5KTWA

Crebbp bromodomain in complex with cpd 44 (3-((5-acetyl-1-(cyclopropylmethyl)-4,5,6,7-tetrahydro-1h-pyrazolo[4,3-c]pyridin-3-yl)amino)-n-isopropylbenzamide)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
114
structure length
114
Chain Sequence
AAFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CREB-binding protein
publication title Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 37
structure length 114
sequence length 114
chains with identical sequence B, C
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ktwA00
5ACYA 5FFYA 2WP1A 5EPSA 4QY4A 2YELA 5AMFA 4NR5A 5DYCA 4LR6A 5F36A 3HMFA 4PCEA 1F68A 4YY4A 4MEPA 4N4FA 3U5NA 4NR7A 5C85A 5I88A 4HBVA 5DW1A 2R10A 4N4IA 4NUEA 4UYEA 5FDZA 4NUDA 4NRCA 3DWYA 5CY9A 2H60A 4HBXA 4KV1A 5CQ7A 5EWWA 5FB0A 4RVRA 4TT4A 2YEMA 4LC2A 3JVLA 2RO1A 4YH3A 3O37A 4J1PA 3UVDA 2DATA 3ZYUA 4NQNA 5A5PA 2DKWA 3JVMA 5LUUA 4QR5A 4C67A 5FE0A 2E7OA 3Q2FA 4TU6A 4Y03A 5HRVA 4XUBA 3LXJA 4LYIA 4PKLA 5I40A 5FE1A 5FG6A 4TS8A 1JM4B 2I8NA 5CPEA 5DFBA 5CQ4A 1JSPB 5EA1A 5IGMA 4N4HA 3QZTA 4ZQLA 4NR8A 5H85A 4WHWA 5A5RA 4TT6A 4QEUA 4QYLA 5ENEA 4NR4A 4QEWA 4QYDA 5C7NA 4A9LA 4YY6A 4O74A 2OSSA 4XY9A 4BHWA 4QUTA 5E74A 5LJ0A 3LJWA 3ONIA 3Q2EA 2GRCA 2FSAA 3MXFA 3UW9A 5FH7A 3JVKA 5CUGA 5HRWA 5DBMA 4CL9A 5FE7A 4YATA 5ENHA 4BW3A 3UVYA 5D7XA 5EU1A 5ENGA 4YK0A 5JI8A 3I3JA 5IG6A 5AMEA 5A5QA 3IU6A 4YYMA 5HRXA 5I7YA 5HELA 5FE2A 5HFQA 5FFVA 5H1VA 4BW1A 4FLPA 2R0SA 5D3PA 3RCWA 3SVFA 4J0SA 4YADA 4MEOA 4HXPA 4IOOA 5D25A 5CGPA 4WIVA 5HM0A 4Q0OA 4NS5A 5IGKA 4XUAA 4HXNA 4HBYA 3MQMA 4HXRA 5BT5A 3IU5A 3P1CA 4O72A 4TTEA 4IR5A 4QSRA 5E3GA 4A9EA 5F1HA 5HQ5A 3O36A 4QZSA 2RNXA 5I83A 4O70A 5F3AA 3U5KA 4GPJA 4UIWA 5E9MA 3U5JA 5KTWA 4NR6A 4OUFA 4BW2A 3O33A 5D0CA 5FE4A 5LKTA 4QSTA 2OUOA 2RFJA 5IGLA 3DAIA 4QC3A 4TZ2A 4O7AA 4UYFB 4CURA 4UIXA 4MR4A 4BW4A 3D7CA 3QZVA 5F63A 4QUUA 2RNYA 4Q0NA 4J0RA 5HENA 5HJCA 5ETBA 5II1A 5HFRA 5FE5A 4CUSA 5EWCA 3MB3A 4PS5A 4YYDA 4TT2A 5FB1A 4O7CA 4O7EA 5LJ2A 4YYNA 3HMEA 5A82A 4MR5A 5DKCA 4HBWA 2DVRA 2R0YA 3UV2A 4A9FA 3JVJA 5H1TA 2RS9B 5HQ7A 4HXOA 5L97A 4Z1SA 3HMHA 5HLSA 4OGJA 4UYDA 5EI4A 5F1LA 5EICA 5A5OA 5CTLA 4YH4A 4QSQA 4A9HA 4UIZA 5DX4A 4CUQA 5C8GA 4IOQA 4UYGA 2L5EA 4Z93A 4PCIA 5E0RA 2DVQA 5A81A 4QSUA 2L85A 2YDWA 4IR4A 4LZRA 5HCLA 5D3RA 5EVAA 1ZS5A 4N4GA 5CUEA 5D3HA 5L8TA 4YYHA 4NR9A 4C66A 5LJ1A 5IBNA 5KHMA 4UYFA 2YYNA 5FE6A 2YW5A 5CUBA 5EWHA 5E9IA 5LVQA 3P1DA 3NXBA 2L84A 3AADA 5ENFA 5D26A 3MULA 4BJXA 5DKDA 4A9JA 2YQDA 4YYJA 4HXSA 4OGIA 5CU8A 5F62A 3U5LA 5D3JA 3K2JA 4LZSA 4ZW1A 2E3KA 5DYXA 5F5ZA 5LKUA 5HEMA 5H1UA 4N3WA 4CUUA 2DWWA 4TU4A 4O78A 5EGUA 5CUAA 4NYXA 5L8UA 5D24A 4TQNA 4TZ8A 4NYVA 4QBMA 2DVSA 4O76A 5CZGA 5A7CA 5FE8A 4O77A 5HQ6A 4LYSA 5DYAA 5AD2A 4CLBA 4MR3A 2F6NA 4KCXA 5CUDA 4QNSA 3MUKA 4IR6A 5L99A 5CFWA 4YBSA 1WUMA 5FH8A 5L98A 5A83A 3P5OA 4ALHA 4YBTA 4QSXA 3LQHA 4YAXA 5CQ6A 4UYHA 4YYGA 3O34A 5ENCA 3UVXA 2I7KA 4UIVA 4QB3A 5F60A 4NQMA 4YYIA 4Z6IA 5I80A 4PTBA 4IR3A 5E7DA 4UIUA 3AQAA 4WHUA 1N72A 5II2A 4QSVA 5DYUA 3LQIA 5C89A 4CUTA 5D3LA 4A9OA 5I29A 5J0DA 5KO4A 5CRMA 4HXMA 5EV9A 4MEQA 5CQTA 5FH6A 3P1EA 3GG3A 5ENIA 3UVWA 4UITA 4QR3A 5I1QA 5FG5A 5EPBA 4A9NA 5BT3A 4TYLA 4AKNA 4QSPA 4LZ2A 4O7FA 2OO1A 3U5MA 4CUPA 4E96A 2D82A 5JWMA 5ENBA 5F2PA 4QC1A 5E9LA 5IGNA 4HXKA 5D3NA 5G4SA 3G0JA 5D3TA 5COIA 4NUCA 4NYWA 2LSPB 4A9KA 5CS8A 3LQJA 5EK9A 4LYWA 5K29A 3UV4A 5A5SA 2DVVA 5E9VA 5FE9A 1E6IA 5I7XA 4QEVA 4YABA 5DFDA 5DLXA 5DY7A 4LDFA 5G4RA 5LVRA 5EP7A 5DFCA 4NXJA 4PY6A 5BT4A 4ALGA 5CRZA 5DW2A 1EQFA 3SVGA 3U5OA 5EPRA 5E73A 5E3DA 5E9YA 5IIDA 3S92A 3MB4A 5FFWA 5EQ1A 5CQ5A 4O75A 5FG4A 5DKHA 5KU3A 5LKZA 2N9GA 4CFKA 2RNWA 5ENJA 2RI7A 5CQ3A 3FKMX 5EWVA 5L96A 4QSSA 5TB6A 1WUGA 4QR4A 5F61A 4F3IA 2NXBA 2E7NA 5I86A 4YYKA 5FE3A 4Z6HA 5KTUA 4CFLA 5DLZA 2YEKA 5CP5A 4YC9A 4MENA 4LRGA 5A5NA 5KTXA 3P1FA 4YBMA 4DONA 5D3SA 5TCMA 4MR6A 3QZSA 5CUCA 3TLPA 4NRAA 5AD3A 3O35A 5CQAA 2G4AA 5C87A 5I89A 5EISA 5A85A 5C4QA 5EWDA 3SVHA 5ETDA 2R0VA 4KV4A 5LKXA 4J3IA 4X2IA 4XYAA 1X0JA 2MJVB 2WP2A 2D9EA 4NRBA 4O7BA 4A9IA 4Z1QA 4ZC9A 3UV5A 4UIYA 4IORA 3U5PA 4XY8A 2F6JA 2KTBB 4A9MA 4QSWA 5F25A 5FBXA 3G0LA 4O71A 5CQ8A 5E9KA 3S91A 5EM3A 4HXLA
chains in the Genus database with same CATH superfamily
5ACYA 5FFYA 2WP1A 5EPSA 4QY4A 2YELA 5AMFA 4NR5A 5DYCA 4LR6A 5F36A 3HMFA 4PCEA 1F68A 4YY4A 4MEPA 4N4FA 3U5NA 4NR7A 5C85A 5I88A 4HBVA 5DW1A 2R10A 4N4IA 4NUEA 4UYEA 5FDZA 4NUDA 4NRCA 3DWYA 5CY9A 2H60A 4HBXA 4KV1A 5CQ7A 5EWWA 5FB0A 4RVRA 4TT4A 2YEMA 4LC2A 3JVLA 2RO1A 4YH3A 3O37A 4J1PA 3UVDA 2DATA 3ZYUA 4NQNA 5A5PA 2DKWA 3JVMA 5LUUA 4QR5A 4C67A 5FE0A 2E7OA 3Q2FA 4TU6A 4Y03A 5HRVA 4XUBA 3LXJA 4LYIA 4PKLA 5I40A 5FE1A 5FG6A 4TS8A 1JM4B 2I8NA 5CPEA 5DFBA 5CQ4A 1JSPB 5EA1A 5IGMA 4N4HA 3QZTA 4ZQLA 4NR8A 5H85A 4WHWA 5A5RA 4TT6A 4QEUA 4QYLA 5ENEA 4NR4A 4QEWA 4QYDA 5C7NA 4A9LA 4YY6A 4O74A 2OSSA 4XY9A 4BHWA 4QUTA 5E74A 5LJ0A 3LJWA 3ONIA 3Q2EA 2GRCA 2FSAA 3MXFA 3UW9A 5FH7A 3JVKA 5CUGA 5HRWA 5DBMA 4CL9A 5FE7A 4YATA 5ENHA 4BW3A 3UVYA 5D7XA 3D1DA 5ENGA 4YK0A 5EU1A 5JI8A 3I3JA 5IG6A 5AMEA 5A5QA 3IU6A 4YYMA 5HRXA 5I7YA 5HELA 5FE2A 5HFQA 5FFVA 5H1VA 4BW1A 4FLPA 2R0SA 5D3PA 3RCWA 3SVFA 4J0SA 4YADA 4MEOA 4HXPA 4IOOA 5D25A 5CGPA 4WIVA 5HM0A 4Q0OA 4NS5A 5IGKA 4XUAA 4HXNA 4HBYA 3MQMA 4HXRA 5BT5A 3IU5A 3P1CA 4O72A 4TTEA 4IR5A 4QSRA 5E3GA 4A9EA 5F1HA 5HQ5A 3O36A 4QZSA 2RNXA 5I83A 4O70A 5F3AA 3U5KA 4GPJA 4UIWA 5E9MA 1PUOA 3U5JA 4AKIA 5KTWA 4NR6A 4OUFA 4BW2A 3O33A 5D0CA 5FE4A 5LKTA 4QSTA 2OUOA 2RFJA 5IGLA 3DAIA 4QC3A 4TZ2A 4O7AA 4UYFB 4CURA 4UIXA 4MR4A 4BW4A 3D7CA 3QZVA 5F63A 4QUUA 2RNYA 4Q0NA 4J0RA 5HENA 5HJCA 5ETBA 5II1A 5HFRA 5FE5A 4CUSA 5EWCA 3MB3A 4PS5A 4YYDA 4TT2A 5FB1A 4O7CA 4O7EA 5LJ2A 4YYNA 3HMEA 5A82A 4MR5A 5DKCA 4HBWA 2DVRA 2R0YA 3UV2A 4A9FA 3JVJA 5H1TA 2RS9B 5HQ7A 4HXOA 5L97A 4Z1SA 3HMHA 5HLSA 4OGJA 4UYDA 5EI4A 5F1LA 5EICA 5A5OA 5CTLA 4YH4A 4QSQA 4A9HA 4UIZA 5DX4A 4CUQA 5C8GA 4IOQA 4UYGA 2L5EA 4Z93A 4PCIA 5E0RA 2DVQA 5A81A 4QSUA 2L85A 2YDWA 4IR4A 4LZRA 5HCLA 5D3RA 5EVAA 1ZS5A 4N4GA 5CUEA 1ZKRA 5D3HA 5L8TA 4YYHA 4NR9A 4C66A 5LJ1A 3D1BA 5IBNA 5KHMA 4UYFA 2YYNA 5FE6A 2YW5A 5CUBA 5EWHA 5E9IA 5LVQA 3P1DA 3NXBA 2L84A 3AADA 5ENFA 5D26A 3MULA 4BJXA 5DKDA 4A9JA 2YQDA 4YYJA 4HXSA 4OGIA 5CU8A 5F62A 3U5LA 5D3JA 3K2JA 4LZSA 4ZW1A 2E3KA 5DYXA 5F5ZA 5LKUA 5HEMA 5H1UA 4N3WA 4CUUA 2DWWA 4TU4A 4O78A 5EGUA 5CUAA 4NYXA 5L8UA 5D24A 4TQNA 4TZ8A 4NYVA 4QBMA 2DVSA 4O76A 5CZGA 5A7CA 5FE8A 4O77A 5HQ6A 4LYSA 5DYAA 5AD2A 4CLBA 4MR3A 2F6NA 4KCXA 5CUDA 4QNSA 3MUKA 4IR6A 5L99A 5CFWA 4YBSA 1WUMA 5FH8A 5L98A 5A83A 3P5OA 4ALHA 4YBTA 4QSXA 3LQHA 4YAXA 5CQ6A 4AI6A 4UYHA 4YYGA 3O34A 5ENCA 3UVXA 2I7KA 4UIVA 4QB3A 5F60A 4NQMA 4YYIA 4Z6IA 5I80A 4PTBA 4IR3A 5E7DA 4UIUA 3AQAA 4WHUA 1N72A 5II2A 4QSVA 5DYUA 3LQIA 5C89A 4AKHA 4CUTA 5D3LA 4A9OA 5I29A 5J0DA 5KO4A 5CRMA 4HXMA 5EV9A 4MEQA 5CQTA 5FH6A 3P1EA 3GG3A 5ENIA 3UVWA 4UITA 4QR3A 5I1QA 5FG5A 5EPBA 4A9NA 5BT3A 3VKGA 4TYLA 4AKNA 4QSPA 4LZ2A 4O7FA 2OO1A 3U5MA 4CUPA 4E96A 2D82A 5JWMA 5ENBA 5F2PA 4QC1A 5E9LA 5IGNA 4HXKA 5D3NA 5G4SA 3G0JA 5D3TA 5COIA 4NUCA 4NYWA 2LSPB 4A9KA 5CS8A 3LQJA 5EK9A 4LYWA 5K29A 3UV4A 5A5SA 2DVVA 5E9VA 5FE9A 1E6IA 5I7XA 4QEVA 4YABA 5DFDA 5DLXA 5DY7A 4LDFA 5G4RA 5LVRA 5EP7A 5DFCA 4NXJA 4PY6A 5BT4A 4ALGA 5CRZA 5DW2A 1EQFA 3SVGA 3U5OA 5EPRA 5E73A 5E3DA 5E9YA 5IIDA 3S92A 3MB4A 5FFWA 5EQ1A 5CQ5A 4O75A 5FG4A 5DKHA 5KU3A 5LKZA 2N9GA 4CFKA 2RNWA 5ENJA 3VKHA 2RI7A 5CQ3A 3FKMX 5EWVA 5L96A 4QSSA 5TB6A 1WUGA 4QR4A 5F61A 4F3IA 2NXBA 2E7NA 5I86A 4YYKA 5FE3A 4Z6HA 5KTUA 4CFLA 5DLZA 2YEKA 5CP5A 4YC9A 4MENA 4LRGA 5A5NA 5KTXA 3P1FA 4YBMA 4DONA 5D3SA 5TCMA 4AKGA 4MR6A 3QZSA 5CUCA 3TLPA 4NRAA 5AD3A 3O35A 5CQAA 2G4AA 5C87A 5I89A 5EISA 5A85A 5C4QA 5EWDA 3SVHA 5ETDA 2R0VA 4KV4A 5LKXA 4J3IA 4X2IA 4XYAA 1X0JA 2MJVB 2WP2A 2D9EA 3ERRA 4NRBA 4O7BA 4A9IA 4Z1QA 4ZC9A 3UV5A 4UIYA 4IORA 3U5PA 4XY8A 2F6JA 2KTBB 4A9MA 4QSWA 5F25A 5FBXA 3G0LA 4O71A 5CQ8A 5E9KA 3S91A 5EM3A 4HXLA 2EJNA
chains in the Genus database with same CATH topology
5ACYA 5FFYA 2WP1A 5EPSA 4QY4A 2YELA 5AMFA 4NR5A 5DYCA 4LR6A 5F36A 3HMFA 4PCEA 1F68A 4YY4A 4MEPA 4N4FA 3U5NA 4NR7A 5C85A 5I88A 4HBVA 5DW1A 2R10A 4N4IA 4NUEA 4UYEA 5FDZA 4NUDA 4NRCA 3DWYA 5CY9A 2H60A 4HBXA 4KV1A 5CQ7A 5EWWA 5FB0A 4RVRA 4TT4A 2YEMA 4LC2A 3JVLA 2RO1A 4YH3A 3O37A 4J1PA 3UVDA 2DATA 3ZYUA 4NQNA 5A5PA 2DKWA 3JVMA 5LUUA 4QR5A 4C67A 5FE0A 2E7OA 3Q2FA 4TU6A 4Y03A 5HRVA 4XUBA 3LXJA 4LYIA 4PKLA 5I40A 5FE1A 5FG6A 4TS8A 1JM4B 2I8NA 5CPEA 5DFBA 5CQ4A 1JSPB 5EA1A 5IGMA 4N4HA 3QZTA 4ZQLA 4NR8A 5H85A 4WHWA 5A5RA 4TT6A 4QEUA 4QYLA 5ENEA 4NR4A 4QEWA 4QYDA 5C7NA 4A9LA 4YY6A 4O74A 2OSSA 4XY9A 4BHWA 4QUTA 5E74A 5LJ0A 3LJWA 3ONIA 3Q2EA 2GRCA 2FSAA 3MXFA 3UW9A 5FH7A 3JVKA 5CUGA 5HRWA 5DBMA 4CL9A 5FE7A 4YATA 5ENHA 4BW3A 3UVYA 5D7XA 5EU1A 5ENGA 4YK0A 5JI8A 3I3JA 5IG6A 5AMEA 5A5QA 3IU6A 4YYMA 5HRXA 5I7YA 5HELA 5FE2A 5HFQA 5FFVA 5H1VA 4BW1A 4FLPA 2R0SA 5D3PA 3RCWA 3SVFA 4J0SA 4YADA 4MEOA 4HXPA 4IOOA 5D25A 5CGPA 4WIVA 5HM0A 4Q0OA 4NS5A 5IGKA 4XUAA 4HXNA 4HBYA 3MQMA 4HXRA 5BT5A 3IU5A 3P1CA 4O72A 4TTEA 4IR5A 4QSRA 5E3GA 4A9EA 5F1HA 5HQ5A 3O36A 4QZSA 2RNXA 5I83A 4O70A 5F3AA 3U5KA 4GPJA 4UIWA 5E9MA 3U5JA 5KTWA 4NR6A 4OUFA 4BW2A 3O33A 5D0CA 5FE4A 5LKTA 4QSTA 2OUOA 2RFJA 5IGLA 3DAIA 4QC3A 4TZ2A 4O7AA 4UYFB 4CURA 4UIXA 4MR4A 4BW4A 3D7CA 3QZVA 5F63A 4QUUA 2RNYA 4Q0NA 4J0RA 5HENA 5HJCA 5ETBA 5II1A 5HFRA 5FE5A 4CUSA 5EWCA 3MB3A 4PS5A 4YYDA 4TT2A 5FB1A 4O7CA 4O7EA 5LJ2A 4YYNA 3HMEA 5A82A 4MR5A 5DKCA 4HBWA 2DVRA 2R0YA 3UV2A 4A9FA 3JVJA 5H1TA 2RS9B 5HQ7A 4HXOA 5L97A 4Z1SA 3HMHA 5HLSA 4OGJA 4UYDA 5EI4A 5F1LA 5EICA 5A5OA 5CTLA 4YH4A 4QSQA 4A9HA 4UIZA 5DX4A 4CUQA 5C8GA 4IOQA 4UYGA 2L5EA 4Z93A 4PCIA 5E0RA 2DVQA 5A81A 4QSUA 2L85A 2YDWA 4IR4A 4LZRA 5HCLA 5D3RA 5EVAA 1ZS5A 4N4GA 5CUEA 5D3HA 5L8TA 4YYHA 4NR9A 4C66A 5LJ1A 5IBNA 5KHMA 4UYFA 2YYNA 5FE6A 2YW5A 5CUBA 5EWHA 5E9IA 5LVQA 3P1DA 3NXBA 2L84A 3AADA 5ENFA 5D26A 3MULA 4BJXA 5DKDA 4A9JA 2YQDA 4YYJA 4HXSA 4OGIA 5CU8A 5F62A 3U5LA 5D3JA 3K2JA 4LZSA 4ZW1A 2E3KA 5DYXA 5F5ZA 5LKUA 5HEMA 5H1UA 4N3WA 4CUUA 2DWWA 4TU4A 4O78A 5EGUA 5CUAA 4NYXA 5L8UA 5D24A 4TQNA 4TZ8A 4NYVA 4QBMA 2DVSA 4O76A 5CZGA 5A7CA 5FE8A 4O77A 5HQ6A 4LYSA 5DYAA 5AD2A 4CLBA 4MR3A 2F6NA 4KCXA 5CUDA 4QNSA 3MUKA 4IR6A 5L99A 5CFWA 4YBSA 1WUMA 5FH8A 5L98A 5A83A 3P5OA 4ALHA 4YBTA 4QSXA 3LQHA 4YAXA 5CQ6A 4UYHA 4YYGA 3O34A 5ENCA 3UVXA 2I7KA 4UIVA 4QB3A 5F60A 4NQMA 4YYIA 4Z6IA 5I80A 4PTBA 4IR3A 5E7DA 4UIUA 3AQAA 4WHUA 1N72A 5II2A 4QSVA 5DYUA 3LQIA 5C89A 4CUTA 5D3LA 4A9OA 5I29A 5J0DA 5KO4A 5CRMA 4HXMA 5EV9A 4MEQA 5CQTA 5FH6A 3P1EA 3GG3A 5ENIA 3UVWA 4UITA 4QR3A 5I1QA 5FG5A 5EPBA 4A9NA 5BT3A 4TYLA 4AKNA 4QSPA 4LZ2A 4O7FA 2OO1A 3U5MA 4CUPA 4E96A 2D82A 5JWMA 5ENBA 5F2PA 4QC1A 5E9LA 5IGNA 4HXKA 5D3NA 5G4SA 3G0JA 5D3TA 5COIA 4NUCA 4NYWA 2LSPB 4A9KA 5CS8A 3LQJA 5EK9A 4LYWA 5K29A 3UV4A 5A5SA 2DVVA 5E9VA 5FE9A 1E6IA 5I7XA 4QEVA 4YABA 5DFDA 5DLXA 5DY7A 4LDFA 5G4RA 5LVRA 5EP7A 5DFCA 4NXJA 4PY6A 5BT4A 4ALGA 5CRZA 5DW2A 1EQFA 3SVGA 3U5OA 5EPRA 5E73A 5E3DA 5E9YA 5IIDA 3S92A 3MB4A 5FFWA 5EQ1A 5CQ5A 4O75A 5FG4A 5DKHA 5KU3A 5LKZA 2N9GA 4CFKA 2RNWA 5ENJA 2RI7A 5CQ3A 3FKMX 5EWVA 5L96A 4QSSA 5TB6A 1WUGA 4QR4A 5F61A 4F3IA 2NXBA 2E7NA 5I86A 4YYKA 5FE3A 4Z6HA 5KTUA 4CFLA 5DLZA 2YEKA 5CP5A 4YC9A 4MENA 4LRGA 5A5NA 5KTXA 3P1FA 4YBMA 4DONA 5D3SA 5TCMA 4MR6A 3QZSA 5CUCA 3TLPA 4NRAA 5AD3A 3O35A 5CQAA 2G4AA 5C87A 5I89A 5EISA 5A85A 5C4QA 5EWDA 3SVHA 5ETDA 2R0VA 4KV4A 5LKXA 4J3IA 4X2IA 4XYAA 1X0JA 2MJVB 2WP2A 2D9EA 4NRBA 4O7BA 4A9IA 4Z1QA 4ZC9A 3UV5A 4UIYA 4IORA 3U5PA 4XY8A 2F6JA 2KTBB 4A9MA 4QSWA 5F25A 5FBXA 3G0LA 4O71A 5CQ8A 5E9KA 3S91A 5EM3A 4HXLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ACY A;  5FFY A;  2WP1 A;  5EPS A;  4QY4 A;  2YEL A;  5AMF A;  4NR5 A;  5DYC A;  4LR6 A;  5F36 A;  3HMF A;  4PCE A;  1F68 A;  4YY4 A;  4MEP A;  4N4F A;  3U5N A;  4NR7 A;  5C85 A;  5I88 A;  4HBV A;  5DW1 A;  2R10 A;  4N4I A;  4NUE A;  4UYE A;  5FDZ A;  4NUD A;  4NRC A;  3DWY A;  5CY9 A;  2H60 A;  4HBX A;  4KV1 A;  5CQ7 A;  5EWW A;  5FB0 A;  4RVR A;  4TT4 A;  2YEM A;  4LC2 A;  3JVL A;  2RO1 A;  4YH3 A;  3O37 A;  4J1P A;  3UVD A;  2DAT A;  3ZYU A;  4NQN A;  5A5P A;  2DKW A;  3JVM A;  5LUU A;  4QR5 A;  4C67 A;  5FE0 A;  2E7O A;  3Q2F A;  4TU6 A;  4Y03 A;  5HRV A;  4XUB A;  3LXJ A;  4LYI A;  4PKL A;  5I40 A;  5FE1 A;  5FG6 A;  4TS8 A;  1JM4 B;  2I8N A;  5CPE A;  5DFB A;  5CQ4 A;  1JSP B;  5EA1 A;  5IGM A;  4N4H A;  3QZT A;  4ZQL A;  4NR8 A;  5H85 A;  4WHW A;  5A5R A;  4TT6 A;  4QEU A;  4QYL A;  5ENE A;  4NR4 A;  4QEW A;  4QYD A;  5C7N A;  4A9L A;  4YY6 A;  4O74 A;  2OSS A;  4XY9 A;  4BHW A;  4QUT A;  5E74 A;  5LJ0 A;  3LJW A;  3ONI A;  3Q2E A;  2GRC A;  2FSA A;  3MXF A;  3UW9 A;  5FH7 A;  3JVK A;  5CUG A;  5HRW A;  5DBM A;  4CL9 A;  5FE7 A;  4YAT A;  5ENH A;  4BW3 A;  3UVY A;  5D7X A;  5EU1 A;  5ENG A;  4YK0 A;  5JI8 A;  3I3J A;  5IG6 A;  5AME A;  5A5Q A;  3IU6 A;  4YYM A;  5HRX A;  5I7Y A;  5HEL A;  5FE2 A;  5HFQ A;  5FFV A;  5H1V A;  4BW1 A;  4FLP A;  2R0S A;  5D3P A;  3RCW A;  3SVF A;  4J0S A;  4YAD A;  4MEO A;  4HXP A;  4IOO A;  5D25 A;  5CGP A;  4WIV A;  5HM0 A;  4Q0O A;  4NS5 A;  5IGK A;  4XUA A;  4HXN A;  4HBY A;  3MQM A;  4HXR A;  5BT5 A;  3IU5 A;  3P1C A;  4O72 A;  4TTE A;  4IR5 A;  4QSR A;  5E3G A;  4A9E A;  5F1H A;  5HQ5 A;  3O36 A;  4QZS A;  2RNX A;  5I83 A;  4O70 A;  5F3A A;  3U5K A;  4GPJ A;  4UIW A;  5E9M A;  3U5J A;  5KTW A;  4NR6 A;  4OUF A;  4BW2 A;  3O33 A;  5D0C A;  5FE4 A;  5LKT A;  4QST A;  2OUO A;  2RFJ A;  5IGL A;  3DAI A;  4QC3 A;  4TZ2 A;  4O7A A;  4UYF B;  4CUR A;  4UIX A;  4MR4 A;  4BW4 A;  3D7C A;  3QZV A;  5F63 A;  4QUU A;  2RNY A;  4Q0N A;  4J0R A;  5HEN A;  5HJC A;  5ETB A;  5II1 A;  5HFR A;  5FE5 A;  4CUS A;  5EWC A;  3MB3 A;  4PS5 A;  4YYD A;  4TT2 A;  5FB1 A;  4O7C A;  4O7E A;  5LJ2 A;  4YYN A;  3HME A;  5A82 A;  4MR5 A;  5DKC A;  4HBW A;  2DVR A;  2R0Y A;  3UV2 A;  4A9F A;  3JVJ A;  5H1T A;  2RS9 B;  5HQ7 A;  4HXO A;  5L97 A;  4Z1S A;  3HMH A;  5HLS A;  4OGJ A;  4UYD A;  5EI4 A;  5F1L A;  5EIC A;  5A5O A;  5CTL A;  4YH4 A;  4QSQ A;  4A9H A;  4UIZ A;  5DX4 A;  4CUQ A;  5C8G A;  4IOQ A;  4UYG A;  2L5E A;  4Z93 A;  4PCI A;  5E0R A;  2DVQ A;  5A81 A;  4QSU A;  2L85 A;  2YDW A;  4IR4 A;  4LZR A;  5HCL A;  5D3R A;  5EVA A;  1ZS5 A;  4N4G A;  5CUE A;  5D3H A;  5L8T A;  4YYH A;  4NR9 A;  4C66 A;  5LJ1 A;  5IBN A;  5KHM A;  4UYF A;  2YYN A;  5FE6 A;  2YW5 A;  5CUB A;  5EWH A;  5E9I A;  5LVQ A;  3P1D A;  3NXB A;  2L84 A;  3AAD A;  5ENF A;  5D26 A;  3MUL A;  4BJX A;  5DKD A;  4A9J A;  2YQD A;  4YYJ A;  4HXS A;  4OGI A;  5CU8 A;  5F62 A;  3U5L A;  5D3J A;  3K2J A;  4LZS A;  4ZW1 A;  2E3K A;  5DYX A;  5F5Z A;  5LKU A;  5HEM A;  5H1U A;  4N3W A;  4CUU A;  2DWW A;  4TU4 A;  4O78 A;  5EGU A;  5CUA A;  4NYX A;  5L8U A;  5D24 A;  4TQN A;  4TZ8 A;  4NYV A;  4QBM A;  2DVS A;  4O76 A;  5CZG A;  5A7C A;  5FE8 A;  4O77 A;  5HQ6 A;  4LYS A;  5DYA A;  5AD2 A;  4CLB A;  4MR3 A;  2F6N A;  4KCX A;  5CUD A;  4QNS A;  3MUK A;  4IR6 A;  5L99 A;  5CFW A;  4YBS A;  1WUM A;  5FH8 A;  5L98 A;  5A83 A;  3P5O A;  4ALH A;  4YBT A;  4QSX A;  3LQH A;  4YAX A;  5CQ6 A;  4UYH A;  4YYG A;  3O34 A;  5ENC A;  3UVX A;  2I7K A;  4UIV A;  4QB3 A;  5F60 A;  4NQM A;  4YYI A;  4Z6I A;  5I80 A;  4PTB A;  4IR3 A;  5E7D A;  4UIU A;  3AQA A;  4WHU A;  1N72 A;  5II2 A;  4QSV A;  5DYU A;  3LQI A;  5C89 A;  4CUT A;  5D3L A;  4A9O A;  5I29 A;  5J0D A;  5KO4 A;  5CRM A;  4HXM A;  5EV9 A;  4MEQ A;  5CQT A;  5FH6 A;  3P1E A;  3GG3 A;  5ENI A;  3UVW A;  4UIT A;  4QR3 A;  5I1Q A;  5FG5 A;  5EPB A;  4A9N A;  5BT3 A;  4TYL A;  4AKN A;  4QSP A;  4LZ2 A;  4O7F A;  2OO1 A;  3U5M A;  4CUP A;  4E96 A;  2D82 A;  5JWM A;  5ENB A;  5F2P A;  4QC1 A;  5E9L A;  5IGN A;  4HXK A;  5D3N A;  5G4S A;  3G0J A;  5D3T A;  5COI A;  4NUC A;  4NYW A;  2LSP B;  4A9K A;  5CS8 A;  3LQJ A;  5EK9 A;  4LYW A;  5K29 A;  3UV4 A;  5A5S A;  2DVV A;  5E9V A;  5FE9 A;  1E6I A;  5I7X A;  4QEV A;  4YAB A;  5DFD A;  5DLX A;  5DY7 A;  4LDF A;  5G4R A;  5LVR A;  5EP7 A;  5DFC A;  4NXJ A;  4PY6 A;  5BT4 A;  4ALG A;  5CRZ A;  5DW2 A;  1EQF A;  3SVG A;  3U5O A;  5EPR A;  5E73 A;  5E3D A;  5E9Y A;  5IID A;  3S92 A;  3MB4 A;  5FFW A;  5EQ1 A;  5CQ5 A;  4O75 A;  5FG4 A;  5DKH A;  5KU3 A;  5LKZ A;  2N9G A;  4CFK A;  2RNW A;  5ENJ A;  2RI7 A;  5CQ3 A;  3FKM X;  5EWV A;  5L96 A;  4QSS A;  5TB6 A;  1WUG A;  4QR4 A;  5F61 A;  4F3I A;  2NXB A;  2E7N A;  5I86 A;  4YYK A;  5FE3 A;  4Z6H A;  5KTU A;  4CFL A;  5DLZ A;  2YEK A;  5CP5 A;  4YC9 A;  4MEN A;  4LRG A;  5A5N A;  5KTX A;  3P1F A;  4YBM A;  4DON A;  5D3S A;  5TCM A;  4MR6 A;  3QZS A;  5CUC A;  3TLP A;  4NRA A;  5AD3 A;  3O35 A;  5CQA A;  2G4A A;  5C87 A;  5I89 A;  5EIS A;  5A85 A;  5C4Q A;  5EWD A;  3SVH A;  5ETD A;  2R0V A;  4KV4 A;  5LKX A;  4J3I A;  4X2I A;  4XYA A;  1X0J A;  2MJV B;  2WP2 A;  2D9E A;  4NRB A;  4O7B A;  4A9I A;  4Z1Q A;  4ZC9 A;  3UV5 A;  4UIY A;  4IOR A;  3U5P A;  4XY8 A;  2F6J A;  2KTB B;  4A9M A;  4QSW A;  5F25 A;  5FBX A;  3G0L A;  4O71 A;  5CQ8 A;  5E9K A;  3S91 A;  5EM3 A;  4HXL A; 
#chains in the Genus database with same CATH topology
 5ACY A;  5FFY A;  2WP1 A;  5EPS A;  4QY4 A;  2YEL A;  5AMF A;  4NR5 A;  5DYC A;  4LR6 A;  5F36 A;  3HMF A;  4PCE A;  1F68 A;  4YY4 A;  4MEP A;  4N4F A;  3U5N A;  4NR7 A;  5C85 A;  5I88 A;  4HBV A;  5DW1 A;  2R10 A;  4N4I A;  4NUE A;  4UYE A;  5FDZ A;  4NUD A;  4NRC A;  3DWY A;  5CY9 A;  2H60 A;  4HBX A;  4KV1 A;  5CQ7 A;  5EWW A;  5FB0 A;  4RVR A;  4TT4 A;  2YEM A;  4LC2 A;  3JVL A;  2RO1 A;  4YH3 A;  3O37 A;  4J1P A;  3UVD A;  2DAT A;  3ZYU A;  4NQN A;  5A5P A;  2DKW A;  3JVM A;  5LUU A;  4QR5 A;  4C67 A;  5FE0 A;  2E7O A;  3Q2F A;  4TU6 A;  4Y03 A;  5HRV A;  4XUB A;  3LXJ A;  4LYI A;  4PKL A;  5I40 A;  5FE1 A;  5FG6 A;  4TS8 A;  1JM4 B;  2I8N A;  5CPE A;  5DFB A;  5CQ4 A;  1JSP B;  5EA1 A;  5IGM A;  4N4H A;  3QZT A;  4ZQL A;  4NR8 A;  5H85 A;  4WHW A;  5A5R A;  4TT6 A;  4QEU A;  4QYL A;  5ENE A;  4NR4 A;  4QEW A;  4QYD A;  5C7N A;  4A9L A;  4YY6 A;  4O74 A;  2OSS A;  4XY9 A;  4BHW A;  4QUT A;  5E74 A;  5LJ0 A;  3LJW A;  3ONI A;  3Q2E A;  2GRC A;  2FSA A;  3MXF A;  3UW9 A;  5FH7 A;  3JVK A;  5CUG A;  5HRW A;  5DBM A;  4CL9 A;  5FE7 A;  4YAT A;  5ENH A;  4BW3 A;  3UVY A;  5D7X A;  3D1D A;  5ENG A;  4YK0 A;  5EU1 A;  5JI8 A;  3I3J A;  5IG6 A;  5AME A;  5A5Q A;  3IU6 A;  4YYM A;  5HRX A;  5I7Y A;  5HEL A;  5FE2 A;  5HFQ A;  5FFV A;  5H1V A;  4BW1 A;  4FLP A;  2R0S A;  5D3P A;  3RCW A;  3SVF A;  4J0S A;  4YAD A;  4MEO A;  4HXP A;  4IOO A;  5D25 A;  5CGP A;  4WIV A;  5HM0 A;  4Q0O A;  4NS5 A;  5IGK A;  4XUA A;  4HXN A;  4HBY A;  3MQM A;  4HXR A;  5BT5 A;  3IU5 A;  3P1C A;  4O72 A;  4TTE A;  4IR5 A;  4QSR A;  5E3G A;  4A9E A;  5F1H A;  5HQ5 A;  3O36 A;  4QZS A;  2RNX A;  5I83 A;  4O70 A;  5F3A A;  3U5K A;  4GPJ A;  4UIW A;  5E9M A;  1PUO A;  3U5J A;  4AKI A;  5KTW A;  4NR6 A;  4OUF A;  4BW2 A;  3O33 A;  5D0C A;  5FE4 A;  5LKT A;  4QST A;  2OUO A;  2RFJ A;  5IGL A;  3DAI A;  4QC3 A;  4TZ2 A;  4O7A A;  4UYF B;  4CUR A;  4UIX A;  4MR4 A;  4BW4 A;  3D7C A;  3QZV A;  5F63 A;  4QUU A;  2RNY A;  4Q0N A;  4J0R A;  5HEN A;  5HJC A;  5ETB A;  5II1 A;  5HFR A;  5FE5 A;  4CUS A;  5EWC A;  3MB3 A;  4PS5 A;  4YYD A;  4TT2 A;  5FB1 A;  4O7C A;  4O7E A;  5LJ2 A;  4YYN A;  3HME A;  5A82 A;  4MR5 A;  5DKC A;  4HBW A;  2DVR A;  2R0Y A;  3UV2 A;  4A9F A;  3JVJ A;  5H1T A;  2RS9 B;  5HQ7 A;  4HXO A;  5L97 A;  4Z1S A;  3HMH A;  5HLS A;  4OGJ A;  4UYD A;  5EI4 A;  5F1L A;  5EIC A;  5A5O A;  5CTL A;  4YH4 A;  4QSQ A;  4A9H A;  4UIZ A;  5DX4 A;  4CUQ A;  5C8G A;  4IOQ A;  4UYG A;  2L5E A;  4Z93 A;  4PCI A;  5E0R A;  2DVQ A;  5A81 A;  4QSU A;  2L85 A;  2YDW A;  4IR4 A;  4LZR A;  5HCL A;  5D3R A;  5EVA A;  1ZS5 A;  4N4G A;  5CUE A;  1ZKR A;  5D3H A;  5L8T A;  4YYH A;  4NR9 A;  4C66 A;  5LJ1 A;  3D1B A;  5IBN A;  5KHM A;  4UYF A;  2YYN A;  5FE6 A;  2YW5 A;  5CUB A;  5EWH A;  5E9I A;  5LVQ A;  3P1D A;  3NXB A;  2L84 A;  3AAD A;  5ENF A;  5D26 A;  3MUL A;  4BJX A;  5DKD A;  4A9J A;  2YQD A;  4YYJ A;  4HXS A;  4OGI A;  5CU8 A;  5F62 A;  3U5L A;  5D3J A;  3K2J A;  4LZS A;  4ZW1 A;  2E3K A;  5DYX A;  5F5Z A;  5LKU A;  5HEM A;  5H1U A;  4N3W A;  4CUU A;  2DWW A;  4TU4 A;  4O78 A;  5EGU A;  5CUA A;  4NYX A;  5L8U A;  5D24 A;  4TQN A;  4TZ8 A;  4NYV A;  4QBM A;  2DVS A;  4O76 A;  5CZG A;  5A7C A;  5FE8 A;  4O77 A;  5HQ6 A;  4LYS A;  5DYA A;  5AD2 A;  4CLB A;  4MR3 A;  2F6N A;  4KCX A;  5CUD A;  4QNS A;  3MUK A;  4IR6 A;  5L99 A;  5CFW A;  4YBS A;  1WUM A;  5FH8 A;  5L98 A;  5A83 A;  3P5O A;  4ALH A;  4YBT A;  4QSX A;  3LQH A;  4YAX A;  5CQ6 A;  4AI6 A;  4UYH A;  4YYG A;  3O34 A;  5ENC A;  3UVX A;  2I7K A;  4UIV A;  4QB3 A;  5F60 A;  4NQM A;  4YYI A;  4Z6I A;  5I80 A;  4PTB A;  4IR3 A;  5E7D A;  4UIU A;  3AQA A;  4WHU A;  1N72 A;  5II2 A;  4QSV A;  5DYU A;  3LQI A;  5C89 A;  4AKH A;  4CUT A;  5D3L A;  4A9O A;  5I29 A;  5J0D A;  5KO4 A;  5CRM A;  4HXM A;  5EV9 A;  4MEQ A;  5CQT A;  5FH6 A;  3P1E A;  3GG3 A;  5ENI A;  3UVW A;  4UIT A;  4QR3 A;  5I1Q A;  5FG5 A;  5EPB A;  4A9N A;  5BT3 A;  3VKG A;  4TYL A;  4AKN A;  4QSP A;  4LZ2 A;  4O7F A;  2OO1 A;  3U5M A;  4CUP A;  4E96 A;  2D82 A;  5JWM A;  5ENB A;  5F2P A;  4QC1 A;  5E9L A;  5IGN A;  4HXK A;  5D3N A;  5G4S A;  3G0J A;  5D3T A;  5COI A;  4NUC A;  4NYW A;  2LSP B;  4A9K A;  5CS8 A;  3LQJ A;  5EK9 A;  4LYW A;  5K29 A;  3UV4 A;  5A5S A;  2DVV A;  5E9V A;  5FE9 A;  1E6I A;  5I7X A;  4QEV A;  4YAB A;  5DFD A;  5DLX A;  5DY7 A;  4LDF A;  5G4R A;  5LVR A;  5EP7 A;  5DFC A;  4NXJ A;  4PY6 A;  5BT4 A;  4ALG A;  5CRZ A;  5DW2 A;  1EQF A;  3SVG A;  3U5O A;  5EPR A;  5E73 A;  5E3D A;  5E9Y A;  5IID A;  3S92 A;  3MB4 A;  5FFW A;  5EQ1 A;  5CQ5 A;  4O75 A;  5FG4 A;  5DKH A;  5KU3 A;  5LKZ A;  2N9G A;  4CFK A;  2RNW A;  5ENJ A;  3VKH A;  2RI7 A;  5CQ3 A;  3FKM X;  5EWV A;  5L96 A;  4QSS A;  5TB6 A;  1WUG A;  4QR4 A;  5F61 A;  4F3I A;  2NXB A;  2E7N A;  5I86 A;  4YYK A;  5FE3 A;  4Z6H A;  5KTU A;  4CFL A;  5DLZ A;  2YEK A;  5CP5 A;  4YC9 A;  4MEN A;  4LRG A;  5A5N A;  5KTX A;  3P1F A;  4YBM A;  4DON A;  5D3S A;  5TCM A;  4AKG A;  4MR6 A;  3QZS A;  5CUC A;  3TLP A;  4NRA A;  5AD3 A;  3O35 A;  5CQA A;  2G4A A;  5C87 A;  5I89 A;  5EIS A;  5A85 A;  5C4Q A;  5EWD A;  3SVH A;  5ETD A;  2R0V A;  4KV4 A;  5LKX A;  4J3I A;  4X2I A;  4XYA A;  1X0J A;  2MJV B;  2WP2 A;  2D9E A;  3ERR A;  4NRB A;  4O7B A;  4A9I A;  4Z1Q A;  4ZC9 A;  3UV5 A;  4UIY A;  4IOR A;  3U5P A;  4XY8 A;  2F6J A;  2KTB B;  4A9M A;  4QSW A;  5F25 A;  5FBX A;  3G0L A;  4O71 A;  5CQ8 A;  5E9K A;  3S91 A;  5EM3 A;  4HXL A;  2EJN A; 
#chains in the Genus database with same CATH homology
 5ACY A;  5FFY A;  2WP1 A;  5EPS A;  4QY4 A;  2YEL A;  5AMF A;  4NR5 A;  5DYC A;  4LR6 A;  5F36 A;  3HMF A;  4PCE A;  1F68 A;  4YY4 A;  4MEP A;  4N4F A;  3U5N A;  4NR7 A;  5C85 A;  5I88 A;  4HBV A;  5DW1 A;  2R10 A;  4N4I A;  4NUE A;  4UYE A;  5FDZ A;  4NUD A;  4NRC A;  3DWY A;  5CY9 A;  2H60 A;  4HBX A;  4KV1 A;  5CQ7 A;  5EWW A;  5FB0 A;  4RVR A;  4TT4 A;  2YEM A;  4LC2 A;  3JVL A;  2RO1 A;  4YH3 A;  3O37 A;  4J1P A;  3UVD A;  2DAT A;  3ZYU A;  4NQN A;  5A5P A;  2DKW A;  3JVM A;  5LUU A;  4QR5 A;  4C67 A;  5FE0 A;  2E7O A;  3Q2F A;  4TU6 A;  4Y03 A;  5HRV A;  4XUB A;  3LXJ A;  4LYI A;  4PKL A;  5I40 A;  5FE1 A;  5FG6 A;  4TS8 A;  1JM4 B;  2I8N A;  5CPE A;  5DFB A;  5CQ4 A;  1JSP B;  5EA1 A;  5IGM A;  4N4H A;  3QZT A;  4ZQL A;  4NR8 A;  5H85 A;  4WHW A;  5A5R A;  4TT6 A;  4QEU A;  4QYL A;  5ENE A;  4NR4 A;  4QEW A;  4QYD A;  5C7N A;  4A9L A;  4YY6 A;  4O74 A;  2OSS A;  4XY9 A;  4BHW A;  4QUT A;  5E74 A;  5LJ0 A;  3LJW A;  3ONI A;  3Q2E A;  2GRC A;  2FSA A;  3MXF A;  3UW9 A;  5FH7 A;  3JVK A;  5CUG A;  5HRW A;  5DBM A;  4CL9 A;  5FE7 A;  4YAT A;  5ENH A;  4BW3 A;  3UVY A;  5D7X A;  5EU1 A;  5ENG A;  4YK0 A;  5JI8 A;  3I3J A;  5IG6 A;  5AME A;  5A5Q A;  3IU6 A;  4YYM A;  5HRX A;  5I7Y A;  5HEL A;  5FE2 A;  5HFQ A;  5FFV A;  5H1V A;  4BW1 A;  4FLP A;  2R0S A;  5D3P A;  3RCW A;  3SVF A;  4J0S A;  4YAD A;  4MEO A;  4HXP A;  4IOO A;  5D25 A;  5CGP A;  4WIV A;  5HM0 A;  4Q0O A;  4NS5 A;  5IGK A;  4XUA A;  4HXN A;  4HBY A;  3MQM A;  4HXR A;  5BT5 A;  3IU5 A;  3P1C A;  4O72 A;  4TTE A;  4IR5 A;  4QSR A;  5E3G A;  4A9E A;  5F1H A;  5HQ5 A;  3O36 A;  4QZS A;  2RNX A;  5I83 A;  4O70 A;  5F3A A;  3U5K A;  4GPJ A;  4UIW A;  5E9M A;  3U5J A;  5KTW A;  4NR6 A;  4OUF A;  4BW2 A;  3O33 A;  5D0C A;  5FE4 A;  5LKT A;  4QST A;  2OUO A;  2RFJ A;  5IGL A;  3DAI A;  4QC3 A;  4TZ2 A;  4O7A A;  4UYF B;  4CUR A;  4UIX A;  4MR4 A;  4BW4 A;  3D7C A;  3QZV A;  5F63 A;  4QUU A;  2RNY A;  4Q0N A;  4J0R A;  5HEN A;  5HJC A;  5ETB A;  5II1 A;  5HFR A;  5FE5 A;  4CUS A;  5EWC A;  3MB3 A;  4PS5 A;  4YYD A;  4TT2 A;  5FB1 A;  4O7C A;  4O7E A;  5LJ2 A;  4YYN A;  3HME A;  5A82 A;  4MR5 A;  5DKC A;  4HBW A;  2DVR A;  2R0Y A;  3UV2 A;  4A9F A;  3JVJ A;  5H1T A;  2RS9 B;  5HQ7 A;  4HXO A;  5L97 A;  4Z1S A;  3HMH A;  5HLS A;  4OGJ A;  4UYD A;  5EI4 A;  5F1L A;  5EIC A;  5A5O A;  5CTL A;  4YH4 A;  4QSQ A;  4A9H A;  4UIZ A;  5DX4 A;  4CUQ A;  5C8G A;  4IOQ A;  4UYG A;  2L5E A;  4Z93 A;  4PCI A;  5E0R A;  2DVQ A;  5A81 A;  4QSU A;  2L85 A;  2YDW A;  4IR4 A;  4LZR A;  5HCL A;  5D3R A;  5EVA A;  1ZS5 A;  4N4G A;  5CUE A;  5D3H A;  5L8T A;  4YYH A;  4NR9 A;  4C66 A;  5LJ1 A;  5IBN A;  5KHM A;  4UYF A;  2YYN A;  5FE6 A;  2YW5 A;  5CUB A;  5EWH A;  5E9I A;  5LVQ A;  3P1D A;  3NXB A;  2L84 A;  3AAD A;  5ENF A;  5D26 A;  3MUL A;  4BJX A;  5DKD A;  4A9J A;  2YQD A;  4YYJ A;  4HXS A;  4OGI A;  5CU8 A;  5F62 A;  3U5L A;  5D3J A;  3K2J A;  4LZS A;  4ZW1 A;  2E3K A;  5DYX A;  5F5Z A;  5LKU A;  5HEM A;  5H1U A;  4N3W A;  4CUU A;  2DWW A;  4TU4 A;  4O78 A;  5EGU A;  5CUA A;  4NYX A;  5L8U A;  5D24 A;  4TQN A;  4TZ8 A;  4NYV A;  4QBM A;  2DVS A;  4O76 A;  5CZG A;  5A7C A;  5FE8 A;  4O77 A;  5HQ6 A;  4LYS A;  5DYA A;  5AD2 A;  4CLB A;  4MR3 A;  2F6N A;  4KCX A;  5CUD A;  4QNS A;  3MUK A;  4IR6 A;  5L99 A;  5CFW A;  4YBS A;  1WUM A;  5FH8 A;  5L98 A;  5A83 A;  3P5O A;  4ALH A;  4YBT A;  4QSX A;  3LQH A;  4YAX A;  5CQ6 A;  4UYH A;  4YYG A;  3O34 A;  5ENC A;  3UVX A;  2I7K A;  4UIV A;  4QB3 A;  5F60 A;  4NQM A;  4YYI A;  4Z6I A;  5I80 A;  4PTB A;  4IR3 A;  5E7D A;  4UIU A;  3AQA A;  4WHU A;  1N72 A;  5II2 A;  4QSV A;  5DYU A;  3LQI A;  5C89 A;  4CUT A;  5D3L A;  4A9O A;  5I29 A;  5J0D A;  5KO4 A;  5CRM A;  4HXM A;  5EV9 A;  4MEQ A;  5CQT A;  5FH6 A;  3P1E A;  3GG3 A;  5ENI A;  3UVW A;  4UIT A;  4QR3 A;  5I1Q A;  5FG5 A;  5EPB A;  4A9N A;  5BT3 A;  4TYL A;  4AKN A;  4QSP A;  4LZ2 A;  4O7F A;  2OO1 A;  3U5M A;  4CUP A;  4E96 A;  2D82 A;  5JWM A;  5ENB A;  5F2P A;  4QC1 A;  5E9L A;  5IGN A;  4HXK A;  5D3N A;  5G4S A;  3G0J A;  5D3T A;  5COI A;  4NUC A;  4NYW A;  2LSP B;  4A9K A;  5CS8 A;  3LQJ A;  5EK9 A;  4LYW A;  5K29 A;  3UV4 A;  5A5S A;  2DVV A;  5E9V A;  5FE9 A;  1E6I A;  5I7X A;  4QEV A;  4YAB A;  5DFD A;  5DLX A;  5DY7 A;  4LDF A;  5G4R A;  5LVR A;  5EP7 A;  5DFC A;  4NXJ A;  4PY6 A;  5BT4 A;  4ALG A;  5CRZ A;  5DW2 A;  1EQF A;  3SVG A;  3U5O A;  5EPR A;  5E73 A;  5E3D A;  5E9Y A;  5IID A;  3S92 A;  3MB4 A;  5FFW A;  5EQ1 A;  5CQ5 A;  4O75 A;  5FG4 A;  5DKH A;  5KU3 A;  5LKZ A;  2N9G A;  4CFK A;  2RNW A;  5ENJ A;  2RI7 A;  5CQ3 A;  3FKM X;  5EWV A;  5L96 A;  4QSS A;  5TB6 A;  1WUG A;  4QR4 A;  5F61 A;  4F3I A;  2NXB A;  2E7N A;  5I86 A;  4YYK A;  5FE3 A;  4Z6H A;  5KTU A;  4CFL A;  5DLZ A;  2YEK A;  5CP5 A;  4YC9 A;  4MEN A;  4LRG A;  5A5N A;  5KTX A;  3P1F A;  4YBM A;  4DON A;  5D3S A;  5TCM A;  4MR6 A;  3QZS A;  5CUC A;  3TLP A;  4NRA A;  5AD3 A;  3O35 A;  5CQA A;  2G4A A;  5C87 A;  5I89 A;  5EIS A;  5A85 A;  5C4Q A;  5EWD A;  3SVH A;  5ETD A;  2R0V A;  4KV4 A;  5LKX A;  4J3I A;  4X2I A;  4XYA A;  1X0J A;  2MJV B;  2WP2 A;  2D9E A;  4NRB A;  4O7B A;  4A9I A;  4Z1Q A;  4ZC9 A;  3UV5 A;  4UIY A;  4IOR A;  3U5P A;  4XY8 A;  2F6J A;  2KTB B;  4A9M A;  4QSW A;  5F25 A;  5FBX A;  3G0L A;  4O71 A;  5CQ8 A;  5E9K A;  3S91 A;  5EM3 A;  4HXL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...