5KU3A

Brd4 bromodomain in complex with cpd59 ((s)-1-(3-((2-fluoro-4-(1-methyl-1h-pyrazol-4-yl)phenyl)amino)-1-(tetrahydrofuran-3-yl)-6,7-dihydro-1h-pyrazolo[4,3-c]pyridin-5(4h)-yl)ethanone)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
126
structure length
126
Chain Sequence
STNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVDAVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYIYNKPGDDIVLMAEALEKLFLQKINELPTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bromodomain-containing protein 4
publication title Discovery of a Potent and Selective in Vivo Probe (GNE-272) for the Bromodomains of CBP/EP300.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 42
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2016-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 5ku3A01
5E0RA 5AMEA 4YH3A 3LQHA 4CFKA 4NR8A 4HBXA 4IOOA 3D7CA 4MR6A 5A81A 5C89A 3UVYA 5I88A 5IGKA 4UIYA 5FH7A 2L5EA 3DAIA 5DYAA 4MR4A 2F6JA 2YYNA 5IG6A 4LZSA 5FE5A 4HXOA 5C4QA 3U5LA 4LDFA 5C7NA 4Q0NA 4A9KA 5FFWA 5EPSA 5DLXA 5A5QA 5H85A 5L99A 2H60A 4CUTA 3LQJA 5CQ4A 5CQ6A 2GRCA 4YH4A 4ALGA 4DONA 4YADA 4QSQA 5G4SA 4YY6A 3IU5A 3FKMX 3QZSA 2LSPB 4KCXA 5F3AA 3P1EA 2WP2A 3P1FA 5D3NA 5EP7A 4BW2A 4YYKA 1WUGA 5DBMA 5LJ2A 5CUBA 5DW2A 4N4GA 3ONIA 4LZRA 5D26A 2RI7A 4QUUA 5CQ3A 4O77A 4BHWA 5II2A 5JWMA 1JSPB 5FFYA 5CUEA 4HBYA 5FDZA 3P1DA 5FG6A 5EA1A 4NYVA 4QSRA 5DKHA 3JVJA 5TCMA 5CY9A 4O7EA 5E9KA 3O34A 3SVGA 4YATA 4WHWA 3UV2A 5EICA 5ENGA 4NR6A 5FE1A 5E9MA 2D9EA 4MR3A 5KTUA 4QSVA 4Z1QA 4QC1A 4IR3A 4A9MA 4NR5A 5CS8A 4QSWA 5CFWA 4A9LA 4XY9A 5F60A 4XY8A 5F61A 2D82A 2OO1A 2F6NA 4QNSA 5DYUA 2YELA 3LJWA 5EWWA 5FH8A 4QSUA 2DATA 5BT3A 4Q0OA 5C85A 4MEQA 3LQIA 5FH6A 5D3JA 4HBWA 5DYCA 5CRZA 5L98A 2OSSA 2R0VA 3TLPA 4A9HA 2RNYA 4YYGA 4NR9A 3O35A 5L8TA 5LJ0A 4XUBA 5KHMA 5HQ5A 5E9IA 4IR5A 2RO1A 4TS8A 5FB1A 4C66A 3O36A 5IIDA 5EWVA 2E7OA 2L85A 5CTLA 3U5PA 3S91A 5FE7A 2YEKA 5DKDA 4PY6A 4UITA 4QSSA 5DLZA 5KO4A 3UV5A 5EWDA 2DVSA 5II1A 5A5OA 5CUGA 4QYLA 5KU3A 4YYNA 3O33A 2RS9B 1X0JA 5FE9A 4HXNA 4QBMA 5DFCA 4BJXA 5CU8A 4N4IA 5HCLA 5A5PA 5EK9A 3AQAA 4NUDA 4YYJA 5HLSA 3JVKA 4NRAA 2KTBB 4UYEA 4CUSA 5I86A 3MQMA 5G4RA 4TT6A 2R10A 4N3WA 4IOQA 5I80A 5D3PA 4NR7A 4NQMA 4ZC9A 4YBMA 3Q2EA 3GG3A 4UIXA 3U5MA 4CUQA 2DVVA 5A82A 5DKCA 4IR4A 2RNWA 5ETDA 4LRGA 5F36A 4AKNA 5JI8A 3U5JA 4OUFA 4UYHA 3QZTA 5A5RA 5FE2A 5L8UA 5CUDA 2NXBA 5EVAA 2N9GA 2MJVB 5DX4A 4J0SA 5CUAA 4NRCA 4YYMA 5ENCA 5CP5A 3JVLA 5AD2A 3G0JA 5FBXA 4QEWA 3O37A 5LJ1A 2DVQA 3DWYA 4QUTA 4BW3A 5EI4A 5DFDA 3P5OA 4KV4A 1F68A 5J0DA 3UVWA 3UVXA 4UYFB 4QB3A 4YAXA 4CL9A 5CGPA 2E3KA 4O71A 5CRMA 5E9VA 5D3RA 5E9LA 5I7XA 3U5NA 4UYGA 4PCEA 4QR5A 5D3SA 3S92A 5D3HA 2FSAA 2YDWA 4A9IA 4UIWA 5EISA 5E9YA 4N4HA 4MENA 5EPRA 4TT4A 4YYDA 4YBSA 4LZ2A 5CQAA 5HFQA 5A5SA 5EGUA 5A5NA 5I1QA 5H1TA 4LC2A 4QR3A 5HJCA 4OGIA 5I89A 5FE3A 4O70A 5A7CA 2DKWA 3AADA 4O75A 5EWCA 2R0SA 2I8NA 4O7FA 5H1VA 5HENA 4O7CA 5ENEA 5CQTA 5E7DA 2L84A 5D7XA 5DYXA 1JM4B 4WHUA 4PCIA 4J1PA 5AD3A 3UW9A 3MB3A 5EU1A 4A9FA 4YYHA 5E74A 3ZYUA 2RNXA 5CZGA 4CFLA 5E73A 4YK0A 4IR6A 5EV9A 5HM0A 4TQNA 4X2IA 4QR4A 4BW4A 5IGLA 4TU6A 4QSPA 4MEPA 5IBNA 4RVRA 5HQ6A 1ZS5A 5BT5A 5L97A 5LVRA 3U5OA 5LKUA 4TU4A 5DFBA 5ACYA 5F1HA 3G0LA 5ETBA 5F25A 4TZ2A 3MXFA 2R0YA 5HEMA 4TYLA 4UIVA 4KV1A 5F62A 2WP1A 4HXPA 2YQDA 4QY4A 5KTWA 2OUOA 4O78A 4QEUA 4OGJA 4CURA 5CUCA 4NRBA 5CQ5A 5LVQA 4Z6IA 4A9EA 4IORA 4N4FA 5CQ8A 4TTEA 3UVDA 3P1CA 3SVHA 4TT2A 5D3TA 4UYDA 5LKZA 4O7AA 4HXKA 5C8GA 5HFRA 4PTBA 3HMFA 4PS5A 5HELA 3MB4A 5TB6A 4Z93A 5C87A 4BW1A 4MR5A 4ZW1A 3Q2FA 5HRVA 5FFVA 4YYIA 3HMEA 5COIA 4XUAA 4ZQLA 4CLBA 4A9OA 5FE6A 5FG5A 5D0CA 5A85A 4QZSA 4LYIA 5I7YA 4YBTA 2DWWA 5BT4A 4GPJA 2DVRA 4PKLA 5E3GA 4O72A 5LKXA 4HXLA 4O74A 3RCWA 5LUUA 5EQ1A 3U5KA 4CUPA 3IU6A 4HXSA 4UYFA 4YC9A 4NYWA 4ALHA 5H1UA 4J0RA 4HXMA 5EPBA 4YABA 3K2JA 4A9NA 1N72A 4C67A 3SVFA 4Z1SA 5D24A 4XYAA 5FE0A 5IGMA 4QYDA 3HMHA 3UV4A 4Z6HA 5A83A 4NQNA 5D3LA 3NXBA 4UIZA 4F3IA 5I83A 5CQ7A 4YY4A 2RFJA 1WUMA 5ENIA 5EWHA 5I40A 5K29A 4QSXA 4TZ8A 5CPEA 4E96A 3JVMA 3MULA 4LYSA 4QC3A 4WIVA 5HQ7A 5ENFA 5FG4A 3I3JA 4QSTA 2E7NA 4NYXA 4HXRA 5D25A 5DW1A 5F1LA 5F2PA 5ENBA 2I7KA 5IGNA 4O7BA 5AMFA 5I29A 4LYWA 4FLPA 4LR6A 5ENJA 5L96A 5HRWA 2G4AA 3LXJA 4NS5A 5ENHA 4A9JA 3MUKA 4O76A 4Y03A 5DY7A 4CUUA 5KTXA 4HBVA 4NUCA 4NXJA 4J3IA 4MEOA 1E6IA 4UIUA 5EM3A 5FE4A 5FB0A 5E3DA 4NUEA 5F5ZA 2YEMA 2YW5A 5LKTA 3QZVA 1EQFA 5F63A 4QEVA 5FE8A 4NR4A 5HRXA
chains in the Genus database with same CATH superfamily
5E0RA 5AMEA 4YH3A 3LQHA 4CFKA 4NR8A 4HBXA 4IOOA 3D7CA 4MR6A 5A81A 5C89A 3UVYA 5I88A 5IGKA 4UIYA 5FH7A 2L5EA 3DAIA 5DYAA 4MR4A 2F6JA 2YYNA 5IG6A 4LZSA 5FE5A 4HXOA 5C4QA 3U5LA 4LDFA 5C7NA 4Q0NA 4A9KA 5FFWA 5EPSA 5DLXA 5A5QA 5H85A 5L99A 2H60A 4CUTA 3LQJA 5CQ4A 5CQ6A 2GRCA 4YH4A 4ALGA 4DONA 4YADA 4QSQA 5G4SA 4YY6A 3IU5A 3VKGA 3FKMX 3QZSA 2LSPB 4KCXA 5F3AA 3P1EA 2WP2A 3P1FA 5D3NA 5EP7A 4BW2A 4YYKA 1WUGA 5DBMA 5LJ2A 5CUBA 5DW2A 4N4GA 3ONIA 4LZRA 5D26A 2RI7A 4QUUA 5CQ3A 4O77A 4BHWA 5II2A 5JWMA 1JSPB 5FFYA 5CUEA 4HBYA 5FDZA 3P1DA 5FG6A 5EA1A 4NYVA 4QSRA 5DKHA 3JVJA 5TCMA 5CY9A 4O7EA 5E9KA 3O34A 3SVGA 4YATA 4WHWA 3UV2A 5EICA 5ENGA 4NR6A 5FE1A 5E9MA 2D9EA 4MR3A 5KTUA 3D1BA 4QSVA 4Z1QA 4QC1A 4IR3A 4A9MA 4NR5A 5CS8A 4QSWA 5CFWA 4A9LA 4XY9A 5F60A 4XY8A 5F61A 3D1DA 2D82A 2OO1A 2F6NA 4QNSA 5DYUA 2YELA 3LJWA 5EWWA 5FH8A 4QSUA 2DATA 5BT3A 4Q0OA 5C85A 4MEQA 3LQIA 5FH6A 5D3JA 4HBWA 5DYCA 5CRZA 5L98A 2OSSA 2R0VA 3TLPA 4A9HA 2RNYA 4YYGA 4NR9A 3O35A 5L8TA 5LJ0A 4XUBA 5KHMA 5HQ5A 5E9IA 4IR5A 2RO1A 4TS8A 5FB1A 4C66A 3O36A 5IIDA 5EWVA 2E7OA 2L85A 5CTLA 3U5PA 3S91A 5FE7A 2YEKA 5DKDA 4PY6A 4UITA 4QSSA 5DLZA 5KO4A 3UV5A 5EWDA 2DVSA 5II1A 5A5OA 5CUGA 4QYLA 5KU3A 4YYNA 3O33A 2RS9B 1X0JA 5FE9A 4HXNA 4QBMA 5DFCA 4BJXA 5CU8A 4N4IA 5HCLA 5A5PA 5EK9A 3AQAA 4NUDA 4YYJA 5HLSA 3JVKA 4NRAA 2KTBB 4UYEA 4CUSA 5I86A 3MQMA 5G4RA 4TT6A 2R10A 4N3WA 4IOQA 5I80A 5D3PA 4NR7A 4NQMA 4ZC9A 4YBMA 3Q2EA 3GG3A 4UIXA 3U5MA 4CUQA 2DVVA 5A82A 5DKCA 4IR4A 2RNWA 5ETDA 4LRGA 5F36A 4AKNA 5JI8A 3U5JA 4OUFA 4UYHA 3QZTA 5A5RA 5FE2A 5L8UA 5CUDA 2NXBA 5EVAA 2N9GA 2MJVB 5DX4A 4J0SA 5CUAA 4NRCA 4YYMA 5ENCA 5CP5A 3JVLA 5AD2A 3G0JA 5FBXA 4QEWA 3O37A 5LJ1A 2DVQA 3DWYA 4QUTA 4BW3A 5EI4A 5DFDA 3P5OA 4KV4A 1F68A 5J0DA 3UVWA 3UVXA 4UYFB 4QB3A 4AI6A 4YAXA 4CL9A 5CGPA 2E3KA 4O71A 5CRMA 5E9VA 5D3RA 5E9LA 5I7XA 3U5NA 4UYGA 4PCEA 4QR5A 5D3SA 3S92A 5D3HA 2FSAA 2YDWA 4A9IA 4UIWA 5EISA 5E9YA 4N4HA 4MENA 5EPRA 4TT4A 4YYDA 4YBSA 4LZ2A 5CQAA 5HFQA 5A5SA 5EGUA 5A5NA 5I1QA 5H1TA 4AKGA 4LC2A 4QR3A 5HJCA 4OGIA 5I89A 5FE3A 4O70A 5A7CA 2DKWA 3AADA 4O75A 5EWCA 2R0SA 2I8NA 4O7FA 5H1VA 5HENA 4O7CA 5ENEA 5CQTA 5E7DA 2L84A 5D7XA 5DYXA 1JM4B 4WHUA 4PCIA 4J1PA 5AD3A 3UW9A 3MB3A 5EU1A 4A9FA 4YYHA 5E74A 3ZYUA 2RNXA 5CZGA 4CFLA 5E73A 4YK0A 4IR6A 5EV9A 5HM0A 4TQNA 4AKHA 4X2IA 4QR4A 4BW4A 5IGLA 4TU6A 4QSPA 4MEPA 5IBNA 4RVRA 5HQ6A 1ZS5A 5BT5A 3ERRA 5L97A 5LVRA 3U5OA 5LKUA 4TU4A 5DFBA 3VKHA 5ACYA 5F1HA 3G0LA 2EJNA 5ETBA 5F25A 4TZ2A 3MXFA 2R0YA 5HEMA 4TYLA 4UIVA 4KV1A 5F62A 2WP1A 4HXPA 2YQDA 4QY4A 5KTWA 2OUOA 4O78A 4QEUA 4OGJA 4CURA 5CUCA 4NRBA 5CQ5A 5LVQA 4Z6IA 4A9EA 4IORA 4N4FA 5CQ8A 4TTEA 3UVDA 3P1CA 3SVHA 4TT2A 5D3TA 4UYDA 5LKZA 4O7AA 4HXKA 5C8GA 5HFRA 4PTBA 3HMFA 4PS5A 5HELA 3MB4A 5TB6A 4Z93A 5C87A 4BW1A 4MR5A 1PUOA 4ZW1A 3Q2FA 5HRVA 5FFVA 4YYIA 3HMEA 5COIA 4XUAA 4ZQLA 4CLBA 4A9OA 5FE6A 5FG5A 5D0CA 5A85A 4QZSA 4LYIA 5I7YA 4YBTA 2DWWA 5BT4A 4GPJA 2DVRA 4PKLA 5E3GA 4O72A 5LKXA 4HXLA 4O74A 3RCWA 5LUUA 5EQ1A 3U5KA 4CUPA 3IU6A 4HXSA 4UYFA 4YC9A 4NYWA 4ALHA 5H1UA 4J0RA 4HXMA 5EPBA 4YABA 3K2JA 4A9NA 1N72A 4C67A 3SVFA 4Z1SA 5D24A 4XYAA 5FE0A 5IGMA 4QYDA 3HMHA 3UV4A 4Z6HA 5A83A 4NQNA 5D3LA 3NXBA 4UIZA 4F3IA 5I83A 5CQ7A 1ZKRA 4YY4A 2RFJA 1WUMA 5ENIA 5EWHA 5I40A 5K29A 4QSXA 4TZ8A 5CPEA 4E96A 3JVMA 3MULA 4LYSA 4QC3A 4WIVA 5HQ7A 5ENFA 5FG4A 3I3JA 4QSTA 2E7NA 4NYXA 4HXRA 5D25A 5DW1A 5F1LA 5F2PA 5ENBA 2I7KA 5IGNA 4O7BA 5AMFA 5I29A 4LYWA 4FLPA 4LR6A 5ENJA 5L96A 5HRWA 4AKIA 2G4AA 3LXJA 4NS5A 5ENHA 4A9JA 3MUKA 4O76A 4Y03A 5DY7A 4CUUA 5KTXA 4HBVA 4NUCA 4NXJA 4J3IA 4MEOA 1E6IA 4UIUA 5EM3A 5FE4A 5FB0A 5E3DA 4NUEA 5F5ZA 2YEMA 2YW5A 5LKTA 3QZVA 1EQFA 5F63A 4QEVA 5FE8A 4NR4A 5HRXA
chains in the Genus database with same CATH topology
5E0RA 5AMEA 4YH3A 3LQHA 4CFKA 4NR8A 4HBXA 4IOOA 3D7CA 4MR6A 5A81A 5C89A 3UVYA 5I88A 5IGKA 4UIYA 5FH7A 2L5EA 3DAIA 5DYAA 4MR4A 2F6JA 2YYNA 5IG6A 4LZSA 5FE5A 4HXOA 5C4QA 3U5LA 4LDFA 5C7NA 4Q0NA 4A9KA 5FFWA 5EPSA 5DLXA 5A5QA 5H85A 5L99A 2H60A 4CUTA 3LQJA 5CQ4A 5CQ6A 2GRCA 4YH4A 4ALGA 4DONA 4YADA 4QSQA 5G4SA 4YY6A 3IU5A 3FKMX 3QZSA 2LSPB 4KCXA 5F3AA 3P1EA 2WP2A 3P1FA 5D3NA 5EP7A 4BW2A 4YYKA 1WUGA 5DBMA 5LJ2A 5CUBA 5DW2A 4N4GA 3ONIA 4LZRA 5D26A 2RI7A 4QUUA 5CQ3A 4O77A 4BHWA 5II2A 5JWMA 1JSPB 5FFYA 5CUEA 4HBYA 5FDZA 3P1DA 5FG6A 5EA1A 4NYVA 4QSRA 5DKHA 3JVJA 5TCMA 5CY9A 4O7EA 5E9KA 3O34A 3SVGA 4YATA 4WHWA 3UV2A 5EICA 5ENGA 4NR6A 5FE1A 5E9MA 2D9EA 4MR3A 5KTUA 4QSVA 4Z1QA 4QC1A 4IR3A 4A9MA 4NR5A 5CS8A 4QSWA 5CFWA 4A9LA 4XY9A 5F60A 4XY8A 5F61A 2D82A 2OO1A 2F6NA 4QNSA 5DYUA 2YELA 3LJWA 5EWWA 5FH8A 4QSUA 2DATA 5BT3A 4Q0OA 5C85A 4MEQA 3LQIA 5FH6A 5D3JA 4HBWA 5DYCA 5CRZA 5L98A 2OSSA 2R0VA 3TLPA 4A9HA 2RNYA 4YYGA 4NR9A 3O35A 5L8TA 5LJ0A 4XUBA 5KHMA 5HQ5A 5E9IA 4IR5A 2RO1A 4TS8A 5FB1A 4C66A 3O36A 5IIDA 5EWVA 2E7OA 2L85A 5CTLA 3U5PA 3S91A 5FE7A 2YEKA 5DKDA 4PY6A 4UITA 4QSSA 5DLZA 5KO4A 3UV5A 5EWDA 2DVSA 5II1A 5A5OA 5CUGA 4QYLA 5KU3A 4YYNA 3O33A 2RS9B 1X0JA 5FE9A 4HXNA 4QBMA 5DFCA 4BJXA 5CU8A 4N4IA 5HCLA 5A5PA 5EK9A 3AQAA 4NUDA 4YYJA 5HLSA 3JVKA 4NRAA 2KTBB 4UYEA 4CUSA 5I86A 3MQMA 5G4RA 4TT6A 2R10A 4N3WA 4IOQA 5I80A 5D3PA 4NR7A 4NQMA 4ZC9A 4YBMA 3Q2EA 3GG3A 4UIXA 3U5MA 4CUQA 2DVVA 5A82A 5DKCA 4IR4A 2RNWA 5ETDA 4LRGA 5F36A 4AKNA 5JI8A 3U5JA 4OUFA 4UYHA 3QZTA 5A5RA 5FE2A 5L8UA 5CUDA 2NXBA 5EVAA 2N9GA 2MJVB 5DX4A 4J0SA 5CUAA 4NRCA 4YYMA 5ENCA 5CP5A 3JVLA 5AD2A 3G0JA 5FBXA 4QEWA 3O37A 5LJ1A 2DVQA 3DWYA 4QUTA 4BW3A 5EI4A 5DFDA 3P5OA 4KV4A 1F68A 5J0DA 3UVWA 3UVXA 4UYFB 4QB3A 4YAXA 4CL9A 5CGPA 2E3KA 4O71A 5CRMA 5E9VA 5D3RA 5E9LA 5I7XA 3U5NA 4UYGA 4PCEA 4QR5A 5D3SA 3S92A 5D3HA 2FSAA 2YDWA 4A9IA 4UIWA 5EISA 5E9YA 4N4HA 4MENA 5EPRA 4TT4A 4YYDA 4YBSA 4LZ2A 5CQAA 5HFQA 5A5SA 5EGUA 5A5NA 5I1QA 5H1TA 4LC2A 4QR3A 5HJCA 4OGIA 5I89A 5FE3A 4O70A 5A7CA 2DKWA 3AADA 4O75A 5EWCA 2R0SA 2I8NA 4O7FA 5H1VA 5HENA 4O7CA 5ENEA 5CQTA 5E7DA 2L84A 5D7XA 5DYXA 1JM4B 4WHUA 4PCIA 4J1PA 5AD3A 3UW9A 3MB3A 5EU1A 4A9FA 4YYHA 5E74A 3ZYUA 2RNXA 5CZGA 4CFLA 5E73A 4YK0A 4IR6A 5EV9A 5HM0A 4TQNA 4X2IA 4QR4A 4BW4A 5IGLA 4TU6A 4QSPA 4MEPA 5IBNA 4RVRA 5HQ6A 1ZS5A 5BT5A 5L97A 5LVRA 3U5OA 5LKUA 4TU4A 5DFBA 5ACYA 5F1HA 3G0LA 5ETBA 5F25A 4TZ2A 3MXFA 2R0YA 5HEMA 4TYLA 4UIVA 4KV1A 5F62A 2WP1A 4HXPA 2YQDA 4QY4A 5KTWA 2OUOA 4O78A 4QEUA 4OGJA 4CURA 5CUCA 4NRBA 5CQ5A 5LVQA 4Z6IA 4A9EA 4IORA 4N4FA 5CQ8A 4TTEA 3UVDA 3P1CA 3SVHA 4TT2A 5D3TA 4UYDA 5LKZA 4O7AA 4HXKA 5C8GA 5HFRA 4PTBA 3HMFA 4PS5A 5HELA 3MB4A 5TB6A 4Z93A 5C87A 4BW1A 4MR5A 4ZW1A 3Q2FA 5HRVA 5FFVA 4YYIA 3HMEA 5COIA 4XUAA 4ZQLA 4CLBA 4A9OA 5FE6A 5FG5A 5D0CA 5A85A 4QZSA 4LYIA 5I7YA 4YBTA 2DWWA 5BT4A 4GPJA 2DVRA 4PKLA 5E3GA 4O72A 5LKXA 4HXLA 4O74A 3RCWA 5LUUA 5EQ1A 3U5KA 4CUPA 3IU6A 4HXSA 4UYFA 4YC9A 4NYWA 4ALHA 5H1UA 4J0RA 4HXMA 5EPBA 4YABA 3K2JA 4A9NA 1N72A 4C67A 3SVFA 4Z1SA 5D24A 4XYAA 5FE0A 5IGMA 4QYDA 3HMHA 3UV4A 4Z6HA 5A83A 4NQNA 5D3LA 3NXBA 4UIZA 4F3IA 5I83A 5CQ7A 4YY4A 2RFJA 1WUMA 5ENIA 5EWHA 5I40A 5K29A 4QSXA 4TZ8A 5CPEA 4E96A 3JVMA 3MULA 4LYSA 4QC3A 4WIVA 5HQ7A 5ENFA 5FG4A 3I3JA 4QSTA 2E7NA 4NYXA 4HXRA 5D25A 5DW1A 5F1LA 5F2PA 5ENBA 2I7KA 5IGNA 4O7BA 5AMFA 5I29A 4LYWA 4FLPA 4LR6A 5ENJA 5L96A 5HRWA 2G4AA 3LXJA 4NS5A 5ENHA 4A9JA 3MUKA 4O76A 4Y03A 5DY7A 4CUUA 5KTXA 4HBVA 4NUCA 4NXJA 4J3IA 4MEOA 1E6IA 4UIUA 5EM3A 5FE4A 5FB0A 5E3DA 4NUEA 5F5ZA 2YEMA 2YW5A 5LKTA 3QZVA 1EQFA 5F63A 4QEVA 5FE8A 4NR4A 5HRXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E0R A;  5AME A;  4YH3 A;  3LQH A;  4CFK A;  4NR8 A;  4HBX A;  4IOO A;  3D7C A;  4MR6 A;  5A81 A;  5C89 A;  3UVY A;  5I88 A;  5IGK A;  4UIY A;  5FH7 A;  2L5E A;  3DAI A;  5DYA A;  4MR4 A;  2F6J A;  2YYN A;  5IG6 A;  4LZS A;  5FE5 A;  4HXO A;  5C4Q A;  3U5L A;  4LDF A;  5C7N A;  4Q0N A;  4A9K A;  5FFW A;  5EPS A;  5DLX A;  5A5Q A;  5H85 A;  5L99 A;  2H60 A;  4CUT A;  3LQJ A;  5CQ4 A;  5CQ6 A;  2GRC A;  4YH4 A;  4ALG A;  4DON A;  4YAD A;  4QSQ A;  5G4S A;  4YY6 A;  3IU5 A;  3FKM X;  3QZS A;  2LSP B;  4KCX A;  5F3A A;  3P1E A;  2WP2 A;  3P1F A;  5D3N A;  5EP7 A;  4BW2 A;  4YYK A;  1WUG A;  5DBM A;  5LJ2 A;  5CUB A;  5DW2 A;  4N4G A;  3ONI A;  4LZR A;  5D26 A;  2RI7 A;  4QUU A;  5CQ3 A;  4O77 A;  4BHW A;  5II2 A;  5JWM A;  1JSP B;  5FFY A;  5CUE A;  4HBY A;  5FDZ A;  3P1D A;  5FG6 A;  5EA1 A;  4NYV A;  4QSR A;  5DKH A;  3JVJ A;  5TCM A;  5CY9 A;  4O7E A;  5E9K A;  3O34 A;  3SVG A;  4YAT A;  4WHW A;  3UV2 A;  5EIC A;  5ENG A;  4NR6 A;  5FE1 A;  5E9M A;  2D9E A;  4MR3 A;  5KTU A;  4QSV A;  4Z1Q A;  4QC1 A;  4IR3 A;  4A9M A;  4NR5 A;  5CS8 A;  4QSW A;  5CFW A;  4A9L A;  4XY9 A;  5F60 A;  4XY8 A;  5F61 A;  2D82 A;  2OO1 A;  2F6N A;  4QNS A;  5DYU A;  2YEL A;  3LJW A;  5EWW A;  5FH8 A;  4QSU A;  2DAT A;  5BT3 A;  4Q0O A;  5C85 A;  4MEQ A;  3LQI A;  5FH6 A;  5D3J A;  4HBW A;  5DYC A;  5CRZ A;  5L98 A;  2OSS A;  2R0V A;  3TLP A;  4A9H A;  2RNY A;  4YYG A;  4NR9 A;  3O35 A;  5L8T A;  5LJ0 A;  4XUB A;  5KHM A;  5HQ5 A;  5E9I A;  4IR5 A;  2RO1 A;  4TS8 A;  5FB1 A;  4C66 A;  3O36 A;  5IID A;  5EWV A;  2E7O A;  2L85 A;  5CTL A;  3U5P A;  3S91 A;  5FE7 A;  2YEK A;  5DKD A;  4PY6 A;  4UIT A;  4QSS A;  5DLZ A;  5KO4 A;  3UV5 A;  5EWD A;  2DVS A;  5II1 A;  5A5O A;  5CUG A;  4QYL A;  5KU3 A;  4YYN A;  3O33 A;  2RS9 B;  1X0J A;  5FE9 A;  4HXN A;  4QBM A;  5DFC A;  4BJX A;  5CU8 A;  4N4I A;  5HCL A;  5A5P A;  5EK9 A;  3AQA A;  4NUD A;  4YYJ A;  5HLS A;  3JVK A;  4NRA A;  2KTB B;  4UYE A;  4CUS A;  5I86 A;  3MQM A;  5G4R A;  4TT6 A;  2R10 A;  4N3W A;  4IOQ A;  5I80 A;  5D3P A;  4NR7 A;  4NQM A;  4ZC9 A;  4YBM A;  3Q2E A;  3GG3 A;  4UIX A;  3U5M A;  4CUQ A;  2DVV A;  5A82 A;  5DKC A;  4IR4 A;  2RNW A;  5ETD A;  4LRG A;  5F36 A;  4AKN A;  5JI8 A;  3U5J A;  4OUF A;  4UYH A;  3QZT A;  5A5R A;  5FE2 A;  5L8U A;  5CUD A;  2NXB A;  5EVA A;  2N9G A;  2MJV B;  5DX4 A;  4J0S A;  5CUA A;  4NRC A;  4YYM A;  5ENC A;  5CP5 A;  3JVL A;  5AD2 A;  3G0J A;  5FBX A;  4QEW A;  3O37 A;  5LJ1 A;  2DVQ A;  3DWY A;  4QUT A;  4BW3 A;  5EI4 A;  5DFD A;  3P5O A;  4KV4 A;  1F68 A;  5J0D A;  3UVW A;  3UVX A;  4UYF B;  4QB3 A;  4YAX A;  4CL9 A;  5CGP A;  2E3K A;  4O71 A;  5CRM A;  5E9V A;  5D3R A;  5E9L A;  5I7X A;  3U5N A;  4UYG A;  4PCE A;  4QR5 A;  5D3S A;  3S92 A;  5D3H A;  2FSA A;  2YDW A;  4A9I A;  4UIW A;  5EIS A;  5E9Y A;  4N4H A;  4MEN A;  5EPR A;  4TT4 A;  4YYD A;  4YBS A;  4LZ2 A;  5CQA A;  5HFQ A;  5A5S A;  5EGU A;  5A5N A;  5I1Q A;  5H1T A;  4LC2 A;  4QR3 A;  5HJC A;  4OGI A;  5I89 A;  5FE3 A;  4O70 A;  5A7C A;  2DKW A;  3AAD A;  4O75 A;  5EWC A;  2R0S A;  2I8N A;  4O7F A;  5H1V A;  5HEN A;  4O7C A;  5ENE A;  5CQT A;  5E7D A;  2L84 A;  5D7X A;  5DYX A;  1JM4 B;  4WHU A;  4PCI A;  4J1P A;  5AD3 A;  3UW9 A;  3MB3 A;  5EU1 A;  4A9F A;  4YYH A;  5E74 A;  3ZYU A;  2RNX A;  5CZG A;  4CFL A;  5E73 A;  4YK0 A;  4IR6 A;  5EV9 A;  5HM0 A;  4TQN A;  4X2I A;  4QR4 A;  4BW4 A;  5IGL A;  4TU6 A;  4QSP A;  4MEP A;  5IBN A;  4RVR A;  5HQ6 A;  1ZS5 A;  5BT5 A;  5L97 A;  5LVR A;  3U5O A;  5LKU A;  4TU4 A;  5DFB A;  5ACY A;  5F1H A;  3G0L A;  5ETB A;  5F25 A;  4TZ2 A;  3MXF A;  2R0Y A;  5HEM A;  4TYL A;  4UIV A;  4KV1 A;  5F62 A;  2WP1 A;  4HXP A;  2YQD A;  4QY4 A;  5KTW A;  2OUO A;  4O78 A;  4QEU A;  4OGJ A;  4CUR A;  5CUC A;  4NRB A;  5CQ5 A;  5LVQ A;  4Z6I A;  4A9E A;  4IOR A;  4N4F A;  5CQ8 A;  4TTE A;  3UVD A;  3P1C A;  3SVH A;  4TT2 A;  5D3T A;  4UYD A;  5LKZ A;  4O7A A;  4HXK A;  5C8G A;  5HFR A;  4PTB A;  3HMF A;  4PS5 A;  5HEL A;  3MB4 A;  5TB6 A;  4Z93 A;  5C87 A;  4BW1 A;  4MR5 A;  4ZW1 A;  3Q2F A;  5HRV A;  5FFV A;  4YYI A;  3HME A;  5COI A;  4XUA A;  4ZQL A;  4CLB A;  4A9O A;  5FE6 A;  5FG5 A;  5D0C A;  5A85 A;  4QZS A;  4LYI A;  5I7Y A;  4YBT A;  2DWW A;  5BT4 A;  4GPJ A;  2DVR A;  4PKL A;  5E3G A;  4O72 A;  5LKX A;  4HXL A;  4O74 A;  3RCW A;  5LUU A;  5EQ1 A;  3U5K A;  4CUP A;  3IU6 A;  4HXS A;  4UYF A;  4YC9 A;  4NYW A;  4ALH A;  5H1U A;  4J0R A;  4HXM A;  5EPB A;  4YAB A;  3K2J A;  4A9N A;  1N72 A;  4C67 A;  3SVF A;  4Z1S A;  5D24 A;  4XYA A;  5FE0 A;  5IGM A;  4QYD A;  3HMH A;  3UV4 A;  4Z6H A;  5A83 A;  4NQN A;  5D3L A;  3NXB A;  4UIZ A;  4F3I A;  5I83 A;  5CQ7 A;  4YY4 A;  2RFJ A;  1WUM A;  5ENI A;  5EWH A;  5I40 A;  5K29 A;  4QSX A;  4TZ8 A;  5CPE A;  4E96 A;  3JVM A;  3MUL A;  4LYS A;  4QC3 A;  4WIV A;  5HQ7 A;  5ENF A;  5FG4 A;  3I3J A;  4QST A;  2E7N A;  4NYX A;  4HXR A;  5D25 A;  5DW1 A;  5F1L A;  5F2P A;  5ENB A;  2I7K A;  5IGN A;  4O7B A;  5AMF A;  5I29 A;  4LYW A;  4FLP A;  4LR6 A;  5ENJ A;  5L96 A;  5HRW A;  2G4A A;  3LXJ A;  4NS5 A;  5ENH A;  4A9J A;  3MUK A;  4O76 A;  4Y03 A;  5DY7 A;  4CUU A;  5KTX A;  4HBV A;  4NUC A;  4NXJ A;  4J3I A;  4MEO A;  1E6I A;  4UIU A;  5EM3 A;  5FE4 A;  5FB0 A;  5E3D A;  4NUE A;  5F5Z A;  2YEM A;  2YW5 A;  5LKT A;  3QZV A;  1EQF A;  5F63 A;  4QEV A;  5FE8 A;  4NR4 A;  5HRX A; 
#chains in the Genus database with same CATH topology
 5E0R A;  5AME A;  4YH3 A;  3LQH A;  4CFK A;  4NR8 A;  4HBX A;  4IOO A;  3D7C A;  4MR6 A;  5A81 A;  5C89 A;  3UVY A;  5I88 A;  5IGK A;  4UIY A;  5FH7 A;  2L5E A;  3DAI A;  5DYA A;  4MR4 A;  2F6J A;  2YYN A;  5IG6 A;  4LZS A;  5FE5 A;  4HXO A;  5C4Q A;  3U5L A;  4LDF A;  5C7N A;  4Q0N A;  4A9K A;  5FFW A;  5EPS A;  5DLX A;  5A5Q A;  5H85 A;  5L99 A;  2H60 A;  4CUT A;  3LQJ A;  5CQ4 A;  5CQ6 A;  2GRC A;  4YH4 A;  4ALG A;  4DON A;  4YAD A;  4QSQ A;  5G4S A;  4YY6 A;  3IU5 A;  3VKG A;  3FKM X;  3QZS A;  2LSP B;  4KCX A;  5F3A A;  3P1E A;  2WP2 A;  3P1F A;  5D3N A;  5EP7 A;  4BW2 A;  4YYK A;  1WUG A;  5DBM A;  5LJ2 A;  5CUB A;  5DW2 A;  4N4G A;  3ONI A;  4LZR A;  5D26 A;  2RI7 A;  4QUU A;  5CQ3 A;  4O77 A;  4BHW A;  5II2 A;  5JWM A;  1JSP B;  5FFY A;  5CUE A;  4HBY A;  5FDZ A;  3P1D A;  5FG6 A;  5EA1 A;  4NYV A;  4QSR A;  5DKH A;  3JVJ A;  5TCM A;  5CY9 A;  4O7E A;  5E9K A;  3O34 A;  3SVG A;  4YAT A;  4WHW A;  3UV2 A;  5EIC A;  5ENG A;  4NR6 A;  5FE1 A;  5E9M A;  2D9E A;  4MR3 A;  5KTU A;  3D1B A;  4QSV A;  4Z1Q A;  4QC1 A;  4IR3 A;  4A9M A;  4NR5 A;  5CS8 A;  4QSW A;  5CFW A;  4A9L A;  4XY9 A;  5F60 A;  4XY8 A;  5F61 A;  3D1D A;  2D82 A;  2OO1 A;  2F6N A;  4QNS A;  5DYU A;  2YEL A;  3LJW A;  5EWW A;  5FH8 A;  4QSU A;  2DAT A;  5BT3 A;  4Q0O A;  5C85 A;  4MEQ A;  3LQI A;  5FH6 A;  5D3J A;  4HBW A;  5DYC A;  5CRZ A;  5L98 A;  2OSS A;  2R0V A;  3TLP A;  4A9H A;  2RNY A;  4YYG A;  4NR9 A;  3O35 A;  5L8T A;  5LJ0 A;  4XUB A;  5KHM A;  5HQ5 A;  5E9I A;  4IR5 A;  2RO1 A;  4TS8 A;  5FB1 A;  4C66 A;  3O36 A;  5IID A;  5EWV A;  2E7O A;  2L85 A;  5CTL A;  3U5P A;  3S91 A;  5FE7 A;  2YEK A;  5DKD A;  4PY6 A;  4UIT A;  4QSS A;  5DLZ A;  5KO4 A;  3UV5 A;  5EWD A;  2DVS A;  5II1 A;  5A5O A;  5CUG A;  4QYL A;  5KU3 A;  4YYN A;  3O33 A;  2RS9 B;  1X0J A;  5FE9 A;  4HXN A;  4QBM A;  5DFC A;  4BJX A;  5CU8 A;  4N4I A;  5HCL A;  5A5P A;  5EK9 A;  3AQA A;  4NUD A;  4YYJ A;  5HLS A;  3JVK A;  4NRA A;  2KTB B;  4UYE A;  4CUS A;  5I86 A;  3MQM A;  5G4R A;  4TT6 A;  2R10 A;  4N3W A;  4IOQ A;  5I80 A;  5D3P A;  4NR7 A;  4NQM A;  4ZC9 A;  4YBM A;  3Q2E A;  3GG3 A;  4UIX A;  3U5M A;  4CUQ A;  2DVV A;  5A82 A;  5DKC A;  4IR4 A;  2RNW A;  5ETD A;  4LRG A;  5F36 A;  4AKN A;  5JI8 A;  3U5J A;  4OUF A;  4UYH A;  3QZT A;  5A5R A;  5FE2 A;  5L8U A;  5CUD A;  2NXB A;  5EVA A;  2N9G A;  2MJV B;  5DX4 A;  4J0S A;  5CUA A;  4NRC A;  4YYM A;  5ENC A;  5CP5 A;  3JVL A;  5AD2 A;  3G0J A;  5FBX A;  4QEW A;  3O37 A;  5LJ1 A;  2DVQ A;  3DWY A;  4QUT A;  4BW3 A;  5EI4 A;  5DFD A;  3P5O A;  4KV4 A;  1F68 A;  5J0D A;  3UVW A;  3UVX A;  4UYF B;  4QB3 A;  4AI6 A;  4YAX A;  4CL9 A;  5CGP A;  2E3K A;  4O71 A;  5CRM A;  5E9V A;  5D3R A;  5E9L A;  5I7X A;  3U5N A;  4UYG A;  4PCE A;  4QR5 A;  5D3S A;  3S92 A;  5D3H A;  2FSA A;  2YDW A;  4A9I A;  4UIW A;  5EIS A;  5E9Y A;  4N4H A;  4MEN A;  5EPR A;  4TT4 A;  4YYD A;  4YBS A;  4LZ2 A;  5CQA A;  5HFQ A;  5A5S A;  5EGU A;  5A5N A;  5I1Q A;  5H1T A;  4AKG A;  4LC2 A;  4QR3 A;  5HJC A;  4OGI A;  5I89 A;  5FE3 A;  4O70 A;  5A7C A;  2DKW A;  3AAD A;  4O75 A;  5EWC A;  2R0S A;  2I8N A;  4O7F A;  5H1V A;  5HEN A;  4O7C A;  5ENE A;  5CQT A;  5E7D A;  2L84 A;  5D7X A;  5DYX A;  1JM4 B;  4WHU A;  4PCI A;  4J1P A;  5AD3 A;  3UW9 A;  3MB3 A;  5EU1 A;  4A9F A;  4YYH A;  5E74 A;  3ZYU A;  2RNX A;  5CZG A;  4CFL A;  5E73 A;  4YK0 A;  4IR6 A;  5EV9 A;  5HM0 A;  4TQN A;  4AKH A;  4X2I A;  4QR4 A;  4BW4 A;  5IGL A;  4TU6 A;  4QSP A;  4MEP A;  5IBN A;  4RVR A;  5HQ6 A;  1ZS5 A;  5BT5 A;  3ERR A;  5L97 A;  5LVR A;  3U5O A;  5LKU A;  4TU4 A;  5DFB A;  3VKH A;  5ACY A;  5F1H A;  3G0L A;  2EJN A;  5ETB A;  5F25 A;  4TZ2 A;  3MXF A;  2R0Y A;  5HEM A;  4TYL A;  4UIV A;  4KV1 A;  5F62 A;  2WP1 A;  4HXP A;  2YQD A;  4QY4 A;  5KTW A;  2OUO A;  4O78 A;  4QEU A;  4OGJ A;  4CUR A;  5CUC A;  4NRB A;  5CQ5 A;  5LVQ A;  4Z6I A;  4A9E A;  4IOR A;  4N4F A;  5CQ8 A;  4TTE A;  3UVD A;  3P1C A;  3SVH A;  4TT2 A;  5D3T A;  4UYD A;  5LKZ A;  4O7A A;  4HXK A;  5C8G A;  5HFR A;  4PTB A;  3HMF A;  4PS5 A;  5HEL A;  3MB4 A;  5TB6 A;  4Z93 A;  5C87 A;  4BW1 A;  4MR5 A;  1PUO A;  4ZW1 A;  3Q2F A;  5HRV A;  5FFV A;  4YYI A;  3HME A;  5COI A;  4XUA A;  4ZQL A;  4CLB A;  4A9O A;  5FE6 A;  5FG5 A;  5D0C A;  5A85 A;  4QZS A;  4LYI A;  5I7Y A;  4YBT A;  2DWW A;  5BT4 A;  4GPJ A;  2DVR A;  4PKL A;  5E3G A;  4O72 A;  5LKX A;  4HXL A;  4O74 A;  3RCW A;  5LUU A;  5EQ1 A;  3U5K A;  4CUP A;  3IU6 A;  4HXS A;  4UYF A;  4YC9 A;  4NYW A;  4ALH A;  5H1U A;  4J0R A;  4HXM A;  5EPB A;  4YAB A;  3K2J A;  4A9N A;  1N72 A;  4C67 A;  3SVF A;  4Z1S A;  5D24 A;  4XYA A;  5FE0 A;  5IGM A;  4QYD A;  3HMH A;  3UV4 A;  4Z6H A;  5A83 A;  4NQN A;  5D3L A;  3NXB A;  4UIZ A;  4F3I A;  5I83 A;  5CQ7 A;  1ZKR A;  4YY4 A;  2RFJ A;  1WUM A;  5ENI A;  5EWH A;  5I40 A;  5K29 A;  4QSX A;  4TZ8 A;  5CPE A;  4E96 A;  3JVM A;  3MUL A;  4LYS A;  4QC3 A;  4WIV A;  5HQ7 A;  5ENF A;  5FG4 A;  3I3J A;  4QST A;  2E7N A;  4NYX A;  4HXR A;  5D25 A;  5DW1 A;  5F1L A;  5F2P A;  5ENB A;  2I7K A;  5IGN A;  4O7B A;  5AMF A;  5I29 A;  4LYW A;  4FLP A;  4LR6 A;  5ENJ A;  5L96 A;  5HRW A;  4AKI A;  2G4A A;  3LXJ A;  4NS5 A;  5ENH A;  4A9J A;  3MUK A;  4O76 A;  4Y03 A;  5DY7 A;  4CUU A;  5KTX A;  4HBV A;  4NUC A;  4NXJ A;  4J3I A;  4MEO A;  1E6I A;  4UIU A;  5EM3 A;  5FE4 A;  5FB0 A;  5E3D A;  4NUE A;  5F5Z A;  2YEM A;  2YW5 A;  5LKT A;  3QZV A;  1EQF A;  5F63 A;  4QEV A;  5FE8 A;  4NR4 A;  5HRX A; 
#chains in the Genus database with same CATH homology
 5E0R A;  5AME A;  4YH3 A;  3LQH A;  4CFK A;  4NR8 A;  4HBX A;  4IOO A;  3D7C A;  4MR6 A;  5A81 A;  5C89 A;  3UVY A;  5I88 A;  5IGK A;  4UIY A;  5FH7 A;  2L5E A;  3DAI A;  5DYA A;  4MR4 A;  2F6J A;  2YYN A;  5IG6 A;  4LZS A;  5FE5 A;  4HXO A;  5C4Q A;  3U5L A;  4LDF A;  5C7N A;  4Q0N A;  4A9K A;  5FFW A;  5EPS A;  5DLX A;  5A5Q A;  5H85 A;  5L99 A;  2H60 A;  4CUT A;  3LQJ A;  5CQ4 A;  5CQ6 A;  2GRC A;  4YH4 A;  4ALG A;  4DON A;  4YAD A;  4QSQ A;  5G4S A;  4YY6 A;  3IU5 A;  3FKM X;  3QZS A;  2LSP B;  4KCX A;  5F3A A;  3P1E A;  2WP2 A;  3P1F A;  5D3N A;  5EP7 A;  4BW2 A;  4YYK A;  1WUG A;  5DBM A;  5LJ2 A;  5CUB A;  5DW2 A;  4N4G A;  3ONI A;  4LZR A;  5D26 A;  2RI7 A;  4QUU A;  5CQ3 A;  4O77 A;  4BHW A;  5II2 A;  5JWM A;  1JSP B;  5FFY A;  5CUE A;  4HBY A;  5FDZ A;  3P1D A;  5FG6 A;  5EA1 A;  4NYV A;  4QSR A;  5DKH A;  3JVJ A;  5TCM A;  5CY9 A;  4O7E A;  5E9K A;  3O34 A;  3SVG A;  4YAT A;  4WHW A;  3UV2 A;  5EIC A;  5ENG A;  4NR6 A;  5FE1 A;  5E9M A;  2D9E A;  4MR3 A;  5KTU A;  4QSV A;  4Z1Q A;  4QC1 A;  4IR3 A;  4A9M A;  4NR5 A;  5CS8 A;  4QSW A;  5CFW A;  4A9L A;  4XY9 A;  5F60 A;  4XY8 A;  5F61 A;  2D82 A;  2OO1 A;  2F6N A;  4QNS A;  5DYU A;  2YEL A;  3LJW A;  5EWW A;  5FH8 A;  4QSU A;  2DAT A;  5BT3 A;  4Q0O A;  5C85 A;  4MEQ A;  3LQI A;  5FH6 A;  5D3J A;  4HBW A;  5DYC A;  5CRZ A;  5L98 A;  2OSS A;  2R0V A;  3TLP A;  4A9H A;  2RNY A;  4YYG A;  4NR9 A;  3O35 A;  5L8T A;  5LJ0 A;  4XUB A;  5KHM A;  5HQ5 A;  5E9I A;  4IR5 A;  2RO1 A;  4TS8 A;  5FB1 A;  4C66 A;  3O36 A;  5IID A;  5EWV A;  2E7O A;  2L85 A;  5CTL A;  3U5P A;  3S91 A;  5FE7 A;  2YEK A;  5DKD A;  4PY6 A;  4UIT A;  4QSS A;  5DLZ A;  5KO4 A;  3UV5 A;  5EWD A;  2DVS A;  5II1 A;  5A5O A;  5CUG A;  4QYL A;  5KU3 A;  4YYN A;  3O33 A;  2RS9 B;  1X0J A;  5FE9 A;  4HXN A;  4QBM A;  5DFC A;  4BJX A;  5CU8 A;  4N4I A;  5HCL A;  5A5P A;  5EK9 A;  3AQA A;  4NUD A;  4YYJ A;  5HLS A;  3JVK A;  4NRA A;  2KTB B;  4UYE A;  4CUS A;  5I86 A;  3MQM A;  5G4R A;  4TT6 A;  2R10 A;  4N3W A;  4IOQ A;  5I80 A;  5D3P A;  4NR7 A;  4NQM A;  4ZC9 A;  4YBM A;  3Q2E A;  3GG3 A;  4UIX A;  3U5M A;  4CUQ A;  2DVV A;  5A82 A;  5DKC A;  4IR4 A;  2RNW A;  5ETD A;  4LRG A;  5F36 A;  4AKN A;  5JI8 A;  3U5J A;  4OUF A;  4UYH A;  3QZT A;  5A5R A;  5FE2 A;  5L8U A;  5CUD A;  2NXB A;  5EVA A;  2N9G A;  2MJV B;  5DX4 A;  4J0S A;  5CUA A;  4NRC A;  4YYM A;  5ENC A;  5CP5 A;  3JVL A;  5AD2 A;  3G0J A;  5FBX A;  4QEW A;  3O37 A;  5LJ1 A;  2DVQ A;  3DWY A;  4QUT A;  4BW3 A;  5EI4 A;  5DFD A;  3P5O A;  4KV4 A;  1F68 A;  5J0D A;  3UVW A;  3UVX A;  4UYF B;  4QB3 A;  4YAX A;  4CL9 A;  5CGP A;  2E3K A;  4O71 A;  5CRM A;  5E9V A;  5D3R A;  5E9L A;  5I7X A;  3U5N A;  4UYG A;  4PCE A;  4QR5 A;  5D3S A;  3S92 A;  5D3H A;  2FSA A;  2YDW A;  4A9I A;  4UIW A;  5EIS A;  5E9Y A;  4N4H A;  4MEN A;  5EPR A;  4TT4 A;  4YYD A;  4YBS A;  4LZ2 A;  5CQA A;  5HFQ A;  5A5S A;  5EGU A;  5A5N A;  5I1Q A;  5H1T A;  4LC2 A;  4QR3 A;  5HJC A;  4OGI A;  5I89 A;  5FE3 A;  4O70 A;  5A7C A;  2DKW A;  3AAD A;  4O75 A;  5EWC A;  2R0S A;  2I8N A;  4O7F A;  5H1V A;  5HEN A;  4O7C A;  5ENE A;  5CQT A;  5E7D A;  2L84 A;  5D7X A;  5DYX A;  1JM4 B;  4WHU A;  4PCI A;  4J1P A;  5AD3 A;  3UW9 A;  3MB3 A;  5EU1 A;  4A9F A;  4YYH A;  5E74 A;  3ZYU A;  2RNX A;  5CZG A;  4CFL A;  5E73 A;  4YK0 A;  4IR6 A;  5EV9 A;  5HM0 A;  4TQN A;  4X2I A;  4QR4 A;  4BW4 A;  5IGL A;  4TU6 A;  4QSP A;  4MEP A;  5IBN A;  4RVR A;  5HQ6 A;  1ZS5 A;  5BT5 A;  5L97 A;  5LVR A;  3U5O A;  5LKU A;  4TU4 A;  5DFB A;  5ACY A;  5F1H A;  3G0L A;  5ETB A;  5F25 A;  4TZ2 A;  3MXF A;  2R0Y A;  5HEM A;  4TYL A;  4UIV A;  4KV1 A;  5F62 A;  2WP1 A;  4HXP A;  2YQD A;  4QY4 A;  5KTW A;  2OUO A;  4O78 A;  4QEU A;  4OGJ A;  4CUR A;  5CUC A;  4NRB A;  5CQ5 A;  5LVQ A;  4Z6I A;  4A9E A;  4IOR A;  4N4F A;  5CQ8 A;  4TTE A;  3UVD A;  3P1C A;  3SVH A;  4TT2 A;  5D3T A;  4UYD A;  5LKZ A;  4O7A A;  4HXK A;  5C8G A;  5HFR A;  4PTB A;  3HMF A;  4PS5 A;  5HEL A;  3MB4 A;  5TB6 A;  4Z93 A;  5C87 A;  4BW1 A;  4MR5 A;  4ZW1 A;  3Q2F A;  5HRV A;  5FFV A;  4YYI A;  3HME A;  5COI A;  4XUA A;  4ZQL A;  4CLB A;  4A9O A;  5FE6 A;  5FG5 A;  5D0C A;  5A85 A;  4QZS A;  4LYI A;  5I7Y A;  4YBT A;  2DWW A;  5BT4 A;  4GPJ A;  2DVR A;  4PKL A;  5E3G A;  4O72 A;  5LKX A;  4HXL A;  4O74 A;  3RCW A;  5LUU A;  5EQ1 A;  3U5K A;  4CUP A;  3IU6 A;  4HXS A;  4UYF A;  4YC9 A;  4NYW A;  4ALH A;  5H1U A;  4J0R A;  4HXM A;  5EPB A;  4YAB A;  3K2J A;  4A9N A;  1N72 A;  4C67 A;  3SVF A;  4Z1S A;  5D24 A;  4XYA A;  5FE0 A;  5IGM A;  4QYD A;  3HMH A;  3UV4 A;  4Z6H A;  5A83 A;  4NQN A;  5D3L A;  3NXB A;  4UIZ A;  4F3I A;  5I83 A;  5CQ7 A;  4YY4 A;  2RFJ A;  1WUM A;  5ENI A;  5EWH A;  5I40 A;  5K29 A;  4QSX A;  4TZ8 A;  5CPE A;  4E96 A;  3JVM A;  3MUL A;  4LYS A;  4QC3 A;  4WIV A;  5HQ7 A;  5ENF A;  5FG4 A;  3I3J A;  4QST A;  2E7N A;  4NYX A;  4HXR A;  5D25 A;  5DW1 A;  5F1L A;  5F2P A;  5ENB A;  2I7K A;  5IGN A;  4O7B A;  5AMF A;  5I29 A;  4LYW A;  4FLP A;  4LR6 A;  5ENJ A;  5L96 A;  5HRW A;  2G4A A;  3LXJ A;  4NS5 A;  5ENH A;  4A9J A;  3MUK A;  4O76 A;  4Y03 A;  5DY7 A;  4CUU A;  5KTX A;  4HBV A;  4NUC A;  4NXJ A;  4J3I A;  4MEO A;  1E6I A;  4UIU A;  5EM3 A;  5FE4 A;  5FB0 A;  5E3D A;  4NUE A;  5F5Z A;  2YEM A;  2YW5 A;  5LKT A;  3QZV A;  1EQF A;  5F63 A;  4QEV A;  5FE8 A;  4NR4 A;  5HRX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...