5KTWA

Crebbp bromodomain in complex with cpd 44 (3-((5-acetyl-1-(cyclopropylmethyl)-4,5,6,7-tetrahydro-1h-pyrazolo[4,3-c]pyridin-3-yl)amino)-n-isopropylbenzamide)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
AAFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 37
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ktwA00
5H1TA 4IOOA 4UYHA 4CFLA 4E96A 1EQFA 2R0YA 4QSWA 4LZ2A 2E3KA 4IOQA 4CUSA 4PY6A 4YYKA 5F5ZA 5DYAA 5G4RA 4YK0A 5CUCA 4IR5A 3IU5A 4NR9A 3NXBA 4A9NA 5HRWA 4QR5A 4LC2A 4LRGA 5A5QA 5BT5A 4X2IA 3P1EA 5BT4A 5E9IA 5IIDA 5AD3A 5EPRA 5FH6A 4YYDA 4KCXA 3LQHA 3O35A 5A83A 2G4AA 5KO4A 4QYDA 4NUEA 4AKNA 4QSXA 1E6IA 5EWVA 5I7YA 4YY6A 3P1FA 5FE6A 4NS5A 5EPSA 2KTBB 4WHUA 5HQ5A 4UYEA 3I3JA 5DY7A 4BJXA 5E3DA 5A7CA 5ENBA 4CUUA 4BW1A 4TQNA 5HFQA 5K29A 4QZSA 5F62A 5F25A 3JVMA 5DW1A 2F6NA 4LDFA 4QSTA 4YYIA 3MULA 4NUDA 5LJ0A 5DYUA 5KTWA 5FG5A 5I40A 5HLSA 4UYGA 2R0VA 5LVQA 5EWCA 5L8UA 4RVRA 5DX4A 4TU4A 4WHWA 5D3HA 5FE4A 5LKUA 5D3TA 5LVRA 2YDWA 4QYLA 2DWWA 2OUOA 4J0SA 5ENGA 4O7FA 4CUPA 4QSSA 5C89A 4NRBA 4UIWA 4QSRA 4NRAA 4NYVA 5CQTA 5DLXA 4HXLA 5DYCA 5HFRA 3D7CA 3LJWA 5E74A 4A9IA 4HXRA 5AMFA 5EICA 2I8NA 4A9MA 4UYDA 4NYWA 5C7NA 3UVXA 3AQAA 2I7KA 4A9OA 5CGPA 4A9HA 3JVKA 4O76A 5D25A 4O78A 4UIZA 4IORA 2DVSA 4UYFB 5I29A 5D3LA 4MR5A 3LQJA 5F61A 4MR3A 5E3GA 4QY4A 3S91A 5ENEA 5DFDA 5ENJA 3U5KA 4NQMA 5CUDA 4HBYA 3U5JA 5CUGA 4XUBA 4XYAA 5L8TA 4NXJA 4LYSA 4YC9A 5EWHA 4XY8A 4TS8A 5A82A 2D9EA 5DLZA 4QBMA 4TTEA 5EI4A 4YYJA 4ZW1A 5FB1A 4KV1A 5FB0A 4NR6A 4A9JA 2E7NA 1WUMA 5LKZA 4CFKA 5COIA 4QR4A 5FG6A 4QUTA 5D26A 5E0RA 3Q2EA 3LXJA 3JVJA 4XUAA 4WIVA 4CL9A 1WUGA 3ZYUA 4YYNA 4LYWA 4YH4A 4Z1SA 4YAXA 2DATA 4PTBA 4QUUA 5CQ6A 4YH3A 5ENIA 4QSQA 4O77A 5IGMA 3MB4A 3O37A 2L5EA 5EWWA 3QZSA 4MEQA 4QEUA 5TB6A 5HRXA 5CFWA 4UIYA 2WP2A 3P1CA 4J1PA 5HRVA 4LZRA 2RO1A 4PS5A 4OUFA 5ETBA 4HBWA 5JI8A 5CU8A 4Q0NA 5CRMA 5DYXA 5CZGA 5CUBA 5I1QA 3HMFA 3MB3A 3IU6A 4PCEA 4Q0OA 3UV5A 2YELA 4NR5A 5A81A 2RNXA 4UIVA 2OO1A 4YYGA 5I88A 3U5NA 5E9LA 5D3JA 5EK9A 2YEMA 5G4SA 3UVWA 5FE9A 4UYFA 5IGLA 5FG4A 3FKMX 4FLPA 5FBXA 2RFJA 5E9YA 3Q2FA 4O7BA 5DFCA 2DVQA 4TU6A 4N3WA 4QC1A 4LR6A 5LUUA 4Z93A 4PCIA 5D3SA 4QSPA 5BT3A 5HEMA 5CTLA 5D24A 5F3AA 5CQ3A 4O71A 5C87A 5E9VA 5I83A 4HXPA 3P1DA 4N4HA 2R10A 4DONA 4TZ8A 4CUTA 4N4GA 4N4IA 3QZVA 4YY4A 4LYIA 5KTUA 5EPBA 5DKCA 4NUCA 5EV9A 4MEPA 3ONIA 5E9KA 4BW4A 4QR3A 2F6JA 5HELA 5I86A 5FE3A 5E9MA 5F36A 5FE8A 5F1HA 3TLPA 5EA1A 3S92A 3UV2A 5TCMA 3G0LA 1X0JA 4YYMA 4C66A 3AADA 4UITA 5CY9A 4OGJA 4NYXA 4MR6A 5CQ4A 5EM3A 4QNSA 1ZS5A 4YBMA 5AMEA 4GPJA 4NR7A 5L96A 5IGKA 2YW5A 5EQ1A 3GG3A 5HENA 5D3PA 3MQMA 4HBXA 2D82A 4CUQA 5I7XA 5FE2A 4HBVA 3MXFA 3UVYA 5CPEA 5IG6A 5DKHA 3K2JA 5EU1A 4O70A 2DKWA 3UV4A 5FE0A 5FE7A 5LKTA 5D0CA 3O34A 2RNWA 4IR4A 2RNYA 2L85A 5EGUA 5DW2A 4NRCA 5L97A 5F2PA 4YYHA 1N72A 5FH7A 1JM4B 2YYNA 5FFYA 3SVFA 3U5PA 5FE5A 5EISA 4QEVA 4ALGA 4MENA 5D7XA 4J3IA 5FFWA 5HCLA 4J0RA 4KV4A 4O7CA 2WP1A 4TT6A 5C85A 3P5OA 5CS8A 2DVRA 3DAIA 5ACYA 4NR8A 5CQAA 4YBSA 4A9EA 3RCWA 5A5NA 5CP5A 5HJCA 4A9LA 5ENCA 4YBTA 4UIXA 3UVDA 5H85A 3MUKA 5CQ5A 5FH8A 2E7OA 5FFVA 4Z6HA 4YATA 2LSPB 3DWYA 5F60A 2NXBA 4HXOA 5CUAA 5II2A 2H60A 4BHWA 4IR6A 4YADA 4HXNA 3QZTA 4ALHA 5CQ7A 4HXSA 2MJVB 4TT2A 3G0JA 2N9GA 5HQ7A 4CURA 4O72A 5H1VA 4Z1QA 4BW3A 4TZ2A 5FDZA 5DFBA 4UIUA 4C67A 4N4FA 5FE1A 4NQNA 3O33A 4F3IA 4A9KA 5IBNA 3U5MA 5F1LA 1F68A 4O74A 4O75A 4TYLA 2GRCA 4IR3A 5KU3A 2RI7A 5LJ1A 2DVVA 5AD2A 4PKLA 3SVHA 5J0DA 3HMHA 5HQ6A 5CUEA 2YEKA 5F63A 4MEOA 5A85A 2FSAA 4TT4A 4A9FA 4ZC9A 4MR4A 5ETDA 5A5OA 5EWDA 2YQDA 3JVLA 5CQ8A 4ZQLA 4O7EA 5D3NA 5A5RA 3O36A 4YABA 3U5OA 3HMEA 2R0SA 2OSSA 4LZSA 5LJ2A 5A5SA 4Y03A 2L84A 5II1A 3SVGA 4QEWA 5ENFA 5E7DA 4Z6IA 4HXKA 5L98A 5I89A 2RS9B 3LQIA 5ENHA 4QSVA 5DBMA 4OGIA 4QB3A 5CRZA 5KHMA 4O7AA 4HXMA 4QC3A 5C4QA 5I80A 5C8GA 5KTXA 5DKDA 3U5LA 5JWMA 5D3RA 4CLBA 5LKXA 5IGNA 5A5PA 4BW2A 5EP7A 5EVAA 5L99A 3UW9A 4QSUA 1JSPB 5E73A 5H1UA 4XY9A 5HM0A 4NR4A
chains in the Genus database with same CATH superfamily
5H1TA 4IOOA 4UYHA 4CFLA 4E96A 1EQFA 2R0YA 4QSWA 4LZ2A 4AKIA 2E3KA 4IOQA 4CUSA 4PY6A 4YYKA 5F5ZA 5DYAA 5G4RA 4YK0A 5CUCA 4IR5A 3IU5A 4NR9A 3NXBA 4A9NA 5HRWA 4QR5A 4LC2A 4LRGA 5A5QA 5BT5A 4X2IA 3P1EA 5BT4A 5E9IA 5IIDA 5AD3A 5EPRA 3ERRA 5FH6A 4YYDA 4KCXA 3LQHA 3O35A 5A83A 2G4AA 5KO4A 4QYDA 4NUEA 4AKNA 4QSXA 1E6IA 5EWVA 5I7YA 4YY6A 3P1FA 5FE6A 4NS5A 5EPSA 2KTBB 4WHUA 5HQ5A 4UYEA 3I3JA 5DY7A 4BJXA 5E3DA 5A7CA 5ENBA 4CUUA 4BW1A 4TQNA 5HFQA 5K29A 4QZSA 5F62A 5F25A 3JVMA 5DW1A 2F6NA 4LDFA 4QSTA 4YYIA 3MULA 4NUDA 5LJ0A 5DYUA 5KTWA 5FG5A 5I40A 5HLSA 4UYGA 2R0VA 5LVQA 5EWCA 5L8UA 4RVRA 5DX4A 4TU4A 4WHWA 5D3HA 5FE4A 5LKUA 5D3TA 5LVRA 2YDWA 4QYLA 2DWWA 2OUOA 4J0SA 5ENGA 4O7FA 4CUPA 4QSSA 5C89A 4NRBA 3D1DA 4UIWA 5I80A 4QSRA 4NRAA 4NYVA 5CQTA 5DLXA 4HXLA 5DYCA 5HFRA 3D7CA 3LJWA 5E74A 4A9IA 4HXRA 5AMFA 5EICA 2I8NA 4A9MA 4UYDA 4NYWA 5C7NA 3UVXA 3AQAA 2I7KA 4A9OA 5CGPA 4A9HA 3JVKA 4O76A 5D25A 4O78A 4UIZA 4IORA 2DVSA 4UYFB 5I29A 5D3LA 4MR5A 3LQJA 5F61A 4MR3A 5E3GA 4QY4A 3S91A 5ENEA 5DFDA 5ENJA 3U5KA 4NQMA 5CUDA 4HBYA 3U5JA 5CUGA 4XUBA 4XYAA 5L8TA 4NXJA 4LYSA 4YC9A 5EWHA 4XY8A 4TS8A 5A82A 2D9EA 5DLZA 4QBMA 4TTEA 5EI4A 4YYJA 4ZW1A 5FB1A 4KV1A 5FB0A 4NR6A 4A9JA 2E7NA 1WUMA 5LKZA 4CFKA 1PUOA 5COIA 4QR4A 5FG6A 4QUTA 5D26A 5E0RA 3Q2EA 3LXJA 3JVJA 4XUAA 4WIVA 4CL9A 1WUGA 3ZYUA 4YYNA 4LYWA 4YH4A 4Z1SA 4YAXA 2DATA 4PTBA 4QUUA 5CQ6A 4YH3A 5ENIA 4QSQA 4O77A 5IGMA 3MB4A 3O37A 2L5EA 5EWWA 3QZSA 4MEQA 4QEUA 5TB6A 5HRXA 5CFWA 4UIYA 2WP2A 3P1CA 4J1PA 5HRVA 4LZRA 2RO1A 4PS5A 4OUFA 5ETBA 4HBWA 5JI8A 5CU8A 4Q0NA 5CRMA 5DYXA 5CZGA 5CUBA 5I1QA 3HMFA 3MB3A 3IU6A 4PCEA 4Q0OA 3UV5A 2YELA 4NR5A 5KTXA 5A81A 2RNXA 4AI6A 4UIVA 2OO1A 4YYGA 5I88A 3U5NA 5E9LA 5D3JA 5EK9A 2YEMA 5G4SA 3UVWA 5FE9A 4UYFA 5IGLA 5FG4A 3FKMX 4FLPA 5FBXA 2RFJA 5E9YA 3Q2FA 4O7BA 5DFCA 2DVQA 4TU6A 4N3WA 4QC1A 4LR6A 5LUUA 4Z93A 4PCIA 5D3SA 4QSPA 5BT3A 5HEMA 5CTLA 5D24A 5F3AA 5CQ3A 4O71A 5C87A 5E9VA 5I83A 4HXPA 3P1DA 4N4HA 2R10A 4DONA 4TZ8A 4CUTA 4N4GA 4N4IA 3QZVA 4YY4A 4LYIA 5KTUA 5EPBA 5DKCA 4NUCA 5EV9A 4MEPA 3ONIA 5E9KA 4BW4A 4QR3A 2F6JA 5HELA 5I86A 5FE3A 5E9MA 5F36A 5FE8A 5F1HA 3TLPA 5EA1A 3S92A 3UV2A 5TCMA 3G0LA 1X0JA 4YYMA 4C66A 3AADA 4UITA 5CY9A 4OGJA 4NYXA 4MR6A 5CQ4A 5EM3A 4QNSA 1ZS5A 4YBMA 5AMEA 4GPJA 4NR7A 5L96A 5IGKA 2YW5A 5EQ1A 3GG3A 5HENA 5D3PA 3MQMA 4HBXA 2D82A 4CUQA 5I7XA 5FE2A 4HBVA 3MXFA 3UVYA 5CPEA 5IG6A 5DKHA 3K2JA 5EU1A 4O70A 2DKWA 3UV4A 5FE0A 5FE7A 5LKTA 5D0CA 3O34A 2RNWA 4IR4A 2RNYA 2L85A 5EGUA 5DW2A 4NRCA 5L97A 5F2PA 4YYHA 1N72A 5FH7A 1JM4B 2YYNA 5FFYA 3SVFA 3U5PA 5FE5A 5EISA 4QEVA 4ALGA 4MENA 5D7XA 4J3IA 5FFWA 5HCLA 4J0RA 4KV4A 4O7CA 2WP1A 4TT6A 5C85A 3P5OA 5CS8A 2DVRA 3DAIA 5ACYA 4NR8A 5CQAA 4YBSA 4A9EA 3RCWA 5A5NA 4AKGA 5CP5A 5HJCA 4A9LA 5ENCA 4YBTA 2EJNA 3VKHA 4UIXA 3UVDA 5H85A 3MUKA 5CQ5A 5FH8A 2E7OA 5FFVA 4Z6HA 4YATA 2LSPB 3DWYA 5F60A 2NXBA 4HXOA 5CUAA 5II2A 2H60A 4BHWA 4IR6A 4YADA 4HXNA 3QZTA 4ALHA 5CQ7A 4HXSA 2MJVB 4TT2A 3G0JA 2N9GA 5HQ7A 4CURA 4O72A 5H1VA 4Z1QA 4BW3A 4TZ2A 5FDZA 5DFBA 4UIUA 4C67A 4N4FA 5FE1A 4NQNA 3O33A 4F3IA 4A9KA 5IBNA 3U5MA 5F1LA 1F68A 4O74A 4O75A 4TYLA 2GRCA 4IR3A 5KU3A 2RI7A 5LJ1A 2DVVA 5AD2A 4PKLA 3SVHA 5J0DA 3HMHA 5HQ6A 5CUEA 2YEKA 5F63A 4MEOA 5A85A 2FSAA 4TT4A 4A9FA 4ZC9A 4MR4A 5ETDA 5A5OA 5EWDA 2YQDA 3JVLA 5CQ8A 4ZQLA 4O7EA 5D3NA 5A5RA 3O36A 4YABA 3U5OA 3HMEA 2R0SA 2OSSA 4LZSA 5LJ2A 5A5SA 4Y03A 2L84A 5II1A 3SVGA 4QEWA 5ENFA 5E7DA 4Z6IA 4HXKA 5L98A 5I89A 2RS9B 3LQIA 5ENHA 4QSVA 5CRZA 4OGIA 4QB3A 3D1BA 5DBMA 1ZKRA 4HXMA 4O7AA 4QC3A 5KHMA 5C4QA 5C8GA 5DKDA 3U5LA 5JWMA 5D3RA 3VKGA 4CLBA 5LKXA 5IGNA 5A5PA 4AKHA 4BW2A 5EP7A 5EVAA 5L99A 3UW9A 4QSUA 1JSPB 5E73A 5H1UA 4XY9A 5HM0A 4NR4A
chains in the Genus database with same CATH topology
5H1TA 4IOOA 4UYHA 4CFLA 4E96A 1EQFA 2R0YA 4QSWA 4LZ2A 2E3KA 4IOQA 4CUSA 4PY6A 4YYKA 5F5ZA 5DYAA 5G4RA 4YK0A 5CUCA 4IR5A 3IU5A 4NR9A 3NXBA 4A9NA 5HRWA 4QR5A 4LC2A 4LRGA 5A5QA 5BT5A 4X2IA 3P1EA 5BT4A 5E9IA 5IIDA 5AD3A 5EPRA 5FH6A 4YYDA 4KCXA 3LQHA 3O35A 5A83A 2G4AA 5KO4A 4QYDA 4NUEA 4AKNA 4QSXA 1E6IA 5EWVA 5I7YA 4YY6A 3P1FA 5FE6A 4NS5A 5EPSA 2KTBB 4WHUA 5HQ5A 4UYEA 3I3JA 5DY7A 4BJXA 5E3DA 5A7CA 5ENBA 4CUUA 4BW1A 4TQNA 5HFQA 5K29A 4QZSA 5F62A 5F25A 3JVMA 5DW1A 2F6NA 4LDFA 4QSTA 4YYIA 3MULA 4NUDA 5LJ0A 5DYUA 5KTWA 5FG5A 5I40A 5HLSA 4UYGA 2R0VA 5LVQA 5EWCA 5L8UA 4RVRA 5DX4A 4TU4A 4WHWA 5D3HA 5FE4A 5LKUA 5D3TA 5LVRA 2YDWA 4QYLA 2DWWA 2OUOA 4J0SA 5ENGA 4O7FA 4CUPA 4QSSA 5C89A 4NRBA 4UIWA 4QSRA 4NRAA 4NYVA 5CQTA 5DLXA 4HXLA 5DYCA 5HFRA 3D7CA 3LJWA 5E74A 4A9IA 4HXRA 5AMFA 5EICA 2I8NA 4A9MA 4UYDA 4NYWA 5C7NA 3UVXA 3AQAA 2I7KA 4A9OA 5CGPA 4A9HA 3JVKA 4O76A 5D25A 4O78A 4UIZA 4IORA 2DVSA 4UYFB 5I29A 5D3LA 4MR5A 3LQJA 5F61A 4MR3A 5E3GA 4QY4A 3S91A 5ENEA 5DFDA 5ENJA 3U5KA 4NQMA 5CUDA 4HBYA 3U5JA 5CUGA 4XUBA 4XYAA 5L8TA 4NXJA 4LYSA 4YC9A 5EWHA 4XY8A 4TS8A 5A82A 2D9EA 5DLZA 4QBMA 4TTEA 5EI4A 4YYJA 4ZW1A 5FB1A 4KV1A 5FB0A 4NR6A 4A9JA 2E7NA 1WUMA 5LKZA 4CFKA 5COIA 4QR4A 5FG6A 4QUTA 5D26A 5E0RA 3Q2EA 3LXJA 3JVJA 4XUAA 4WIVA 4CL9A 1WUGA 3ZYUA 4YYNA 4LYWA 4YH4A 4Z1SA 4YAXA 2DATA 4PTBA 4QUUA 5CQ6A 4YH3A 5ENIA 4QSQA 4O77A 5IGMA 3MB4A 3O37A 2L5EA 5EWWA 3QZSA 4MEQA 4QEUA 5TB6A 5HRXA 5CFWA 4UIYA 2WP2A 3P1CA 4J1PA 5HRVA 4LZRA 2RO1A 4PS5A 4OUFA 5ETBA 4HBWA 5JI8A 5CU8A 4Q0NA 5CRMA 5DYXA 5CZGA 5CUBA 5I1QA 3HMFA 3MB3A 3IU6A 4PCEA 4Q0OA 3UV5A 2YELA 4NR5A 5A81A 2RNXA 4UIVA 2OO1A 4YYGA 5I88A 3U5NA 5E9LA 5D3JA 5EK9A 2YEMA 5G4SA 3UVWA 5FE9A 4UYFA 5IGLA 5FG4A 3FKMX 4FLPA 5FBXA 2RFJA 5E9YA 3Q2FA 4O7BA 5DFCA 2DVQA 4TU6A 4N3WA 4QC1A 4LR6A 5LUUA 4Z93A 4PCIA 5D3SA 4QSPA 5BT3A 5HEMA 5CTLA 5D24A 5F3AA 5CQ3A 4O71A 5C87A 5E9VA 5I83A 4HXPA 3P1DA 4N4HA 2R10A 4DONA 4TZ8A 4CUTA 4N4GA 4N4IA 3QZVA 4YY4A 4LYIA 5KTUA 5EPBA 5DKCA 4NUCA 5EV9A 4MEPA 3ONIA 5E9KA 4BW4A 4QR3A 2F6JA 5HELA 5I86A 5FE3A 5E9MA 5F36A 5FE8A 5F1HA 3TLPA 5EA1A 3S92A 3UV2A 5TCMA 3G0LA 1X0JA 4YYMA 4C66A 3AADA 4UITA 5CY9A 4OGJA 4NYXA 4MR6A 5CQ4A 5EM3A 4QNSA 1ZS5A 4YBMA 5AMEA 4GPJA 4NR7A 5L96A 5IGKA 2YW5A 5EQ1A 3GG3A 5HENA 5D3PA 3MQMA 4HBXA 2D82A 4CUQA 5I7XA 5FE2A 4HBVA 3MXFA 3UVYA 5CPEA 5IG6A 5DKHA 3K2JA 5EU1A 4O70A 2DKWA 3UV4A 5FE0A 5FE7A 5LKTA 5D0CA 3O34A 2RNWA 4IR4A 2RNYA 2L85A 5EGUA 5DW2A 4NRCA 5L97A 5F2PA 4YYHA 1N72A 5FH7A 1JM4B 2YYNA 5FFYA 3SVFA 3U5PA 5FE5A 5EISA 4QEVA 4ALGA 4MENA 5D7XA 4J3IA 5FFWA 5HCLA 4J0RA 4KV4A 4O7CA 2WP1A 4TT6A 5C85A 3P5OA 5CS8A 2DVRA 3DAIA 5ACYA 4NR8A 5CQAA 4YBSA 4A9EA 3RCWA 5A5NA 5CP5A 5HJCA 4A9LA 5ENCA 4YBTA 4UIXA 3UVDA 5H85A 3MUKA 5CQ5A 5FH8A 2E7OA 5FFVA 4Z6HA 4YATA 2LSPB 3DWYA 5F60A 2NXBA 4HXOA 5CUAA 5II2A 2H60A 4BHWA 4IR6A 4YADA 4HXNA 3QZTA 4ALHA 5CQ7A 4HXSA 2MJVB 4TT2A 3G0JA 2N9GA 5HQ7A 4CURA 4O72A 5H1VA 4Z1QA 4BW3A 4TZ2A 5FDZA 5DFBA 4UIUA 4C67A 4N4FA 5FE1A 4NQNA 3O33A 4F3IA 4A9KA 5IBNA 3U5MA 5F1LA 1F68A 4O74A 4O75A 4TYLA 2GRCA 4IR3A 5KU3A 2RI7A 5LJ1A 2DVVA 5AD2A 4PKLA 3SVHA 5J0DA 3HMHA 5HQ6A 5CUEA 2YEKA 5F63A 4MEOA 5A85A 2FSAA 4TT4A 4A9FA 4ZC9A 4MR4A 5ETDA 5A5OA 5EWDA 2YQDA 3JVLA 5CQ8A 4ZQLA 4O7EA 5D3NA 5A5RA 3O36A 4YABA 3U5OA 3HMEA 2R0SA 2OSSA 4LZSA 5LJ2A 5A5SA 4Y03A 2L84A 5II1A 3SVGA 4QEWA 5ENFA 5E7DA 4Z6IA 4HXKA 5L98A 5I89A 2RS9B 3LQIA 5ENHA 4QSVA 5DBMA 4OGIA 4QB3A 5CRZA 5KHMA 4O7AA 4HXMA 4QC3A 5C4QA 5I80A 5C8GA 5KTXA 5DKDA 3U5LA 5JWMA 5D3RA 4CLBA 5LKXA 5IGNA 5A5PA 4BW2A 5EP7A 5EVAA 5L99A 3UW9A 4QSUA 1JSPB 5E73A 5H1UA 4XY9A 5HM0A 4NR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1T A;  4IOO A;  4UYH A;  4CFL A;  4E96 A;  1EQF A;  2R0Y A;  4QSW A;  4LZ2 A;  2E3K A;  4IOQ A;  4CUS A;  4PY6 A;  4YYK A;  5F5Z A;  5DYA A;  5G4R A;  4YK0 A;  5CUC A;  4IR5 A;  3IU5 A;  4NR9 A;  3NXB A;  4A9N A;  5HRW A;  4QR5 A;  4LC2 A;  4LRG A;  5A5Q A;  5BT5 A;  4X2I A;  3P1E A;  5BT4 A;  5E9I A;  5IID A;  5AD3 A;  5EPR A;  5FH6 A;  4YYD A;  4KCX A;  3LQH A;  3O35 A;  5A83 A;  2G4A A;  5KO4 A;  4QYD A;  4NUE A;  4AKN A;  4QSX A;  1E6I A;  5EWV A;  5I7Y A;  4YY6 A;  3P1F A;  5FE6 A;  4NS5 A;  5EPS A;  2KTB B;  4WHU A;  5HQ5 A;  4UYE A;  3I3J A;  5DY7 A;  4BJX A;  5E3D A;  5A7C A;  5ENB A;  4CUU A;  4BW1 A;  4TQN A;  5HFQ A;  5K29 A;  4QZS A;  5F62 A;  5F25 A;  3JVM A;  5DW1 A;  2F6N A;  4LDF A;  4QST A;  4YYI A;  3MUL A;  4NUD A;  5LJ0 A;  5DYU A;  5KTW A;  5FG5 A;  5I40 A;  5HLS A;  4UYG A;  2R0V A;  5LVQ A;  5EWC A;  5L8U A;  4RVR A;  5DX4 A;  4TU4 A;  4WHW A;  5D3H A;  5FE4 A;  5LKU A;  5D3T A;  5LVR A;  2YDW A;  4QYL A;  2DWW A;  2OUO A;  4J0S A;  5ENG A;  4O7F A;  4CUP A;  4QSS A;  5C89 A;  4NRB A;  4UIW A;  4QSR A;  4NRA A;  4NYV A;  5CQT A;  5DLX A;  4HXL A;  5DYC A;  5HFR A;  3D7C A;  3LJW A;  5E74 A;  4A9I A;  4HXR A;  5AMF A;  5EIC A;  2I8N A;  4A9M A;  4UYD A;  4NYW A;  5C7N A;  3UVX A;  3AQA A;  2I7K A;  4A9O A;  5CGP A;  4A9H A;  3JVK A;  4O76 A;  5D25 A;  4O78 A;  4UIZ A;  4IOR A;  2DVS A;  4UYF B;  5I29 A;  5D3L A;  4MR5 A;  3LQJ A;  5F61 A;  4MR3 A;  5E3G A;  4QY4 A;  3S91 A;  5ENE A;  5DFD A;  5ENJ A;  3U5K A;  4NQM A;  5CUD A;  4HBY A;  3U5J A;  5CUG A;  4XUB A;  4XYA A;  5L8T A;  4NXJ A;  4LYS A;  4YC9 A;  5EWH A;  4XY8 A;  4TS8 A;  5A82 A;  2D9E A;  5DLZ A;  4QBM A;  4TTE A;  5EI4 A;  4YYJ A;  4ZW1 A;  5FB1 A;  4KV1 A;  5FB0 A;  4NR6 A;  4A9J A;  2E7N A;  1WUM A;  5LKZ A;  4CFK A;  5COI A;  4QR4 A;  5FG6 A;  4QUT A;  5D26 A;  5E0R A;  3Q2E A;  3LXJ A;  3JVJ A;  4XUA A;  4WIV A;  4CL9 A;  1WUG A;  3ZYU A;  4YYN A;  4LYW A;  4YH4 A;  4Z1S A;  4YAX A;  2DAT A;  4PTB A;  4QUU A;  5CQ6 A;  4YH3 A;  5ENI A;  4QSQ A;  4O77 A;  5IGM A;  3MB4 A;  3O37 A;  2L5E A;  5EWW A;  3QZS A;  4MEQ A;  4QEU A;  5TB6 A;  5HRX A;  5CFW A;  4UIY A;  2WP2 A;  3P1C A;  4J1P A;  5HRV A;  4LZR A;  2RO1 A;  4PS5 A;  4OUF A;  5ETB A;  4HBW A;  5JI8 A;  5CU8 A;  4Q0N A;  5CRM A;  5DYX A;  5CZG A;  5CUB A;  5I1Q A;  3HMF A;  3MB3 A;  3IU6 A;  4PCE A;  4Q0O A;  3UV5 A;  2YEL A;  4NR5 A;  5A81 A;  2RNX A;  4UIV A;  2OO1 A;  4YYG A;  5I88 A;  3U5N A;  5E9L A;  5D3J A;  5EK9 A;  2YEM A;  5G4S A;  3UVW A;  5FE9 A;  4UYF A;  5IGL A;  5FG4 A;  3FKM X;  4FLP A;  5FBX A;  2RFJ A;  5E9Y A;  3Q2F A;  4O7B A;  5DFC A;  2DVQ A;  4TU6 A;  4N3W A;  4QC1 A;  4LR6 A;  5LUU A;  4Z93 A;  4PCI A;  5D3S A;  4QSP A;  5BT3 A;  5HEM A;  5CTL A;  5D24 A;  5F3A A;  5CQ3 A;  4O71 A;  5C87 A;  5E9V A;  5I83 A;  4HXP A;  3P1D A;  4N4H A;  2R10 A;  4DON A;  4TZ8 A;  4CUT A;  4N4G A;  4N4I A;  3QZV A;  4YY4 A;  4LYI A;  5KTU A;  5EPB A;  5DKC A;  4NUC A;  5EV9 A;  4MEP A;  3ONI A;  5E9K A;  4BW4 A;  4QR3 A;  2F6J A;  5HEL A;  5I86 A;  5FE3 A;  5E9M A;  5F36 A;  5FE8 A;  5F1H A;  3TLP A;  5EA1 A;  3S92 A;  3UV2 A;  5TCM A;  3G0L A;  1X0J A;  4YYM A;  4C66 A;  3AAD A;  4UIT A;  5CY9 A;  4OGJ A;  4NYX A;  4MR6 A;  5CQ4 A;  5EM3 A;  4QNS A;  1ZS5 A;  4YBM A;  5AME A;  4GPJ A;  4NR7 A;  5L96 A;  5IGK A;  2YW5 A;  5EQ1 A;  3GG3 A;  5HEN A;  5D3P A;  3MQM A;  4HBX A;  2D82 A;  4CUQ A;  5I7X A;  5FE2 A;  4HBV A;  3MXF A;  3UVY A;  5CPE A;  5IG6 A;  5DKH A;  3K2J A;  5EU1 A;  4O70 A;  2DKW A;  3UV4 A;  5FE0 A;  5FE7 A;  5LKT A;  5D0C A;  3O34 A;  2RNW A;  4IR4 A;  2RNY A;  2L85 A;  5EGU A;  5DW2 A;  4NRC A;  5L97 A;  5F2P A;  4YYH A;  1N72 A;  5FH7 A;  1JM4 B;  2YYN A;  5FFY A;  3SVF A;  3U5P A;  5FE5 A;  5EIS A;  4QEV A;  4ALG A;  4MEN A;  5D7X A;  4J3I A;  5FFW A;  5HCL A;  4J0R A;  4KV4 A;  4O7C A;  2WP1 A;  4TT6 A;  5C85 A;  3P5O A;  5CS8 A;  2DVR A;  3DAI A;  5ACY A;  4NR8 A;  5CQA A;  4YBS A;  4A9E A;  3RCW A;  5A5N A;  5CP5 A;  5HJC A;  4A9L A;  5ENC A;  4YBT A;  4UIX A;  3UVD A;  5H85 A;  3MUK A;  5CQ5 A;  5FH8 A;  2E7O A;  5FFV A;  4Z6H A;  4YAT A;  2LSP B;  3DWY A;  5F60 A;  2NXB A;  4HXO A;  5CUA A;  5II2 A;  2H60 A;  4BHW A;  4IR6 A;  4YAD A;  4HXN A;  3QZT A;  4ALH A;  5CQ7 A;  4HXS A;  2MJV B;  4TT2 A;  3G0J A;  2N9G A;  5HQ7 A;  4CUR A;  4O72 A;  5H1V A;  4Z1Q A;  4BW3 A;  4TZ2 A;  5FDZ A;  5DFB A;  4UIU A;  4C67 A;  4N4F A;  5FE1 A;  4NQN A;  3O33 A;  4F3I A;  4A9K A;  5IBN A;  3U5M A;  5F1L A;  1F68 A;  4O74 A;  4O75 A;  4TYL A;  2GRC A;  4IR3 A;  5KU3 A;  2RI7 A;  5LJ1 A;  2DVV A;  5AD2 A;  4PKL A;  3SVH A;  5J0D A;  3HMH A;  5HQ6 A;  5CUE A;  2YEK A;  5F63 A;  4MEO A;  5A85 A;  2FSA A;  4TT4 A;  4A9F A;  4ZC9 A;  4MR4 A;  5ETD A;  5A5O A;  5EWD A;  2YQD A;  3JVL A;  5CQ8 A;  4ZQL A;  4O7E A;  5D3N A;  5A5R A;  3O36 A;  4YAB A;  3U5O A;  3HME A;  2R0S A;  2OSS A;  4LZS A;  5LJ2 A;  5A5S A;  4Y03 A;  2L84 A;  5II1 A;  3SVG A;  4QEW A;  5ENF A;  5E7D A;  4Z6I A;  4HXK A;  5L98 A;  5I89 A;  2RS9 B;  3LQI A;  5ENH A;  4QSV A;  5DBM A;  4OGI A;  4QB3 A;  5CRZ A;  5KHM A;  4O7A A;  4HXM A;  4QC3 A;  5C4Q A;  5I80 A;  5C8G A;  5KTX A;  5DKD A;  3U5L A;  5JWM A;  5D3R A;  4CLB A;  5LKX A;  5IGN A;  5A5P A;  4BW2 A;  5EP7 A;  5EVA A;  5L99 A;  3UW9 A;  4QSU A;  1JSP B;  5E73 A;  5H1U A;  4XY9 A;  5HM0 A;  4NR4 A; 
#chains in the Genus database with same CATH topology
 5H1T A;  4IOO A;  4UYH A;  4CFL A;  4E96 A;  1EQF A;  2R0Y A;  4QSW A;  4LZ2 A;  4AKI A;  2E3K A;  4IOQ A;  4CUS A;  4PY6 A;  4YYK A;  5F5Z A;  5DYA A;  5G4R A;  4YK0 A;  5CUC A;  4IR5 A;  3IU5 A;  4NR9 A;  3NXB A;  4A9N A;  5HRW A;  4QR5 A;  4LC2 A;  4LRG A;  5A5Q A;  5BT5 A;  4X2I A;  3P1E A;  5BT4 A;  5E9I A;  5IID A;  5AD3 A;  5EPR A;  3ERR A;  5FH6 A;  4YYD A;  4KCX A;  3LQH A;  3O35 A;  5A83 A;  2G4A A;  5KO4 A;  4QYD A;  4NUE A;  4AKN A;  4QSX A;  1E6I A;  5EWV A;  5I7Y A;  4YY6 A;  3P1F A;  5FE6 A;  4NS5 A;  5EPS A;  2KTB B;  4WHU A;  5HQ5 A;  4UYE A;  3I3J A;  5DY7 A;  4BJX A;  5E3D A;  5A7C A;  5ENB A;  4CUU A;  4BW1 A;  4TQN A;  5HFQ A;  5K29 A;  4QZS A;  5F62 A;  5F25 A;  3JVM A;  5DW1 A;  2F6N A;  4LDF A;  4QST A;  4YYI A;  3MUL A;  4NUD A;  5LJ0 A;  5DYU A;  5KTW A;  5FG5 A;  5I40 A;  5HLS A;  4UYG A;  2R0V A;  5LVQ A;  5EWC A;  5L8U A;  4RVR A;  5DX4 A;  4TU4 A;  4WHW A;  5D3H A;  5FE4 A;  5LKU A;  5D3T A;  5LVR A;  2YDW A;  4QYL A;  2DWW A;  2OUO A;  4J0S A;  5ENG A;  4O7F A;  4CUP A;  4QSS A;  5C89 A;  4NRB A;  3D1D A;  4UIW A;  5I80 A;  4QSR A;  4NRA A;  4NYV A;  5CQT A;  5DLX A;  4HXL A;  5DYC A;  5HFR A;  3D7C A;  3LJW A;  5E74 A;  4A9I A;  4HXR A;  5AMF A;  5EIC A;  2I8N A;  4A9M A;  4UYD A;  4NYW A;  5C7N A;  3UVX A;  3AQA A;  2I7K A;  4A9O A;  5CGP A;  4A9H A;  3JVK A;  4O76 A;  5D25 A;  4O78 A;  4UIZ A;  4IOR A;  2DVS A;  4UYF B;  5I29 A;  5D3L A;  4MR5 A;  3LQJ A;  5F61 A;  4MR3 A;  5E3G A;  4QY4 A;  3S91 A;  5ENE A;  5DFD A;  5ENJ A;  3U5K A;  4NQM A;  5CUD A;  4HBY A;  3U5J A;  5CUG A;  4XUB A;  4XYA A;  5L8T A;  4NXJ A;  4LYS A;  4YC9 A;  5EWH A;  4XY8 A;  4TS8 A;  5A82 A;  2D9E A;  5DLZ A;  4QBM A;  4TTE A;  5EI4 A;  4YYJ A;  4ZW1 A;  5FB1 A;  4KV1 A;  5FB0 A;  4NR6 A;  4A9J A;  2E7N A;  1WUM A;  5LKZ A;  4CFK A;  1PUO A;  5COI A;  4QR4 A;  5FG6 A;  4QUT A;  5D26 A;  5E0R A;  3Q2E A;  3LXJ A;  3JVJ A;  4XUA A;  4WIV A;  4CL9 A;  1WUG A;  3ZYU A;  4YYN A;  4LYW A;  4YH4 A;  4Z1S A;  4YAX A;  2DAT A;  4PTB A;  4QUU A;  5CQ6 A;  4YH3 A;  5ENI A;  4QSQ A;  4O77 A;  5IGM A;  3MB4 A;  3O37 A;  2L5E A;  5EWW A;  3QZS A;  4MEQ A;  4QEU A;  5TB6 A;  5HRX A;  5CFW A;  4UIY A;  2WP2 A;  3P1C A;  4J1P A;  5HRV A;  4LZR A;  2RO1 A;  4PS5 A;  4OUF A;  5ETB A;  4HBW A;  5JI8 A;  5CU8 A;  4Q0N A;  5CRM A;  5DYX A;  5CZG A;  5CUB A;  5I1Q A;  3HMF A;  3MB3 A;  3IU6 A;  4PCE A;  4Q0O A;  3UV5 A;  2YEL A;  4NR5 A;  5KTX A;  5A81 A;  2RNX A;  4AI6 A;  4UIV A;  2OO1 A;  4YYG A;  5I88 A;  3U5N A;  5E9L A;  5D3J A;  5EK9 A;  2YEM A;  5G4S A;  3UVW A;  5FE9 A;  4UYF A;  5IGL A;  5FG4 A;  3FKM X;  4FLP A;  5FBX A;  2RFJ A;  5E9Y A;  3Q2F A;  4O7B A;  5DFC A;  2DVQ A;  4TU6 A;  4N3W A;  4QC1 A;  4LR6 A;  5LUU A;  4Z93 A;  4PCI A;  5D3S A;  4QSP A;  5BT3 A;  5HEM A;  5CTL A;  5D24 A;  5F3A A;  5CQ3 A;  4O71 A;  5C87 A;  5E9V A;  5I83 A;  4HXP A;  3P1D A;  4N4H A;  2R10 A;  4DON A;  4TZ8 A;  4CUT A;  4N4G A;  4N4I A;  3QZV A;  4YY4 A;  4LYI A;  5KTU A;  5EPB A;  5DKC A;  4NUC A;  5EV9 A;  4MEP A;  3ONI A;  5E9K A;  4BW4 A;  4QR3 A;  2F6J A;  5HEL A;  5I86 A;  5FE3 A;  5E9M A;  5F36 A;  5FE8 A;  5F1H A;  3TLP A;  5EA1 A;  3S92 A;  3UV2 A;  5TCM A;  3G0L A;  1X0J A;  4YYM A;  4C66 A;  3AAD A;  4UIT A;  5CY9 A;  4OGJ A;  4NYX A;  4MR6 A;  5CQ4 A;  5EM3 A;  4QNS A;  1ZS5 A;  4YBM A;  5AME A;  4GPJ A;  4NR7 A;  5L96 A;  5IGK A;  2YW5 A;  5EQ1 A;  3GG3 A;  5HEN A;  5D3P A;  3MQM A;  4HBX A;  2D82 A;  4CUQ A;  5I7X A;  5FE2 A;  4HBV A;  3MXF A;  3UVY A;  5CPE A;  5IG6 A;  5DKH A;  3K2J A;  5EU1 A;  4O70 A;  2DKW A;  3UV4 A;  5FE0 A;  5FE7 A;  5LKT A;  5D0C A;  3O34 A;  2RNW A;  4IR4 A;  2RNY A;  2L85 A;  5EGU A;  5DW2 A;  4NRC A;  5L97 A;  5F2P A;  4YYH A;  1N72 A;  5FH7 A;  1JM4 B;  2YYN A;  5FFY A;  3SVF A;  3U5P A;  5FE5 A;  5EIS A;  4QEV A;  4ALG A;  4MEN A;  5D7X A;  4J3I A;  5FFW A;  5HCL A;  4J0R A;  4KV4 A;  4O7C A;  2WP1 A;  4TT6 A;  5C85 A;  3P5O A;  5CS8 A;  2DVR A;  3DAI A;  5ACY A;  4NR8 A;  5CQA A;  4YBS A;  4A9E A;  3RCW A;  5A5N A;  4AKG A;  5CP5 A;  5HJC A;  4A9L A;  5ENC A;  4YBT A;  2EJN A;  3VKH A;  4UIX A;  3UVD A;  5H85 A;  3MUK A;  5CQ5 A;  5FH8 A;  2E7O A;  5FFV A;  4Z6H A;  4YAT A;  2LSP B;  3DWY A;  5F60 A;  2NXB A;  4HXO A;  5CUA A;  5II2 A;  2H60 A;  4BHW A;  4IR6 A;  4YAD A;  4HXN A;  3QZT A;  4ALH A;  5CQ7 A;  4HXS A;  2MJV B;  4TT2 A;  3G0J A;  2N9G A;  5HQ7 A;  4CUR A;  4O72 A;  5H1V A;  4Z1Q A;  4BW3 A;  4TZ2 A;  5FDZ A;  5DFB A;  4UIU A;  4C67 A;  4N4F A;  5FE1 A;  4NQN A;  3O33 A;  4F3I A;  4A9K A;  5IBN A;  3U5M A;  5F1L A;  1F68 A;  4O74 A;  4O75 A;  4TYL A;  2GRC A;  4IR3 A;  5KU3 A;  2RI7 A;  5LJ1 A;  2DVV A;  5AD2 A;  4PKL A;  3SVH A;  5J0D A;  3HMH A;  5HQ6 A;  5CUE A;  2YEK A;  5F63 A;  4MEO A;  5A85 A;  2FSA A;  4TT4 A;  4A9F A;  4ZC9 A;  4MR4 A;  5ETD A;  5A5O A;  5EWD A;  2YQD A;  3JVL A;  5CQ8 A;  4ZQL A;  4O7E A;  5D3N A;  5A5R A;  3O36 A;  4YAB A;  3U5O A;  3HME A;  2R0S A;  2OSS A;  4LZS A;  5LJ2 A;  5A5S A;  4Y03 A;  2L84 A;  5II1 A;  3SVG A;  4QEW A;  5ENF A;  5E7D A;  4Z6I A;  4HXK A;  5L98 A;  5I89 A;  2RS9 B;  3LQI A;  5ENH A;  4QSV A;  5CRZ A;  4OGI A;  4QB3 A;  3D1B A;  5DBM A;  1ZKR A;  4HXM A;  4O7A A;  4QC3 A;  5KHM A;  5C4Q A;  5C8G A;  5DKD A;  3U5L A;  5JWM A;  5D3R A;  3VKG A;  4CLB A;  5LKX A;  5IGN A;  5A5P A;  4AKH A;  4BW2 A;  5EP7 A;  5EVA A;  5L99 A;  3UW9 A;  4QSU A;  1JSP B;  5E73 A;  5H1U A;  4XY9 A;  5HM0 A;  4NR4 A; 
#chains in the Genus database with same CATH homology
 5H1T A;  4IOO A;  4UYH A;  4CFL A;  4E96 A;  1EQF A;  2R0Y A;  4QSW A;  4LZ2 A;  2E3K A;  4IOQ A;  4CUS A;  4PY6 A;  4YYK A;  5F5Z A;  5DYA A;  5G4R A;  4YK0 A;  5CUC A;  4IR5 A;  3IU5 A;  4NR9 A;  3NXB A;  4A9N A;  5HRW A;  4QR5 A;  4LC2 A;  4LRG A;  5A5Q A;  5BT5 A;  4X2I A;  3P1E A;  5BT4 A;  5E9I A;  5IID A;  5AD3 A;  5EPR A;  5FH6 A;  4YYD A;  4KCX A;  3LQH A;  3O35 A;  5A83 A;  2G4A A;  5KO4 A;  4QYD A;  4NUE A;  4AKN A;  4QSX A;  1E6I A;  5EWV A;  5I7Y A;  4YY6 A;  3P1F A;  5FE6 A;  4NS5 A;  5EPS A;  2KTB B;  4WHU A;  5HQ5 A;  4UYE A;  3I3J A;  5DY7 A;  4BJX A;  5E3D A;  5A7C A;  5ENB A;  4CUU A;  4BW1 A;  4TQN A;  5HFQ A;  5K29 A;  4QZS A;  5F62 A;  5F25 A;  3JVM A;  5DW1 A;  2F6N A;  4LDF A;  4QST A;  4YYI A;  3MUL A;  4NUD A;  5LJ0 A;  5DYU A;  5KTW A;  5FG5 A;  5I40 A;  5HLS A;  4UYG A;  2R0V A;  5LVQ A;  5EWC A;  5L8U A;  4RVR A;  5DX4 A;  4TU4 A;  4WHW A;  5D3H A;  5FE4 A;  5LKU A;  5D3T A;  5LVR A;  2YDW A;  4QYL A;  2DWW A;  2OUO A;  4J0S A;  5ENG A;  4O7F A;  4CUP A;  4QSS A;  5C89 A;  4NRB A;  4UIW A;  4QSR A;  4NRA A;  4NYV A;  5CQT A;  5DLX A;  4HXL A;  5DYC A;  5HFR A;  3D7C A;  3LJW A;  5E74 A;  4A9I A;  4HXR A;  5AMF A;  5EIC A;  2I8N A;  4A9M A;  4UYD A;  4NYW A;  5C7N A;  3UVX A;  3AQA A;  2I7K A;  4A9O A;  5CGP A;  4A9H A;  3JVK A;  4O76 A;  5D25 A;  4O78 A;  4UIZ A;  4IOR A;  2DVS A;  4UYF B;  5I29 A;  5D3L A;  4MR5 A;  3LQJ A;  5F61 A;  4MR3 A;  5E3G A;  4QY4 A;  3S91 A;  5ENE A;  5DFD A;  5ENJ A;  3U5K A;  4NQM A;  5CUD A;  4HBY A;  3U5J A;  5CUG A;  4XUB A;  4XYA A;  5L8T A;  4NXJ A;  4LYS A;  4YC9 A;  5EWH A;  4XY8 A;  4TS8 A;  5A82 A;  2D9E A;  5DLZ A;  4QBM A;  4TTE A;  5EI4 A;  4YYJ A;  4ZW1 A;  5FB1 A;  4KV1 A;  5FB0 A;  4NR6 A;  4A9J A;  2E7N A;  1WUM A;  5LKZ A;  4CFK A;  5COI A;  4QR4 A;  5FG6 A;  4QUT A;  5D26 A;  5E0R A;  3Q2E A;  3LXJ A;  3JVJ A;  4XUA A;  4WIV A;  4CL9 A;  1WUG A;  3ZYU A;  4YYN A;  4LYW A;  4YH4 A;  4Z1S A;  4YAX A;  2DAT A;  4PTB A;  4QUU A;  5CQ6 A;  4YH3 A;  5ENI A;  4QSQ A;  4O77 A;  5IGM A;  3MB4 A;  3O37 A;  2L5E A;  5EWW A;  3QZS A;  4MEQ A;  4QEU A;  5TB6 A;  5HRX A;  5CFW A;  4UIY A;  2WP2 A;  3P1C A;  4J1P A;  5HRV A;  4LZR A;  2RO1 A;  4PS5 A;  4OUF A;  5ETB A;  4HBW A;  5JI8 A;  5CU8 A;  4Q0N A;  5CRM A;  5DYX A;  5CZG A;  5CUB A;  5I1Q A;  3HMF A;  3MB3 A;  3IU6 A;  4PCE A;  4Q0O A;  3UV5 A;  2YEL A;  4NR5 A;  5A81 A;  2RNX A;  4UIV A;  2OO1 A;  4YYG A;  5I88 A;  3U5N A;  5E9L A;  5D3J A;  5EK9 A;  2YEM A;  5G4S A;  3UVW A;  5FE9 A;  4UYF A;  5IGL A;  5FG4 A;  3FKM X;  4FLP A;  5FBX A;  2RFJ A;  5E9Y A;  3Q2F A;  4O7B A;  5DFC A;  2DVQ A;  4TU6 A;  4N3W A;  4QC1 A;  4LR6 A;  5LUU A;  4Z93 A;  4PCI A;  5D3S A;  4QSP A;  5BT3 A;  5HEM A;  5CTL A;  5D24 A;  5F3A A;  5CQ3 A;  4O71 A;  5C87 A;  5E9V A;  5I83 A;  4HXP A;  3P1D A;  4N4H A;  2R10 A;  4DON A;  4TZ8 A;  4CUT A;  4N4G A;  4N4I A;  3QZV A;  4YY4 A;  4LYI A;  5KTU A;  5EPB A;  5DKC A;  4NUC A;  5EV9 A;  4MEP A;  3ONI A;  5E9K A;  4BW4 A;  4QR3 A;  2F6J A;  5HEL A;  5I86 A;  5FE3 A;  5E9M A;  5F36 A;  5FE8 A;  5F1H A;  3TLP A;  5EA1 A;  3S92 A;  3UV2 A;  5TCM A;  3G0L A;  1X0J A;  4YYM A;  4C66 A;  3AAD A;  4UIT A;  5CY9 A;  4OGJ A;  4NYX A;  4MR6 A;  5CQ4 A;  5EM3 A;  4QNS A;  1ZS5 A;  4YBM A;  5AME A;  4GPJ A;  4NR7 A;  5L96 A;  5IGK A;  2YW5 A;  5EQ1 A;  3GG3 A;  5HEN A;  5D3P A;  3MQM A;  4HBX A;  2D82 A;  4CUQ A;  5I7X A;  5FE2 A;  4HBV A;  3MXF A;  3UVY A;  5CPE A;  5IG6 A;  5DKH A;  3K2J A;  5EU1 A;  4O70 A;  2DKW A;  3UV4 A;  5FE0 A;  5FE7 A;  5LKT A;  5D0C A;  3O34 A;  2RNW A;  4IR4 A;  2RNY A;  2L85 A;  5EGU A;  5DW2 A;  4NRC A;  5L97 A;  5F2P A;  4YYH A;  1N72 A;  5FH7 A;  1JM4 B;  2YYN A;  5FFY A;  3SVF A;  3U5P A;  5FE5 A;  5EIS A;  4QEV A;  4ALG A;  4MEN A;  5D7X A;  4J3I A;  5FFW A;  5HCL A;  4J0R A;  4KV4 A;  4O7C A;  2WP1 A;  4TT6 A;  5C85 A;  3P5O A;  5CS8 A;  2DVR A;  3DAI A;  5ACY A;  4NR8 A;  5CQA A;  4YBS A;  4A9E A;  3RCW A;  5A5N A;  5CP5 A;  5HJC A;  4A9L A;  5ENC A;  4YBT A;  4UIX A;  3UVD A;  5H85 A;  3MUK A;  5CQ5 A;  5FH8 A;  2E7O A;  5FFV A;  4Z6H A;  4YAT A;  2LSP B;  3DWY A;  5F60 A;  2NXB A;  4HXO A;  5CUA A;  5II2 A;  2H60 A;  4BHW A;  4IR6 A;  4YAD A;  4HXN A;  3QZT A;  4ALH A;  5CQ7 A;  4HXS A;  2MJV B;  4TT2 A;  3G0J A;  2N9G A;  5HQ7 A;  4CUR A;  4O72 A;  5H1V A;  4Z1Q A;  4BW3 A;  4TZ2 A;  5FDZ A;  5DFB A;  4UIU A;  4C67 A;  4N4F A;  5FE1 A;  4NQN A;  3O33 A;  4F3I A;  4A9K A;  5IBN A;  3U5M A;  5F1L A;  1F68 A;  4O74 A;  4O75 A;  4TYL A;  2GRC A;  4IR3 A;  5KU3 A;  2RI7 A;  5LJ1 A;  2DVV A;  5AD2 A;  4PKL A;  3SVH A;  5J0D A;  3HMH A;  5HQ6 A;  5CUE A;  2YEK A;  5F63 A;  4MEO A;  5A85 A;  2FSA A;  4TT4 A;  4A9F A;  4ZC9 A;  4MR4 A;  5ETD A;  5A5O A;  5EWD A;  2YQD A;  3JVL A;  5CQ8 A;  4ZQL A;  4O7E A;  5D3N A;  5A5R A;  3O36 A;  4YAB A;  3U5O A;  3HME A;  2R0S A;  2OSS A;  4LZS A;  5LJ2 A;  5A5S A;  4Y03 A;  2L84 A;  5II1 A;  3SVG A;  4QEW A;  5ENF A;  5E7D A;  4Z6I A;  4HXK A;  5L98 A;  5I89 A;  2RS9 B;  3LQI A;  5ENH A;  4QSV A;  5DBM A;  4OGI A;  4QB3 A;  5CRZ A;  5KHM A;  4O7A A;  4HXM A;  4QC3 A;  5C4Q A;  5I80 A;  5C8G A;  5KTX A;  5DKD A;  3U5L A;  5JWM A;  5D3R A;  4CLB A;  5LKX A;  5IGN A;  5A5P A;  4BW2 A;  5EP7 A;  5EVA A;  5L99 A;  3UW9 A;  4QSU A;  1JSP B;  5E73 A;  5H1U A;  4XY9 A;  5HM0 A;  4NR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...