVOA 2FIAA 3R9EA 2R7HA 5AG6A 2CY2A 2WYRA 3PB8X 4QUSA 5J1QA 2Q04A 4Y49C 4TNUA 1ZG8A 2OOTA 2EK9A 4MHYA 3V7ZA 2YNCA 5D8NA 4KSAA 3S9NA 4B12A 3R1KA 4UIAA 3B3VA 4UIBA 1XEBA 2EO8A 4YWYA 2RFHA 3PRTA 2B3UA 1JQGA 4MY3A 3WT4A 4C68A 3SXOA 2WUUA 4C7HA 1Z9UA 4KSIA 3TOAA 4J3GA 2VZYA 2B4DB 2C6CA 3BLNA 2P6GA 4CYNA 1LCPA 2Z10A 3FNCA 1LANA 3CXSA 4AVAA 1FT7A 5D29A 4AVCA 8CPAA 1Z8WA 3PFEA 4PXDA 4KOXA 1QSNA 4CAVA 1Z8XA 3PB7X 3TX8A 2VZZA 4GS4A 2J8RA 3KR5A 2PVWA 3LD2A 3PZJA 2Q4ZA 5H84A 1L0CA 4YU9A 5EMIA 4XNHC 2BCOA 4EMEA 2PJ1A 4U5YA 2P0WA 3WR7A 4PPZA 4X5KA 4PQAA 5ISVA 2BL1A 3TO9A 4JD6A 4P10A 1ZLIA 2C6PA 1F57A 4M3SA 1YSJA 1NSAA 4NSQA 2PRQA 2A4NA 4C7IA 2PJ9A 3T9YA 2EWBA 2R8VA 3N7ZA 3P2HA 2ABZA 2DPTA 2OZGA 4FAIA 5HVGA 3CDXA 3RZAA 4KS9A 5CNPA 4KOSA 2DXQA 4DUKA 4R3LA 2G0BA 4L8AA 4QC6A 5CPAA 3S9MA 2PJ8A 1KWMA 1QSMA 2XEJA 4CYQA 1MJBA 1HDQA 4P4IA 4F8ZA 2HC9A 1CX8A 1VKCA 3FJUA 3H8GA 5AG5A 4EVYA 4HNXB 3BI1A 3EO4A 4R57A 1MK4A 3CXPA 3IGRA 5K8PA 4JZ0A 2PSWA 3BJ8A 2ZW7A 2PE3A 4MFKA 2ZW5A 1XIXA 4KOYA 1M44A 4NXYA 3VARA 3EXNA 4JXQA 1WWZA 4R6TA 3GYAA 1B87A 1QSTA 2BUEA 3CT9A 3FYNA 3KHXA 1ARMA 1I12A 1IGBA 2OU2A 2V77A 3FBUA 1X10A 2OR4A 4MFPA 1I21A 5LRJA 3I1UA 3CXQA 3SXNA 4WJBA 4MRIA 5J8FA 4K3NA 4OMEA 4PSXA 5HVFA 4A38A 2JBJA 1BO4A 2WPXA 2PJAA 3D7DA 3LWUA 3KI9A 2GLJA 4OP4A 4IK2A 5A27A 4KOUA 4NGSA 4CAXA 3I9SA 2V8VA 3DDDA 4CGOA 4L89A 4P44A 4EWTA 2O28A 1P0HA 1CP7A 2PJ5A 4KVME 2BEIA 1KUYA 1CPXA 2QVPA 2J9AA 2X7BA 4A94A 1IOFA 1DTDA 3PBBA 4UFVA 3IWGA 4NEXA 2FL4A 2AFXA 2JDDA 3MRUA 2ZXVA 2FVGA 3D7GA 1TF8A 2GIVA 1YW6A 3KKWA 2JLMA 3SI0A 3R9FA 2PJ7A 3S6KA 3VATA 3IFEA 2FIWA 1RXTA 2G3TA 3GIUA 2QIRA 1R43A 2Z3LA 3QAHA 3TE4A 1Q2CA 2CTBA 2HV2A 4HPSA 1Y0RA 1BAVA 3FF3A 5IB0A 2VQYA 3NH5A 3IU2A 1IU8A 2QJ8A 1IOIA 1YQEA 1UFHA 4F9VA 4UEEA 4KORA 2PR1A 4E2AA 1UWYA 4A95A 5K8NA 3S6FA 4CS0B 3NFZA 5I0CA 5HVHA 1Y9KA 2WZNA 4Q7AA 3WC7A 4XPLA 4A32A 4B13A 5I4MA 2NYQA 5KTDA 3K2KA 2ODFA 3LMSA 4JYWA 4LQ6A 1Y7RA 2JDCA 4RN7A 4B10A 4I49A 1YW4A 3LACA 1AYEA 1V0CA 4P4JA 3H5ZA 4C2YA 3FIXA 4NGMA 3PGPA 4RI1A 2G9DA 1YVKA 1VHEA 2ANPA 1R57A 1IY7A 1XF8A 1Y7EA 4BINA 2CNTA 5DWNA 4ZY0A 3KQZA 2Z3PA 4IUSA 2PIZA 2AFSA 3D7FA 3TT2A 1LAPA 4M6GA 3TOBA 2AFZA 2XEGA 2Z3MA 3NH8A 1NMTA 2GU2A 2ZEFA 3SJEA 2HUZA 2POKA 1YLEA 2PJ0A 3D8PA 4PV6A 4HNWB 3CPAA 2RC4A 2DF5A 3D68A 4A2ZA 1VHSA 2RB7A 4YRHA 4KVXA 4H89A 4G1PA 4HKFA 7CPAA 4CGMA 3PP9A 3EY5A 3KZWA 4QVTA 3W91A 1CBXA 4UF4A 2HQYA 4CGLA 3TC8A 1CPSA 2V8DA 3HLPA 1MJ9A 2AFMA 2B4DA 3MGDA 2PJCA 5E96A 4AG9A 1TKFA 4OIDA 1Z4RA 4BMHA 3C26A 2ZEDA 1I1DA 1JWQA 5G22A 4OC3A 5AGEA 5DWMA 5EC4A 2I79A 5JGFA 2H5MA 4P6YA 2O53A 4M6IA 2B5GB 3GB0A 3BJ7A 2PRBA 2NSMA 3B3CA 2GANA 1LAMA 1N71A 2D4OA 4ZY1A 4OKOA 1Z5RA 2AFOA 2I3CA 3SHPA 4JWPA 4FUUA 2QECA 1IYLA 2ZEPA 4NCZA 4OAEA 4BD9A 4NGRA 3B2YA 1XMBA 2ZW6A 4MHDA 3CZXA 4C2XA 2O4HA 4X3RA 2ZENA 2Q7SA 2IMOA 3IIBA 4UEFA 1M4DA 3R95A 1ARLA 2ZEGA 3TO7A 4ONUA 2VI7A 5FVJA 2PIYA 1IIDA 4KOVA 1Q2DA 4MHPA 2PJBA 1XJOA 2DEAA 3GKRA 3V38A 2Z11A 3IO1A 1P4NA 3H8FA 1ZO0A 4PK3A 4ZBGA 3B8GA 1IYKA 2B58A 3IWWA 4MCSA 4OADA 3FEEA 3IC1A 1AUGA 3P2FA 1SQHA 2P6FA 3D67A 1PUAA 2Q43A 2PJ4A 4MY0A 5F46A 2K5TA 4JXRA 2DPSA 2Z0ZA 4KOWA 4BBHA 2Y0MA 2GE3A 4ZYQA 3FB3A 1TKHA 4YGOA 2GLFA 2V8GA 5THWA 1IB1E 4XPDB 1Z8LA 4M6HA 2YGWA 2AFWA 2BSWA 3RNZA 4A33A 1X12A 1ON0A 3E0KA 4QBJA 5K8MA 2CTCA 4KLWA 2R1IA 2CXAA 2Q44A 4KUAA 4CYPA 2C6GA 1S7FA 3NA6A 3MN8A 3BHXA 4R87A 1S3ZA 4UCNA 4U9YA 5KTCA 2YNDA 3ISZA 1K4JA 3QB8A 4A39A 4HNYB 4ONWA 5AG7A 1RO5A 3IWEA 1Z8TA 2FE7A 2FT0A 1Y0YA 2ZPAA 2VBQA 3KL9A 5G20A 1B6BA 5JPHA 4KVOE 4B5PA 2OH1A 3KQXA 2BOAA 1Q7LA 2PCUA 2YNCC 1KZFA 1M4GA 1XFOA 1YGHA 4F0YA 1XRYA 5LYDA 2QMLA 4X8IA 3VH9A 4CAEA 1R3NA 3DSBA 3LODA 3UY5A 2IJZA 3A9LA 2ZELA 4A30A 1EE3P 4FD5A 1NE9A 1WK4A 3BXMA 4R7MA 2ZOFA 1TKJA 5LYFA 3BI0A 2REFA 2R98A 1Q2YA 3F8KA 3NE7A 4MXUA 5IB9A 4CGPA 4MHZA
chains in the Genus database with same CATH topology
4KLVA 4B14A 5F47A 1YREA 4CAFA 4XPDC 4FD4A 4M85A 1GHEA 2OZHA 2Z3KA 3JUWA 1MJAA 4FD6A 4AB7A 4RS2A 2B5GA 4NF1A 5F48A 4XPKA 2B3VA 1S7LA 3H4QA 1S60A 2Z3OA 4UBRA 3TO6A 2Q4YA 1TIQA 1YR0A 4H6ZA 2I00A 3W6XA 3DR6A 4MJ8A 4F6AA 5AG4A 2ARHA 2P6EA 4JLYA 1FY7A 1S5KA 2YNEA 2KCWA 4DNCA 4UFWA 3F5BA 4CGNA 4CYOA 4E0AA 3VWDA 4B5OA 2IL4A 3I3GA 2VEZA 2OB0A 4U9ZA 4MFQA 4R9MA 4B11A 4H6UA 5H86A 3FXTA 4AVBA 2ATRA 4II9A 3S6HA 5HMNA 2FS5A 2Q7BA 1KUXA 2PQ8A 2J8MA 3IU1A 4IF5A 4MBUA 3S6GA 4KSFA 5C82A 2OZUA 5IV0A 1CM0A 1IICA 1NSLA 2JEVA 4E8OA 4A31A 3D3SA 2G3AA 2PR8A 4YFJA 3R96A 3TFYA 3ZJ0A 5J8CA 2PDOA 2NMTA 4PSWA 4MFLA 1M1DA 5GCNA 4LUAA 2EUIA 3T90A 2FCKA 5G1ZA 3F0AA 5C88A 5IX3A 4MI4A 1CJWA 3VWEA 3D2PA 4UCPA 2F5IA 3JVNA 4ORFA 3V8IA 3G3SA 3EFAA 4UCMA 2WPWA 1M4IA 4KUBA 4PK2A 3W6SA 4MFZA 2CNMA 1PU9A 1S7NA 1Y9WA 1S7KA 4K30A 4B5PB 4FD7A 4F0XA 3RYOA 3JTKA 4QB9A 5F49A 4R3KA 1YK3A 3D2MA 3DR8A 4ZGYB 3OWCA 5EBVA 4Q36A 4UA3A 2WSAA 4C2ZA 4KOTA 1QSOA 2ZW4A 4AG7A 3ZZIA 4CRYB 4MFJA 4XNHB 1OZPA 4JJXA 2VXKA 2FXFA 1XE4A 5HH1A 1QSRA 1XMTA 1YX0A 5BWAB 2D4PA 2Q0YA 4UWIA 2J8NA 2C27A 2AE6A 1U6MA 5A28A 2AJ6A 4Q38A 2CNSA 3G8WA 4CAWA 1J4JA 4LX9A 2PC1A 4UFXA 4KZTA 2Q4VA 4OLLA 3R9GA 2EVNA 5KTAA 1Z4EA 2Z3NA 3EC4A 4CRZB 3GY9A 5G21A 3TTHA 1BOBA 3TCVA 4UWJA 2FSRA 4Y49B 1KUVA 3FRMA 5JQ4A 3K9UA 3DNSA 2REEA 2B4BA 1LRZA 1YVOA 2FIAA 3R9EA 2R7HA 5AG6A 2CY2A 4QUSA 2Q04A 4Y49C 2YNCA 4KSAA 4B12A 3R1KA 1XEBA 2B3UA 4C68A 4MY3A 3SXOA 2WUUA 4C7HA 1Z9UA 3TOAA 4J3GA 2VZYA 2B4DB 3BLNA 2P6GA 4CYNA 2Z10A 3FNCA 3CXSA 4AVAA 4AVCA 4KOXA 1QSNA 4CAVA 2VZZA 4GS4A 2J8RA 3LD2A 3PZJA 5H84A 1L0CA 4XNHC 4U5YA 2P0WA 3WR7A 4X5KA 5ISVA 2BL1A 3TO9A 4JD6A 4M3SA 4NSQA 2A4NA 4C7IA 3T9YA 2R8VA 3N7ZA 3P2HA 2DPTA 2OZGA 4KS9A 5CNPA 4KOSA 2DXQA 4R3LA 2G0BA 4L8AA 4QC6A 1QSMA 4CYQA 1MJBA 1VKCA 4EVYA 5AG5A 4HNXB 3EO4A 4R57A 1MK4A 3CXPA 3IGRA 2PSWA 3BJ8A 2ZW7A 4MFKA 2ZW5A 1XIXA 4KOYA 1M44A 4NXYA 3EXNA 4JXQA 1WWZA 3GYAA 1B87A 1QSTA 2BUEA 3FYNA 1I12A 4MFPA 2OU2A 3FBUA 1I21A 3SXNA 3CXQA 5J8FA 4PSXA 1BO4A 2WPXA 5A27A 4KOUA 4CAXA 3I9SA 3DDDA 4CGOA 4L89A 2O28A 1P0HA 4KVME 2BEIA 1KUYA 2X7BA 4UFVA 3IWGA 4NEXA 2FL4A 2JDDA 2ZXVA 2GIVA 3KKWA 2JLMA 3R9FA 3S6KA 2FIWA 1RXTA 2G3TA 2QIRA 2Z3LA 3QAHA 3TE4A 1Q2CA 2HV2A 5IB0A 2VQYA 3IU2A 1UFHA 4KORA 2PR1A 4E2AA 4A95A 3S6FA 4CS0B 5I0CA 1Y9KA 4B13A 4XPLA 4A32A 5KTDA 1Y7RA 2JDCA 4B10A 4I49A 1V0CA 4C2YA 3H5ZA 3FIXA 3PGPA 4RI1A 1YVKA 1R57A 1XF8A 2CNTA 5DWNA 2Z3PA 4IUSA 3TT2A 3TOBA 2Z3MA 1NMTA 2HUZA 1YLEA 3D8PA 4PV6A 4HNWB 2RC4A 4A2ZA 1VHSA 4YRHA 4KVXA 4H89A 4HKFA 4CGMA 3PP9A 3EY5A 4QVTA 3W91A 2HQYA 4CGLA 1MJ9A 2B4DA 3MGDA 5E96A 4AG9A 1Z4RA 4BMHA 3C26A 1I1DA 5G22A 5AGEA 5DWMA 5EC4A 2I79A 2H5MA 2B5GB 3BJ7A 2PRBA 2GANA 1N71A 2D4OA 3SHPA 4JWPA 2QECA 1IYLA 4NCZA 4OAEA 2ZW6A 4MHDA 4C2XA 3R95A 1M4DA 3TO7A 4ONUA 2VI7A 5FVJA 1IIDA 4KOVA 1Q2DA 3GKRA 2Z11A 1P4NA 1ZO0A 4PK3A 4ZBGA 3B8GA 1IYKA 2B58A 4OADA 3P2FA 1SQHA 2P6FA 1PUAA 4MY0A 5F46A 4JXRA 2K5TA 2DPSA 2Z0ZA 4KOWA 4BBHA 2Y0MA 2GE3A 3FB3A 4YGOA 1IB1E 4XPDB 2YGWA 2BSWA 4A33A 1ON0A 3E0KA 4QBJA 4KLWA 2R1IA 2CXAA 2Q44A 4KUAA 4CYPA 1S7FA 4R87A 1S3ZA 4UCNA 4U9YA 5KTCA 2YNDA 1K4JA 3QB8A 4HNYB 5AG7A 1RO5A 3IWEA 2FE7A 2FT0A 2ZPAA 2VBQA 5G20A 1B6BA 5JPHA 4KVOE 4B5PA 2OH1A 2YNCC 1KZFA 1M4GA 1YGHA 4F0YA 4CAEA 2QMLA 3DSBA 3LODA 3UY5A 3A9LA 4A30A 4FD5A 1NE9A 1WK4A 2REFA 2R98A 1Q2YA 3F8KA 3NE7A 4CGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLV A;  5F47 A;  1YRE A;  4XPD C;  4FD4 A;  4M85 A;  1GHE A;  2OZH A;  3JUW A;  1MJA A;  4FD6 A;  4AB7 A;  4RS2 A;  2B5G A;  4NF1 A;  5F48 A;  4XPK A;  2B3V A;  1S7L A;  3H4Q A;  1S60 A;  4UBR A;  3TO6 A;  2Q4Y A;  1TIQ A;  1YR0 A;  4H6Z A;  2I00 A;  3W6X A;  3DR6 A;  4MJ8 A;  4F6A A;  2ARH A;  2P6E A;  4JLY A;  1FY7 A;  1S5K A;  2KCW A;  4DNC A;  3F5B A;  4E0A A;  3VWD A;  4B5O A;  2IL4 A;  3I3G A;  2VEZ A;  2OB0 A;  4U9Z A;  4R9M A;  4H6U A;  5H86 A;  3FXT A;  4AVB A;  2ATR A;  4II9 A;  3S6H A;  5HMN A;  2FS5 A;  2Q7B A;  1KUX A;  2PQ8 A;  2J8M A;  4IF5 A;  4MBU A;  3S6G A;  5C82 A;  2OZU A;  5IV0 A;  1CM0 A;  1IIC A;  1NSL A;  2JEV A;  4E8O A;  3D3S A;  2G3A A;  2PR8 A;  4YFJ A;  3R96 A;  3TFY A;  3ZJ0 A;  5J8C A;  2PDO A;  2NMT A;  4PSW A;  1M1D A;  5GCN A;  4LUA A;  2EUI A;  3T90 A;  2FCK A;  3F0A A;  5C88 A;  5IX3 A;  4MI4 A;  1CJW A;  3VWE A;  3D2P A;  2F5I A;  3JVN A;  4ORF A;  3V8I A;  3G3S A;  3EFA A;  2WPW A;  1M4I A;  4KUB A;  4PK2 A;  3W6S A;  2CNM A;  1PU9 A;  1S7N A;  1Y9W A;  1S7K A;  4K30 A;  4B5P B;  4FD7 A;  3RYO A;  4QB9 A;  5F49 A;  4R3K A;  1YK3 A;  3D2M A;  3DR8 A;  3OWC A;  5EBV A;  4UA3 A;  4KOT A;  1QSO A;  2ZW4 A;  4AG7 A;  3ZZI A;  4CRY B;  4XNH B;  1OZP A;  4JJX A;  2VXK A;  2FXF A;  1XE4 A;  5HH1 A;  1QSR A;  1XMT A;  1YX0 A;  2D4P A;  2Q0Y A;  4UWI A;  2J8N A;  2C27 A;  2AE6 A;  1U6M A;  2AJ6 A;  2CNS A;  3G8W A;  4CAW A;  1J4J A;  4LX9 A;  2PC1 A;  4KZT A;  2Q4V A;  4OLL A;  3R9G A;  2EVN A;  5KTA A;  1Z4E A;  3EC4 A;  4CRZ B;  3GY9 A;  3TTH A;  1BOB A;  3TCV A;  4UWJ A;  2FSR A;  4Y49 B;  1KUV A;  3FRM A;  5JQ4 A;  3K9U A;  3DNS A;  2REE A;  2B4B A;  1LRZ A;  1YVO A;  2FIA A;  3R9E A;  2R7H A;  2CY2 A;  4QUS A;  2Q04 A;  4Y49 C;  3R1K A;  1XEB A;  2B3U A;  4MY3 A;  3SXO A;  1Z9U A;  3TOA A;  4J3G A;  2VZY A;  2B4D B;  3BLN A;  2P6G A;  2Z10 A;  3FNC A;  3CXS A;  4AVA A;  4AVC A;  4KOX A;  1QSN A;  4CAV A;  2VZZ A;  4GS4 A;  2J8R A;  3LD2 A;  3PZJ A;  5H84 A;  1L0C A;  4XNH C;  4U5Y A;  2P0W A;  3WR7 A;  4X5K A;  5ISV A;  2BL1 A;  3TO9 A;  4JD6 A;  4M3S A;  4NSQ A;  2A4N A;  3T9Y A;  2R8V A;  3N7Z A;  3P2H A;  2OZG A;  5CNP A;  4KOS A;  2DXQ A;  4R3L A;  2G0B A;  4L8A A;  4QC6 A;  1QSM A;  1MJB A;  1VKC A;  4EVY A;  4HNX B;  3EO4 A;  4R57 A;  1MK4 A;  3CXP A;  3IGR A;  2PSW A;  3BJ8 A;  2ZW7 A;  2ZW5 A;  1XIX A;  4KOY A;  1M44 A;  4NXY A;  3EXN A;  4JXQ A;  1WWZ A;  3GYA A;  1B87 A;  1QST A;  2BUE A;  3FYN A;  1I12 A;  2OU2 A;  3FBU A;  1I21 A;  3SXN A;  3CXQ A;  5J8F A;  4PSX A;  1BO4 A;  2WPX A;  4KOU A;  4CAX A;  3I9S A;  3DDD A;  4L89 A;  2O28 A;  1P0H A;  4KVM E;  2BEI A;  1KUY A;  2X7B A;  3IWG A;  4NEX A;  2FL4 A;  2JDD A;  2ZXV A;  2GIV A;  3KKW A;  2JLM A;  3R9F A;  3S6K A;  2FIW A;  1RXT A;  2G3T A;  2QIR A;  3QAH A;  3TE4 A;  1Q2C A;  2HV2 A;  5IB0 A;  2VQY A;  1UFH A;  4KOR A;  2PR1 A;  4E2A A;  3S6F A;  4CS0 B;  5I0C A;  1Y9K A;  4XPL A;  5KTD A;  1Y7R A;  2JDC A;  4I49 A;  1V0C A;  3FIX A;  3PGP A;  4RI1 A;  1YVK A;  1R57 A;  1XF8 A;  2CNT A;  5DWN A;  4IUS A;  3TT2 A;  3TOB A;  1NMT A;  2HUZ A;  1YLE A;  4PV6 A;  3D8P A;  4HNW B;  2RC4 A;  1VHS A;  4YRH A;  4KVX A;  4H89 A;  4HKF A;  3PP9 A;  3EY5 A;  4QVT A;  3W91 A;  2HQY A;  1MJ9 A;  2B4D A;  3MGD A;  5E96 A;  4AG9 A;  1Z4R A;  4BMH A;  3C26 A;  1I1D A;  5DWM A;  5EC4 A;  2I79 A;  2H5M A;  2B5G B;  3BJ7 A;  2PRB A;  2GAN A;  1N71 A;  2D4O A;  3SHP A;  4JWP A;  2QEC A;  1IYL A;  4NCZ A;  4OAE A;  2ZW6 A;  4MHD A;  3R95 A;  1M4D A;  3TO7 A;  4ONU A;  2VI7 A;  5FVJ A;  1IID A;  4KOV A;  1Q2D A;  3GKR A;  2Z11 A;  1P4N A;  4PK3 A;  4ZBG A;  3B8G A;  1IYK A;  2B58 A;  4OAD A;  3P2F A;  1SQH A;  2P6F A;  1PUA A;  4MY0 A;  5F46 A;  2K5T A;  4JXR A;  2Z0Z A;  4KOW A;  2Y0M A;  2GE3 A;  3FB3 A;  4YGO A;  1IB1 E;  4XPD B;  2BSW A;  1ON0 A;  3E0K A;  4QBJ A;  4KLW A;  2R1I A;  2Q44 A;  4KUA A;  1S7F A;  4R87 A;  1S3Z A;  4U9Y A;  5KTC A;  1K4J A;  3QB8 A;  4HNY B;  1RO5 A;  2FE7 A;  2FT0 A;  2ZPA A;  2VBQ A;  1B6B A;  5JPH A;  4KVO E;  4B5P A;  2OH1 A;  1KZF A;  1M4G A;  1YGH A;  4F0Y A;  2QML A;  3DSB A;  3LOD A;  3UY5 A;  4FD5 A;  1NE9 A;  1WK4 A;  2REF A;  2R98 A;  1Q2Y A;  3F8K A;  3NE7 A; 
#chains in the Genus database with same CATH topology
 3PBE A;  3QAY A;  3HUV A;  4MCP A;  4KLV A;  3SI2 A;  4NGQ A;  4NGN A;  4B14 A;  5F47 A;  1YRE A;  3D7H A;  3PB9 X;  5JM6 A;  4CAF A;  3IEH A;  4XPD C;  3T8W A;  4FD4 A;  4M85 A;  3N5F A;  1HDU A;  1GHE A;  2OZH A;  2PJ3 A;  4TWE A;  4AXV A;  2Z3K A;  4H2K A;  5DS0 A;  2V8H A;  3JUW A;  1MJA A;  4FD6 A;  4MCR A;  3S9L A;  4AB7 A;  2Q51 A;  4RS2 A;  2B5G A;  4NF1 A;  5F48 A;  4XPK A;  2ZEM A;  1BPN A;  1GYT A;  2B3V A;  1S7L A;  3H4Q A;  1ZG7 A;  1S60 A;  2Z3O A;  4UBR A;  3TO6 A;  2Q4Y A;  4PXC A;  3SJF A;  1TIQ A;  1TF9 A;  3NH4 A;  1YR0 A;  2ZOG A;  2ZEE A;  4OIW A;  2IQ6 A;  4H6Z A;  2I00 A;  3W6X A;  2PVV A;  3DR6 A;  4O23 A;  4MJ8 A;  4NGT A;  3RBU A;  4F6A A;  3ISX A;  4OC2 A;  5AG4 A;  2ARH A;  1XOV A;  2P6E A;  4R76 A;  1DE4 C;  1FY7 A;  4IAV A;  4JLY A;  1VIX A;  4WWV A;  1VGY A;  1S5K A;  5HXD A;  2YNE A;  2PJ2 A;  3H8E A;  4A37 A;  5JH9 A;  1XBU A;  3KHZ A;  5LRG A;  2KCW A;  4DNC A;  3IJ3 A;  4GM5 A;  4UFW A;  3D4U A;  4P45 A;  4P4E A;  3F5B A;  4CGN A;  4CYO A;  1QQ9 A;  4OC1 A;  1AMP A;  3FED A;  2QYV A;  3SJX A;  3GUX A;  4E0A A;  3QNV A;  3VWD A;  2IL4 A;  3I3G A;  4B5O A;  2VEZ A;  2F7V A;  2OB0 A;  3PB6 X;  4ZX8 A;  4U9Z A;  2C1C A;  4MFQ A;  4R9M A;  4ZX9 A;  4CPA A;  4B11 A;  4H6U A;  3PB4 X;  5H86 A;  3FXT A;  4AVB A;  2ATR A;  2AFU A;  3S6H A;  4GXH A;  2FS5 A;  2Q7B A;  2XEF A;  5HMN A;  4II9 A;  1KUX A;  2PQ8 A;  5K8O A;  5F09 A;  2ZEH A;  2J8M A;  3IU1 A;  4IF5 A;  2VL1 A;  4MBU A;  4OC4 A;  1OBR A;  1ELL P;  3S6G A;  4X2T A;  4KSF A;  4Z65 A;  5C82 A;  1BLL E;  2OZU A;  5IV0 A;  3WC6 A;  4MHN A;  1CM0 A;  1IIC A;  1NSL A;  2JEV A;  1A2Z A;  1Z2L A;  4E8O A;  4A31 A;  1H8L A;  3PEI A;  3RO0 A;  3D3S A;  2G3A A;  2PR8 A;  4UEZ A;  3B3S A;  3R96 A;  4YFJ A;  1RTQ A;  3TFY A;  2BO9 A;  3ZJ0 A;  5J8C A;  1QMU A;  2PDO A;  2NMT A;  4PSW A;  1ELM P;  4MFL A;  1M1D A;  5GCN A;  4LUA A;  2EUI A;  4R8F A;  3T90 A;  2GRE A;  3SI1 A;  2FCK A;  4MCQ A;  5G1Z A;  3F0A A;  2JEW A;  3B7I A;  5C88 A;  5IX3 A;  4MI4 A;  3K9T A;  4P4B A;  1CJW A;  3VWE A;  3D2P A;  4EFD A;  2PJ6 A;  3GLJ A;  4NFR A;  1VHO A;  5LRK A;  4UCP A;  2F5I A;  2ZEO A;  4NJQ A;  3JVN A;  4ORF A;  3V8I A;  3G3S A;  3EFA A;  4UCM A;  1M4L A;  2WPW A;  3FMC A;  1M4I A;  5LYI A;  3RAM A;  2GFQ A;  3WC5 A;  4RUH A;  4F9U A;  1PYT B;  4KUB A;  4PK2 A;  3W6S A;  4MFZ A;  4NJR A;  2CNM A;  4LQG A;  1PU9 A;  4P4D A;  4PXE A;  1HEE A;  1S7N A;  3FX6 A;  3D66 A;  2CF4 A;  1Y9W A;  1S7K A;  5CBM A;  4K30 A;  4B5P B;  3CPX A;  4FD7 A;  3RYO A;  4F0X A;  3JTK A;  1FNO A;  2XEI A;  4MMO A;  4QB9 A;  5F49 A;  4R3K A;  4ZI6 A;  5ELY A;  1YK3 A;  3D2M A;  4OC5 A;  3FEC A;  3SJG A;  3DR8 A;  4ZGY B;  3OWC A;  5EBV A;  2F8H A;  4Q36 A;  4UA3 A;  2WSA A;  4PXB A;  4C2Z A;  4KOT A;  1QSO A;  2HB6 A;  2CIJ A;  2ZW4 A;  4P4F A;  4AG7 A;  3ZZI A;  4CRY B;  4MFJ A;  4XNH B;  1OZP A;  4JJX A;  2VXK A;  2FXF A;  1XE4 A;  5HH1 A;  1QSR A;  3L2N A;  2EK8 A;  1XMT A;  1YX0 A;  4OC0 A;  5BWA B;  2D4P A;  2Q0Y A;  3B35 A;  1F2P A;  1YME A;  4UWI A;  2J8N A;  4B6Z A;  2C27 A;  2AE6 A;  1TXR A;  1LOK A;  1U6M A;  5A28 A;  1CP6 A;  2AJ6 A;  3DLJ A;  3B3T A;  4Q38 A;  2CNS A;  3G8W A;  4FBE A;  4CAW A;  1J4J A;  3JRU A;  4LX9 A;  3WAB A;  2PC1 A;  3FH4 A;  4UFX A;  4KZT A;  2Q4V A;  3KGQ A;  4OLL A;  4FWU A;  3R9G A;  5LYL A;  3B3W A;  4NGP A;  2EVN A;  5KTA A;  2JBK A;  3DGV A;  4DYO A;  1Z4E A;  3PFO A;  1LFW A;  1ZLH A;  4W9Y A;  2Z3N A;  2EBJ A;  3EC4 A;  3GY9 A;  5G21 A;  4CRZ B;  1ZG9 A;  3TTH A;  3KAS A;  1BOB A;  3TCV A;  4UWJ A;  4DJL A;  3NE8 A;  3FVL A;  2FSR A;  4Y49 B;  1KUV A;  3FRM A;  1CG2 A;  1YLO A;  5JQ4 A;  3K9U A;  4ZY2 A;  3DNS A;  4IHM A;  6CPA A;  2REE A;  1F2O A;  3KR4 A;  2B4B A;  1BPM A;  1LRZ A;  1PCA A;  1YVO A;  2FIA A;  3R9E A;  2R7H A;  5AG6 A;  2CY2 A;  2WYR A;  3PB8 X;  4QUS A;  5J1Q A;  2Q04 A;  4Y49 C;  4TNU A;  1ZG8 A;  2OOT A;  2EK9 A;  4MHY A;  3V7Z A;  2YNC A;  5D8N A;  4KSA A;  3S9N A;  4B12 A;  3R1K A;  4UIA A;  3B3V A;  4UIB A;  1XEB A;  2EO8 A;  4YWY A;  2RFH A;  3PRT A;  2B3U A;  1JQG A;  4MY3 A;  3WT4 A;  4C68 A;  3SXO A;  2WUU A;  4C7H A;  1Z9U A;  4KSI A;  3TOA A;  4J3G A;  2VZY A;  2B4D B;  2C6C A;  3BLN A;  2P6G A;  4CYN A;  1LCP A;  2Z10 A;  3FNC A;  1LAN A;  3CXS A;  4AVA A;  1FT7 A;  5D29 A;  4AVC A;  8CPA A;  1Z8W A;  3PFE A;  4PXD A;  4KOX A;  1QSN A;  4CAV A;  1Z8X A;  3PB7 X;  3TX8 A;  2VZZ A;  4GS4 A;  2J8R A;  3KR5 A;  2PVW A;  3LD2 A;  3PZJ A;  2Q4Z A;  5H84 A;  1L0C A;  4YU9 A;  5EMI A;  4XNH C;  2BCO A;  4EME A;  2PJ1 A;  4U5Y A;  2P0W A;  3WR7 A;  4PPZ A;  4X5K A;  4PQA A;  5ISV A;  2BL1 A;  3TO9 A;  4JD6 A;  4P10 A;  1ZLI A;  2C6P A;  1F57 A;  4M3S A;  1YSJ A;  1NSA A;  4NSQ A;  2PRQ A;  2A4N A;  4C7I A;  2PJ9 A;  3T9Y A;  2EWB A;  2R8V A;  3N7Z A;  3P2H A;  2ABZ A;  2DPT A;  2OZG A;  4FAI A;  5HVG A;  3CDX A;  3RZA A;  4KS9 A;  5CNP A;  4KOS A;  2DXQ A;  4DUK A;  4R3L A;  2G0B A;  4L8A A;  4QC6 A;  5CPA A;  3S9M A;  2PJ8 A;  1KWM A;  1QSM A;  2XEJ A;  4CYQ A;  1MJB A;  1HDQ A;  4P4I A;  4F8Z A;  2HC9 A;  1CX8 A;  1VKC A;  3FJU A;  3H8G A;  5AG5 A;  4EVY A;  4HNX B;  3BI1 A;  3EO4 A;  4R57 A;  1MK4 A;  3CXP A;  3IGR A;  5K8P A;  4JZ0 A;  2PSW A;  3BJ8 A;  2ZW7 A;  2PE3 A;  4MFK A;  2ZW5 A;  1XIX A;  4KOY A;  1M44 A;  4NXY A;  3VAR A;  3EXN A;  4JXQ A;  1WWZ A;  4R6T A;  3GYA A;  1B87 A;  1QST A;  2BUE A;  3CT9 A;  3FYN A;  3KHX A;  1ARM A;  1I12 A;  1IGB A;  2OU2 A;  2V77 A;  3FBU A;  1X10 A;  2OR4 A;  4MFP A;  1I21 A;  5LRJ A;  3I1U A;  3CXQ A;  3SXN A;  4WJB A;  4MRI A;  5J8F A;  4K3N A;  4OME A;  4PSX A;  5HVF A;  4A38 A;  2JBJ A;  1BO4 A;  2WPX A;  2PJA A;  3D7D A;  3LWU A;  3KI9 A;  2GLJ A;  4OP4 A;  4IK2 A;  5A27 A;  4KOU A;  4NGS A;  4CAX A;  3I9S A;  2V8V A;  3DDD A;  4CGO A;  4L89 A;  4P44 A;  4EWT A;  2O28 A;  1P0H A;  1CP7 A;  2PJ5 A;  4KVM E;  2BEI A;  1KUY A;  1CPX A;  2QVP A;  2J9A A;  2X7B A;  4A94 A;  1IOF A;  1DTD A;  3PBB A;  4UFV A;  3IWG A;  4NEX A;  2FL4 A;  2AFX A;  2JDD A;  3MRU A;  2ZXV A;  2FVG A;  3D7G A;  1TF8 A;  2GIV A;  1YW6 A;  3KKW A;  2JLM A;  3SI0 A;  3R9F A;  2PJ7 A;  3S6K A;  3VAT A;  3IFE A;  2FIW A;  1RXT A;  2G3T A;  3GIU A;  2QIR A;  1R43 A;  2Z3L A;  3QAH A;  3TE4 A;  1Q2C A;  2CTB A;  2HV2 A;  4HPS A;  1Y0R A;  1BAV A;  3FF3 A;  5IB0 A;  2VQY A;  3NH5 A;  3IU2 A;  1IU8 A;  2QJ8 A;  1IOI A;  1YQE A;  1UFH A;  4F9V A;  4UEE A;  4KOR A;  2PR1 A;  4E2A A;  1UWY A;  4A95 A;  5K8N A;  3S6F A;  4CS0 B;  3NFZ A;  5I0C A;  5HVH A;  1Y9K A;  2WZN A;  4Q7A A;  3WC7 A;  4XPL A;  4A32 A;  4B13 A;  5I4M A;  2NYQ A;  5KTD A;  3K2K A;  2ODF A;  3LMS A;  4JYW A;  4LQ6 A;  1Y7R A;  2JDC A;  4RN7 A;  4B10 A;  4I49 A;  1YW4 A;  3LAC A;  1AYE A;  1V0C A;  4P4J A;  3H5Z A;  4C2Y A;  3FIX A;  4NGM A;  3PGP A;  4RI1 A;  2G9D A;  1YVK A;  1VHE A;  2ANP A;  1R57 A;  1IY7 A;  1XF8 A;  1Y7E A;  4BIN A;  2CNT A;  5DWN A;  4ZY0 A;  3KQZ A;  2Z3P A;  4IUS A;  2PIZ A;  2AFS A;  3D7F A;  3TT2 A;  1LAP A;  4M6G A;  3TOB A;  2AFZ A;  2XEG A;  2Z3M A;  3NH8 A;  1NMT A;  2GU2 A;  2ZEF A;  3SJE A;  2HUZ A;  2POK A;  1YLE A;  2PJ0 A;  3D8P A;  4PV6 A;  4HNW B;  3CPA A;  2RC4 A;  2DF5 A;  3D68 A;  4A2Z A;  1VHS A;  2RB7 A;  4YRH A;  4KVX A;  4H89 A;  4G1P A;  4HKF A;  7CPA A;  4CGM A;  3PP9 A;  3EY5 A;  3KZW A;  4QVT A;  3W91 A;  1CBX A;  4UF4 A;  2HQY A;  4CGL A;  3TC8 A;  1CPS A;  2V8D A;  3HLP A;  1MJ9 A;  2AFM A;  2B4D A;  3MGD A;  2PJC A;  5E96 A;  4AG9 A;  1TKF A;  4OID A;  1Z4R A;  4BMH A;  3C26 A;  2ZED A;  1I1D A;  1JWQ A;  5G22 A;  4OC3 A;  5AGE A;  5DWM A;  5EC4 A;  2I79 A;  5JGF A;  2H5M A;  4P6Y A;  2O53 A;  4M6I A;  2B5G B;  3GB0 A;  3BJ7 A;  2PRB A;  2NSM A;  3B3C A;  2GAN A;  1LAM A;  1N71 A;  2D4O A;  4ZY1 A;  4OKO A;  1Z5R A;  2AFO A;  2I3C A;  3SHP A;  4JWP A;  4FUU A;  2QEC A;  1IYL A;  2ZEP A;  4NCZ A;  4OAE A;  4BD9 A;  4NGR A;  3B2Y A;  1XMB A;  2ZW6 A;  4MHD A;  3CZX A;  4C2X A;  2O4H A;  4X3R A;  2ZEN A;  2Q7S A;  2IMO A;  3IIB A;  4UEF A;  1M4D A;  3R95 A;  1ARL A;  2ZEG A;  3TO7 A;  4ONU A;  2VI7 A;  5FVJ A;  2PIY A;  1IID A;  4KOV A;  1Q2D A;  4MHP A;  2PJB A;  1XJO A;  2DEA A;  3GKR A;  3V38 A;  2Z11 A;  3IO1 A;  1P4N A;  3H8F A;  1ZO0 A;  4PK3 A;  4ZBG A;  3B8G A;  1IYK A;  2B58 A;  3IWW A;  4MCS A;  4OAD A;  3FEE A;  3IC1 A;  1AUG A;  3P2F A;  1SQH A;  2P6F A;  3D67 A;  1PUA A;  2Q43 A;  2PJ4 A;  4MY0 A;  5F46 A;  2K5T A;  4JXR A;  2DPS A;  2Z0Z A;  4KOW A;  4BBH A;  2Y0M A;  2GE3 A;  4ZYQ A;  3FB3 A;  1TKH A;  4YGO A;  2GLF A;  2V8G A;  5THW A;  1IB1 E;  4XPD B;  1Z8L A;  4M6H A;  2YGW A;  2AFW A;  2BSW A;  3RNZ A;  4A33 A;  1X12 A;  1ON0 A;  3E0K A;  4QBJ A;  5K8M A;  2CTC A;  4KLW A;  2R1I A;  2CXA A;  2Q44 A;  4KUA A;  4CYP A;  2C6G A;  1S7F A;  3NA6 A;  3MN8 A;  3BHX A;  4R87 A;  1S3Z A;  4UCN A;  4U9Y A;  5KTC A;  2YND A;  3ISZ A;  1K4J A;  3QB8 A;  4A39 A;  4HNY B;  4ONW A;  5AG7 A;  1RO5 A;  3IWE A;  1Z8T A;  2FE7 A;  2FT0 A;  1Y0Y A;  2ZPA A;  2VBQ A;  3KL9 A;  5G20 A;  1B6B A;  5JPH A;  4KVO E;  4B5P A;  2OH1 A;  3KQX A;  2BOA A;  1Q7L A;  2PCU A;  2YNC C;  1KZF A;  1M4G A;  1XFO A;  1YGH A;  4F0Y A;  1XRY A;  5LYD A;  2QML A;  4X8I A;  3VH9 A;  4CAE A;  1R3N A;  3DSB A;  3LOD A;  3UY5 A;  2IJZ A;  3A9L A;  2ZEL A;  4A30 A;  1EE3 P;  4FD5 A;  1NE9 A;  1WK4 A;  3BXM A;  4R7M A;  2ZOF A;  1TKJ A;  5LYF A;  3BI0 A;  2REF A;  2R98 A;  1Q2Y A;  3F8K A;  3NE7 A;  4MXU A;  5IB9 A;  4CGP A;  4MHZ A; 
#chains in the Genus database with same CATH homology
 4KLV A;  4B14 A;  5F47 A;  1YRE A;  4CAF A;  4XPD C;  4FD4 A;  4M85 A;  1GHE A;  2OZH A;  2Z3K A;  3JUW A;  1MJA A;  4FD6 A;  4AB7 A;  4RS2 A;  2B5G A;  4NF1 A;  5F48 A;  4XPK A;  2B3V A;  1S7L A;  3H4Q A;  1S60 A;  2Z3O A;  4UBR A;  3TO6 A;  2Q4Y A;  1TIQ A;  1YR0 A;  4H6Z A;  2I00 A;  3W6X A;  3DR6 A;  4MJ8 A;  4F6A A;  5AG4 A;  2ARH A;  2P6E A;  4JLY A;  1FY7 A;  1S5K A;  2YNE A;  2KCW A;  4DNC A;  4UFW A;  3F5B A;  4CGN A;  4CYO A;  4E0A A;  3VWD A;  4B5O A;  2IL4 A;  3I3G A;  2VEZ A;  2OB0 A;  4U9Z A;  4MFQ A;  4R9M A;  4B11 A;  4H6U A;  5H86 A;  3FXT A;  4AVB A;  2ATR A;  4II9 A;  3S6H A;  5HMN A;  2FS5 A;  2Q7B A;  1KUX A;  2PQ8 A;  2J8M A;  3IU1 A;  4IF5 A;  4MBU A;  3S6G A;  4KSF A;  5C82 A;  2OZU A;  5IV0 A;  1CM0 A;  1IIC A;  1NSL A;  2JEV A;  4E8O A;  4A31 A;  3D3S A;  2G3A A;  2PR8 A;  4YFJ A;  3R96 A;  3TFY A;  3ZJ0 A;  5J8C A;  2PDO A;  2NMT A;  4PSW A;  4MFL A;  1M1D A;  5GCN A;  4LUA A;  2EUI A;  3T90 A;  2FCK A;  5G1Z A;  3F0A A;  5C88 A;  5IX3 A;  4MI4 A;  1CJW A;  3VWE A;  3D2P A;  4UCP A;  2F5I A;  3JVN A;  4ORF A;  3V8I A;  3G3S A;  3EFA A;  4UCM A;  2WPW A;  1M4I A;  4KUB A;  4PK2 A;  3W6S A;  4MFZ A;  2CNM A;  1PU9 A;  1S7N A;  1Y9W A;  1S7K A;  4K30 A;  4B5P B;  4FD7 A;  4F0X A;  3RYO A;  3JTK A;  4QB9 A;  5F49 A;  4R3K A;  1YK3 A;  3D2M A;  3DR8 A;  4ZGY B;  3OWC A;  5EBV A;  4Q36 A;  4UA3 A;  2WSA A;  4C2Z A;  4KOT A;  1QSO A;  2ZW4 A;  4AG7 A;  3ZZI A;  4CRY B;  4MFJ A;  4XNH B;  1OZP A;  4JJX A;  2VXK A;  2FXF A;  1XE4 A;  5HH1 A;  1QSR A;  1XMT A;  1YX0 A;  5BWA B;  2D4P A;  2Q0Y A;  4UWI A;  2J8N A;  2C27 A;  2AE6 A;  1U6M A;  5A28 A;  2AJ6 A;  4Q38 A;  2CNS A;  3G8W A;  4CAW A;  1J4J A;  4LX9 A;  2PC1 A;  4UFX A;  4KZT A;  2Q4V A;  4OLL A;  3R9G A;  2EVN A;  5KTA A;  1Z4E A;  2Z3N A;  3EC4 A;  4CRZ B;  3GY9 A;  5G21 A;  3TTH A;  1BOB A;  3TCV A;  4UWJ A;  2FSR A;  4Y49 B;  1KUV A;  3FRM A;  5JQ4 A;  3K9U A;  3DNS A;  2REE A;  2B4B A;  1LRZ A;  1YVO A;  2FIA A;  3R9E A;  2R7H A;  5AG6 A;  2CY2 A;  4QUS A;  2Q04 A;  4Y49 C;  2YNC A;  4KSA A;  4B12 A;  3R1K A;  1XEB A;  2B3U A;  4C68 A;  4MY3 A;  3SXO A;  2WUU A;  4C7H A;  1Z9U A;  3TOA A;  4J3G A;  2VZY A;  2B4D B;  3BLN A;  2P6G A;  4CYN A;  2Z10 A;  3FNC A;  3CXS A;  4AVA A;  4AVC A;  4KOX A;  1QSN A;  4CAV A;  2VZZ A;  4GS4 A;  2J8R A;  3LD2 A;  3PZJ A;  5H84 A;  1L0C A;  4XNH C;  4U5Y A;  2P0W A;  3WR7 A;  4X5K A;  5ISV A;  2BL1 A;  3TO9 A;  4JD6 A;  4M3S A;  4NSQ A;  2A4N A;  4C7I A;  3T9Y A;  2R8V A;  3N7Z A;  3P2H A;  2DPT A;  2OZG A;  4KS9 A;  5CNP A;  4KOS A;  2DXQ A;  4R3L A;  2G0B A;  4L8A A;  4QC6 A;  1QSM A;  4CYQ A;  1MJB A;  1VKC A;  4EVY A;  5AG5 A;  4HNX B;  3EO4 A;  4R57 A;  1MK4 A;  3CXP A;  3IGR A;  2PSW A;  3BJ8 A;  2ZW7 A;  4MFK A;  2ZW5 A;  1XIX A;  4KOY A;  1M44 A;  4NXY A;  3EXN A;  4JXQ A;  1WWZ A;  3GYA A;  1B87 A;  1QST A;  2BUE A;  3FYN A;  1I12 A;  4MFP A;  2OU2 A;  3FBU A;  1I21 A;  3SXN A;  3CXQ A;  5J8F A;  4PSX A;  1BO4 A;  2WPX A;  5A27 A;  4KOU A;  4CAX A;  3I9S A;  3DDD A;  4CGO A;  4L89 A;  2O28 A;  1P0H A;  4KVM E;  2BEI A;  1KUY A;  2X7B A;  4UFV A;  3IWG A;  4NEX A;  2FL4 A;  2JDD A;  2ZXV A;  2GIV A;  3KKW A;  2JLM A;  3R9F A;  3S6K A;  2FIW A;  1RXT A;  2G3T A;  2QIR A;  2Z3L A;  3QAH A;  3TE4 A;  1Q2C A;  2HV2 A;  5IB0 A;  2VQY A;  3IU2 A;  1UFH A;  4KOR A;  2PR1 A;  4E2A A;  4A95 A;  3S6F A;  4CS0 B;  5I0C A;  1Y9K A;  4B13 A;  4XPL A;  4A32 A;  5KTD A;  1Y7R A;  2JDC A;  4B10 A;  4I49 A;  1V0C A;  4C2Y A;  3H5Z A;  3FIX A;  3PGP A;  4RI1 A;  1YVK A;  1R57 A;  1XF8 A;  2CNT A;  5DWN A;  2Z3P A;  4IUS A;  3TT2 A;  3TOB A;  2Z3M A;  1NMT A;  2HUZ A;  1YLE A;  3D8P A;  4PV6 A;  4HNW B;  2RC4 A;  4A2Z A;  1VHS A;  4YRH A;  4KVX A;  4H89 A;  4HKF A;  4CGM A;  3PP9 A;  3EY5 A;  4QVT A;  3W91 A;  2HQY A;  4CGL A;  1MJ9 A;  2B4D A;  3MGD A;  5E96 A;  4AG9 A;  1Z4R A;  4BMH A;  3C26 A;  1I1D A;  5G22 A;  5AGE A;  5DWM A;  5EC4 A;  2I79 A;  2H5M A;  2B5G B;  3BJ7 A;  2PRB A;  2GAN A;  1N71 A;  2D4O A;  3SHP A;  4JWP A;  2QEC A;  1IYL A;  4NCZ A;  4OAE A;  2ZW6 A;  4MHD A;  4C2X A;  3R95 A;  1M4D A;  3TO7 A;  4ONU A;  2VI7 A;  5FVJ A;  1IID A;  4KOV A;  1Q2D A;  3GKR A;  2Z11 A;  1P4N A;  1ZO0 A;  4PK3 A;  4ZBG A;  3B8G A;  1IYK A;  2B58 A;  4OAD A;  3P2F A;  1SQH A;  2P6F A;  1PUA A;  4MY0 A;  5F46 A;  4JXR A;  2K5T A;  2DPS A;  2Z0Z A;  4KOW A;  4BBH A;  2Y0M A;  2GE3 A;  3FB3 A;  4YGO A;  1IB1 E;  4XPD B;  2YGW A;  2BSW A;  4A33 A;  1ON0 A;  3E0K A;  4QBJ A;  4KLW A;  2R1I A;  2CXA A;  2Q44 A;  4KUA A;  4CYP A;  1S7F A;  4R87 A;  1S3Z A;  4UCN A;  4U9Y A;  5KTC A;  2YND A;  1K4J A;  3QB8 A;  4HNY B;  5AG7 A;  1RO5 A;  3IWE A;  2FE7 A;  2FT0 A;  2ZPA A;  2VBQ A;  5G20 A;  1B6B A;  5JPH A;  4KVO E;  4B5P A;  2OH1 A;  2YNC C;  1KZF A;  1M4G A;  1YGH A;  4F0Y A;  4CAE A;  2QML A;  3DSB A;  3LOD A;  3UY5 A;  3A9L A;  4A30 A;  4FD5 A;  1NE9 A;  1WK4 A;  2REF A;  2R98 A;  1Q2Y A;  3F8K A;  3NE7 A;  4CGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...