5KUMA

Crystal structure of inward rectifier kir2.2 k62w mutant in complex with pip2
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
326
structure length
326
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDWPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of control of inward rectifier Kir2 channel gating by bulk anionic phospholipids.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords ATP-sensitive inward rectifier potassium channel 12
total genus 88
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5kumA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 5kumA01
1P7BA 4MVSA 5J9PC 2ZXWC 4XDJA 4QE7A 1J95A 1M57C 1R3LC 2JK5C 4J9ZB 5KUKA 1KKDA 4GX1A 4G27B 3ASOC 3SPGA 3FB6C 3AT8A 5CBGA 4XDKA 3F5WC 1R3IC 2X6BA 3RVYA 4PDLA 3ZRSA 3AGWA 3AT9A 1M56C 3E89A 3ZJZA 1U4FA 4PA4A 3SPHA 4JTCB 3AG3C 2DWDC 1K4DC 3TETA 1OCOC 4PDRA 3ATBA 4I9WA 4LBEC 4WFHA 3E86A 2AHZA 4GX2A 2R9RB 3K0DA 4MSWC 3SYCA 3GB7C 4JTDB 2WLIB 4OXSA 4R8CA 1ZWIC 3WG7C 2NLJC 4PA9A 4MTOA 3LNMB 4R7CA 3SPJA 4X88A 4XDLA 2HVKC 3ABMC 1ORQC 4PA7A 3R65A 5KUMA 4G28B 1OCRC 4P9OA 4R50A 1R3KC 3ABLC 3SPIA 2W0FC 3VOUA 2GIXA 4RO2A 2ATKC 3BEHA 4DXWA 2ZD9A 5B1BC 3LDEA 4P30A 4WFFA 2ITCC 5EC2C 2P7TC 1XL6A 4PA3A 4EKWA 2EIMC 2EIKC 2HJFC 4PDVA 2EINC 2WLLA 2DWEC 2WLIA 4RAIA 3T2MA 3UM7A 2BOCC 1LNQA 2DYSC 3RBZA 5CBFA 1QLEC 3OGCC 3ATFA 4MVOA 2QKSA 3HPLC 2AHYA 3RVZA 4H37A 4RUFA 4BW5A 2WLJA 3EFFK 1K4CC 3KG2A 4JTAB 3E8HA 4GX0A 4GX5A 4HZ3A 3ASNC 3F7YC 3JYCA 4MVZA 1R3JC 2A9HA 1XL4A 4P9PA 5EBMC 3SYOA 2EIJC 2X6CA 5EBWC 2YEVA 2Q68A 4MW3A 4X89A 1JVMA 2QTOA 3T1CA 5BZBA 3AG4C 3PJSK 2Q67A 2WLNA 2WLMA 4PA6A 3ABKC 3X2QC 3T4ZA 2OCCC 3FB5C 3OUSA 4HYOA 4F4LA 3ATEA 4RUEA 4J9YB 3UKMA 2Q6AA 3VSQA 4QE9A 1U4EA 3OR7C 1N9PA 3E8FA 3F7VC 4CBCA 1V55C 3SYPA 4MTFA 1S5HC 1OCZC 2HG5C 3E8GA 3K6NA 3RW0A 5E1AC 2WLKA 3LDDA 3LDCA 4MS2A 2K1EA 3SPCA 4LCUC 2H8PC 5EC1C 2IH1C 2Y69C 3K04A 4H33A 3STZC 5CBHA 5EK0A 4UUJC 3SYAA 3K06A 4MVRA 3IGAC 3OR6C 3FB7C 1V54C 4MTGA 2HVJC 2E4FA 4MVMA 2WLHA 2X6AA 4R6ZA 5IY5C 2A79B 3FB8C 2ITDC 4MVQA 3SYQA 2DYRC 3ATDA 2IH3C 3AG1C 3E83A 3TCUA 4P2ZA 4MW8A 5EBLC 4LP8A 2A0LA 3K03A 4TWKA 3AUWB 3K0GA 4WFGA 2HFEC 3SJQC 3STLC 4WFEA 2Q69A 4QNHB 3ATAA 3LUTB 2WLLB 4X8AA 4ZBMA 1BL8A 3AG2C 2EILC 3E8BA 2KB1A 1OCCC 4PDMA 5B3SC 3IFXA 4MVUA 3T4DA 4KFMA 3K08A 5B1AC 1G4YB 2BOBC 3OUFA
chains in the Genus database with same CATH superfamily
5E79Z 1HHJA 4UT9H 4R6UA 1HW7A 4V2CB 2ZNJA 5CJOL 1WB7A 5BW7C 3TBVB 4GX1A 5CN1A 3UMNA 4AUJA 5KYYA 3C5JB 5CBGA 3PABA 3QZWB 4IKLA 4IRJC 4WJKB 1WS7A 4PJDA 1RZKC 5F89B 2CDGA 2WSDA 1BPLB 4YDNA 5C0DA 2EXYD 2AQQA 4DESA 2VUOA 4F27A 1NAMA 3A0RA 3K0DA 4GNKB 2F66C 2OQJB 4OZIE 4X6EA 3RWFB 2GJ6B 4RDBA 4RNRB 1Y1DA 1CE6B 1U8CB 1KYOK 2ZIMA 1W72A 2R51A 1BMZA 4LCIL 2EUXA 2DQEL 3FTSA 2NLJB 1OK8A 3QI9C 2HRLA 5J12B 3V55A 3E0GA 1Z3RA 4LSQH 3K4DA 4OLYH 4TOYL 4AQ1C 3PWVB 4A7GF 2CSPA 2Y2TA 3M86A 3WIAA 4JGJA 1AQDB 3ML9A 5JNYA 5IW1B 1IUZA 5DC2A 3T77B 5KYXB 1QI4A 2VM3A 2BNQB 1I3GH 1T4WA 3D39B 4FM2A 2BFVH 5I0VA 1XMWA 4LU5L 5IMKA 2VWKA 3QCVL 4PIRF 4RGMB 5CZRA 1UM5L 4TVPL 4GW5B 5C6TH 1MW2A 4XNYL 3EGDB 2YZ1A 5E08L 2ILLA 1VDGA 4FABH 3UABA 4PJXB 2CDFA 2FWUA 1TTRA 3ZKMD 3KJ4B 2A9DA 1ZT1B 3RE0A 2GK0B 1EO5A 1DN0B 3FRPA 2WXFA 3FU9A 4FQPA 2YUAA 1R24B 3NJGA 3OAWA 3T3MB 1OGTB 2H32A 4X8JB 2NTFA 2YEZA 3V6ZA 3X13A 2ZXBA 2WVUA 4XOAA 2HVBA 2X40A 2EUZA 3DV6B 5C08E 3C6LD 2YRBA 3LYRA 1WEJL 3LRSA 4NQXA 4P5TA 3UTQB 3VD2A 2XN9B 3PFQA 3U4KA 1KGUA 5E1QA 2OMBA 2XZCH 2AK1L 2VXUL 5C0ND 1QLEH 2DMHA 3CFEA 1HXYB 3QSKB 4NKMA 2Z0UA 4X6DE 2EDNA 5DEGA 4NQDA 3T65A 2NZ9D 5I5JA 4IIJA 3VQYA 1Z9LA 4LPVA 2DQ0A 1EN4A 3QIBB 2WP3T 3MHHC 4MCNA 5E03A 2NUTA 3RWRD 2WWOA 4RWYL 1Z32X 1E43A 5D1QD 3SOBL 4LH6A 4M48H 2X2JA 4WFEA 1AI6A 2P5OA 2D9CA 4RFNB 4ELMF 3I3EA 5GGRB 3GSOB 1IBZA 3GXNA 1ZVSA 1A7OH 1ZV2A 3CMAV 3Q44A 5KSUB 3NZSA 4K5NA 4UYPA 3ZSTA 3VW3H 2D3VA 4AC2A 3DX8B 3ZS8C 3QUYA 3X1NA 2Q3ZA 4DCQB 4L48A 3HMXH 1BYPA 1OTUD 3MNWB 3KWWA 4B3RB 1Z3GL 1SJMA 3DROA 2ZUVA 5EMYA 2C4FT 3OJDA 2C3WA 3U7AA 5K9JL 3KLSA 1T5WA 4XCNB 3LNNA 4QXGH 2Y3AA 4NNYA 1O9VA 3WS3A 1WCQA 2MEJB 3HG4A 1OLLA 2ZG3A 5KSAC 1M1SA 3TZVA 3GMLB 2BP8B 5DYFA 4WRLA 3LQAH 4BK8A 4CVZA 3OL2A 4D8PA 1JZ4A 2HPOA 4Z7NF 4O9HH 3OG6B 4WLCA 2JKRM 4MQ7A 4NBZB 2XWBA 3HNVL 1B0IA 2ZE5A 3NIGF 3W37A 2J2ZA 2X28A 4UM9D 4AJVA 1F6LL 3OF6D 4NO5B 1AO7B 1XUQA 2EH7H 3GS7A 3BRGC 3R0MA 4YXKL 1AVMA 2XWXA 3MPCA 1BCIA 3T0EE 3IFOA 3MRLA 1ZANH 1F3DH 3HB3D 3OKNB 1IBLO 2XWJA 1BFSA 3THOA 4UCUA 3UTQA 1DZBA 4HUVB 3FKUS 3UAJD 5CBFA 4ZFOL 3AS0A 4R4BA 4X4YB 4AQYO 3MKKA 4X9GA 3SE3C 4ZX3A 4N0YL 2DWDB 5CU5A 4ZUVB 1LO0H 2DKSA 4S1SL 5F9WC 1OGTA 1FGVH 2JEUA 3M7MX 3KPRB 3V4VL 1G9NC 4JQVC 3VQ1C 2BSTB 4N2OA 3FFCA 1NGZB 2D3NA 1DUZA 3R7QA 3GF8A 5C8YA 2HWZH 3NSCA 3PJSK 4U7MA 1T0NA 5GRYA 5INCB 4QNPF 4AE0A 4FAAB 4TSAH 4NAJA 4DF9A 5EH1A 5KSBE 4N0UB 4HWEH 4DVRH 3HNVH 4U1GC 5TDNB 1JUFA 4HQQH 2UZYA 2BNQA 1FPOA 2FX7L 4A7VA 3M8OH 4NUQA 1EHKB 3BKMH 3F58H 3QG6B 3VTAA 2JKXA 3KPOA 2R69H 1YIJV 4TTDD 2E27L 5BZDB 1Q86W 1NI8A 4PG9A 3MAWA 4QXGL 1T0MB 2AF2A 2QHRL 4WV1A 1B6UA 1I9IH 3GJFB 4FI6A 5DFTA 3V4VB 4AQEA 3HR6A 4PPTA 4UCSA 5CEYA 4ABVA 1X5FA 4JQXA 4RMVA 3VXQB 2Z93A 1QKZH 3MV8E 1W72B 3NFPA 4LEEA 4TPRL 4PN6A 1U8CA 3G5WA 5JIHA 2D2OA 1KBWA 4ANXA 3EG9B 5CZKA 3J81N 4KUZL 4GRLB 2VDLB 5CGMA 2YMXL 3Q9PA 4X6EB 2YAMA 3HPJA 4KHXH 5T3XH 1MJUH 3O4LD 2UUCB 2NX5E 3U30C 3O6KL 5DMGD 1XIWB 2C1OB 4LDOB 4XBPA 3RU8L 4XMKL 4J6RH 1JDCA 4CL7A 1NC4D 1CICD 4LRIA 5I73B 3CXCU 3FF8A 4KJYB 3MLUL 2PO6B 3P9WB 2A38A 1MZZA 3FW6A 2YPVA 4D2NA 2HAZA 5CEZD 4KY1L 1U21A 1FGNL 4P2QD 3SPGA 3NIDB 4PTTB 4PS7A 4WI2A 4JFUA 4NKIL 1CLYL 5HFLA 1I7TB 3QFDB 4QY8A 4JTCB 5E94B 4N5ED 1RUAH 5JH7A 1SKVA 1NQBA 3KR3H 1M93A 4M00A 5FOBA 5TGBB 3ISRA 2CK0H 2KLTA 1H19A 5AZEL 4R8CA 1FVEB 4K7PX 4HJJH 3T2NH 4JREC 3T0VA 1BQLH 3IU4H 3A0OA 2A6JB 4DP1X 1S7VB 4YHKH 4DQOH 3QO0A 1YJWV 1NJ9A 3F8UB 4G7YH 1GN6A 1XR9A 2EYSB 2IADA 3L9EA 2R72A 3UT5A 4DKFL 1AB3A 2WZPA 3IF1B 5E2VH 5TE7L 3ZL2A 4DERA 4YQXL 3BXNA 3CN2A 3X2QB 3PJSB 4L4TE 4ZAKB 2DQJL 4AILC 3QEQE 4WU7B 4FXTA 3PWJB 4JI3O 4LF9B 1LL1A 4NXSA 4PV9B 3ZPDA 4BINA 5IBLD 3S36H 4LCVA 3QORC 1DBKL 3CRMA 4CN1A 1CTMA 2XAQA 1ZWIB 3PPEA 3TWYA 2VIRB 4N0CC 3G6EV 4HWZA 1EO8L 3ZLQC 4AGLA 5L7XH 5I8KH 4J3VA 4KX7A 3VFTB 3DC6A 2BOCB 4XT1C 4Y1AB 4MJIA 4NN5B 3LQZB 4HWUA 5CLZA 5GGVL 3CFBB 1YEKL 4JY5L 1T1WA 1UKQA 4LK4A 3WFBL 2OXHA 5GGQH 5DD6B 4ZI7B 3B1UA 3N1QC 1BIIA 1UWEL 4B96A 4YHNB 2YWYA 1R3LB 1M53A 1QSFD 1W0VA 2NUPB 2DBLL 3JAWA 4I2XE 1F3JA 43CAB 4BFJA 3P30A 1SFHA 4LZKA 3A67H 2YLKA 1F4YH 3HVNA 5F7BA 1H6UA 2H4EA 2M7WA 2GBAA 2KPNA 4Y9BA 3GKWH 1DQDL 1TCRB 1TEGA 1X5JA 3Q8FA 4JMXA 1M6UA 3SQBB 5MHSE 2HKHH 2F4VO 1N6VA 2XWZA 3O3DA 4UU9A 3T3ME 3ZMZA 3D8CA 1PLGL 3FTZA 4NFBA 2FHFA 4M1CC 2EDOA 4X9BA 1U8IB 4EJ1C 3AREC 4OGQB 4ZFZA 5BR8B 1OAXH 3RZCB 2MW2B 5LP6C 1NCUA 2I9TA 5GGVY 3PYCA 3G80A 4FRWA 3QXTA 4U1NB 2OMTA 3SKOA 2YLHA 1NPNA 3ARXA 3NPSC 3VRLF 1O9GA 2CJTA 3HKEA 3OSVA 4PSPA 3DDFA 1L3WA 1SQ2N 4KUMA 4F57H 2BOBC 5HDWA 5EC1B 2A99A 4BR6A 1BGYH 1P7BA 1IFHH 1MFEH 4DNLA 3FTGB 4YXHL 4OVUA 2G2RA 5JWPA 5BV7H 4Q2ZA 2QFRA 5JQGB 2V9UA 5A2QN 5CA1A 1CXEA 1L9OA 3QNEA 4PH8A 1AJQA 1E4XH 4FNTA 2CTQA 3EJZC 3L4YA 1BJ8A 4QXUH 2NY7L 3N6YA 1NTZH 4EB6B 1URIA 3QEUA 4YSOA 2AANA 3WY1A 3MCLH 3VWKA 4RRPM 1BAFL 1GGUA 3L6FA 3OZ9H 5I0ZA 2XPZA 1RI8A 3KG5A 1ONQB 4EOWH 1EEZB 1PQZA 1VSCA 1YNTF 3HAEB 3L3JB 5ACZA 1AIFA 4QRRE 1USZA 1EBOA 2JNZA 5JVDA 3MBXL 4OZHB 5ANME 5KS9F 4H0LC 2VN5A 4X9HA 5GZOC 3MRJB 1KGCE 2FH8A 3MNMA 2ZD9A 2VE6B 3LCYA 1AYRA 2WP3O 5ID0B 1BVZA 3VXPB 1EFRG 3GLEA 3L4ZA 4U1MA 2WA4A 3S8FB 1OAUL 4H8HA 4PLJD 5DJ8A 5E5RB 3D36A 2R39A 5EZLA 3U6XS 3HC4L 2R9HC 4FNSA 4HUMB 3FFDB 2IW5A 5DVPA 2XAHA 4RGND 1RZ7H 4B9JA 4Y9FA 4OGXL 3MRIA 4UIKL 4UF7C 3OAAG 1C5DB 5ICXB 2AV7B 4FPPA 1JR9A 2XN2A 4MKTA 2WLNA 3VB8A 5CFAA 1B90A 4KH9A 4QTIL 3P4MB 1CTOA 2CAZC 3AJ7A 4NXNO 1EFQA 3DLQR 4GFTB 2OYPA 5C2BH 1Q0YH 3MQIA 4Q6YA 4U1LB 1PKXA 3PNRB 5E6ZA 4QE9A 5TK4A 5K1NA 1CBVH 1ACYH 3IJ4A 3I6GB 2ENJA 3MOBL 3SD5A 4QDGA 2UUBO 2L6LA 4K8XA 3CZLA 3QVNA 4TNVK 1Q6UA 5FV2A 4W4NA 1GAFH 2RQ6A 5AKRA 5DHEA 3GK8L 3ISYA 5KA5A 3IGLA 2ITEA 3MRRB 5I1LB 4CC0A 2GEEA 2DIAA 1AIFB 4JFYB 3HAEA 1LYQA 2ZQMA 4Z95H 5IESH 3RUGE 4GCZA 1HWGB 2OTWB 2Z65C 1CBVL 1RH8A 2KS0A 2GTAA 3C5ZB 3QIBD 1QX1A 3AREB 3MBWA 3PP4H 4XB3A 3PQYD 3EYQC 3OR7A 2WXNA 1CJYA 4Y2DB 2H3NB 4CJ1A 1BZ7A 3CZFB 3HZYA 5I66A 2HFEC 3I56V 1EEYB 2WZ0A 3RWJA 5I26A 2GI0A 3B2UD 2PY5A 5IYBO 5C0FB 5B1AB 4JW3A 4ODUB 1S9VA 5C07B 2JJSA 4HBCL 5KSAA 1JK9A 3TZVC 3KPSA 1A65A 1NBYB 4HBNA 4FADA 1FFNA 1UM4H 1F4YL 5CWSA 3VXUA 4KZCA 1KKDA 2ZE0A 3ULUL 2DBLH 1F00I 3GXIA 4KKRA 5I1AA 2NXYB 3QUYC 2HHHO 3B4SA 4OV5B 4JFVA 3KPMA 4MVBD 5KAIZ 4JPVL 1LP9F 4WUUD 1M3IA 5GGVH 5E24E 2WLIB 2OKMA 2WQSA 2OW6A 4EBQL 2OI9B 1NGXA 4Y2DC 3QHFH 5DZPA 5DURD 3U9PL 3ILPB 3NP3A 1NMCB 5LGNA 1JZFA 5I18L 4UDTA 4K7FB 1SBSH 1UQSA 3I2CH 4NLAA 1GA2A 3MV9B 1L9QA 1R3LA 3IT8D 1EAPA 4JO1L 3WD5H 4DP6X 4QGPA 4AT6A 1HWHB 4ZI7A 5HBBA 2AV1B 3WEMA 3HG5A 2WLLA 5DRWA 3FO0L 1F11A 1LNQA 3JD2A 2X87A 3TONA 1RCYA 2PW1A 5LN4A 4PQXA 3L2MA 1KXQA 4ZW6A 1JK8B 1WSST 4F8OA 4JE4B 2IBZH 2FJGA 3TPUA 1FRGH 3DRTA 2BCMA 3O4LA 4FQ1L 4YQXH 2Z1PA 5I1CL 4L8BB 3AQZA 5D72L 4W9EC 2X6CA 2ZZUT 3BP6B 3K2KA 1OAXL 3P4LA 2H32H 3P2BA 5HYJA 5T1LA 3WFEH 1JHLL 4XZUB 4Y1TA 3K5OA 4ZK8A 4OW6A 5E8NB 2A9NL 1H3TA 1A6VL 12E8H 5FA4A 3HKFA 3OR6B 2AAAA 1IJNA 2H5UA 3L48A 1N3NA 5D4HA 1XV8A 1ICTA 1Z9PA 1ZHBA 4HDIA 3VU1A 5F7NC 3ZZLA 4MS2A 3EO0B 5IFHH 1SY6L 2IAMA 3R1GH 5I2IB 2CJ3A 3RT3C 5BR8O 4LFBB 1LQBC 3ZRVA 1D5MA 1IAOA 2NXZB 4TQHA 4XO4A 4U31A 5D6DA 3BCCH 1MJJB 4AQZA 5JOPD 4KKQA 2F08A 5DD1H 1MFBH 1SLUA 1RURL 4WTXA 4W9IC 5CEXB 2AEOA 2X05A 1E8WA 3AG1C 4CAGA 2R2BA 3QZPA 1NCTA 5I8KL 1K5QA 1QTSA 4X6DB 1JI1A 1MW3A 4C58B 5I15H 5F88B 2X3AA 3EH3B 5CJQH 2J5LC 5CKGA 1HL9A 2COVD 1N32B 1FLRL 4L1BA 3WFCL 4FXGB 3MC0A 4ERSL 3VXSE 4J3XA 1VESA 4OF8A 4N20A 2ED8A 4HJUA 1OF0A 3QDMB 3K6SA 4JZGA 3CFNA 1I9RL 3BP6A 4Q52A 4XPHL 4GT1A 4G8EA 4K0OA 5E8DH 4GI9A 2Z4QB 1VFAA 2Q9OA 2ICCA 1VEMA 2YOAA 4FFYA 1NCCL 3FO1A 3BWAB 3O4LB 3JBG7 3HPJB 4BCYA 5GRUH 2ENSA 3D5OF 4WFFE 3FAVA 2PPEA 2FJSA 1DANT 2AI0L 4XP4L 3AU1A 3TN0B 3W9DA 1G0DA 3FN0H 3BMWA 3V6FA 5D55A 3U10A 4KK8D 1F11B 3DIVA 2HN7A 5DRWB 4OY9A 4CZZA 2PO6D 4AYEC 1RERA 5GSRB 4EF3A 3QUMB 3E3QE 4ZG1A 4PD4K 4QAMB 3BLPX 4XXWC 4UV9A 3CXHK 5TH2B 3SPIA 1N59A 4LLDA 3W57A 1E1RG 1D5BA 4QRSB 5E4EC 2E74B 1MFDH 3CTTA 3FT0A 5EC2C 3HLAB 2HT2C 1G7IB 1XL6A 4RESB 1HHHA 5C97A 3QG6A 4JAMA 1AJ7L 3LEVL 4PLJC 1EXGA 3CJHA 2J12B 4KY1H 3ULVL 2LAGB 2N7BA 5E9AA 1A6ZB 4JN2B 5EBWB 3T0EB 2Y7LA 4GBXD 3FRUA 4OLVH 4H37A 2J1KA 2QHLA 4HPYL 2K7QA 3B3IB 1NGZA 3GSQA 3QC5X 5FC9A 1PL3A 4YZWA 3QUHA 2F18A 4FKEA 4N2BA 1VQ9V 5GHWL 3VXUB 5LYJB 5FGBA 3UQ8A 1J05B 5H35B 3FC8A 1AAJA 1BFVH 3MBEC 2PWHA 1YCIA 3G08A 3ARGC 2E6QA 1VACB 4MAUL 3OR7C 5B1OA 3I9PA 5D7JC 3F7RA 3BPNB 5AOKA 5IBTH 4GS7C 1BPVA 1YTFB 3UP1A 1KBGL 4NXKA 5G5DA 5KSBB 2H8PC 2QSQA 1NR7A 2Y7MA 2Y1YA 3B8SA 1J5IA 3AREA 4JI5O 2RR3A 1R73A 1N19A 3AUVA 1GTFA 1FCGA 4R8WH 2GJRA 2A9CA 3QEHB 1IO4C 5KJRH 3STZB 3M8AA 1J0IA 4MAUH 4PGBB 3TASA 4DAGL 3B8NA 3EJYD 1HR0O 3E38A 1FG2A 3FCTB 5ERWA 3LZQA 1HKLH 4NX0A 5C09B 3OAUH 4DR6B 1BFVL 2BNRA 2JELL 3KPNB 1A4BA 4TSAL 2E75C 2V7HA 1DQVA 2CJUH 3UG3A 5AL0A 4LP8A 4Y1SA 4BK5C 1M2VA 4M48L 3STLC 3QGVA 5E6ID 5JMOC 4ODSL 4N8CL 3RI5F 3CVCA 2GABA 4F2EA 1FNLA 1NUFA 5D2LA 1B4JL 5LXGH 4A04A 4JX0A 3LHAA 3WEXA 2DJ4A 2NCEA 3U48A 2N7AA 2A7BA 3RB5A 2AK1H 2VXUH 3UGUA 4OU3A 1FG2B 3FCTA 5DFAA 5ERWB 5C09A 4H8UA 3S0PA 3ZO9A 1RJCA 5JHLA 1TO5A 2DWEA 3M1BB 5HPOA 2OCCB 4KK6D 3PN1A 3EADA 1RSOA 3CWBH 3N2KA 5FA3B 3F3HA 2WW8A 3NIDE 4KJQC 2FQGA 1ND0A 4F5CE 3UO2A 3SR2C 1XQ8A 5B1CA 4NQDB 3TEYA 1WP7A 1VZIA 3S48A 4XC1H 3BPNC 3WN6A 1A9EB 2CA4A 2AI0H 3MRJA 5C6TL 2E9WA 1AC6A 3QCVH 1FXKA 2P80A 4ZHQA 1VQOV 1XI1A 1PEWA 2H0PA 2V17L 3VD4A 3V6OE 2PI5A 3UTTA 5JJJB 3B5GA 1QLEC 4GKJB 4YDKL 3U0ZA 1L0PA 2HT2D 3DX0A 4JKPL 4ALAH 2EE3A 2IO5A 1IC4L 3G9AB 4IW4C 2MOVA 1AHWC 3VXOA 1QRNE 3EGDA 3HRZB 1R1CA 5EBWC 1DJYA 4X4XA 3OG4B 5D6DC 2KZKA 4QIRA 5A1AA 1J8HB 4QHUA 3KHOA 4UILL 1CLCA 1F58H 3G7TA 3NEOA 2OCCC 5HHPB 4ZW8A 3GNML 3CSPA 2R4SH 4KGJA 4DKTA 5JNYB 4LFHG 1KN2H 3EBGA 3H9SE 3O11A 2PXYB 3E2HB 3G5XA 2VZOA 4XN5A 2E0PA 1NC2D 4U1NA 5F9WB 5DMYA 3S3JA 1S5HC 3PWLA 2B9BA 1LE9B 2Y23A 2AXTZ 5GSRA 4ZMNA 5C0CD 3SPCA 3QI9A 4PJEF 4YN3A 4Z3JA 4N2GA 2CKBB 2YGQA 4AYDC 4POUB 5JCOC 1XILA 5JIPA 1RQ5A 1EGJH 1AR2A 2NNCA 1FBIL 1M1KW 2LFEA 5GS0L 3LY6A 5L6YH 4ZOCA 2R1WA 4JPIB 3UGEA 4MB4A 4KQ0A 1DBJH 1UASA 3K7UA 3CPUA 1X9UA 4YDIH 2WXGA 2MCAA 4F5CA 2XTLA 2DQFA 1Q6IA 3AY4A 1MRCL 2GVYA 1ZLUK 3Q5YA 3PAZA 3NCCB 4ZZKA 1C12B 4MASA 4U3JA 1SMAA 2R0WH 3LQZA 4FKKA 3DVGB 1PGRB 1GGIL 1TUEB 4KPHL 5JW3H 1RZ8B 4NO2B 4YDVA 1TVKA 4BBWA 4JM4H 3KH4A 3PWUA 4PW3A 3QQ3B 4JPSA 4YBQC 3WI9A 3Q6GH 4DR3B 1QQDB 3FO0H 3NFSH 1I5YA 2FQEA 3RWIA 1FH5H 1ULVA 5ECGA 8CGTA 3CPLB 4WKXA 1PKQA 2BSRB 4Y9GA 2Q6WB 4JVWA 4N2NA 3L9YA 5GS0D 4IBZA 3VRJB 3WAJA 2DIBA 1IAOB 4OT1L 1BT8A 1MFAL 5FDWA 5DRZA 1K3ZA 4DK1A 1GZPB 3NCFB 4HOXA 1GN4A 3VTTA 2ATAA 4WUUB 3IRCA 2F54B 1YO4A 4WW1B 4XP5L 1FO0L 1FC2D 3NIFF 4GY4A 1PG7W 2CLRB 3LKNA 1GZPA 4Z7NE 1PJ9A 1QASA 2P26A 3OR6A 4LAQH 3LH9A 4YH6A 1BZOA 3L3OA 1N67A 3VQ2C 2NW2B 2XA8L 2P5EB 4QYAA 1TYRA 2PYLA 2MTPA 2CPCA 3VI4E 3MLXL 2LU7A 5HPMA 1R9FA 5AAWC 1QVOA 3A6BL 4U1IA 5D7JA 3ARRA 3ET9F 4RA3A 4L8BA 4Y19B 1RULH 1A7NH 1NOLA 1NCBL 3VGGA 3SGDH 1R1BA 4DZBA 3RWEB 5IT2H 2FJGB 3TPUB 4U6VL 2YD0A 3NA4A 4OJDH 1N6QL 3FQRB 4LKXA 1DBAH 3KPSD 1HHGB 3U4AA 3VH8G 2N4IA 4ZQKA 2B5IB 2BHUA 3FZUD 4HIEA 3U6XA 2OSXA 1BBDH 4MJ4A 2QGBA 3VWJA 4B6ZA 3Q8CA 4UNIA 4KNSA 3C6LA 3GSXA 4DWHA 2EYRB 4NQQA 4I5BA 4L3ED 3CUPB 3TEXA 4ZNEA 3W5NA 4GRMB 1VMGA 2GHZA 3B2VH 4LLAA 1AKJA 4XO3A 4NS0A 1M57B 1YF2A 2HFFB 1N33B 1AYOA 2KSDA 2IH1B 3E8GA 3ILPA 4JPIA 5DU7A 1XX9C 3I55V 3JCUZ 1NDMB 4FYQA 1XGZA 1UD5A 4QHMB 4MD5A 1GAFL 3U0TB 4HPOL 3FSOA 4FXGC 1XMEB 2NXYC 5JW5B 1IQWL 2WKGA 1D5NA 3DUUA 4Z3HA 3CN0A 3SE3A 4ETYA 4ODHH 1OW0A 4I1PA 4LSPH 4O2CA 3QHTC 5DMKB 3V4VA 1FJ1A 4JR9H 1KIPA 4H20L 4AQEB 1QR1A 3E83A 1PW3A 3T6XA 2NR6D 2BSKA 4FIPC 3OQ3B 3HG0A 1KCSH 2OBGA 3ZHTA 2UZYB 5ALBH 5E2WL 5C07A 4J3SA 2MK3A 1RFYA 3P0YL 5LCVH 4X65O 2H0FA 4WO4A 1DQQB 4AENB 5J8OA 3HC4H 1T0NB 1KENL 1TJIL 1WPCA 4OIIH 5INCA 4G6FB 3D69A 4J11A 4GRWH 1QLFA 2XZAH 1JHTB 4WSJA 2CD0A 4ANVA 4NZDA 1M05A 2BSTA 2E4TA 1JFFA 1U6AH 1RIUH 5IEKA 1G1KA 2ED6A 2NOYA 3HUJB 4NM4H 4OCSH 3ZHKA 1YEHH 2O6FA 4JI4O 5C0GB 5SWQB 1CFVH 3CB2A 1ZA6B 1P7GA 3II3A 4ZOLA 4ONHB 4GX2A 1A9EA 4OXSA 3WXWL 4DKEL 5JORB 5T5FA 5FHAL 3PY9A 4JRYA 1Q3EA 1IBKB 1WQVT 4X6BA 4ELMA 4XXCA 2Y6TE 5FCSH 2JXMA 4X4YA 5F9JB 3BZDA 3CXHJ 4HS3A 1B4TA 4YL9A 4FG2A 5JPNA 2BOBB 3SDXF 5G4NA 4BM7A 3ZE2F 3IEAA 2EINC 5HXMA 4IQHA 5KBNC 5DUJA 4FFBB 2IFGA 2X4UB 5KVGE 3MV9E 4P06A 1AD0A 5E9DB 5K33A 5BVJB 3D87B 3LKPB 3GMLA 2PNDA 3C75A 2BJMH 1UXSA 4JY6B 4JV5O 2OZ4L 4WEMB 5TDPA 3MV7B 1YEWA 5EWIL 5IHBA 4K5LA 3EDFA 3QDJE 1E9OA 2IC2A 4HIHB 4OD1L 4H26A 2PETA 3MNWA 3RY6C 1G4MA 3HEIB 3OXSA 1IT9L 5FM5O 3DX8A 3QUYB 4OTXH 1P7QA 3QIUC 4HYOA 1MCSA 1OD7A 1IFGA 3QUYD 3N1GC 1WAAA 1ZVSB 4Y4KA 3K6DA 2PUQT 3WNOA 4PUBH 4O02L 4D9LL 1MRDH 4P48A 4E5XG 3SDDB 1E42A 4Q0XH 3K8KA 3R0NA 1YJDL 5E2TH 5T3XE 2IQ9H 3L6FB 3WTWA 3HC0B 3OB0K 3V6BR 3DSNB 3H1ZA 4HIIB 3DUSA 4PJCE 2H3OA 3NIFE 2H3XC 2EILB 1V54C 4ORGB 4ZMOA 4OI7A 1QSFA 4K8RL 3UTSB 3S88L 1HXYA 4MAYA 4ZO9A 5AAMA 4MHHI 4XPAH 5IE9A 2ZX9A 3HC3H 4M8QB 2VDQL 1H9DA 2ZUYA 4GLRI 1I4FA 3TNNB 5F70A 5JZ7C 4GW1A 4Y0GA 1CYXA 1JGLH 5IJ9B 4QT5B 4WI0B 3L70H 5DD5H 4WCEV 2GIMA 3OGIB 2HT3D 1EJ8A 5EF3A 4UM9A 1F51A 2DS4A 2CDFB 4Z7OE 5LP6B 4I4TB 1JWSA 3HCVB 4ZDHB 2OCJA 3ZTEA 1PNDA 2X7RB 4UXNA 4ANWA 3EJJX 3TJHD 1GN2A 1J5DA 1RUQH 2IJ0C 1PCXA 1JAEA 4JFHE 3CJHB 1CG9A 5L3BA 1CGXA 2D7TH 2KDYA 4NP4H 2VQEO 3IJ9A 2NY1B 1HHHB 2EJ7A 3GYRA 1GMEA 1K6QL 1AILA 2JGDA 1PKQE 1NIEA 4IS6B 1FV1A 3PWVA 1XFPA 5GZNC 1W0VB 4JQIL 2X9ZA 4PA9A 4IRSD 1QNZH 4DUWA 3MRGA 1J8SA 1XR8A 5D8JH 4RISH 4Z0BL 4C57C 1J0HA 2HN7B 3L08A 3I9IA 3FU0A 4O51A 4LHUD 4NN5C 3BE1L 3WEBA 4X5WA 3B2EE 1ZAGA 2EIMC 3RVXC 1F4HA 2B1AL 3UG5A 4GUPB 4KTDH 1ET7A 1ZTEA 1YN7B 4ONGL 3BKYH 1ADWA 2R15A 4HIJA 1QPKA 2Q8BH 4JG1H 2NNXA 4N2KA 5F1NA 1BW8A 1CD1B 2Z9TA 4IMLB 4ONGH 4KTEL 2JIZG 4X5QA 2CDGB 2VWEC 4R3SB 4RUFA 4WO4C 2B1AH 4PJDB 3US9A 3UEQA 4BKTC 3R8BB 1GKEA 1HX0A 4DRXA 2WSKA 2V2TA 3C5JA 4YMPA 3BE1H 4NERA 5E95B 3TBVA 3ALXA 2J3SA 1RIHH 4UOW1 1ZHKA 1G7MB 4YSDA 4KHXL 1FO0A 4FERA 1INDH 3D09A 3IJYB 1ZCRA 3FQXB 1E7UA 3GLDA 1KBBA 4KWUA 4RISL 3VWKC 4P2RA 3T6QC 1F6AA 1CR9H 1Z5HA 3EYOA 4X6DA 3QWOB 5ABZA 2D03L 3QPXL 4D3CL 3T09A 1T20A 4Y8AA 1BREA 2PPAA 3N1PC 3CCHB 2EZ0C 3WJJC 4A1RA 3CAFA 5DDHA 3QNZA 4NAQA 1T0OA 1KY6A 4X80L 2ZAGA 3RLSA 5FO2A 2NY6B 1KOAA 3BKML 3F58L 3NPSB 3FB7C 1KIRB 4H44C 4LLUB 4CNIA 3DPDA 2VMFA 5E94A 5I6PA 1KWGA 5D7LA 3QFJD 3V95A 5I1IL 2DTMH 5KVFL 4AZ8A 4HG4J 2X4NB 4FFYL 2FYUH 1GRJA 1H0DA 3AXHA 4XX1E 4DV5B 4Y4HB 5LBQA 3FUIA 7FABL 2IWGA 3WU1A 4F7TB 1J8RA 4GUOA 1NFIA 3T8MA 4YWGL 5I74B 1TMQA 3ORJA 3U4BL 3QRBA 1CK0L 3SGEH 3TH2T 2CH8A 4XMZA 3V4VH 4QTHB 4PVLA 2L35A 2ZOUA 4EFBA 4PDMA 4MNQD 4IT5A 4ODBD 1RZJH 1PNMA 1HE8A 3FMGH 3IE4A 4APXA 1UA7A 3SE4A 4Z7IA 1VZHA 1WZMA 4ZXBB 2Q0OC 3S96A 3UC2A 4GG6A 1MCIA 4FZ8L 4AIXA 1ZL8B 2HRHA 1CVRA 3QUZA 3ZRSA 5EZOL 3VXQA 2YUZA 2G5UA 1X59A 3B4NA 3T0BA 2EDDA 1QBZA 4AT6B 2CLVB 4ZSOA 2OZNA 3RYFB 3BN9C 2FX8H 2QV2A 1SRYA 5GW7A 5FO8B 3DBXB 5HDBF 3LKSB 1VADB 4X7EC 5TQ2L 3MRHA 2VRAA 3WG7C 1XF3A 4PJXF 1S7QA 4UZGA 5GRJL 4UFZA 3MMEB 2P47B 4M7ZB 4G59C 2QKAA 4P9HC 4EDWH 3QG7L 3U0WL 4YSEA 2A3QA 5DZJA 5I1DB 3SJVE 1VFMA 4EPSA 3GUTA 3FTYA 3MODH 1G7HB 4LF6O 3ZHVA 3I6KB 5F9OH 3KPMB 4MQXD 4B5ZA 3OPZL 4OV5A 1JF1B 2YPLE 3F85A 3QIUA 2QDVA 1R3IH 3O2WL 4FHKA 3W7SA 2UXBB 4PMEA 3UERA 2J20A 2W94A 3V5KB 5EU6A 3WLBB 3T1YB 5B1BB 3KPRA 3GTTA 2YQ3A 4WTQA 2Q10A 4JTAB 3AABA 2N04A 4ZUVA 3EIFA 2WPDG 5L8LB 1UWGH 3SBQA 5BRZB 1UZ6E 1G6RH 3POCA 1OP5K 1J5CA 3TIEB 4X89A 2RCVA 3VFSB 4M9OA 1K5NA 3KCXA 1UJ3C 3QNYB 1BDYA 5CM1A 3FHEA 4G1EB 3VWJD 4L3CB 3RWJB 5IM7A 2XTSA 2YIDA 2GBVA 1BVLA 4DP2X 2DQGH 4LSRH 3ZN1A 1N5YL 1R5IB 2PMZA 4JFZH 3NCBB 3SKJH 1DVXA 1G0YR 1SHXA 1QLEL 1ASOA 1E4WL 1FL3A 2J8UB 1INEH 4X0KB 4X6CA 1ODUA 2HXAA 3MLWH 2VM9A 2V5RA 5IJKC 4JFYA 4F33A 1S5LZ 5D7JD 1WEJH 4ZD3H 4N87A 5DJ0A 4GG6E 2IG2H 3STZC 1HDMA 2IMNA 5IYZA 4EO5A 4LLQA 2V5MA 2VC2H 3MNVB 3QPQD 1PZ5A 4KXZI 3VSUA 3Q2VA 4L3FA 3WS3B 2H8PB 1L0QA 4ZMQA 1FF5A 2VQFO 2FQFA 2DIEA 3ZE0B 2W81C 3V4UH 1DLBA 4NCDA 5FYLE 3TA3B 4I0XA 4G7QB 1CC3A 4N26A 5AW2B 3B5HA 4E41B 2YAFA 5E5MA 1TVBA 4TVPH 4TQFA 3FO9B 4LT7A 2QADC 4YJ2A 5AW9B 2E8YA 4JO8A 1EK3A 2DAVA 2PF4E 1FYJA 3UCRA 2PCFB 4AITA 1EEUA 5F0MB 5HYSA 1BZ9A 3F04A 3RTLA 2Z31A 1V3KA 2C34A 4ODHL 4UQCA 1J9RA 3VYPA 3PAVA 2GT9B 3FFDA 2ICEA 1R3JB 3WKPA 1AXTL 1J95A 3C3TA 1YPZB 3GBNL 4Z7VF 2WWMC 3SPVB 2R9IA 4TOIA 4YEFA 4BUHA 3A0HZ 2GYSA 2YKKA 1GZQB 1JPFA 1YMMD 4X8XA 3P73A 3X17A 3TJEH 2P5ED 2ARJA 3CSTA 1NKGA 3U1SL 3G9VA 1QEWA 4FEIA 2XN9A 3J2PA 3OHXC 3QJTB 4F7MB 4AEIH 4AYBA 5E4EB 1Y74A 1BMGA 5JHLH 3LNMB 5KX5B 2Q76B 2SODB 4QHKI 1EEZA 1BBDL 1PQZB 3B37A 3ESNA 4FCAA 4LHQB 4UQ2A 4I18C 1J0JA 5CLTA 2YAOA 5SWZB 3I02B 3I3DA 2RBLA 3L3KA 4P2YA 4WFHE 2E46A 1MREL 2GK0A 2CRIA 2Q0ZX 3FRPB 4P4RA 4WHYH 4CDGC 3CSFA 4BCXA 5FYJE 3ARFD 3REWA 3K6FA 3ZKXC 1DQQA 4JHAH 2P6JA 4RGMC 3QI9D 3DIDA 1CI5A 1QTPA 1I1AD 3MGTA 3MRPB 4J2XA 2OR7A 1IIIA 3HNTH 4IBSA 5I6KA 1QFWI 4IM8A 3VXMA 4EN3C 1R3JC 4AY0A 5IW1A 3C09C 3AS3A 1JGVL 1WZLA 5C0BA 5J13B 5HGHB 4OZIF 2JIXB 2QTOA 2BY0A 3QK0A 2NSQA 4HS6B 4OFPA 2ALWA 3BW9B 3KCPB 1PNCA 4K23L 1KEGH 2GTWB 1MLBA 3V4PB 3A5VA 2IOMA 4DGVL 4ZFZB 2NLJA 3NDZE 5F9AC 4AVHA 3VM7A 1HCYA 1RUML 1UD8A 2XBDA 1U4EA 5E9NA 2BVYA 3E8FA 1P5VB 1DVTA 4CVUA 5EYPB 4NTYA 3JCZA 3T4YB 3BKCL 1HWWA 1C1EL 1MF2L 2FO1A 5HGBB 3LJ3A 5AB0A 4BZ1A 4C83B 43CAA 3K80A 4PJHF 4H33A 4HJGA 1AZNA 3SYAA 5B38G 1G9NH 2L7JA 2XI9A 3HS0A 1UM6L 4PCSA 5GGTH 4ETQB 1TEYA 1X7SA 4YAQB 2UVEA 2HH0L 3IJHA 1CU4L 2I24N 5F8RC 4QRPB 2FK9A 3CK0H 3QC6X 1XB3A 4TRPL 5EU5B 1WFMA 4YGVB 5CA0A 1P4BL 2DZEA 5LMNB 1JF5A 3CN4A 2AQTA 3CFBA 1J5EB 4ZQKB 3G67A 2PP8A 1HHJB 4HK3J 2VABB 2VDRH 4DZ8B 3NJJA 4AEHL 3LSOB 1AJNA 4R97B 4DR5O 2IDFA 2ZOKB 1P9MC 3LNIA 4KK5C 4ZXBC 2OJZL 1F2XK 3BIBX 1RFDL 1GY1A 5A43C 4M5SA 1NKDA 3V0DA 4F6RB 1M71B 5GGSB 2ADFL 3PL6A 1YQVL 4ISVA 2ZDIC 5IK3A 5E23A 2E74C 2GAZB 2EDTA 3WUWG 4JHAL 4JAUA 5E2JA 5C09D 2AZAA 5IHHA 1FORL 4PRHA 1WBZA 3WUWA 5A2BA 4F93B 2BSBA 5M7QA 4ZAKA 4RQEA 5F2VO 3BP5B 3MCKB 1NAKL 3P0GB 4HEME 4NT6B 1UYWL 2YQGA 3RPIA 4PJ9D 2VXSL 3A6CH 5F1OB 5EOQH 1TPXC 3EFOA 5KZCD 2ZX5A 1Q0EA 2FLBT 4NKDB 1FYTD 1L9TA 4F2MA 4G6KL 3I50L 1U96A 2NNAA 2G60H 3SYCA 5IW6B 2CUMA 3BP5A 1TETL 3MCKA 1OGAE 1TVHB 2ARHA 3HZVA 3WUWB 2A6JA 4WWOA 1RZJC 4TUOA 2C9VA 3P9MB 5DN6G 3O9WC 3CX5J 3UDWA 2FMLA 4IHOA 1FWXA 3TJEL 4XPGH 4BKSC 5CINL 2VISB 1U3HC 1QQDA 4PJFE 3WL9A 2YBRA 3THMH 1X5HA 3GSUA 2ZNIA 3MN8A 4JO4L 3MJ9H 4L9LA 3PQYA 2GHWB 1RZGA 3D0LB 3UC0L 3S5LA 3APQA 2RN9A 2W5PA 5F93C 4OCXL 3DVGA 4Z7QB 4YE4H 1KTDA 2YA1A 3L7FA 1N70A 1K97A 4HZ1A 4QOKE 2UZXA 1FXHA 4MVZA 1KC8W 5EU5A 1HCVA 4F8PA 4H8WH 4PGZA 3LPWA 3HE6A 2W9LA 4N5UA 5B8CA 5A16A 3DJ9A 3INUL 4S1RL 5AW0B 5D1XB 3IAGC 4KXZH 1CLZL 1WAAE 4JAVA 2D7MA 4G3YL 4PREB 1N7MH 1K8DB 1XZ0B 4JJ5A 4KJWC 3V4UL 2J1YA 1FP5A 5DD0H 3AWEA 4QKTA 3DXRB 1SF3A 3HBGA 1WFNA 4G8IB 4N2DA 5E1AB 2AK4E 4CSZA 4DV1B 5I1JL 4XP1L 5DUPH 3VD9A 3MV01 4LASH 3O0RH 4PCTA 4BEIA 3ETBF 2QSCL 4M62H 2BVUA 3NA9L 4UTAA 4D8OA 3F62A 2ERJC 1NEZG 4J3UA 4LF3B 3SGDI 1Q0XL 2ZCZA 1IEBA 3PQYE 3O6ML 1FFQA 2QFPA 3DI2B 2CUAA 4MLSA 1FYHB 4X4KA 4JKKA 1KZQA 2KKQA 2VDOH 5DHYB 5JO5B 4DGUA 5BQDA 5C0BB 3S34H 3KPOB 2FZ3B 3S37L 3JUZA 4AK1A 4NRZA 3ZYZA 1BQSA 4Z7UF 4PBXA 5CZVL 2KDGA 1F41A 5EZIL 4Q20A 2WPGA 4MB3A 2VOTA 4YVNA 2APXA 1OARL 3FCUB 4DVBA 3QAZB 2F19H 1Z5WA 1N8ZB 1IM3B 1HXKA 3BO8B 1GOHA 2F1EA 4AMWA 2XN9D 1O6VA 1IVTA 3H9VA 5GSVA 3LB6D 4J3OG 2EILC 3CVBA 2GTQA 1FL5A 1YYCA 1S9YA 1UD4A 3CFCL 3MLSL 1ZLDA 4MNQB 4PGCA 5EO0A 4WI8A 1AROP 5HDRA 2MOQA 4UVBA 1WA0X 3BJ91 1RP9A 2EH8H 2N05A 1XGPB 2XQYK 4P2CG 1NGYA 4PBDA 4MNHB 1E2WA 4G9DA 4RAUA 4XHJD 4YDMA 5AVUB 4MCZB 4RIRA 2FCBA 2F58H 1MW0A 4ORZC 3MODL 3NJNA 2R2CA 4IMKC 4X1KA 1F1AA 2YPLA 4U05A 3UPCA 1TITA 3OZKA 3HKDA 2JKSA 1FHNA 5HGDA 3TVMB 1T7YA 3IWVA 2VGLM 1ZJAA 4NB5A 2XTJD 5IVOA 3ASWA 2VO5A 2X4QB 3QUZC 3E35A 2X7LB 4OJFH 1K7DA 1XCQA 1R3JA 2GT9A 1IGMH 5AWNH 5JUEL 3B43A 5KS9E 4RGNB 1O7DE 1UD2A 4MQ7B 1UC6A 3POHA 2ZUQC 3QJHA 4FJ6A 2Z31B 1P5UA 5KMGB 3I85A 4XO9A 3IJSA 3KPLB 5KWYC 1GOGA 3NJMA 4HPYH 3TZVB 2FEEI 3GVMA 5L0QC 3L3HA 4HIXL 4NYKA 2CBTA 4NNYB 1IM9D 3ZHSA 1QACA 3QWNA 4XRCA 5DC0A 3VFWA 4M7JL 1EFXB 1N0XL 2GI7A 4AG4L 4TQEH 4NJAH 2DB8A 2P67A 3L45A 2OYQA 2Y6SC 3QAZC 1WT5A 4R84A 3RG1C 3TYFA 4B97A 2H8PA 2ZXAA 3ARDD 3QXVA 3DETD 4Z0XA 3RVWD 5C0CB 5BS0B 2EVJA 1WBYB 3BVUA 3WIHA 4I48B 2V7HB 3VI3F 3TT1L 1F8TH 2BNRB 1A6TA 2OMWB 3FS9A 5LAXB 3VFMA 7FABH 5HVHB 4UQ3A 2DYSB 4F37F 4YLQT 3BHBA 1NEUA 1VPOL 5EOTB 2VQ4A 3CYOA 5L3EA 1T80A 3II1A 4UUJB 5C3TA 5D93C 2ID5A 1FL3B 2J8UA 4FC3E 3RNKA 4JFWA 3OLGA 2D31A 1KJMA 5ISZE 1A6WH 4UDUA 1IGFL 2YD6A 4UT6L 5JXAH 1R5IA 3VDAA 3BUTA 4QRBA 2JTDA 2UUAB 4IBQA 5F6IB 3CFEB 3CRAA 2OYLA 3KLHD 1RSYA 1HT6A 1SNRA 3OLIA 4HSQA 3MD0A 1D5ZA 3ECBB 5BUGA 4HZLB 2V7NB 1MHHA 4RVBA 3VFNA 2E4FA 3L16A 5A2AA 1YDPA 3EJCA 4KDVA 3H3BC 4MXWL 4K9EC 3QPXH 3VQWA 2H32B 4X8JA 4C4KO 5AAPA 5J6SA 1FLRH 1OD9A 3QZNA 3TXSA 1E3ZA 3KBEA 4PJ9A 3ETTA 4J3TA 3IAPA 3K3QA 1QRNA 2R1YA 3W0WB 5CJQL 4PJXA 5HHMB 1KJVB 2GJZB 3UBXA 2E7CA 5CR1A 2X70B 3NZHL 3SCMD 3QIUB 1KNOB 3RYIA 2B1HL 3CRCA 4X5PA 4F1ZA 2CJSA 2DQDL 1A6ZA 4JN2A 1LDPH 1TYJA 4J8RB 2B2XH 5EBWA 4MVUA 3GUTB 3DJRA 2BMKB 5F6IC 4KNQA 3FB6B 4PJEA 4Y4FD 3BKYL 5FV1L 5KYXA 1HNGA 3F12B 3L1EA 5SX4H 3CHXA 4XDJA 1NCHA 1Q8MA 2ED7A 3MJWA 5FS5A 3OZLA 1VEOA 4J10A 1BZDA 1WFUA 2QQKL 1WB8A 3NP4A 2PPCA 3JXAA 3MRBA 2J44A 4URKA 1S78D 3JVGC 3NYKA 1PBYA 3Q6FA 1M4UA 1ZT4A 3ATBA 1ZLWK 4GRWE 2DM3A 2F5AH 1M42A 2CIKB 3Q3GA 4XNDA 2FQDA 5BY1A 4ZI8A 3WE6A 4P23A 4HC1H 4BGDA 2OIGA 4EN3B 3E9UA 4WW2F 1JRHI 3R8QA 3WMSA 2OA9A 2YXWA 3VFRB 4I0CC 4IEFB 3HN3A 1PZAA 1ETB1 1QLRA 2VC2B 4JFPA 1FRGL 4X6CF 1E65A 2BNQE 1PZCA 3PABB 5KYYB 3IDYB 4J27A 4JHWH 2AMUA 1PV0A 2FBJH 1T5XB 4R7DA 15C8H 3GJEA 4OGQC 3KAAA 3GFUA 1XOUA 3L5IA 3CQQA 5EPMA 2AQ1A 1H3WM 4WCYL 5KOMC 1ZVNA 2W0FA 3DO7A 1ZEAL 5CEXA 3MLZH 4EIUA 1HNZB 2IGTA 5T5FL 3DRQA 1OWWA 3HC3L 3RGHA 1LEIB 1DEDA 1ZVHA 4RAVB 4BZ1H 2IGFH 2VN7A 4TV9B 1BQUA 4NO0A 1MNUL 1DTOA 4XC3L 3N0AA 2YGNA 3HZMA 3SYPA 3SHSA 4AW4A 4B9YA 3O81A 2YC0A 3BWUF 3FU8A 3KPPA 4XMLL 2W0FB 1MCDA 2VKXA 3LHPL 3C8HA 1CS6A 4YFDB 5TF0A 2A9BA 3MV8D 3U2SA 4G80A 4YSPA 3ROOA 4TT3G 1NLBL 2X4PA 3F5WA 4MRBA 3BEVB 3UYPB 4DJMA 2KZWA 3FQXA 1KIUB 1ZLVH 4UTCA 3KWTA 4OQTH 4R96A 1XF4A 4PJ5B 3Q9QA 4Q9QL 1B88A 3F05A 5IHLB 1D7DA 3LB6C 5D2LE 3SDCA 2F7QA 5IMOB 4ATWA 1RD6A 3KWUA 5FIEA 2QELA 1G7JB 3VFGH 1EZLA 1IGJB 4IMLA 2HRPH 2R70A 5EBMA 4EZMA 1MCWM 1MCPH 5F1NB 4PRIB 3VFRA 1M7IB 5I1HH 3HNSL 4HV8B 1BSMA 4H1LG 4GKLA 1YN7A 4OFYD 3LRHA 5C7XH 2R0LH 4E2OA 3T2OA 4AUYA 5IYCO 2HX7A 2MCG1 3LMJL 4J3BA 5KS9A 1MOFA 2CGOA 4DGIH 1FDLH 1QD0A 4LLYB 5CD3B 1AD9B 1MIEH 4N4YB 1OP4A 2KZBA 4Z95L 2VUKA 5IESL 2CTRA 4Z5RB 3MACH 3KLAB 3NABH 4N85A 1EAPB 4KI5F 3TBBA 4C56E 4WO0A 3W82A 3MV9A 1JXJA 1J9TA 5FK9B 4OPHA 3IFLH 4DTGL 3L72H 1WD8A 3SPHA 2E5LO 4ZOAA 5E6IB 4HEPA 3BZFB 4HFUL 5DS1A 2H1PH 3U7WL 3P11L 1YPZE 3I84A 4V2BA 4P04A 4BZ2H 1HESA 2EZPA 1MCPL 3MVSA 3GS0A 4J8RA 4JFHD 2BY3A 2CGNA 5D1XC 3WXWH 4LPXA 1MZEA 1ZLVK 1BYNA 3MJ9A 5H9CA 3RYIB 5CB4B 2IH3B 4FZEH 3GMRB 3WNPA 2DQUL 1JMZA 4A66A 5LP6A 1JWSB 2C26A 1A4AA 3HCVA 3TV3H 3MV7D 4OLUH 1BCCH 4OQTL 4HAMA 2AEQL 2XNAA 4E4EA 4F80A 4IBYA 1QRND 4C4BA 1BVNP 2B4CH 1YEIL 3O65A 4UMSA 3WHXB 2JGUA 3O9WA 2DKUA 3UDWC 2WY3B 4TSFG 3ECBA 1I4FB 4ODUA 2AEIT 2CO7B 5DXWA 4DN3L 5I71C 1LE5A 1WWAX 1WS8A 3DYMA 3SDDD 4F91B 2TSBA 3OTOB 4PV1B 4CH6A 4ANUA 1PJWA 3CHRA 4ZNEE 2JVDA 3LEXB 4HNAB 4M7ZC 1N4CA 5F7MC 2EIEA 3ZRFC 2P48B 1KJMB 3WG7B 2IDSA 3C5ZA 3LIZA 1T5KA 3TA4D 3HC0A 4BWTA 3PHOA 3EDEA 1ROWA 4HX1A 1AR1D 5EOTA 3B9VA 1BAFH 5C0NC 1W8NA 3MNZB 5I1LA 1UH2A 1TEFA 3IS1X 4HUCA 1VQLV 4IJ3B 4MJID 2Y69B 4LLWA 4Y4KB 5GPRA 4A7QA 5DJAB 2FSDA 1UKSA 1ZD6A 4QYOB 2X1QA 5I19H 5BQ7B 4L2LA 1RP3B 4P5MA 5E51A 3T2QA 4R0LB 3L7EB 3GXFA 2IWKA 1NVPD 4HIHA 4HK0B 5DTFA 1YDXA 5IVXF 1BQHG 3ULVC 5J1SC 2QQLH 5TDPB 2KKWA 1CXKA 4W4OC 2Y7QA 1EFXA 1TTAA 3P4MA 5SWSA 5HHNA 4YDLC 3HI5H 5KAQF 3BP7B 4XO5A 3FT4B 3H7BB 1S5HB 1XD1A 1AP6A 1F4WH 5KAFZ 1MVUA 2DEWX 3E6FB 5IKCA 4P9HH 5E9DA 2VDPL 2CAKA 3FH8A 4P2RE 5BVJA 2PWEA 1NUDA 3SJQC 3D07A 3QFJE 1EZSA 2BVPB 4JYAB 5L3DA 1BZ8A 1JTOA 2XSKA 3BOVA 3B7UX 4HS3B 4IMKA 4MCMA 3TN0C 5EZYB 2YJLA 1FN4B 4E9YA 2HTLC 3A67L 4N25A 4PEEA 4UIMB 4ZMTA 4J9ZB 1DJSA 4I2XB 5F3BA 4RDQG 5CP3A 2EE6A 5D5QA 4Y4KC 4RQFA 4ZOLB 3BWSA 4ONHA 4OZHA 1KB3A 5B7MA 3LN5B 4Y5XA 1JNHB 2O6EA 3L3JA 5L2KB 4KJWD 4H2AA 1KB9K 1J0ZA 2XV2A 4MKMA 5FHBH 2YPKB 4Q9BA 2B08A 4X7TB 2ZXDA 3BIAX 3FUJA 4G6JL 1FL5B 5EU7C 3VWKB 3UJTH 1OQOA 2UXDB 3R18A 4PJ8D 1QLFB 4UTAL 5B39B 1SZXA 5D7IE 3D69B 3BSZA 4IIQB 3BO8A 4ZPVA 1S7XA 1IAKA 5JQGA 3GI9H 4W6XB 2WNGA 2W0XA 4JGUA 2BP3A 4WO4B 2VDNB 4Q2ZB 4U1GB 4GAAA 4IU3B 4G7VL 5H4YA 3T0EC 1TJGL 2HSIA 1U2YA 2ZE7A 2EIZB 4PJGF 3B83A 4QRRD 3VD7A 4N9GA 5ILTH 1B3QA 4PM1A 3H2PA 4UT6H 2BPBA 3SBRA 3LQAC 2V3DA 4B60A 2RQEA 3NJFA 3T0DA 1P1ZB 3APDA 4ENEC 4XXDA 1M56B 1OT4A 2CLZB 3LKQA 4M6NL 3E8HA 4WI7A 3P40A 4O2CB 4YUEL 3UBXG 3WLWC 5B38A 4XR8C 1P7KB 3RZCA 4NZJA 4OZGA 5IWAO 1RIVH 3H9SD 2VT0A 1U8NB 3MXWL 3MLRH 3OHXB 1ZS8B 5EFIB 4LLVA 4RWHA 1GL4B 5E99L 4KP4A 1ZDSA 4HMDA 5BXFA 4BQ9A 4DK3A 4HKXB 2WLYA 3WJLC 3BUPA 4RUEA 4RFEA 5CR8A 3OMAB 5HYJE 1XZ0A 3CDCA 3ASNB 3PHQB 4Y19D 3WTTA 3L4VA 3GIVB 4P3DA 5CILH 1DUYB 3JAWB 4TTGA 1N0XH 2E75B 1ZE3C 3CUPA 4YHNA 5FWRA 5I1EH 1JVLA 4L29B 4U0RC 4U1JA 5F7DB 5HI3D 1QWHA 2W80C 1A1MB 4IYIA 3SGJA 2Z0BA 3CIQA 3MR9A 1V9PA 5D6CB 2G5RA 3RA7L 1JWUB 1D5IL 1QFOA 1MWAL 1NPJA 4LKXB 3BX7C 1SYSB 2QADB 4KK5D 3F7LA 2LHAA 4ZXBD 4HZAA 3S5LB 1ORSB 1R6KA 2CHXA 4NQCB 2ITDC 4HWZB 2C9UA 3PWPB 3QJRB 4TF4A 2R7EB 5JZ7D 4ZFOB 3QUKB 1KC5H 5C0EA 1S7WA 5DR5L 5C0BE 3O6KH 4DO5A 3TNMA 5HTSA 2VXTL 4MS8D 3C5SA 3UTPD 2EJRA 1G6VK 4KVPA 1YVWA 4XE5B 2Q2EB 3L4CA 4BCZA 2NXZD 4EE2A 5AG9A 4ODTL 1OCCC 2NY0D 3DSQA 3FL7A 4GSRA 5E4IA 2WAQA 4NTWA 4DO6A 2JV6A 3PWNA 4I4WB 4JKPH 1DO5A 3DGGB 4KU1A 4NC1E 4FHJA 3BXNB 5IW6A 4XTRD 3TFBA 3H4HA 1OE3A 1R34A 3E8UH 4PJHE 4QXTA 3PNWA 4UB0H 5J7CC 4F8NA 2EYSA 2CWRA 2J6EA 3CCRV 1KCVH 1UENA 3MHZA 1RMFH 4MNQE 1R5WB 2E27H 3E6HB 4XGZB 4DEWA 5DQJB 5LO7A 5GS1A 1TLKA 2CR3A 1EHNA 1Q81W 3OMIB 3KLKA 1JXGA 1M6OA 1FVEA 2FSEA 3I5DA 3CSYB 1VGEH 3ULSB 1ITBB 1JYXA 3LQMA 4G70B 3VXRA 4LAJH 2FNBA 3H2QA 5TGBA 5D96B 3RWIB 5LHHA 3E22A 2O5YL 1XAUA 3P2DA 5JDSB 1XEDA 4J3WA 1YLBB 1SYSA 3SKUD 1PZUB 2KBGA 4B7EA 5B1BC 2VABA 4DZ8A 4A7UA 3O6MH 2G4GA 2EE9A 3CJJA 3MR9B 2VDLL 5LBSH 1C12A 1XO8A 2X4TB 1CGWA 4HHAA 4RAIA 4YGVA 4H44B 3SJAC 2DYSC 4L29A 2F68X 3U7YL 1IGCL 4NWTL 2NY6C 3DHJA 3NGBC 4KJYA 1E28B 4WKZA 5HJ3A 4CVWA 2YSSA 5ESVB 2OT5A 1OM3L 1XB6A 3BZ4B 1B4JH 5FL7G 5JLZB 3RVZA 2C1OA 4XBPB 4A6YB 3G6BA 4GSDL 2KC0A 3PHQA 1G84A 4OZ4B 3ZYIA 3KCYA 2X0UA 5DHMC 2N74A 4YXWG 3FYIB 2AJVL 3GSWA 3T4YA 4YXKH 3HG1A 4QRTA 3UBGA 4D0CA 3VX0A 4LF8B 3FXIC 2HA1A 2HFGH 3OHXA 4F8LA 1KJ3H 3ZZ1A 5DMJB 1OGPA 2NT0A 1U3JA 4KAQL 3EYFA 2ZWKA 4OZFG 5F6HJ 5GS0C 4DAGH 4IBUA 1TZGH 2OX5A 4L9DA 2MQ0A 3B5TA 3MRQA 5BO1L 1JYVA 3NSJA 3SY6A 4MZIA 4XXDB 1X5GA 4N0FB 5JOPE 1CEZA 2Z8WC 3VVWA 1EERB 4AHCA 2DQ6A 3ZQWA 1TKWB 4X62O 4JO4H 1J8HA 1IAIH 2VR4A 4QHUB 3QUXB 2PP9A 1PVHA 1CFTA 4MVRA 1XF1A 5GONB 3NH7H 5J2UB 1PFCA 2WANA 2G5BB 5GGUB 1OGAA 4IU3A 4XVJL 5DR5H 4JLRA 1WHPA 3CZNA 4LGSB 3TH4T 4DP4X 2CZNA 1LEKB 1PU0A 2BS8A 5DJYB 1S7XB 3MFFA 4NGHL 3WIIH 3HHSA 3QO7A 4QHPA 1I1FB 1KU9A 4GI6A 4H5SB 1XCWA 2QVFB 1XBLA 4PS4H 4EEEA 5CEZE 3FQTA 3GZOA 4FYRA 3FFQA 1FI8C 5CGBA 3UTTB 2VXSH 1QFWL 3ME0B 4MB1A 3FB7B 2QM8A 4P9ML 3L73H 2PYEB 3DK0A 5FYLD 1CBJA 4CC1A 3C08L 4F7MA 1FORH 2MFNA 3QB7C 4GQPH 4Z3TA 3MTRA 1FL6B 5F3BB 1E8XA 3ULVH 1FFTB 2NX5D 3OKNA 4PD4F 3MRDA 2YRZA 3QXDA 4FLOA 4OGYH 1XGRB 2W6JG 5EO1B 3MU3A 3AT9A 5JA8B 4R26L 1OXYA 5JOFB 1C08A 1IMHC 2XG5A 3WFVA 3QH3B 3QR2A 5AVSB 4TKWA 4HAGA 2Y9RT 3CDZA 1F90H 2BP0A 4AXWB 5GS2D 4KL1A 5AZ2L 4M1GH 4JY4B 5H8DA 3S97C 5C9KA 1OAYH 3SGJC 1RUKL 3M46A 1ROCA 4D8PB 5HYSB 4CVZB 2XAFA 1BVKB 2YN3A 2PCFA 2ZUQB 3KYOB 1CIDA 4GB9A 3BP7A 4Z6AT 1COBA 4WFFD 3SE9H 3WEXB 2P06A 2WQWA 1NCOA 4XCNA 3GMNA 3EYVB 2HYMA 3V0IA 2JIXD 4H7VA 3EHBB 2QPUA 1NZRA 1AG6A 4M6OL 3UL4A 2BHYA 5D71L 2WINA 4W4LA 1CFSB 4GAYB 1AKPA 3O6FD 3BKCH 3IJ8A 2J8OA 4DFIA 3JATA 1WA8A 1TVDA 2UZPA 5C2UB 3OGCC 4UCTA 3K5MA 2FHBA 1MHPL 5CBAA 2ZWZA 4LLWB 3KPNA 3CN1A 5JTWA 3H7LA 2Z31C 3UJTL 3ETBJ 1KTLA 3ZIAG 1J1PL 1O6SB 2XT1B 5KHKA 5J1AB 3VCLA 2WJ7A 1DF4A 3IDNB 3EYSH 4NB7A 4O4LB 1SJEA 3HI1A 1AP2B 4LHUB 4R4FH 3VH8B 3TO4A 1A4JA 4NCC2 4FLXA 2P42B 1YY8A 2VZ1A 1ZLSL 4Q58C 3VD3A 5DEGB 3KNBA 2C1PB 2LABA 3M99B 4AYFB 2Q4PA 4YPGA 5DYOA 4EIZC 3V0JA 2H26B 1YNTB 3KYNB 5IBLC 3WNLA 4IHJA 3QJVB 2B14A 2WYZA 3UP6A 3G04A 3QEQA 5EC1C 4Z1MG 1O7VA 1W8OA 1CDBA 4OV6F 4UUJC 1EZJA 4ZUWB 4W9FC 5LYJA 3SDAA 5J0BA 1MELA 4GAGL 4CMMB 1S9KC 1ZT1A 4B50A 5C9JA 3QCUH 4JHUA 3V5KA 1TUBA 4S0TD 5DJXA 1Z9MA 2QQQA 1A6VH 1H3XA 1IAMA 2QLYA 3COOA 2FATL 2FDBP 3L1GA 2R1XA 2VSMB 3M07A 4JFED 5KANG 1JHLH 1UEYA 1G7HA 1UWXH 3CLFL 1XF2B 3ZDXF 2VLJD 4G6MH 2PR4L 3S3BB 4R5VA 4NQSA 3U0PB 5I19L 1FA4A 1TF4A 3BH9A 3IPBA 1OAZH 5C86A 4UCFA 5TD4A 1AR4A 5KANI 2PW2B 3F7KA 2AABH 3TTYA 3W7TA 1FZKA 3Q2CA 3CSXA 4LCWB 4S11A 2YIBA 1VFUA 4QLWA 3K8LA 4ONOA 1M56C 2VZTA 3O2VH 4YXLL 3TC9A 1A3LL 1UB6A 2ZCEA 3OX8A 2QWPB 1UWFA 4NCC1 3RWFA 4F9LA 2YAHA 4NPYA 4IBTA 5KJ7E 4C56B 3KW8A 2BZDA 3QHFL 3MRNB 3H1LH 2WZ5A 3KPQB 4PRPA 1TZHA 2J21A 2UY7B 5B21A 2NX5A 2Q7NA 2LFSA 4YX2L 3R65A 1MEXH 4CN4A 5DWUH 1SVZA 4BZ2A 1B4RA 2DDQH 1CFQB 5ICYA 1SYVB 1E4KC 5MEPB 1I53A 2G75A 1SA0A 2AEQH 3J8F7 4MMYA 4OZHE 3MGOB 4O2BA 3LKRA 1SN0A 5IQLA 2DQUH 3CDGB 5JXED 2EVGA 4JEGB 2D3JA 4FMFA 2X4OB 2GQHA 4XN9A 3PLYA 1GPOH 3HZMB 3IBEA 4CSPA 2WNKA 3D4YA 4JM2C 5LBSA 5DZVA 1OPGL 3LPFA 1JVKA 2G9KA 5CMAB 3T6WA 4YVUA 1MCQA 3V5DB 3IXAB 4DR4B 4J28A 3CXDL 1WFOA 1SFDA 1U42A 4L1SA 2H1PL 2R0KL 3IFPB 4G43B 1MHEB 2FR4B 4ZAKC 3RILA 4ZUTA 5SWSD 4GKNA 1LO5A 3X2QC 2JCCF 2WYIA 4H8QA 4N2MA 4GSXA 1XGUB 3HG1D 2ESVA 4LH7A 1XCTA 4B3TO 3ARVA 1CCZA 1B3IA 5D7EA 1BEXA 4TUJB 4Y16A 2CO6B 4E5XB 2FIKB 2C9SA 5I1KL 1EDHA 2A1WL 2DYPA 5EBGA 1KYUA 3LDCA 4AM0B 1INQA 2Z3FA 3HG1E 5IOKA 3BPCA 4G1MA 4S10A 2Y0SA 5IB3A 4KKAD 1RM1B 1DFBH 1LMKA 1CD1A 1NLDH 4HCGA 3V0AC 2V33A 4CVXA 1K4DB 2IWFA 1IC7L 3PFUA 1MNNA 1KPUB 1NBCA 2PABA 4CS2A 2I26N 2HRPL 2QMJA 2X5PA 3C5ZD 4GI8A 5EB9A 3V0FA 5KHGA 2Q9LA 2MH4A 4PWHA 5IMMB 3WMQA 1PZ3A 4LOVA 1SETA 5HGGS 1GVIA 1HILB 3H9ZA 2A0LA 3ZGHA 3VA2C 3RUGB 1A1NA 4B5EA 2P28B 4HWBA 4I9WE 5A2LH 4RRPA 5L88H 4LCWA 2Z3YA 2FE0A 1VKXA 4U6YA 3Q6FB 2H6PA 5EZOH 5B22A 1AGFB 4JPWH 2ZJSL 3MRBB 1BM3H 4AKQA 1CMOA 2NY0B 3K08A 3DX7A 1DN2A 1H5BB 1QMUA 4BSJA 3AC0A 4IBWA 1Z1WA 2DWSA 4K3EL 1DL7L 3VXRE 5KTEH 2XIBA 3M17A 1WJ3A 3AW5A 3FKSG 2AK4A 3TCLA 1UT1A 2ZKHH 4N2IA 1HHKA 5H94B 3HPLB 2ITCA 4JFDD 5I8OL 5MEOB 1XF2A 1FVDA 5T5FH 4ABWA 4NP9A 2E86A 1SXCA 1I1AA 5J6HB 4G6AC 3SJVD 3WGUB 3ZDZF 1ZGLB 1OKEA 1X5YA 1S7SA 2AJYH 3QO5A 2YXYA 3RL2B 4FFYH 3MYJB 2NNRA 1MJ7L 5K59F 3TEWA 4NC1C 3CIAA 2Y4TA 3FCBA 3MV9D 1I1RA 3MUGA 3QIBC 5E00B 4XCEB 3QZOA 1M9NA 4PB0L 1HNWB 4OJYA 1MHHB 4OX9O 4WFFA 2J55A 4MRCA 4P59L 2KERA 3SD2A 1BWWA 2P4KA 4IHJB 1CLOH 1IX2A 2I9LB 4D7BA 3U1QA 3JD4A 3T2MA 3VQVA 3RDTB 1KYFA 4KJPC 4AL8H 3B56A 4L3EB 1UJ3B 2BW5A 2H3NA 5IR1A 4DN4H 2X0LA 5I17A 4QXWA 2EEFA 4MA8L 1W0WB 1AC0A 4F6EA 2D03H 5AOMA 5AYQA 4D3CH 3WTVA 2F5AL 1LK3H 5EUOB 1A4JB 4Y5VA 5SWZD 2ZD0A 4BSVB 2ZAIA 4D0BA 5CA3A 5EV7A 3Q1EA 4UUJA 3WY3A 3SDDA 3U2IA 4GXVH 4MLIA 3LRMA 4H8VA 4NQED 4I55B 1OCCB 3L3GB 1HQRB 3GRWA 5CUSL 1DBML 4N8PA 4IGBA 2IFFH 5DWPA 4E9RA 3RL1B 3U30B 3VSQA 4PG2C 1J1OH 1DQDH 2ZQKA 3CQFA 1N9PA 3WUZA 3WNIA 4ZFFA 2XPGB 4N9OB 1KB9J 2WTRB 1IBGH 3LIZH 4QRAA 3RVUC 4U1LA 1NBMG 3T0AA 4KTDL 3ECUA 2VR6A 4N90D 1EM1A 1ROPA 2B1HH 3VG9B 1G9MH 1KGXA 4XAKE 1XNRO 2LP7A 3S35L 2AV7A 3CC5B 1UADC 4F7PB 4NKOB 1A64A 3QDAA 3WFBH 2WUCH 1BZQK 2WJ5A 5KMGA 3A23A 5E7BA 2EUVA 3NCJL 4JY4A 3G6AB 4JPKH 4G5ZL 3VXNA 1EDQA 3C09B 1NC2A 1SHMA 1SMDA 3T6VA 3AGVA 3D4ZA 1DSFL 5T1KA 2J8HA 3APCA 4UTBH 2WIIA 3LKOB 4YIOA 2E5LB 1DBKH 3QZWG 3MXVH 4FFVD 1QFPA 2OYMA 2NY4B 4NP4L 2BRRL 3PWPE 1MDAA 4KZDH 3CFKA 4QHKJ 1UJTA 5JR1H 3FONA 2W6IG 2RJMA 4W9KC 1FL6A 5AFAA 3C87A 1SERA 3FO2A 1A6WL 3N91A 5EIBC 4MCZA 1RLWA 1A21A 1V8HA 4RAUB 5ACZB 3Q05A 1ONQA 4ZIBA 2LVEA 1J86A 3V9FA 1EUTA 3B7YA 3AACA 2CGRH 4CSSA 4GP5B 1W0WA 1WRFA 4U6TA 4PJHB 2F54E 3RAJL 3TM6A 3F6JA 4PJIB 2X1OA 3VGAB 4DV7O 2DJUA 3LVEA 4P5KA 4AENA 4X98B 4MTOA 5ICZB 1W2BU 1QBML 4I7ZC 3HC2A 4L4TD 3ZR5A 3OKOB 3NCJH 2FYVA 5M95B 4N6RA 2A6IA 1FUNA 1NCJA 2ZM6B 4PY7A 4JKLA 1QR8A 3QFJA 1FNSL 4NUGH 4N0FA 2IQ9L 5KBMA 5E2TL 4BFIB 4XP6H 3VFVB 5DK0A 3C6EA 2VS0A 5F3FA 2Z8SA 3WKQA 3RIAF 5AVWB 4W9JC 5EZPA 3P3TA 4GBXB 3JTTB 5LA6B 5J6HA 5F0JB 5A7BA 3L4UA 2O5XL 4PLNC 3DXAB 2AHYA 4G2KA 4I50A 4XMPH 2IDUA 4MX7A 4R5TA 5IGXH 3K9SA 3AK2A 3ES6B 3ECWA 3GSWB 2VDKH 3U0WH 4GPVA 4XWGL 5IDJA 1AGBA 1L7TL 1K8DA 1OAJA 2UUCO 4KVCL 4X4ZA 2G2NA 4AQ1B 2ZP0T 8FABB 2ZUWA 4JV5B 4GRMA 2FO4B 1ACXA 1YCSA 3O8XA 5D1XA 1D6VL 3SO3C 1SN5A 5TISZ 2RIKA 2VITA 3CG8A 5EZJA 2FUTA 3RNQA 4BA8A 2EYRA 1I8MB 2H6PB 2KQMA 1ORQA 4PJCA 3ZRCC 3MRKA 3NSXA 4I88A 4GUQA 2LU4A 4K3AA 3AAZB 4AL8L 3NRPA 5FF6B 1X6LA 2P5WE 2QHRH 2AQ2A 3FQRA 2QR4A 4TV8A 2R69L 4HGKC 5KHIA 2X1PA 3ETEA 4BFBD 1HK6A 2YBRB 2KL6A 3T4AC 4I87A 4MMZA 1T66C 1HNXO 1OARH 4JO3L 2Q8AL 3GTNA 5HPMB 4HISA 1RM1C 3OKKA 4LEXL 2IDTA 5E6IC 4HFWB 2B1IA 4PJEE 4LPCA 1ES0A 4I3SL 2W8CA 3REVA 3ZHFA 4DKEH 3U6RB 1M6OB 4Z7AA 4KQ4H 3WXVL 2L8AA 3K1DA 2WVTA 4UOZA 4FK5C 5DQJA 1TVHA 4E5XA 1DJIA 3LNEA 4X6DF 5F3HA 3HR5B 3UO1L 5JIIA 1MQKL 3C5ZC 1WIPA 3H0TB 3KJ4C 5F96L 4Y8DC 5FM4A 2E3VA 5KBDA 1XCTB 2Y24A 2E7LA 1PD3A 2ZCHH 1RIUL 1E8YA 1M1XA 3ZHRA 3UT5B 3CCLV 2Q1EA 4H4NA 4AV5A 2J5WA 1XR9B 2XXCB 4OLWH 5MENA 4BWUA 4A6YH 3HR5A 5HVHC 4P2RD 4AQYB 2JEXA 4WAFA 3JARB 5L2JB 1WBZB 2AXGA 3N40F 1BXXA 2QVMA 5DF0A 5I71B 3VXSD 4FMVA 4IOFD 5E2WH 3CPLA 1PX4A 1WVZA 3WELA 5FOBB 5MERA 2UU9B 2X4OA 4ZFOA 1NICA 4LWSA 2Y5TA 1U8LB 3QZMA 1KGCD 1VIWA 4H8WL 4N3UA 2V6HA 2IANA 1M7DA 3RPBA 2IU3A 3S5YA 3RFZC 4L8JA 4K5PA 1S7RA 2WSSG 3SDCC 3ABLC 1NMAH 3WS6C 2W0FC 1JOIA 2XC8A 1X5IA 2JTYA 4HG4K 4HKJA 2UUAO 2Z1KA 2ADQB 2B39A 3OTTA 3WN5B 1QUNA 4JZNA 3GIVA 4P3DB 2A1WH 8FABA 1MCRA 3FN9A 5E1IA 4UOJA 4C83A 5IJDC 2FB4H 5LAPA 4RMWA 2EULA 3B2VL 1RY7B 3HMXL 4HKXA 2XTJB 4Z23A 4B3RO 4GMTH 5E0QA 5CSZA 2G3MA 3K71B 1USQA 5EFIA 4E9LA 1MG1A 2Z93B 1QWUA 3IDGA 4JUSA 3D39D 1IGTA 4RWYH 1MXGA 5D7LE 4NWUL 4QHNA 1KTJA 3VFVA 4LBEA 1IL1A 2FJUB 5ETUB 3BIKA 4GG8A 3SBWC 4JQIA 4QOKD 5I2IA 1JZEA 2AGJH 3ATEA 1GGCL 1Y18A 2UWEE 4V1DD 3UZVA 3VXMB 1TJMA 2R9AA 1CD0A 1RJLB 2ADIB 1X5ZA 4K2UL 1XDCA 1KF9B 3KJ6H 5ACMA 1EXUA 1YJDC 1IM3D 4JANA 5EIBD 1QNMA 3N2JA 3L2NA 3SQOH 4ZPVB 1TR7A 3ZZSA 1W80A 4PJIA 4IIQA 3BDXA 1JZHA 3N0PB 1TUBB 4KZ0A 5C9JB 3H53A 1PD0A 2QDWA 2CCLA 4G9FD 4ZUWA 3TJPA 2BTOA 1LDSA 3B09A 3DX9B 1G7PA 1PLAA 3NACL 4OUUA 5I6OA 2ORBL 1NDTA 4WWPA 1CU4H 1NFDB 2IANE 5FO9B 1KTRL 1YEDA 4FM0A 1D5XA 5GRVL 5C6PB 1KCUL 3KL5A 5ACLA 1G9NL 4GQZA 4X8AA 4Q6KA 4LU5H 2BFVL 4B41A 3U36A 1O6TA 1GMGA 4YXLH 1IVSA 3WJLA 3CZGA 1MRFL 4N68A 1QR9A 5I6MA 4E68A 3IGKA 2IDQA 4O4YL 5FA3A 1F86A 4LRNL 3N27A 1PIGA 3TO4B 1R6TA 3D3QA 1RUMH 2VAJA 2E76C 2QR0B 3JD0A 3IDXL 4ASUG 1GTOA 4AIZB 4AJYV 5B3NA 4JFEA 1TNMA 4MJ6B 2CTWA 2CDYA 4G6ML 2P44B 4GAJH 3TVMD 4BK4A 4K94C 3CC5A 2AEPH 2HX9A 4ZUUB 4MHHG 4LCWE 2R9RB 4BE5A 3CFJA 3VDBA 2C2AA 1TO4A 2JCCB 1DBJL 4KK6C 3GSNH 3ZMNA 2YUXA 4WI9A 5DTFB 3D85A 1UB5A 2YXFA 2LAAA 1MI5A 5EO9A 1TGOA 1HCZA 2CKBH 3WIHL 4R0LA 5AOJA 3UCQA 4NI6A 4RO2A 4J7RA 3S3SA 5I76A 5KSUA 4HU2A 5EG6C 4LHUG 4L2YA 3MNVA 4X1IA 3GSOA 3CRQA 1MREH 2YXHA 4Z7VA 4GKKB 3LZLA 4BFGA 1O7SA 2XIIA 5DJ0B 4WNQA 2EXWD 5K9QI 1ET5A 1IBFA 3FCSB 1DP0A 1LWJA 4D0BB 2AHIA 3P9LB 4XOBA 5K9OB 5B1NA 3EFFK 2FIRT 3ATAA 3ZHDA 3AROA 3QXAB 4DKDC 3T1WA 3LEXA 1IB5A 2E7HA 3QXDB 2AXHA 1IC1A 2B0SL 1I31A 5HI4C 5MEQB 1RSFA 4M5YL 4AC4A 1V54B 2Z7WA 3S2CA 3BEWA 1JCKA 4PMFA 2G3ZA 3QDGA 5IZ7A 5I6XB 5J89A 3DJTA 3L95A 2UXDO 4XCEA 3D39E 5DEFB 5IB2B 4K5MA 2I07B 4NRXB 4GKJO 1MHPH 2E3CA 2FO8A 3ARDC 3FQTB 1HEJC 5EDSA 1PAMA 2FB4L 2A9AA 2ZG1A 4JB9L 1I1FA 4TLKA 5ELIA 3GM8A 4NIYE 4M6OH 2ZOTA 4EUPH 4POYA 3MFGB 3NUKA 4RWUA 2BY2A 1NU1H 3O45B 4C8XA 2EIBA 1NFKA 1GGTA 2EDRA 2YMTA 2ZUSA 3CX5K 3D3VE 2WHVA 3QHZL 4KKLD 5FYJU 2J6WA 1VERA 1FFXA 3L5WA 1WC7B 2D0HA 4LDLB 3Q7JA 3LSSA 1XIWC 5KG9B 3QUXA 5MEOA 3TCLB 2WYHA 4B0MB 4JM0A 1SEQH 1AQDA 4M1GL 4TXVB 4BV1A 2VMEA 3NMEA 5DK3A 5DQ9A 3DO3A 2OL3L 4BXSV 1N59B 4LMQI 3MRQB 3MI6A 3DURA 3LD8C 3T1FA 4LP5A 1YXBA 4GQQA 1D9KD 1I8IB 3T04D 5IEHB 1Z5VA 3B9DA 4L18A 3GI8L 1VKXB 2OMUA 4PGDA 1JV5B 4ZTPH 4OD2B 4P2AA 2EDWA 1RLBA 3K71A 2YAQA 2A4EA 4TTDC 1HILA 1FQ9C 5FNVA 1JJ2U 4XVTL 1MCEA 2GJ6A 3C08H 4PP2B 2VLRE 5T33H 1KYAA 4GG6B 1HZKA 2P8LB 4OLWL 3Q2WA 2B4CC 1HEHC 5CP7A 3NXSA 1NAMB 1OT1A 2YMOA 4L23A 4A6YA 4QCIA 2E9BA 1R4XA 1C8QA 1PIFA 4N8CH 1HWYA 1DVZA 3ARYA 3A4DA 1IBYA 5B1KA 3WU2Z 4WFHA 1EMTL 3BPCB 3WXVH 5ADPH 4AYMC 5LMNO 3PAYA 4HHAB 1PSKH 1S7RB 4I3SH 2YQBA 2YA0A 4JG5A 4J8QA 5IVNA 3QF7A 3RZCC 3TP4A 4CSTA 1YHQV 3QIWC 2Q8AH 4Z1PA 3V52L 3OAYH 1J8KA 4M61A 1EJ6A 3H42H 2G0KA 1AY1L 5D4QA 4OGAC 4XNXL 4P30A 5EIIB 4C55A 3EHBD 5MERB 3PL6C 3ULSA 2JKTM 5DRNA 5JPMC 2FSEB 4YLCA 4FQCL 5C0JB 3HB3C 4LVOC 5CHNB 5LGUA 4S1QH 1LP9B 5EN3A 3D4GA 3T0ED 5L2JA 1HIML 3ZDZB 3BA9A 5FCUH 3X3GL 1DVSA 1JWMA 2Y06L 3Q8AA 4BFFA 3MJ7B 4NQUA 1KJ3L 5EBLA 1HHIA 3C9NB 5D7IA 2EVHA 5LWYL 3H0TA 1IU1A 3R19A 1K9TA 1FH2A 4NHCH 1QLEB 4KXAA 2VDKL 1EUUA 3DGGA 5F3HB 1PG7L 4MVBC 5T3XD 1SZNA 1U95B 2V8MA 2ITDA 4GSDH 3RX9A 3WDJA 1M90W 5DZNA 4L4VE 3NJXA 4ZOBA 5JJNB 3QDJA 4J1UB 5E8OB 4XPFL 4IEFA 5E4OA 5JW4R 5F7HA 1U8JA 2CNZA 1TZHB 2CBPA 2UY7A 1AJ7H 3L71H 1DVFD 2VDLH 3MRNA 1FNSH 4RETB 4JFEE 3DRTB 3OF6A 4TV8B 5IQOA 3FT9A 4X64B 5IQMA 4ZJ9A 1JK8A 1VGKA 3P30L 4NM8L 1SF9A 5D6CA 1EJFA 3LIUA 3W7UA 2ZKOA 5I1GL 3US0A 1KWKA 2OMVA 4WI3A 4LDCA 2OL3B 5A2KH 1ORQB 4PJCB 5I1IH 3TCUA 1YY9D 1CO1A 3K59A 5DT1L 5IQ9B 2R29H 3D2UD 43C9A 1HP8A 1YAZA 5D2NB 2FO4A 3O8XB 4KRMB 4JREB 4NHUA 5D96C 1N36B 4FQIH 1JX9A 3PRZA 1AGBB 1DR9A 1E5BA 2H94A 3FQ4A 4WHDA 3C60A 1BF8A 3EDJA 2IXQB 1GC1L 2DI7A 2V5TA 2MIZA 3IMUA 3UIYA 1AXSB 1U9KA 4UB0L 3SDXA 1MA1A 1A6UH 1UURA 4RLDA 1ZA3B 2QZQA 4U6HA 2JB6A 4R0LC 2AJ3B 2OR9H 1TYEB 3AEIA 4GSQA 3QYCA 5DC9B 4FDWA 1NTMH 1OV8A 2QGEA 1P7KA 4ZDHA 3EH5B 1N32O 1J5OL 2GJZA 3IRZA 4WSGA 1F7YA 4WWNA 3OFNG 3PHSA 2ZUTA 3W5MA 2CUIA 2WTPA