5KTDA

Fdhc with bound products: coenzyme a and dtdp-3-amino-3,6-dideoxy-d-glucose
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
187
structure length
187
Chain Sequence
b'VNFNLKANTTYLRLVEENDAEFICTLRNNDKLNTYISKSTGDIKSQAEWIRNYKNRENNGEEYYFIIFRSDDQSPIGTVRLYDFHENPKSFCWGSWILNEHKTKYAAVESALLVYEAGFSTLGFEQSHFEVMKGNDKVHSFHLKMGAQKISEDDENIYYIFPKSKYKENKIQYARFLGKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FdhC
publication title Structural and Functional Investigation of FdhC from Acinetobacter nosocomialis: A Sugar N-Acyltransferase Belonging to the GNAT Superfamily.
pubmed doi rcsb
source organism Acinetobacter nosocomialis
molecule tags Transferase
total genus 63
structure length 187
sequence length 187
ec nomenclature
pdb deposition date 2016-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 5ktdA00
2FSRA 2BEIA 4AG7A 5J8FA 1IB1E 1U6MA 2ZW5A 4R87A 2BUEA 4KOUA 4EVYA 2KCWA 1S3ZA 2R8VA 2B4DA 2FL4A 4KOVA 2Q04A 2NMTA 2VEZA 5IX3A 1Q2YA 4IF5A 2RC4A 1N71A 1IYKA 5JPHA 3JVNA 3CXPA 2B4DB 2QECA 2ZPAA 4FD4A 2QMLA 5EC4A 5GCNA 2Q0YA 2PDOA 4J3GA 4Y49C 4UWJA 3G3SA 2FT0A 4CAXA 1OZPA 3S6KA 3SXNA 2OU2A 4AB7A 5ISVA 4B5OA 4HNYB 2ARHA 2I79A 1XMTA 2JDDA 3BJ8A 3PGPA 1GHEA 3EY5A 3TFYA 3FBUA 1J4JA 3K9UA 2HQYA 4JXQA 2J8RA 2OB0A 2ATRA 3OWCA 1YK3A 1K4JA 3TOAA 1S7NA 2CNTA 1XIXA 3TO6A 3TE4A 3R9GA 1M1DA 4B5PA 4F0YA 2PR1A 2Z11A 1IIDA 1YX0A 3G8WA 4XPKA 2ZW7A 3QB8A 1QSMA 1S60A 4E8OA 5CNPA 1IYLA 4MHDA 1LRZA 1UFHA 2P6GA 4IUSA 2ZW6A 1TIQA 1VHSA 2G3TA 1KUVA 4JLYA 4KUAA 1FY7A 3IWGA 2P0WA 5F48A 1B87A 2PSWA 5IB0A 5F46A 3ZZIA 3LODA 4KLWA 3MGDA 4QB9A 4ZBGA 2GIVA 3DR6A 2OH1A 3I3GA 3RYOA 3TO7A 4YGOA 5HMNA 5HH1A 4KVME 2R1IA 3D2MA 5FVJA 1S7KA 4MI4A 4BMHA 3IGRA 2B3VA 1MJ9A 3S6HA 3W6SA 3DDDA 2C27A 4KLVA 5KTAA 4JWPA 4KZTA 2PRBA 4L8AA 2PC1A 2FIAA 2I00A 2PQ8A 4MY3A 3EFAA 1S7FA 4U9YA 4HNWB 2WPXA 4NXYA 3F8KA 4KORA 2CNMA 2Q7BA 1V0CA 3EO4A 2VZYA 4KUBA 1QSTA 3TT2A 4CAVA 1ON0A 3S6FA 2OZGA 3DNSA 3PZJA 5IV0A 1VKCA 1NMTA 4XNHB 3CXSA 1SQHA 2B3UA 3S6GA 4KOWA 1MJAA 2DXQA 4AVBA 5EBVA 3KKWA 4KOXA 4RS2A 2JEVA 2OZUA 4KOSA 3GKRA 2REEA 1QSRA 4R9MA 4UA3A 1M4IA 5H84A 2Y0MA 2G3AA 1XEBA 2B4BA 4NEXA 4QC6A 1M4DA 4KOYA 4PV6A 4CAWA 1XE4A 4DNCA 1M44A 2AE6A 2FE7A 4QUSA 4MJ8A 2OZHA 4XPDB 2R98A 1KUXA 3V8IA 2WPWA 1YVOA 4R3KA 2VBQA 2CNSA 3DSBA 1YGHA 2HUZA 2ZW4A 3FRMA 2JLMA 1S5KA 4PSWA 5DWMA 4MBUA 4E2AA 4KVOE 1B6BA 4MY0A 5KTCA 1KUYA 4B5PB 4LUAA 1P0HA 1PU9A 4PSXA 3R9EA 2FCKA 3SHPA 4H6ZA 4JJXA 3R96A 3F5BA 2VQYA 4X5KA 1WK4A 1S7LA 4I49A 2G0BA 4XNHC 2F5IA 1PUAA 1Y9KA 5I0CA 4QVTA 4M3SA 4GS4A 4HKFA 5J8CA 1Q2DA 1YVKA 2P6EA 3BJ7A 2REFA 3LD2A 2Q4VA 5F47A 3D8PA 3PP9A 5H86A 3SXOA 4PK2A 1I1DA 2GANA 2QIRA 3TO9A 4OADA 3FIXA 4CS0B 2P6FA 1MK4A 2O28A 1L0CA 5E96A 4FD5A 2AJ6A 4XPDC 1BOBA 1Q2CA 3TOBA 3F0AA 4LX9A 4OLLA 2D4OA 1IICA 4L89A 3N7ZA 3JUWA 2B5GA 1I21A 2BL1A 2Z10A 2A4NA 4ONUA 2K5TA 2VZZA 3B8GA 1BO4A 1YLEA 3C26A 2Q4YA 1WWZA 1QSNA 3E0KA 4M85A 4F6AA 2PR8A 3GYAA 2J8NA 3ZJ0A 2J8MA 4KOTA 3EXNA 1MJBA 4UWIA 2D4PA 2VI7A 4XPLA 4U5YA 5C82A 3W91A 4JD6A 1XF8A 1YR0A 2ZXVA 1RXTA 2EUIA 4R57A 1Z9UA 1Z4RA 1NE9A 1QSOA 3T9YA 4H89A 3GY9A 2X7BA 3BLNA 2Q44A 1CJWA 3FB3A 3I9SA 4JXRA 2JDCA 4AG9A 4E0AA 4YRHA 4NCZA 4CRYB 4UBRA 4CRZB 1Y9WA 3P2HA 1KZFA 4YFJA 2FXFA 3VWDA 3WR7A 5F49A 4HNXB 5C88A 3FNCA 1CM0A 4AVCA 1I12A 1RO5A 5KTDA 4II9A 4K30A 3FYNA 3P2FA 3W6XA 2CY2A 3QAHA 3T90A 2GE3A 3TTHA 3TCVA 2BSWA 2Z0ZA 4NSQA 3EC4A 1M4GA 4R3LA 1YREA 2R7HA 3R9FA 2H5MA 1R57A 3UY5A 1P4NA 4U9ZA 5DWNA 5JQ4A 4Y49B 3NE7A 3H4QA 4H6UA 2FS5A 3CXQA 3D2PA 1Y7RA 3FXTA 4FD7A 2VXKA 3VWEA 4QBJA 2IL4A 2FIWA 3DR8A 2B58A 2EVNA 1Z4EA 4FD6A 4AVAA 3D3SA 4ORFA 1NSLA 3R95A 4RI1A 4PK3A 3R1KA 4NF1A 4KVXA 2HV2A 4OAEA 2B5GB
chains in the Genus database with same CATH superfamily
3NFZA 2FSRA 4YWYA 2BEIA 1YSJA 3B35A 4AG7A 1IB1E 2PJ8A 3TX8A 4A32A 1U6MA 2ZW5A 5J8FA 4R87A 1UWYA 2BUEA 4KOUA 4R8FA 4P4IA 2KCWA 4EVYA 1S3ZA 2R8VA 2B4DA 4FAIA 4CGLA 2FL4A 3KQZA 4KOVA 2Q04A 4P6YA 2NMTA 2VEZA 5IX3A 5JH9A 2FVGA 1Q2YA 4IF5A 5J1QA 2RC4A 1N71A 3K2KA 4GXHA 1IYKA 5G20A 5JPHA 8CPAA 3JVNA 3CXPA 2B4DB 2CXAA 2RFHA 3KASA 4NGMA 4P4EA 2QECA 2ZPAA 3GB0A 4FD4A 2QMLA 3WABA 3ISZA 3D68A 5EC4A 5GCNA 2Q0YA 2PDOA 4J3GA 4Y49C 4UWJA 3G3SA 4C68A 2FT0A 4CAXA 4NGTA 1OZPA 4OC5A 4LQGA 3S6KA 3SXNA 2OU2A 4PXDA 1CBXA 4AB7A 4NGSA 3PEIA 5ISVA 4B5OA 3GLJA 5JM6A 4HNYB 1IOIA 4WJBA 1HEEA 1TKHA 2ARHA 2I79A 1XMTA 3BI0A 2C6PA 5HVGA 2NYQA 2ZEMA 2JDDA 1LCPA 3BJ8A 3PGPA 1GHEA 3EY5A 3FX6A 3FBUA 3TFYA 2GREA 2POKA 2XEJA 3KHXA 1J4JA 3K9UA 2HQYA 3D67A 4OC2A 4A33A 2Z3NA 4JXQA 2PVWA 3H5ZA 3ISXA 1IGBA 2J8RA 3KGQA 2OB0A 2RB7A 2ATRA 2AFWA 1YK3A 1K4JA 3OWCA 3PB9X 3TOAA 2HB6A 1S7NA 4UFXA 2CNTA 1XIXA 5G21A 3TO6A 4RN7A 1ZG7A 4CYQA 3TE4A 2PJ4A 5G1ZA 1VIXA 4NGQA 1BLLE 2YNCA 3R9GA 1M1DA 4B5PA 4F0YA 2PR1A 4UFWA 3CDXA 2ANPA 1F2PA 2Z11A 1IIDA 1YX0A 2Z3KA 3G8WA 3GIUA 4MRIA 2F7VA 2ZW7A 1X12A 1KWMA 3QB8A 1QSMA 1S60A 5DS0A 4GM5A 4E8OA 4P4BA 5CNPA 2WSAA 3NA6A 1CPXA 1IYLA 5K8OA 3CPXA 4UCNA 3K9TA 2PJ0A 2ZELA 4MHDA 3RZAA 3FECA 1LRZA 1UFHA 2PJ1A 2P6GA 1TF9A 4IUSA 2ZW6A 2EK9A 4MHZA 5K8MA 1TIQA 1VHSA 2YNEA 1DTDA 2G3TA 1KUVA 4MHYA 4JLYA 4KUAA 1BAVA 1FY7A 3IWGA 2P0WA 3LACA 5F48A 4CYPA 1B87A 2PSWA 3KR4A 3PRTA 4TNUA 5F46A 5IB0A 1IU8A 3ZZIA 3JRUA 4BBHA 3LODA 5LRJA 2ZENA 2EWBA 2JBJA 1CX8A 2ZEHA 3D4UA 3MGDA 4KLWA 4QB9A 4ZBGA 3SJFA 2V8DA 4PQAA 5HVFA 2GIVA 3HLPA 1DE4C 3DR6A 2OH1A 3CT9A 3I3GA 3RYOA 3TO7A 4YGOA 1ZG8A 7CPAA 2Q7SA 5HMNA 5HH1A 4MFJA 4KVME 2R1IA 3D2MA 5FVJA 1S7KA 2GLJA 4MI4A 5D8NA 4BMHA 3IGRA 2B3VA 1H8LA 3LMSA 5AGEA 1MJ9A 4KSIA 3S6HA 3W6SA 4NGRA 1ELMP 3DDDA 1A2ZA 2C27A 1R43A 4KLVA 5KTAA 4JWPA 4JYWA 4R7MA 4KZTA 3H8EA 2PRBA 4KSFA 4L8AA 4CAEA 4OMEA 5HXDA 2PC1A 2FIAA 2G9DA 4CPAA 2I00A 4X3RA 4Q38A 5HVHA 4IK2A 2PQ8A 3SJXA 4Q36A 1Z2LA 4MY3A 3EFAA 1S7FA 5IB9A 2YNDA 4KS9A 1CPSA 1XFOA 5CPAA 4B14A 4U9YA 1LFWA 3VARA 4HNWB 4DUKA 2WPXA 4NGNA 2DPSA 5EMIA 4NXYA 5A27A 3F8KA 4UCPA 4PPZA 4WWVA 1JQGA 1VHOA 2EK8A 1XBUA 3A9LA 4KORA 4M6IA 2CNMA 4C2ZA 2PJBA 2Q7BA 1V0CA 3EO4A 2VZYA 4KUBA 1QSTA 3TT2A 2OR4A 1ON0A 3S6FA 2GLFA 2OZGA 3DNSA 3PZJA 5IV0A 1VKCA 2ODFA 3KZWA 3BXMA 3T8WA 1NMTA 3SJEA 4XNHB 2IJZA 2C1CA 2Q51A 5LYDA 3WC7A 3CXSA 1SQHA 2B3UA 2EBJA 3S6GA 3IO1A 4ONWA 3MRUA 4KOWA 1MJAA 2DXQA 5ELYA 3PB7X 2PCUA 5EBVA 2PJAA 4AVBA 3IC1A 3KKWA 4KOXA 4RS2A 4F0XA 2JEVA 4C2YA 2OZUA 4KOSA 3GKRA 1M4LA 2REEA 4B10A 1QSRA 1AMPA 2PJ5A 4R9MA 2HC9A 4B12A 3HUVA 4UA3A 1M4IA 2GU2A 3CPAA 3SI2A 1FT7A 3B3SA 1BPMA 5H84A 2Y0MA 2XEIA 4P4FA 2PJCA 2QJ8A 2CTBA 4MFPA 4MCQA 2ABZA 2PIZA 2G3AA 1GYTA 2Q4ZA 1XEBA 2B4BA 4NEXA 4QC6A 2EO8A 1M4DA 4Q7AA 4KOYA 4PV6A 4CAWA 1XE4A 4DNCA 1M44A 3IWWA 2AE6A 1LAPA 3GUXA 2FE7A 4QUSA 4MJ8A 3FF3A 4ZYQA 2OZHA 4XPDB 4BINA 2ZEPA 2R98A 4M6HA 4TWEA 1KUXA 3V8IA 2WPWA 1YVOA 4UEEA 4R3KA 2VBQA 4CAVA 2CNSA 2PIYA 3DSBA 1YGHA 4A38A 4CAFA 1VHEA 2HUZA 2QVPA 2ZW4A 3B3TA 2JLMA 3FRMA 2O4HA 1R3NA 1S5KA 3VATA 4PSWA 5DWMA 4MBUA 2JBKA 4E2AA 4KVOE 2DPTA 1B6BA 6CPAA 4A95A 2PJ2A 3FEDA 4MY0A 4JZ0A 1KUYA 2Q43A 5KTCA 4C7HA 2ZOFA 4B5PB 2CF4A 4LUAA 1P0HA 1CP6A 4OIDA 1PU9A 4PSXA 3DGVA 2BO9A 2FCKA 3KI9A 4FWUA 1Q7LA 4H6ZA 4OC4A 4JJXA 3R9EA 3R96A 3RNZA 3F5BA 2BOAA 2VQYA 4OC1A 4X5KA 1WK4A 4NJQA 1Y0YA 4C7IA 1S7LA 4I49A 2G0BA 2F8HA 2F5IA 1TKJA 4XNHC 4MFKA 1PUAA 1Z8XA 1Y9KA 5I0CA 4DYOA 4ZI6A 2Z3OA 3NH5A 2PJ7A 2V8VA 4QVTA 4M3SA 2PJ9A 4GS4A 4HKFA 4C2XA 5J8CA 1VGYA 1Q2DA 3IIBA 4MHNA 4OC0A 4A30A 3FMCA 4UEZA 2OOTA 1YVKA 2P6EA 3BJ7A 4K3NA 1FNOA 1AUGA 2REFA 1QQ9A 3H8FA 2WYRA 3RAMA 1YW6A 3LD2A 2Q4VA 4UCMA 3SI0A 2WUUA 1CP7A 5F47A 3BHXA 3D8PA 3PBEA 4EMEA 5G22A 2I3CA 3PP9A 5H86A 3SXOA 5JGFA 1TF8A 4PK2A 1ELLP 4CYOA 4P4JA 1I1DA 2GANA 2QIRA 3TO9A 4OADA 3B7IA 3BI1A 4MCSA 2ZEOA 3B3CA 3PFEA 3FIXA 3V7ZA 4MXUA 4CS0B 2P6FA 5LYIA 1MK4A 4R6TA 1YQEA 4PXEA 2O28A 1Z8WA 3PBBA 3IU2A 1L0CA 3KHZA 4LQ6A 5E96A 3LWUA 4FD5A 2AJ6A 4NGPA 4XPDC 4MCRA 5K8PA 3CZXA 1BOBA 1F2OA 1Q2CA 3TOBA 3F0AA 4LX9A 4OLLA 4CGOA 2D4OA 3N5FA 1IICA 2AFSA 4L89A 3N7ZA 2C6CA 3JUWA 2B5GA 1I21A 2BL1A 2Z10A 2A4NA 4ONUA 2ZEEA 4CGNA 3QAYA 2K5TA 2Z3LA 4R76A 2VZZA 4HPSA 2AFXA 2PJ6A 3B8GA 1BO4A 1YLEA 4EFDA 2IMOA 3C26A 4W9YA 3QNVA 2Q4YA 3D7DA 4B6ZA 3FH4A 2YNCC 4H2KA 4RUHA 1WWZA 5AG4A 1QSNA 3VH9A 3E0KA 4M85A 4EWTA 1IY7A 1ZLHA 2JEWA 2PR8A 2V8GA 3D7HA 2J8NA 2C6GA 3GYAA 4F6AA 3ZJ0A 2PVVA 2J8MA 4KOTA 2WZNA 4ZY2A 3EXNA 2AFMA 1MJBA 4PXBA 2XEFA 4OP4A 2ZEGA 1Y0RA 4UWIA 2D4PA 2VI7A 1ZO0A 4XPLA 3B3WA 4U5YA 1YW4A 1YLOA 5C82A 3NH4A 3KR5A 4OIWA 1PCAA 3W91A 4JD6A 4CYNA 1LAMA 4MCPA 3V38A 1XF8A 1YR0A 2ZXVA 3NH8A 4AXVA 3TC8A 3SI1A 3PFOA 1HDUA 1RXTA 4FUUA 5LYLA 4BD9A 2EUIA 4A2ZA 4DJLA 4R57A 3H8GA 4A37A 5I4MA 1Z8LA 1Z9UA 1Z4RA 1NE9A 3MN8A 4A31A 1QSOA 3D7FA 3T9YA 5AG5A 1OBRA 2J9AA 4H89A 3GY9A 1NSAA 3SJGA 2X7BA 3BLNA 4IAVA 4MFLA 2Q44A 1AYEA 1CJWA 4OKOA 5AG6A 5THWA 4CGMA 3FB3A 3D7GA 3I9SA 3RBUA 5CBMA 4IHMA 3S9LA 4NJRA 2PE3A 2JDCA 2ZOGA 3I1UA 4JXRA 4B13A 4AG9A 5LYFA 4MFQA 4E0AA 4YRHA 4NCZA 2DF5A 3FEEA 4UIAA 3SHPA 1TKFA 4UF4A 4CRYB 4UBRA 4FBEA 3L2NA 4CRZB 1LANA 1ARLA 4F9VA 4X8IA 1Y9WA 2PRQA 3P2HA 1KZFA 4ZX8A 4UFVA 1HDQA 3PB6X 4P45A 4YFJA 2Z3MA 4OC3A 1LOKA 1ZG9A 2FXFA 4P44A 5LRGA 5F49A 3VWDA 3WR7A 4F9UA 2XEGA 4ZY1A 2O53A 4HNXB 1XJOA 1ARMA 1Z8TA 3FNCA 1CM0A 3DLJA 5C88A 4AVCA 1I12A 5BWAB 1RO5A 5KTDA 3WC6A 4II9A 5K8NA 1CG2A 3NE8A 4A39A 2GFQA 2AFZA 4K30A 1XRYA 3FYNA 1XMBA 2CIJA 2Z3PA 2ZEDA 3WC5A 3P2FA 4UIBA 3W6XA 2CTCA 2CY2A 1EE3P 3QAHA 2PJ3A 4YU9A 2GE3A 3T90A 3TTHA 3TCVA 1Y7EA 2BSWA 4P4DA 3WT4A 2Z0ZA 4NSQA 3EC4A 3IEHA 5LRKA 3KQXA 4ZX9A 1ZLIA 1PYTB 1M4GA 4R3LA 4P10A 4X2TA 1YREA 4B11A 5A28A 2R7HA 1QMUA 3R9FA 4O23A 4NFRA 2H5MA 1R57A 3UY5A 2V77A 1P4NA 4U9ZA 3B3VA 5DWNA 4PXCA 5JQ4A 4MFZA 4Y49B 3NE7A 3H4QA 3PB8X 5F09A 2QYVA 2V8HA 1JWQA 1Z5RA 4H6UA 2DEAA 1IOFA 4MMOA 2FS5A 2NSMA 3CXQA 3KL9A 3PB4X 3D2PA 5AG7A 4Z65A 1Y7RA 3FXTA 3IWEA 4FD7A 4KSAA 1BPNA 2VXKA 3S9MA 3VWEA 2VL1A 4QBJA 5D29A 4ZGYB 2IL4A 2FIWA 3DR8A 1XOVA 1X10A 2AFOA 2B58A 3IJ3A 1YMEA 4G1PA 4ZY0A 2EVNA 4MHPA 3D66A 4M6GA 3B2YA 4A94A 4F8ZA 1Z4EA 3FJUA 3JTKA 1RTQA 4FD6A 4AVAA 2AFUA 3RO0A 3D3SA 4ORFA 1NSLA 3R95A 2ZEFA 4RI1A 3IU1A 4PK3A 2IQ6A 3R1KA 3FVLA 3IFEA 3S9NA 4NF1A 2YGWA 4KVXA 4UEFA 4XPKA 2HV2A 4OAEA 2B5GB 1F57A 4CGPA 2BCOA 1TXRA
chains in the Genus database with same CATH topology
2FSRA 2BEIA 4AG7A 5J8FA 1IB1E 4A32A 1U6MA 2ZW5A 4R87A 2BUEA 4KOUA 4EVYA 2KCWA 1S3ZA 2R8VA 2B4DA 4CGLA 2FL4A 4KOVA 2Q04A 2NMTA 2VEZA 5IX3A 1Q2YA 4IF5A 2RC4A 1N71A 1IYKA 5G20A 5JPHA 3JVNA 3CXPA 2B4DB 2CXAA 2QECA 2ZPAA 4FD4A 2QMLA 5EC4A 5GCNA 2Q0YA 2PDOA 4J3GA 4Y49C 4UWJA 3G3SA 4C68A 2FT0A 4CAXA 1OZPA 3S6KA 3SXNA 2OU2A 4AB7A 5ISVA 4B5OA 4HNYB 2ARHA 2I79A 1XMTA 2JDDA 3BJ8A 3PGPA 1GHEA 3EY5A 3TFYA 3FBUA 1J4JA 3K9UA 2HQYA 4A33A 2Z3NA 4JXQA 3H5ZA 2J8RA 2OB0A 2ATRA 3OWCA 1YK3A 1K4JA 3TOAA 1S7NA 4UFXA 2CNTA 1XIXA 5G21A 3TO6A 4CYQA 3TE4A 5G1ZA 2YNCA 3R9GA 1M1DA 4B5PA 4F0YA 2PR1A 4UFWA 2Z11A 1IIDA 1YX0A 2Z3KA 3G8WA 4XPKA 2ZW7A 3QB8A 1QSMA 1S60A 4E8OA 5CNPA 2WSAA 1IYLA 4UCNA 4MHDA 1LRZA 1UFHA 2P6GA 4IUSA 2ZW6A 1TIQA 1VHSA 2YNEA 2G3TA 1KUVA 4JLYA 4KUAA 1FY7A 3IWGA 2P0WA 5F48A 4CYPA 1B87A 2PSWA 5IB0A 5F46A 3ZZIA 4BBHA 3LODA 4KLWA 3MGDA 4QB9A 4ZBGA 2GIVA 3DR6A 2OH1A 3I3GA 3RYOA 3TO7A 4YGOA 5HMNA 5HH1A 4MFJA 4KVME 2R1IA 3D2MA 5FVJA 1S7KA 4MI4A 4BMHA 3IGRA 2B3VA 5AGEA 1MJ9A 3S6HA 3W6SA 3DDDA 2C27A 4KLVA 5KTAA 4JWPA 4KZTA 2PRBA 4KSFA 4L8AA 4CAEA 2PC1A 2FIAA 2I00A 4Q38A 2PQ8A 4Q36A 4MY3A 3EFAA 1S7FA 2YNDA 4KS9A 4B14A 4U9YA 4HNWB 2WPXA 2DPSA 5A27A 4NXYA 3F8KA 4UCPA 3A9LA 4KORA 2CNMA 4C2ZA 2Q7BA 1V0CA 3EO4A 2VZYA 4KUBA 1QSTA 3TT2A 4CAVA 1ON0A 3S6FA 2OZGA 3DNSA 3PZJA 5IV0A 1VKCA 1NMTA 4XNHB 3CXSA 1SQHA 2B3UA 3S6GA 4KOWA 1MJAA 2DXQA 4AVBA 5EBVA 3KKWA 4KOXA 4RS2A 4F0XA 2JEVA 4C2YA 2OZUA 4KOSA 3GKRA 2REEA 4B10A 1QSRA 4R9MA 4B12A 4UA3A 1M4IA 5H84A 2Y0MA 4MFPA 2G3AA 1XEBA 2B4BA 4NEXA 4QC6A 1M4DA 4KOYA 4PV6A 4CAWA 1XE4A 4DNCA 1M44A 2AE6A 2FE7A 4QUSA 4MJ8A 2OZHA 4XPDB 2R98A 1KUXA 3V8IA 2WPWA 1YVOA 4R3KA 2VBQA 2CNSA 3DSBA 1YGHA 4CAFA 2HUZA 2ZW4A 3FRMA 2JLMA 1S5KA 4PSWA 5DWMA 4MBUA 4E2AA 4KVOE 2DPTA 1B6BA 4A95A 4MY0A 5KTCA 1KUYA 4C7HA 4B5PB 4LUAA 1P0HA 1PU9A 4PSXA 3R9EA 2FCKA 3SHPA 4H6ZA 4JJXA 3R96A 3F5BA 2VQYA 4X5KA 1WK4A 4C7IA 1S7LA 4I49A 2G0BA 4XNHC 2F5IA 4MFKA 1PUAA 1Y9KA 5I0CA 2Z3OA 4QVTA 4M3SA 4C2XA 4GS4A 4HKFA 5J8CA 1Q2DA 4A30A 1YVKA 2P6EA 3BJ7A 2REFA 3LD2A 2Q4VA 4UCMA 2WUUA 5F47A 3D8PA 5G22A 3PP9A 5H86A 3SXOA 4PK2A 4CYOA 1I1DA 2GANA 2QIRA 3TO9A 4OADA 3FIXA 4CS0B 2P6FA 1MK4A 2O28A 3IU2A 1L0CA 5E96A 4FD5A 2AJ6A 4XPDC 1BOBA 1Q2CA 3TOBA 4CGOA 3F0AA 4LX9A 4OLLA 2D4OA 1IICA 4L89A 3N7ZA 3JUWA 2B5GA 1I21A 2BL1A 2Z10A 2A4NA 4ONUA 4CGNA 2K5TA 2Z3LA 2VZZA 3B8GA 1BO4A 1YLEA 3C26A 2Q4YA 2YNCC 1WWZA 5AG4A 1QSNA 3E0KA 4M85A 4F6AA 2PR8A 3GYAA 2J8NA 3ZJ0A 2J8MA 4KOTA 3EXNA 1MJBA 4UWIA 2D4PA 2VI7A 1ZO0A 4XPLA 4U5YA 5C82A 3W91A 4JD6A 4CYNA 1XF8A 1YR0A 2ZXVA 1RXTA 2EUIA 4A2ZA 4R57A 1Z9UA 1Z4RA 1NE9A 4A31A 1QSOA 3T9YA 5AG5A 4H89A 3GY9A 2X7BA 3BLNA 4MFLA 2Q44A 1CJWA 5AG6A 4CGMA 3FB3A 3I9SA 4B13A 4JXRA 2JDCA 4AG9A 4MFQA 4E0AA 4YRHA 4NCZA 4CRYB 4UBRA 4CRZB 1Y9WA 3P2HA 1KZFA 4UFVA 4YFJA 2Z3MA 2FXFA 3VWDA 3WR7A 5F49A 4HNXB 5C88A 3FNCA 1CM0A 4AVCA 1I12A 5BWAB 1RO5A 5KTDA 4II9A 4K30A 3FYNA 2Z3PA 3P2FA 3W6XA 2CY2A 3QAHA 3T90A 2GE3A 3TTHA 3TCVA 2BSWA 2Z0ZA 4NSQA 3EC4A 1M4GA 4R3LA 5A28A 4B11A 1YREA 2R7HA 3R9FA 2H5MA 1R57A 3UY5A 1P4NA 4U9ZA 5DWNA 5JQ4A 4MFZA 4Y49B 3NE7A 3H4QA 4H6UA 2FS5A 3CXQA 3D2PA 5AG7A 1Y7RA 4FD7A 3FXTA 3IWEA 4KSAA 2VXKA 3VWEA 4QBJA 4ZGYB 2IL4A 2FIWA 3DR8A 2B58A 2EVNA 1Z4EA 3JTKA 4FD6A 4AVAA 3D3SA 4ORFA 1NSLA 3R95A 4RI1A 3IU1A 4PK3A 3R1KA 4NF1A 2YGWA 4KVXA 2HV2A 4OAEA 2B5GB 4CGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FSR A;  2BEI A;  4AG7 A;  5J8F A;  1IB1 E;  1U6M A;  2ZW5 A;  4R87 A;  2BUE A;  4KOU A;  4EVY A;  2KCW A;  1S3Z A;  2R8V A;  2B4D A;  2FL4 A;  4KOV A;  2Q04 A;  2NMT A;  2VEZ A;  5IX3 A;  1Q2Y A;  4IF5 A;  2RC4 A;  1N71 A;  1IYK A;  5JPH A;  3JVN A;  3CXP A;  2B4D B;  2QEC A;  2ZPA A;  4FD4 A;  2QML A;  5EC4 A;  5GCN A;  2Q0Y A;  2PDO A;  4J3G A;  4Y49 C;  4UWJ A;  3G3S A;  2FT0 A;  4CAX A;  1OZP A;  3S6K A;  3SXN A;  2OU2 A;  4AB7 A;  5ISV A;  4B5O A;  4HNY B;  2ARH A;  2I79 A;  1XMT A;  2JDD A;  3BJ8 A;  3PGP A;  1GHE A;  3EY5 A;  3TFY A;  3FBU A;  1J4J A;  3K9U A;  2HQY A;  4JXQ A;  2J8R A;  2OB0 A;  2ATR A;  3OWC A;  1YK3 A;  1K4J A;  3TOA A;  1S7N A;  2CNT A;  1XIX A;  3TO6 A;  3TE4 A;  3R9G A;  1M1D A;  4B5P A;  4F0Y A;  2PR1 A;  2Z11 A;  1IID A;  1YX0 A;  3G8W A;  4XPK A;  2ZW7 A;  3QB8 A;  1QSM A;  1S60 A;  4E8O A;  5CNP A;  1IYL A;  4MHD A;  1LRZ A;  1UFH A;  2P6G A;  4IUS A;  2ZW6 A;  1TIQ A;  1VHS A;  2G3T A;  1KUV A;  4JLY A;  4KUA A;  1FY7 A;  3IWG A;  2P0W A;  5F48 A;  1B87 A;  2PSW A;  5IB0 A;  5F46 A;  3ZZI A;  3LOD A;  4KLW A;  3MGD A;  4QB9 A;  4ZBG A;  2GIV A;  3DR6 A;  2OH1 A;  3I3G A;  3RYO A;  3TO7 A;  4YGO A;  5HMN A;  5HH1 A;  4KVM E;  2R1I A;  3D2M A;  5FVJ A;  1S7K A;  4MI4 A;  4BMH A;  3IGR A;  2B3V A;  1MJ9 A;  3S6H A;  3W6S A;  3DDD A;  2C27 A;  4KLV A;  5KTA A;  4JWP A;  4KZT A;  2PRB A;  4L8A A;  2PC1 A;  2FIA A;  2I00 A;  2PQ8 A;  4MY3 A;  3EFA A;  1S7F A;  4U9Y A;  4HNW B;  2WPX A;  4NXY A;  3F8K A;  4KOR A;  2CNM A;  2Q7B A;  1V0C A;  3EO4 A;  2VZY A;  4KUB A;  1QST A;  3TT2 A;  4CAV A;  1ON0 A;  3S6F A;  2OZG A;  3DNS A;  3PZJ A;  5IV0 A;  1VKC A;  1NMT A;  4XNH B;  3CXS A;  1SQH A;  2B3U A;  3S6G A;  4KOW A;  1MJA A;  2DXQ A;  4AVB A;  5EBV A;  3KKW A;  4KOX A;  4RS2 A;  2JEV A;  2OZU A;  4KOS A;  3GKR A;  2REE A;  1QSR A;  4R9M A;  4UA3 A;  1M4I A;  5H84 A;  2Y0M A;  2G3A A;  1XEB A;  2B4B A;  4NEX A;  4QC6 A;  1M4D A;  4KOY A;  4PV6 A;  4CAW A;  1XE4 A;  4DNC A;  1M44 A;  2AE6 A;  2FE7 A;  4QUS A;  4MJ8 A;  2OZH A;  4XPD B;  2R98 A;  1KUX A;  3V8I A;  2WPW A;  1YVO A;  4R3K A;  2VBQ A;  2CNS A;  3DSB A;  1YGH A;  2HUZ A;  2ZW4 A;  3FRM A;  2JLM A;  1S5K A;  4PSW A;  5DWM A;  4MBU A;  4E2A A;  4KVO E;  1B6B A;  4MY0 A;  5KTC A;  1KUY A;  4B5P B;  4LUA A;  1P0H A;  1PU9 A;  4PSX A;  3R9E A;  2FCK A;  3SHP A;  4H6Z A;  4JJX A;  3R96 A;  3F5B A;  2VQY A;  4X5K A;  1WK4 A;  1S7L A;  4I49 A;  2G0B A;  4XNH C;  2F5I A;  1PUA A;  1Y9K A;  5I0C A;  4QVT A;  4M3S A;  4GS4 A;  4HKF A;  5J8C A;  1Q2D A;  1YVK A;  2P6E A;  3BJ7 A;  2REF A;  3LD2 A;  2Q4V A;  5F47 A;  3D8P A;  3PP9 A;  5H86 A;  3SXO A;  4PK2 A;  1I1D A;  2GAN A;  2QIR A;  3TO9 A;  4OAD A;  3FIX A;  4CS0 B;  2P6F A;  1MK4 A;  2O28 A;  1L0C A;  5E96 A;  4FD5 A;  2AJ6 A;  4XPD C;  1BOB A;  1Q2C A;  3TOB A;  3F0A A;  4LX9 A;  4OLL A;  2D4O A;  1IIC A;  4L89 A;  3N7Z A;  3JUW A;  2B5G A;  1I21 A;  2BL1 A;  2Z10 A;  2A4N A;  4ONU A;  2K5T A;  2VZZ A;  3B8G A;  1BO4 A;  1YLE A;  3C26 A;  2Q4Y A;  1WWZ A;  1QSN A;  3E0K A;  4M85 A;  4F6A A;  2PR8 A;  3GYA A;  2J8N A;  3ZJ0 A;  2J8M A;  4KOT A;  3EXN A;  1MJB A;  4UWI A;  2D4P A;  2VI7 A;  4XPL A;  4U5Y A;  5C82 A;  3W91 A;  4JD6 A;  1XF8 A;  1YR0 A;  2ZXV A;  1RXT A;  2EUI A;  4R57 A;  1Z9U A;  1Z4R A;  1NE9 A;  1QSO A;  3T9Y A;  4H89 A;  3GY9 A;  2X7B A;  3BLN A;  2Q44 A;  1CJW A;  3FB3 A;  3I9S A;  4JXR A;  2JDC A;  4AG9 A;  4E0A A;  4YRH A;  4NCZ A;  4CRY B;  4UBR A;  4CRZ B;  1Y9W A;  3P2H A;  1KZF A;  4YFJ A;  2FXF A;  3VWD A;  3WR7 A;  5F49 A;  4HNX B;  5C88 A;  3FNC A;  1CM0 A;  4AVC A;  1I12 A;  1RO5 A;  5KTD A;  4II9 A;  4K30 A;  3FYN A;  3P2F A;  3W6X A;  2CY2 A;  3QAH A;  3T90 A;  2GE3 A;  3TTH A;  3TCV A;  2BSW A;  2Z0Z A;  4NSQ A;  3EC4 A;  1M4G A;  4R3L A;  1YRE A;  2R7H A;  3R9F A;  2H5M A;  1R57 A;  3UY5 A;  1P4N A;  4U9Z A;  5DWN A;  5JQ4 A;  4Y49 B;  3NE7 A;  3H4Q A;  4H6U A;  2FS5 A;  3CXQ A;  3D2P A;  1Y7R A;  3FXT A;  4FD7 A;  2VXK A;  3VWE A;  4QBJ A;  2IL4 A;  2FIW A;  3DR8 A;  2B58 A;  2EVN A;  1Z4E A;  4FD6 A;  4AVA A;  3D3S A;  4ORF A;  1NSL A;  3R95 A;  4RI1 A;  4PK3 A;  3R1K A;  4NF1 A;  4KVX A;  2HV2 A;  4OAE A;  2B5G B; 
#chains in the Genus database with same CATH topology
 3NFZ A;  2FSR A;  4YWY A;  2BEI A;  1YSJ A;  3B35 A;  4AG7 A;  1IB1 E;  2PJ8 A;  3TX8 A;  4A32 A;  1U6M A;  2ZW5 A;  5J8F A;  4R87 A;  1UWY A;  2BUE A;  4KOU A;  4R8F A;  4P4I A;  2KCW A;  4EVY A;  1S3Z A;  2R8V A;  2B4D A;  4FAI A;  4CGL A;  2FL4 A;  3KQZ A;  4KOV A;  2Q04 A;  4P6Y A;  2NMT A;  2VEZ A;  5IX3 A;  5JH9 A;  2FVG A;  1Q2Y A;  4IF5 A;  5J1Q A;  2RC4 A;  1N71 A;  3K2K A;  4GXH A;  1IYK A;  5G20 A;  5JPH A;  8CPA A;  3JVN A;  3CXP A;  2B4D B;  2CXA A;  2RFH A;  3KAS A;  4NGM A;  4P4E A;  2QEC A;  2ZPA A;  3GB0 A;  4FD4 A;  2QML A;  3WAB A;  3ISZ A;  3D68 A;  5EC4 A;  5GCN A;  2Q0Y A;  2PDO A;  4J3G A;  4Y49 C;  4UWJ A;  3G3S A;  4C68 A;  2FT0 A;  4CAX A;  4NGT A;  1OZP A;  4OC5 A;  4LQG A;  3S6K A;  3SXN A;  2OU2 A;  4PXD A;  1CBX A;  4AB7 A;  4NGS A;  3PEI A;  5ISV A;  4B5O A;  3GLJ A;  5JM6 A;  4HNY B;  1IOI A;  4WJB A;  1HEE A;  1TKH A;  2ARH A;  2I79 A;  1XMT A;  3BI0 A;  2C6P A;  5HVG A;  2NYQ A;  2ZEM A;  2JDD A;  1LCP A;  3BJ8 A;  3PGP A;  1GHE A;  3EY5 A;  3FX6 A;  3FBU A;  3TFY A;  2GRE A;  2POK A;  2XEJ A;  3KHX A;  1J4J A;  3K9U A;  2HQY A;  3D67 A;  4OC2 A;  4A33 A;  2Z3N A;  4JXQ A;  2PVW A;  3H5Z A;  3ISX A;  1IGB A;  2J8R A;  3KGQ A;  2OB0 A;  2RB7 A;  2ATR A;  2AFW A;  1YK3 A;  1K4J A;  3OWC A;  3PB9 X;  3TOA A;  2HB6 A;  1S7N A;  4UFX A;  2CNT A;  1XIX A;  5G21 A;  3TO6 A;  4RN7 A;  1ZG7 A;  4CYQ A;  3TE4 A;  2PJ4 A;  5G1Z A;  1VIX A;  4NGQ A;  1BLL E;  2YNC A;  3R9G A;  1M1D A;  4B5P A;  4F0Y A;  2PR1 A;  4UFW A;  3CDX A;  2ANP A;  1F2P A;  2Z11 A;  1IID A;  1YX0 A;  2Z3K A;  3G8W A;  3GIU A;  4MRI A;  2F7V A;  2ZW7 A;  1X12 A;  1KWM A;  3QB8 A;  1QSM A;  1S60 A;  5DS0 A;  4GM5 A;  4E8O A;  4P4B A;  5CNP A;  2WSA A;  3NA6 A;  1CPX A;  1IYL A;  5K8O A;  3CPX A;  4UCN A;  3K9T A;  2PJ0 A;  2ZEL A;  4MHD A;  3RZA A;  3FEC A;  1LRZ A;  1UFH A;  2PJ1 A;  2P6G A;  1TF9 A;  4IUS A;  2ZW6 A;  2EK9 A;  4MHZ A;  5K8M A;  1TIQ A;  1VHS A;  2YNE A;  1DTD A;  2G3T A;  1KUV A;  4MHY A;  4JLY A;  4KUA A;  1BAV A;  1FY7 A;  3IWG A;  2P0W A;  3LAC A;  5F48 A;  4CYP A;  1B87 A;  2PSW A;  3KR4 A;  3PRT A;  4TNU A;  5F46 A;  5IB0 A;  1IU8 A;  3ZZI A;  3JRU A;  4BBH A;  3LOD A;  5LRJ A;  2ZEN A;  2EWB A;  2JBJ A;  1CX8 A;  2ZEH A;  3D4U A;  3MGD A;  4KLW A;  4QB9 A;  4ZBG A;  3SJF A;  2V8D A;  4PQA A;  5HVF A;  2GIV A;  3HLP A;  1DE4 C;  3DR6 A;  2OH1 A;  3CT9 A;  3I3G A;  3RYO A;  3TO7 A;  4YGO A;  1ZG8 A;  7CPA A;  2Q7S A;  5HMN A;  5HH1 A;  4MFJ A;  4KVM E;  2R1I A;  3D2M A;  5FVJ A;  1S7K A;  2GLJ A;  4MI4 A;  5D8N A;  4BMH A;  3IGR A;  2B3V A;  1H8L A;  3LMS A;  5AGE A;  1MJ9 A;  4KSI A;  3S6H A;  3W6S A;  4NGR A;  1ELM P;  3DDD A;  1A2Z A;  2C27 A;  1R43 A;  4KLV A;  5KTA A;  4JWP A;  4JYW A;  4R7M A;  4KZT A;  3H8E A;  2PRB A;  4KSF A;  4L8A A;  4CAE A;  4OME A;  5HXD A;  2PC1 A;  2FIA A;  2G9D A;  4CPA A;  2I00 A;  4X3R A;  4Q38 A;  5HVH A;  4IK2 A;  2PQ8 A;  3SJX A;  4Q36 A;  1Z2L A;  4MY3 A;  3EFA A;  1S7F A;  5IB9 A;  2YND A;  4KS9 A;  1CPS A;  1XFO A;  5CPA A;  4B14 A;  4U9Y A;  1LFW A;  3VAR A;  4HNW B;  4DUK A;  2WPX A;  4NGN A;  2DPS A;  5EMI A;  4NXY A;  5A27 A;  3F8K A;  4UCP A;  4PPZ A;  4WWV A;  1JQG A;  1VHO A;  2EK8 A;  1XBU A;  3A9L A;  4KOR A;  4M6I A;  2CNM A;  4C2Z A;  2PJB A;  2Q7B A;  1V0C A;  3EO4 A;  2VZY A;  4KUB A;  1QST A;  3TT2 A;  2OR4 A;  1ON0 A;  3S6F A;  2GLF A;  2OZG A;  3DNS A;  3PZJ A;  5IV0 A;  1VKC A;  2ODF A;  3KZW A;  3BXM A;  3T8W A;  1NMT A;  3SJE A;  4XNH B;  2IJZ A;  2C1C A;  2Q51 A;  5LYD A;  3WC7 A;  3CXS A;  1SQH A;  2B3U A;  2EBJ A;  3S6G A;  3IO1 A;  4ONW A;  3MRU A;  4KOW A;  1MJA A;  2DXQ A;  5ELY A;  3PB7 X;  2PCU A;  5EBV A;  2PJA A;  4AVB A;  3IC1 A;  3KKW A;  4KOX A;  4RS2 A;  4F0X A;  2JEV A;  4C2Y A;  2OZU A;  4KOS A;  3GKR A;  1M4L A;  2REE A;  4B10 A;  1QSR A;  1AMP A;  2PJ5 A;  4R9M A;  2HC9 A;  4B12 A;  3HUV A;  4UA3 A;  1M4I A;  2GU2 A;  3CPA A;  3SI2 A;  1FT7 A;  3B3S A;  1BPM A;  5H84 A;  2Y0M A;  2XEI A;  4P4F A;  2PJC A;  2QJ8 A;  2CTB A;  4MFP A;  4MCQ A;  2ABZ A;  2PIZ A;  2G3A A;  1GYT A;  2Q4Z A;  1XEB A;  2B4B A;  4NEX A;  4QC6 A;  2EO8 A;  1M4D A;  4Q7A A;  4KOY A;  4PV6 A;  4CAW A;  1XE4 A;  4DNC A;  1M44 A;  3IWW A;  2AE6 A;  1LAP A;  3GUX A;  2FE7 A;  4QUS A;  4MJ8 A;  3FF3 A;  4ZYQ A;  2OZH A;  4XPD B;  4BIN A;  2ZEP A;  2R98 A;  4M6H A;  4TWE A;  1KUX A;  3V8I A;  2WPW A;  1YVO A;  4UEE A;  4R3K A;  2VBQ A;  4CAV A;  2CNS A;  2PIY A;  3DSB A;  1YGH A;  4A38 A;  4CAF A;  1VHE A;  2HUZ A;  2QVP A;  2ZW4 A;  3B3T A;  2JLM A;  3FRM A;  2O4H A;  1R3N A;  1S5K A;  3VAT A;  4PSW A;  5DWM A;  4MBU A;  2JBK A;  4E2A A;  4KVO E;  2DPT A;  1B6B A;  6CPA A;  4A95 A;  2PJ2 A;  3FED A;  4MY0 A;  4JZ0 A;  1KUY A;  2Q43 A;  5KTC A;  4C7H A;  2ZOF A;  4B5P B;  2CF4 A;  4LUA A;  1P0H A;  1CP6 A;  4OID A;  1PU9 A;  4PSX A;  3DGV A;  2BO9 A;  2FCK A;  3KI9 A;  4FWU A;  1Q7L A;  4H6Z A;  4OC4 A;  4JJX A;  3R9E A;  3R96 A;  3RNZ A;  3F5B A;  2BOA A;  2VQY A;  4OC1 A;  4X5K A;  1WK4 A;  4NJQ A;  1Y0Y A;  4C7I A;  1S7L A;  4I49 A;  2G0B A;  2F8H A;  2F5I A;  1TKJ A;  4XNH C;  4MFK A;  1PUA A;  1Z8X A;  1Y9K A;  5I0C A;  4DYO A;  4ZI6 A;  2Z3O A;  3NH5 A;  2PJ7 A;  2V8V A;  4QVT A;  4M3S A;  2PJ9 A;  4GS4 A;  4HKF A;  4C2X A;  5J8C A;  1VGY A;  1Q2D A;  3IIB A;  4MHN A;  4OC0 A;  4A30 A;  3FMC A;  4UEZ A;  2OOT A;  1YVK A;  2P6E A;  3BJ7 A;  4K3N A;  1FNO A;  1AUG A;  2REF A;  1QQ9 A;  3H8F A;  2WYR A;  3RAM A;  1YW6 A;  3LD2 A;  2Q4V A;  4UCM A;  3SI0 A;  2WUU A;  1CP7 A;  5F47 A;  3BHX A;  3D8P A;  3PBE A;  4EME A;  5G22 A;  2I3C A;  3PP9 A;  5H86 A;  3SXO A;  5JGF A;  1TF8 A;  4PK2 A;  1ELL P;  4CYO A;  4P4J A;  1I1D A;  2GAN A;  2QIR A;  3TO9 A;  4OAD A;  3B7I A;  3BI1 A;  4MCS A;  2ZEO A;  3B3C A;  3PFE A;  3FIX A;  3V7Z A;  4MXU A;  4CS0 B;  2P6F A;  5LYI A;  1MK4 A;  4R6T A;  1YQE A;  4PXE A;  2O28 A;  1Z8W A;  3PBB A;  3IU2 A;  1L0C A;  3KHZ A;  4LQ6 A;  5E96 A;  3LWU A;  4FD5 A;  2AJ6 A;  4NGP A;  4XPD C;  4MCR A;  5K8P A;  3CZX A;  1BOB A;  1F2O A;  1Q2C A;  3TOB A;  3F0A A;  4LX9 A;  4OLL A;  4CGO A;  2D4O A;  3N5F A;  1IIC A;  2AFS A;  4L89 A;  3N7Z A;  2C6C A;  3JUW A;  2B5G A;  1I21 A;  2BL1 A;  2Z10 A;  2A4N A;  4ONU A;  2ZEE A;  4CGN A;  3QAY A;  2K5T A;  2Z3L A;  4R76 A;  2VZZ A;  4HPS A;  2AFX A;  2PJ6 A;  3B8G A;  1BO4 A;  1YLE A;  4EFD A;  2IMO A;  3C26 A;  4W9Y A;  3QNV A;  2Q4Y A;  3D7D A;  4B6Z A;  3FH4 A;  2YNC C;  4H2K A;  4RUH A;  1WWZ A;  5AG4 A;  1QSN A;  3VH9 A;  3E0K A;  4M85 A;  4EWT A;  1IY7 A;  1ZLH A;  2JEW A;  2PR8 A;  2V8G A;  3D7H A;  2J8N A;  2C6G A;  3GYA A;  4F6A A;  3ZJ0 A;  2PVV A;  2J8M A;  4KOT A;  2WZN A;  4ZY2 A;  3EXN A;  2AFM A;  1MJB A;  4PXB A;  2XEF A;  4OP4 A;  2ZEG A;  1Y0R A;  4UWI A;  2D4P A;  2VI7 A;  1ZO0 A;  4XPL A;  3B3W A;  4U5Y A;  1YW4 A;  1YLO A;  5C82 A;  3NH4 A;  3KR5 A;  4OIW A;  1PCA A;  3W91 A;  4JD6 A;  4CYN A;  1LAM A;  4MCP A;  3V38 A;  1XF8 A;  1YR0 A;  2ZXV A;  3NH8 A;  4AXV A;  3TC8 A;  3SI1 A;  3PFO A;  1HDU A;  1RXT A;  4FUU A;  5LYL A;  4BD9 A;  2EUI A;  4A2Z A;  4DJL A;  4R57 A;  3H8G A;  4A37 A;  5I4M A;  1Z8L A;  1Z9U A;  1Z4R A;  1NE9 A;  3MN8 A;  4A31 A;  1QSO A;  3D7F A;  3T9Y A;  5AG5 A;  1OBR A;  2J9A A;  4H89 A;  3GY9 A;  1NSA A;  3SJG A;  2X7B A;  3BLN A;  4IAV A;  4MFL A;  2Q44 A;  1AYE A;  1CJW A;  4OKO A;  5AG6 A;  5THW A;  4CGM A;  3FB3 A;  3D7G A;  3I9S A;  3RBU A;  5CBM A;  4IHM A;  3S9L A;  4NJR A;  2PE3 A;  2JDC A;  2ZOG A;  3I1U A;  4JXR A;  4B13 A;  4AG9 A;  5LYF A;  4MFQ A;  4E0A A;  4YRH A;  4NCZ A;  2DF5 A;  3FEE A;  4UIA A;  3SHP A;  1TKF A;  4UF4 A;  4CRY B;  4UBR A;  4FBE A;  3L2N A;  4CRZ B;  1LAN A;  1ARL A;  4F9V A;  4X8I A;  1Y9W A;  2PRQ A;  3P2H A;  1KZF A;  4ZX8 A;  4UFV A;  1HDQ A;  3PB6 X;  4P45 A;  4YFJ A;  2Z3M A;  4OC3 A;  1LOK A;  1ZG9 A;  2FXF A;  4P44 A;  5LRG A;  5F49 A;  3VWD A;  3WR7 A;  4F9U A;  2XEG A;  4ZY1 A;  2O53 A;  4HNX B;  1XJO A;  1ARM A;  1Z8T A;  3FNC A;  1CM0 A;  3DLJ A;  5C88 A;  4AVC A;  1I12 A;  5BWA B;  1RO5 A;  5KTD A;  3WC6 A;  4II9 A;  5K8N A;  1CG2 A;  3NE8 A;  4A39 A;  2GFQ A;  2AFZ A;  4K30 A;  1XRY A;  3FYN A;  1XMB A;  2CIJ A;  2Z3P A;  2ZED A;  3WC5 A;  3P2F A;  4UIB A;  3W6X A;  2CTC A;  2CY2 A;  1EE3 P;  3QAH A;  2PJ3 A;  4YU9 A;  2GE3 A;  3T90 A;  3TTH A;  3TCV A;  1Y7E A;  2BSW A;  4P4D A;  3WT4 A;  2Z0Z A;  4NSQ A;  3EC4 A;  3IEH A;  5LRK A;  3KQX A;  4ZX9 A;  1ZLI A;  1PYT B;  1M4G A;  4R3L A;  4P10 A;  4X2T A;  1YRE A;  4B11 A;  5A28 A;  2R7H A;  1QMU A;  3R9F A;  4O23 A;  4NFR A;  2H5M A;  1R57 A;  3UY5 A;  2V77 A;  1P4N A;  4U9Z A;  3B3V A;  5DWN A;  4PXC A;  5JQ4 A;  4MFZ A;  4Y49 B;  3NE7 A;  3H4Q A;  3PB8 X;  5F09 A;  2QYV A;  2V8H A;  1JWQ A;  1Z5R A;  4H6U A;  2DEA A;  1IOF A;  4MMO A;  2FS5 A;  2NSM A;  3CXQ A;  3KL9 A;  3PB4 X;  3D2P A;  5AG7 A;  4Z65 A;  1Y7R A;  3FXT A;  3IWE A;  4FD7 A;  4KSA A;  1BPN A;  2VXK A;  3S9M A;  3VWE A;  2VL1 A;  4QBJ A;  5D29 A;  4ZGY B;  2IL4 A;  2FIW A;  3DR8 A;  1XOV A;  1X10 A;  2AFO A;  2B58 A;  3IJ3 A;  1YME A;  4G1P A;  4ZY0 A;  2EVN A;  4MHP A;  3D66 A;  4M6G A;  3B2Y A;  4A94 A;  4F8Z A;  1Z4E A;  3FJU A;  3JTK A;  1RTQ A;  4FD6 A;  4AVA A;  2AFU A;  3RO0 A;  3D3S A;  4ORF A;  1NSL A;  3R95 A;  2ZEF A;  4RI1 A;  3IU1 A;  4PK3 A;  2IQ6 A;  3R1K A;  3FVL A;  3IFE A;  3S9N A;  4NF1 A;  2YGW A;  4KVX A;  4UEF A;  4XPK A;  2HV2 A;  4OAE A;  2B5G B;  1F57 A;  4CGP A;  2BCO A;  1TXR A; 
#chains in the Genus database with same CATH homology
 2FSR A;  2BEI A;  4AG7 A;  5J8F A;  1IB1 E;  4A32 A;  1U6M A;  2ZW5 A;  4R87 A;  2BUE A;  4KOU A;  4EVY A;  2KCW A;  1S3Z A;  2R8V A;  2B4D A;  4CGL A;  2FL4 A;  4KOV A;  2Q04 A;  2NMT A;  2VEZ A;  5IX3 A;  1Q2Y A;  4IF5 A;  2RC4 A;  1N71 A;  1IYK A;  5G20 A;  5JPH A;  3JVN A;  3CXP A;  2B4D B;  2CXA A;  2QEC A;  2ZPA A;  4FD4 A;  2QML A;  5EC4 A;  5GCN A;  2Q0Y A;  2PDO A;  4J3G A;  4Y49 C;  4UWJ A;  3G3S A;  4C68 A;  2FT0 A;  4CAX A;  1OZP A;  3S6K A;  3SXN A;  2OU2 A;  4AB7 A;  5ISV A;  4B5O A;  4HNY B;  2ARH A;  2I79 A;  1XMT A;  2JDD A;  3BJ8 A;  3PGP A;  1GHE A;  3EY5 A;  3TFY A;  3FBU A;  1J4J A;  3K9U A;  2HQY A;  4A33 A;  2Z3N A;  4JXQ A;  3H5Z A;  2J8R A;  2OB0 A;  2ATR A;  3OWC A;  1YK3 A;  1K4J A;  3TOA A;  1S7N A;  4UFX A;  2CNT A;  1XIX A;  5G21 A;  3TO6 A;  4CYQ A;  3TE4 A;  5G1Z A;  2YNC A;  3R9G A;  1M1D A;  4B5P A;  4F0Y A;  2PR1 A;  4UFW A;  2Z11 A;  1IID A;  1YX0 A;  2Z3K A;  3G8W A;  4XPK A;  2ZW7 A;  3QB8 A;  1QSM A;  1S60 A;  4E8O A;  5CNP A;  2WSA A;  1IYL A;  4UCN A;  4MHD A;  1LRZ A;  1UFH A;  2P6G A;  4IUS A;  2ZW6 A;  1TIQ A;  1VHS A;  2YNE A;  2G3T A;  1KUV A;  4JLY A;  4KUA A;  1FY7 A;  3IWG A;  2P0W A;  5F48 A;  4CYP A;  1B87 A;  2PSW A;  5IB0 A;  5F46 A;  3ZZI A;  4BBH A;  3LOD A;  4KLW A;  3MGD A;  4QB9 A;  4ZBG A;  2GIV A;  3DR6 A;  2OH1 A;  3I3G A;  3RYO A;  3TO7 A;  4YGO A;  5HMN A;  5HH1 A;  4MFJ A;  4KVM E;  2R1I A;  3D2M A;  5FVJ A;  1S7K A;  4MI4 A;  4BMH A;  3IGR A;  2B3V A;  5AGE A;  1MJ9 A;  3S6H A;  3W6S A;  3DDD A;  2C27 A;  4KLV A;  5KTA A;  4JWP A;  4KZT A;  2PRB A;  4KSF A;  4L8A A;  4CAE A;  2PC1 A;  2FIA A;  2I00 A;  4Q38 A;  2PQ8 A;  4Q36 A;  4MY3 A;  3EFA A;  1S7F A;  2YND A;  4KS9 A;  4B14 A;  4U9Y A;  4HNW B;  2WPX A;  2DPS A;  5A27 A;  4NXY A;  3F8K A;  4UCP A;  3A9L A;  4KOR A;  2CNM A;  4C2Z A;  2Q7B A;  1V0C A;  3EO4 A;  2VZY A;  4KUB A;  1QST A;  3TT2 A;  4CAV A;  1ON0 A;  3S6F A;  2OZG A;  3DNS A;  3PZJ A;  5IV0 A;  1VKC A;  1NMT A;  4XNH B;  3CXS A;  1SQH A;  2B3U A;  3S6G A;  4KOW A;  1MJA A;  2DXQ A;  4AVB A;  5EBV A;  3KKW A;  4KOX A;  4RS2 A;  4F0X A;  2JEV A;  4C2Y A;  2OZU A;  4KOS A;  3GKR A;  2REE A;  4B10 A;  1QSR A;  4R9M A;  4B12 A;  4UA3 A;  1M4I A;  5H84 A;  2Y0M A;  4MFP A;  2G3A A;  1XEB A;  2B4B A;  4NEX A;  4QC6 A;  1M4D A;  4KOY A;  4PV6 A;  4CAW A;  1XE4 A;  4DNC A;  1M44 A;  2AE6 A;  2FE7 A;  4QUS A;  4MJ8 A;  2OZH A;  4XPD B;  2R98 A;  1KUX A;  3V8I A;  2WPW A;  1YVO A;  4R3K A;  2VBQ A;  2CNS A;  3DSB A;  1YGH A;  4CAF A;  2HUZ A;  2ZW4 A;  3FRM A;  2JLM A;  1S5K A;  4PSW A;  5DWM A;  4MBU A;  4E2A A;  4KVO E;  2DPT A;  1B6B A;  4A95 A;  4MY0 A;  5KTC A;  1KUY A;  4C7H A;  4B5P B;  4LUA A;  1P0H A;  1PU9 A;  4PSX A;  3R9E A;  2FCK A;  3SHP A;  4H6Z A;  4JJX A;  3R96 A;  3F5B A;  2VQY A;  4X5K A;  1WK4 A;  4C7I A;  1S7L A;  4I49 A;  2G0B A;  4XNH C;  2F5I A;  4MFK A;  1PUA A;  1Y9K A;  5I0C A;  2Z3O A;  4QVT A;  4M3S A;  4C2X A;  4GS4 A;  4HKF A;  5J8C A;  1Q2D A;  4A30 A;  1YVK A;  2P6E A;  3BJ7 A;  2REF A;  3LD2 A;  2Q4V A;  4UCM A;  2WUU A;  5F47 A;  3D8P A;  5G22 A;  3PP9 A;  5H86 A;  3SXO A;  4PK2 A;  4CYO A;  1I1D A;  2GAN A;  2QIR A;  3TO9 A;  4OAD A;  3FIX A;  4CS0 B;  2P6F A;  1MK4 A;  2O28 A;  3IU2 A;  1L0C A;  5E96 A;  4FD5 A;  2AJ6 A;  4XPD C;  1BOB A;  1Q2C A;  3TOB A;  4CGO A;  3F0A A;  4LX9 A;  4OLL A;  2D4O A;  1IIC A;  4L89 A;  3N7Z A;  3JUW A;  2B5G A;  1I21 A;  2BL1 A;  2Z10 A;  2A4N A;  4ONU A;  4CGN A;  2K5T A;  2Z3L A;  2VZZ A;  3B8G A;  1BO4 A;  1YLE A;  3C26 A;  2Q4Y A;  2YNC C;  1WWZ A;  5AG4 A;  1QSN A;  3E0K A;  4M85 A;  4F6A A;  2PR8 A;  3GYA A;  2J8N A;  3ZJ0 A;  2J8M A;  4KOT A;  3EXN A;  1MJB A;  4UWI A;  2D4P A;  2VI7 A;  1ZO0 A;  4XPL A;  4U5Y A;  5C82 A;  3W91 A;  4JD6 A;  4CYN A;  1XF8 A;  1YR0 A;  2ZXV A;  1RXT A;  2EUI A;  4A2Z A;  4R57 A;  1Z9U A;  1Z4R A;  1NE9 A;  4A31 A;  1QSO A;  3T9Y A;  5AG5 A;  4H89 A;  3GY9 A;  2X7B A;  3BLN A;  4MFL A;  2Q44 A;  1CJW A;  5AG6 A;  4CGM A;  3FB3 A;  3I9S A;  4B13 A;  4JXR A;  2JDC A;  4AG9 A;  4MFQ A;  4E0A A;  4YRH A;  4NCZ A;  4CRY B;  4UBR A;  4CRZ B;  1Y9W A;  3P2H A;  1KZF A;  4UFV A;  4YFJ A;  2Z3M A;  2FXF A;  3VWD A;  3WR7 A;  5F49 A;  4HNX B;  5C88 A;  3FNC A;  1CM0 A;  4AVC A;  1I12 A;  5BWA B;  1RO5 A;  5KTD A;  4II9 A;  4K30 A;  3FYN A;  2Z3P A;  3P2F A;  3W6X A;  2CY2 A;  3QAH A;  3T90 A;  2GE3 A;  3TTH A;  3TCV A;  2BSW A;  2Z0Z A;  4NSQ A;  3EC4 A;  1M4G A;  4R3L A;  5A28 A;  4B11 A;  1YRE A;  2R7H A;  3R9F A;  2H5M A;  1R57 A;  3UY5 A;  1P4N A;  4U9Z A;  5DWN A;  5JQ4 A;  4MFZ A;  4Y49 B;  3NE7 A;  3H4Q A;  4H6U A;  2FS5 A;  3CXQ A;  3D2P A;  5AG7 A;  1Y7R A;  4FD7 A;  3FXT A;  3IWE A;  4KSA A;  2VXK A;  3VWE A;  4QBJ A;  4ZGY B;  2IL4 A;  2FIW A;  3DR8 A;  2B58 A;  2EVN A;  1Z4E A;  3JTK A;  4FD6 A;  4AVA A;  3D3S A;  4ORF A;  1NSL A;  3R95 A;  4RI1 A;  3IU1 A;  4PK3 A;  3R1K A;  4NF1 A;  2YGW A;  4KVX A;  2HV2 A;  4OAE A;  2B5G B;  4CGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...