5KUMA

Crystal structure of inward rectifier kir2.2 k62w mutant in complex with pip2
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
326
structure length
326
Chain Sequence
b'CRNRFVKKNGQCNVEFTNMDDWPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-sensitive inward rectifier potassium channel 12
publication title Structural basis of control of inward rectifier Kir2 channel gating by bulk anionic phospholipids.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 88
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5kumA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 5kumA01
4WFEA 3SJQC 3FB8C 4LCUC 1U4FA 1J95A 1OCRC 4WFHA 2K1EA 1XL6A 4MW3A 3RW0A 1V54C 1OCOC 2GIXA 2WLLB 2Q6AA 2HVJC 4G27B 4MVOA 2HFEC 3AUWB 3PJSK 3LUTB 4GX0A 1ORQC 1OCCC 4GX5A 2WLIB 4MTFA 3E8FA 3SYOA 5B1AC 3SYAA 4PDVA 3K04A 1JVMA 3ASNC 2W0FC 3F7VC 3EFFK 1ZWIC 4LBEC 3E89A 2AHYA 2Q68A 1QLEC 2DYSC 3OUSA 3GB7C 2A0LA 4MVUA 2NLJC 4X8AA 3AG2C 3AGWA 4WFGA 2KB1A 1M57C 3IFXA 1KKDA 2EIMC 1R3KC 4RO2A 2ITCC 2WLJA 2ITDC 3ABLC 2IH1C 4KFMA 3SYQA 1U4EA 1V55C 4MSWC 4P9OA 3ATDA 4WFFA 2A9HA 2DWEC 2DWDC 3K0DA 3KG2A 4OXSA 4R50A 3RVYA 3E8HA 2X6BA 1LNQA 3F7YC 2YEVA 3K03A 4UUJC 4P30A 4MVQA 2IH3C 4ZBMA 3SPGA 4HZ3A 3ATEA 4F4LA 3SYPA 3E86A 3E8GA 4RUEA 2JK5C 3ABKC 4XDJA 3K0GA 4P9PA 5B1BC 1G4YB 3AT8A 2QTOA 5KUMA 5CBGA 2EILC 3AG1C 4JTAB 4R8CA 5EBWC 3ASOC 3LDEA 3T4DA 1BL8A 4BW5A 4R7CA 3BEHA 4X88A 5EBLC 4QE7A 3T4ZA 2QKSA 2X6CA 2X6AA 1R3IC 4JTDB 2AHZA 1K4CC 4PA3A 1OCZC 3FB6C 5EC2C 3SPIA 3ZJZA 4X89A 3K06A 4MVZA 4PA9A 4RAIA 4MW8A 3R65A 2DYRC 3IGAC 1K4DC 2BOBC 2EINC 3F5WC 4XDKA 3T2MA 3WG7C 3ATFA 3VSQA 4PA4A 3SYCA 2ATKC 5EK0A 3K6NA 4MVMA 4H37A 2ZD9A 1R3LC 3E8BA 4JTCB 3ATAA 3AG4C 4PDRA 2Q67A 4PDLA 3X2QC 1XL4A 2WLHA 3STLC 3E83A 3HPLC 3RVZA 4PA7A 4J9YB 2WLLA 3K08A 3OR7C 4MVSA 4EKWA 2HJFC 4XDLA 1R3JC 3TCUA 3FB7C 2WLIA 3STZC 2WLNA 5B3SC 4I9WA 4MVRA 4MTGA 5EC1C 2R9RB 2A79B 3SPHA 5J9PC 4P2ZA 3JYCA 2BOCC 2WLKA 3VOUA 4MS2A 2OCCC 5IY5C 4H33A 4MTOA 4R6ZA 3SPJA 3T1CA 4QNHB 2E4FA 4PDMA 4CBCA 4LP8A 3ATBA 3FB5C 3UM7A 3OR6C 2H8PC 3LNMB 2Y69C 3AG3C 4PA6A 3RBZA 5CBFA 4DXWA 3AT9A 3OGCC 5E1AC 2EIJC 3LDCA 3SPCA 1M56C 4GX2A 2EIKC 1N9PA 5CBHA 4QE9A 3ABMC 1S5HC 2WLMA 4TWKA 2ZXWC 3LDDA 5KUKA 4G28B 1P7BA 3TETA 4HYOA 3OUFA 2HVKC 4J9ZB 3UKMA 3ZRSA 2HG5C 5EBMC 4RUFA 5BZBA 4GX1A 2Q69A 2P7TC
chains in the Genus database with same CATH superfamily
3GMOB 3FB8C 1TVHA 3N5AA 5I73B 4DV5O 1ORQB 3GSVB 5FA4A 4G8GD 4EI0A 1OAQL 4XMPH 3SGKC 5I6OA 2A83B 5BRZB 2C7UA 3RDJA 3RE0A 3VQVA 1OQXA 2CDEB 3E9UA 3LXAA 1SUJA 5C86A 4OCWH 4X1IA 2IJIA 4A7GF 4YMPA 2CTRA 4G5ZL 1MZFA 4HBQA 3U0ZA 2BDNL 1OWRM 1XX9C 2VQTA 4PU2A 3S5ZA 4I3GA 5B4MD 2UXCO 4J3OH 3CVBA 3KW7A 1M1KW 1JD9A 5I1EH 1Y74A 1OANA 2AEQH 3CCVV 3F12A 1FF5A 4J28A 5ICXA 1NBZA 4ZW8A 1QVOA 4JM4L 1PG7H 1XD0A 5DZLA 1KCUH 4HS6B 4QXUH 4G6AC 2E7BA 1L8DA 2WLJA 2OMZB 2N74A 4IBLT 4OF0A 3QIBD 2EABA 4FLTA 4JGUA 2YC1A 3ZDXB 1VCAA 2VITA 5ILTH 4HH9A 1EEYB 5HDQH 3B9KD 3V5DB 1S76D 1LO0H 3RX9A 3TXQA 5J8OA 2BTQA 1FLTX 2RGSA 1TYEB 5I30L 3IFNH 3IPBA 1FXKC 4QRRE 2APSA 3NQKA 2IANA 2FEEL 5FW6A 1K72A 4BDVA 5C09A 3FDWA 3CVHA 2WVVB 3ASOC 1URZA 1XGYL 5HI4C 1LWJA 1SJEA 1QACA 1ZVSA 4HT1L 2FWSA 3QTCA 2CR6A 1U3HB 5HSFA 2F54A 1IV8A 3FULA 1NGPH 4DEPB 2QQLL 5LXTB 1LK2B 2PR4H 1OV8A 3CZNA 4TSCL 4Y1TA 3VFMB 4RWHA 1CO1A 4W93A 4A6YL 2F08A 2HJFB 4CC5A 4K5LA 5GS2D 1XNQO 1NAMB 1YJDH 1FFTB 4JZJB 4XX1G 4LLUB 2O4EA 5CBAB 2F1BA 3I2CL 3MCKB 5J5EA 3SDDA 4RRPM 2ZWZA 2E5LO 3I3EA 1IVSA 2YD9A 4OF3A 2VDMB 4PGBA 2E4TA 1S77D 3WKQA 4P5TD 2VWKA 3CMEV 3NABL 4MFHA 2UUCB 2I60L 2X89A 3TCUA 2B4CC 4PYHA 3WELA 4G6ML 5D70L 2YK1L 3CDFA 3UZEC 5T3ZD 4MVRA 2V2XA 3OB0H 1QSED 1W72A 1XOUA 2EACA 4IJ3C 2C9PA 1MVUB 1VQNV 2ZYHA 3GZOA 3QCVL 4ONFL 5HYEA 4YHNA 2J3SA 5GZOC 2Y3NA 4CA4A 2EDDA 1IQDB 2VW7A 1AHKA 2NSQA 2QKIC 5CP7A 4K8XA 4F6EA 1AMYA 2DQIL 2Q7EA 4PBDA 5F7KC 2ZSWB 2PXYB 2P24B 4AGNA 1YYCA 2VL5B 3RWJB 2OK0L 5B39G 3AMLA 5GRJH 2YIBA 4CH4A 2WP3O 1FCCA 2VZ3A 3CHPA 1KTCA 1UH3A 4WFEE 4ECNA 1A4KA 2Y0IA 3Q9QA 5C8JB 5CD5D 3K71A 1AQKH 3KS0H 5KVFL 2X7RB 3FTWA 4LB8A 4K7PY 4U1HA 5F6IC 5LO7A 4DGVL 1DN0A 4L4VB 5E6IB 5E2JA 4JLRA 5I1IH 3ZN1A 4F8LA 3K9AA 2VDQH 4WIQA 2W38A 1NH2D 5DVMA 3HB3B 3QARA 4NQDA 1IEBB 1U4FA 2Y24A 3BMWA 2DN7A 2NOYA 4LWSB 1PF3A 2VLKB 4PRAA 3SKMA 4A2MA 2IXQB 5G5DA 1T0NA 5IEHB 2GC4C 3U30B 4UYPA 2XWJA 2VR7A 3VW3L 1W0JG 4NRXB 1I7UB 3V5HA 4AQOA 2VLRD 1AGBB 4F7CA 5A2BA 5KBPA 4HGWA 1ZUQA 5MEND 3IFLL 1MFMA 1M3IA 2Z35B 3QDJD 3JV4B 3M1BB 1ND0B 3HC0B 4JI1B 3PN1A 1IKOP 2X4NA 1I9IH 1IB5A 3LAFA 4KO5A 1DVFB 5I1GL 2D03H 1PP9H 3N85L 3BZ4A 1M57C 2ZSVB 1CTMA 2YAPA 5D1XB 1TLKA 3V4UL 2MPAH 1KCSH 1Y76B 1AKJD 4WWPA 4PJCB 5FIEA 5JORB 5K9QI 2BP8B 4MS6A 3MV9D 1FL5A 5HHPB 4WV1C 4MT8A 4JI3O 3BUPA 1OTUD 2FEJA 4N2KA 2A6KA 2BP0A 2ISDA 1IFRA 5BOJA 3GBDA 3UTQA 2W0XA 1SVBA 1RZQA 1N4CA 4DESA 5H9CA 2X28A 3RWFA 2X6UA 3CP1A 3F2LA 4FQJH 1T4KB 2VRQA 3D0AA 1E9OB 1W0WB 4RMBA 1EJ6A 2JTDA 3QORC 3CXDH 5E0FA 2RQ8A 3GHBH 1H3VA 4ZXBC 5HGAA 1IAKB 3APDA 1T5WB 4GIPD 1MI5A 5MP6L 2NY4C 4EOWL 1GM8A 3FQYA 1XIWA 3FRPA 4R7XA 1KC5H 3CCHB 2WQWA 3KPOB 3E8BA 3AG4C 1UJ3B 1UWXK 4W70A 4A7QA 4PA7A 2SEBA 4PY8J 3CFTA 3I74A 3UJJL 5EO9A 1MFEH 2ZOOA 1CIUA 3ARZA 3LQZA 3HBQA 4TUKL 3ZE1B 2BK8A 1JZDC 3GSRB 3CCSV 3T1YO 3MLSL 5ICYA 1VQLV 5C0FB 4QO1A 4WHCA 1P4IL 4X4MA 4Z7OF 3UDWA 3G9VA 1WEJH 2P44B 3EHBB 1TUEB 3Q3GB 1KT2B 5D55A 1MG3C 1CXEA 3NQIA 2KERA 1DDTA 1SGKA 1G0YR 1GGUA 2K3HA 5AL0A 3R1GL 3B3BA 2WO4A 3BVWA 4HK0A 3FFDB 2BIPA 4S1RH 5IYZB 4HUUA 3QUYA 1P5UA 3D06A 1S7RB 2E59A 2UZXB 4G28B 2DQEH 1KB9F 2HRGA 2R23A 3N44B 3OX8B 3P30H 1J8HA 3TO4C 1HTYA 1FCGA 3I02A 2GI0A 5CILH 3FN0L 2DOSA 1BLIA 1N26A 2FIRT 2JIXB 2HLFC 4GT1A 3PGDB 4G5AA 3W39B 1E3XA 4OD3H 1T3FA 5IQMA 2JJVA 3GBMH 3PWPA 4F20A 5A2FA 5HYJA 5MENE 4HIEA 5CUSH 3T4AB 1BWWA 1ZTXL 5I24A 3KL3A 3QIWB 1NCAH 4M3JA 3QDJE 3J7AU 1EAQA 1FN4A 3OHXA 4FF9A 2APWA 3K6DA 4M93B 5IBLC 4LL1A 4OLEA 3A0RA 1A1OA 2Q0ZX 5LLIC 4G2KA 2IEPA 1C08A 3DARA 3VG9B 1J0HA 2OYMA 5J56B 2G9KA 5GGVH 1IBLO 1UUSA 3C5SA 5GGQH 1S3KH 4JY4B 1S5JA 3ZE0B 1W0YT 3FXIC 3OC8A 2J4WL 4JF3A 3ARDA 4DV5B 1G94A 2Q7HA 1S9VA 2FX9H 3KYOA 3L54A 3JATA 4M4RB 3ZIMA 2D9CA 4LO9A 4G8IB 1JK9A 1ZTMA 5D4HA 3ZRCC 3E1F1 1XF1A 4HMEA 4X7CC 2BXYA 4ZOLA 5FC9A 4P9PA 4OD1H 4MNHB 1Y6XA 4BK8A 2APVA 4JQXC 4DV4O 4OUUB 4W4OC 4G70B 1WDAA 2W88A 2UXCB 2EYTA 3BMVA 3FO0L 3V6FA 2HG5A 4U3HA 4CVXB 3JWOL 4EI5A 5INDB 5KW9H 1N2RB 1XGRA 4YHPA 1JTTA 1ZKAA 2X4OA 2Y5TB 2TRHA 2XWBB 5DJYA 2YXVA 2DEXX 1IZ3A 5ES4B 3JASA 3D3QA 1DUYB 4PRHA 3VFSB 4BFJA 4QRQA 1FH5L 1KCVH 1A6WL 4XBGB 1BVKB 1R3JB 3A0HZ 1FBIH 1JDAA 4O4YL 4QHNA 1R3LC 5IKCB 2WB1A 5C07A 4Y9GA 3ULVD 2OTLV 1WQVT 5EV7A 2J6EA 1G9MH 3WY4A 4G83A 4JFYA 5B38G 5I1LA 4NKDB 3H8NA 3FQRA 2JJ1G 4MQXD 1AD9A 3HG1D 4MDJB 1MHCB 3RLSA 3T5WA 3UEQA 5IB4B 2WANA 1BPVA 2DQDH 2R8SH 1S8DB 3DRTB 3RI5F 4FJCC 1G1XB 4LCWB 1ACYL 3MBED 1E27B 3E6FA 4UOW1 4GW4B 5FYLL 2R39A 1TZIA 3SKUD 1IX9A 4HIJB 4CNIA 5CGMA 3WJJC 4DUVA 4P2OA 1GTOA 3KVDD 2RQ6A 3O8XA 3Q6GL 3RNKA 2ENQA 2P22C 3HZKB 3BE1H 3LZPA 3L5IA 2EZPA 2EIJB 3KL0A 2HJDA 1KJMA 2DE0X 2BSRB 2VO5A 4OZHB 1EGJH 1AP5A 1NCOA 1OAXH 1RPOA 2Y7LA 4E2LA 4NGHL 1BXVA 1TMCB 4GRMA 4O2FA 4PJAE 1RZKC 5TJWK 1UACL 1VACA 1BQHB 3QFJD 1DSFH 3QR2A 3O11A 1RZJC 2WKGA 2F19H 3DHMA 4XMKL 4CGTA 4FQIH 3IC7A 5AWNL 1YNKL 4K15A 4ETQB 4YGVA 3VXNA 5INCB 5C97A 1DBBL 2AJUL 1E9QA 5FR3A 3V8OA 2VISB 2ERJB 3GMRA 1KSRA 2OR7A 5F7NC 3TX4A 4JDEB 3CC1A 4HSCX 1B2WH 2VLJA 3FH5A 3ARFD 3T1FB 5C0DB 1K92A 4TVPL 5KYWA 2R2HA 2ZNJA 3F3HA 4HKBB 4XWOC 1T0PB 2V6HA 2OQJB 4LNRB 3LPOA 1J88A 1F7YA 4AWJC 4NENB 2J8UA 3TWCH 4M7ZB 4U4BA 3VXQA 1MCHA 1JHTA 4PJFE 2QDWA 4BHUI 1PD1A 2NY3C 3DGDA 3D9AH 4XPHL 1PNDA 5I1KL 2Q68A 1T20A 4HOWA 1SQMA 3RBGA 1NM4A 5C0AD 3K9SA 25C8L 4F8OA 3WSQH 1NBCA 4DR5O 1JZHA 9CGTA 3ATEA 2WCSA 4G6KL 2QMJA 1H8OA 1J1XH 1MCEA 1U8CB 3N0AA 2NSMA 1TETL 3JXAA 3RJDA 3QEQE 1VEWA 4OUOA 2BVOA 4P48A 1E5UI 2ZX5A 1I7FA 5C2UB 1JGDA 4X0KA 4FFYH 2ADGB 4UT9A 1IGML 5T5NF 1ZLUK 4GRLC 5E8NA 3TO2B 5HI5C 1KXVA 4JFWA 4H25A 4DPRA 4LU5H 2EIMB 4RMSA 2HPOA 2VDOB 1RZ8A 4TUJB 1OAUL 4NWUH 1F90H 2OMNA 4NI6A 2AKRB 1KJ2H 2XICA 5EF2A 1EMTH 5DZ9A 5ESAB 2CLRA 3PHSA 1YNTB 4KVCL 4YR6B 4LSUH 5K1VA 1L0NH 4GT0A 3IXTB 1ZK5A 4Y2DA 3R8BB 1EHLH 3ULVE 5ICZA 3OEHG 5DZJA 3AFLA 2B4CH 3F5TA 4AYFA 3OR6A 1WT5A 5GGSY 4WI8A 5EZLB 1ZK9A 3E2HC 4MXVE 4DFIA 4DUXA 2W6JG 3D85B 1UATA 2PYFB 4LF4B 3O6FD 4FYQA 5E5MA 4JI3B 2XLLA 3OLEA 4S0TD 2RDCA 2OR8A 4GYCB 3EXJA 3BUIA 4I13B 3H85A 2NCEA 2Y1AA 3EH4B 3QQ3A 3T3PB 1JXFA 4O2CB 4QYOA 2CBTA 4QPKA 1EDQA 2LFGA 4PAZA 1T7VA 3EJYC 4GLRH 4JANB 3G04A 5G2NA 3HI6H 3ML9A 1UXLA 1XH3A 3MU3A 3BHBB 3FQUB 5AW0B 4JI4O 3T1CA 2H32H 4FXGB 2XWEA 4OLWH 1A6AB 5I1DA 3US1A 2VQUA 4AHCA 3QFJE 5DJ0A 3RVWC 4P2RB 1SDYA 4PRIA 2DI7A 4HWNA 2X41A 5FO8B 2BTOA 4LCUB 4OLZL 5LMNO 1YEIL 3L2NA 4HPYL 4DO5A 1LE9B 1AZUA 4KOBA 2BIIA 2ZWYA 3MO1B 5E7BA 1HI6B 2F5AL 4PJ8C 5D7SH 1XR8A 1YY9C 5DHYB 3L95B 3RQ3A 1PNKA 3WIIL 1UVQB 1QSFA 2AP2A 3Q4HA 4GSRA 2OXGA 4UQIM 4IOFD 4CW1B 1IGIH 1T1XA 2VABB 4XAWH 2EULA 3TU6A 2E9BA 1R3HB 1K6QH 5FUOL 3ZHNA 2WJ5A 1I08A 3AS0A 4IRSD 4AIZB 5ICZB 2B15A 4OQTH 1S46A 3NSXA 1SXCA 1PDKA 4QHLA 2WPDG 5JPNC 4R0LB 5B39B 4JJ5A 4BQBA 3KCXA 5C0AE 1BQKA 3KWWA 5J2UB 3QEGH 3TIDA 3VTAA 2X0LA 4LBAA 2OCFD 5LDSA 3L9RA 1K8IB 2CJUL 4DRXB 3B9DA 3WY2A 4X8AA 2VXSH 2DLFH 3ZJAA 4NC1C 5IB1B 5SWSD 5C0RL 1C1EL 2C3GA 2EXYD 3WEXA 4CC0A 1VIWA 1N6VA 4LVOC 1JFFA 2CM5A 3PXJA 3SQRA 1MRDL 2QSQA 2EQDA 3RURA 1AP6A 3WO4B 1H5BC 4L8DB 1KYOJ 4TV8B 4M8RA 2ZX6A 2HP8A 4JQIL 3WNPA 1YPZF 4M7JH 2O5XH 1OCZB 1MZZA 4H0GA 3AVEA 5EOCJ 5LGYA 1IGCH 3LDEA 2NNCA 4JZOB 1B3IA 3ARED 2F23A 4TV9B 1TPXB 2J8UF 4P5KA 1O9ZA 1INQB 3WTTA 5IP4A 3FTSA 4JV5B 4F37F 3UZQB 1LL1A 3LKNB 1QNZL 1CVRA 4DN4L 3BAKA 5HD8C 3EYUH 4YHLH 1HYSD 3UPCA 5KSBB 1IBLB 3L71H 5T5FH 4FK5C 3PP3H 1F86A 2X0UA 4WSKA 4IKIA 1ES0A 1DL7H 5ANHA 3DROA 3WHE1 5FUCC 5EO0B 1HEJC 4NLAA 4XVTL 3D8CA 2NY0C 5CJQL 2AV7A 4M1GH 5H5NA 1NC4D 1ZSPA 3BEVA 3RTQB 4FZEL 2VRZA 4KHPO 3CC5B 1RUMH 1UB6B 1DVTA 4NXSA 1H15A 3F5WB 5DHEA 1JTPA 3D18A 3V4VA 5KSVB 4MJ5A 1CL7L 3VFWB 1FFOB 2GIYA 1AI1H 3L16A 3WLBB 4EI6A 4J3SA 1VZGA 3MLYH 2EAEA 4HUXA 3N27A 1Y66A 4NQQA 3SE4C 1ZVHA 3BPCB 1FNHA 1WBYB 4IKKA 2XKNB 4Y4HB 3ULSB 3NFPA 4YE0A 2A77H 3D2UB 3P1VA 3V0IA 3P11H 2Q5BA 1VFBA 1FC2D 4M3KB 3RGBA 4Y4KD 2EO9A 4JI5O 1G7PA 2DH3A 4X1KA 4P46C 2XSKA 3DUUA 3S36L 4AJVA 2OMUB 4ZAKB 4DVBB 2FR4B 1UKTA 2COQA 4AQ8A 1ZT1A 1SEBB 4GNKB 1C8PA 2O5NA 3TLRA 1GN2A 3C75A 4R5TA 5AB1A 4ZMXA 1GJIA 3DC5A 3LXCA 5LCVL 4LF7O 3KHQA 5ECJE 3B8MA 1JWMB 1NFDB 3L3OB 4WI9A 4AXWB 2XXGA 5KHJA 2DD8L 2GJZB 2AAVA 4XZUA 4WUUD 4JFEB 2H26B 2CXKA 3MRRB 1IC4H 4GAGL 1YUHB 4GIOA 2JELL 4JAMB 3W0WA 5DJCA 3G67A 1AXTH 5DJ8B 4NQCA 1SS3A 1AG6A 4DO2A 3BVTA 4N0YL 4YZFE 3CHRA 3NFSH 4JDVA 4GFXA 2WYTA 3CN0A 4KDTC 3TWYA 3FT2A 4FRWA 1INEH 1ZSDA 1GMGA 1BQLL 2FX7H 3K04A 3SDCA 5B5EZ 2D7QA 4TKWA 1RUPL 1UXWB 2NX5E 2Y6SC 4MCZA 4HCGA 5FKAB 4ZFFB 1ZTEA 1XGZA 4MD0B 1Q9OB 4DHLA 2I9TA 1NTDA 3ABUA 1XMOB 5C0CD 2UXXA 5SWSE 5L2KD 3FUJA 3UJIL 3D36A 2D9QB 4TMPA 3U10A 1YMMD 3D4CA 1UD8A 1ET5A 1WA1X 4P4RB 3IFOB 1CR9L 3S3XA 5IVZB 2YIAA 4NBYB 4HW6A 2JK5B 3MV8B 5HGBB 1C5BL 1BHAA 2AXHA 2HX7A 2W65A 2DF3A 3TN0A 1RSYA 3GXTA 4TPRH 1HINL 4LVHB 1AS6A 3L70H 2XN2A 2VL4A 5BOPA 1KIPA 4FE9A 2XKUA 1OTTD 1TTGA 4XVUC 1RZFH 3EYVB 1RULH 4ELMB 4Z76B 5ADOL 1SYVA 4H1LA 4WKXA 1NCIA 4WK0B 2XBDA 3GMQB 4AK1A 5M95B 4LAJH 4JI8B 1LTXA 4X7EC 2OXHA 5GIRB 3KD4A 3MA9L 1ICTA 2YGPA 3U7YL 5C0IB 2EDWA 3IAPA 4HCIA 4P59L 5GRWA 2B16A 5J3HD 1QLEL 1I1YB 2P26A 5CSGA 2MOQA 4IHOB 3X3FH 4KHTL 3G3LA 3MRMB 4ZMPA 3IMRA 4KNUA 1NM9A 5JHDB 5E56A 3ECUA 3X13A 1H2MA 3OMZA 2PMZA 5HYSA 5JQ6L 1IM3A 3II2A 5JJJB 1F4WL 3DV4B 4LSRL 5IMOB 1S5HA 4AG4L 2D0GA 2W9DH 2HT4D 3QXAB 4JPVL 3WKMH 1M9SA 3H6AA 1NIDA 2D2CB 4C59B 4DR7B 2UWEA 5IEKA 1TYRA 3W11D 4EN3C 1GSMA 1IEAA 3JYCA 1RZKH 2O6DA 2GAZA 2OM5A 4MS2A 2XN1A 3WNIA 3T0ED 4Y4FA 4JGSA 4WWKC 2OTWB 1PU0A 2NXYC 5IESH 2KKWA 2NYYC 1UWFA 1H6FA 3ML8A 1NLDL 1DFBL 4JVUA 1KEML 4LPXA 1QA9A 2OMVB 4MKMA 4DGYL 5CB4B 1YSOA 4Q6IB 5E70A 1CT8B 1NZRA 2GPZA 2JI2A 5IVXE 5EBLA 4DV3O 3MLVH 3EBHA 5DEDA 4WUUE 5GRUL 5L88H 3VD2A 1BFVH 1IZJA 1WTLA 1W8NA 4X6EA 4DGWC 4DP1X 3SE8L 5I1AB 3FD9A 4DN3L 3QEUA 4GXVL 4RWYH 3EXLA 3WE6B 2EE9A 5ITFB 2DH2A 4FXKA 3WAKA 1R5VA 3CIQA 3AAZB 2ZCLH 3U4EA 1QQCA 1K33A 2HFEC 3MVSA 2X5PA 3MNDA 4GX5A 4DV1B 2XZQL 2I7OA 4RFOL 2ZP0T 1JX9A 1NJ9B 4ZX3A 1FNSH 2W0FC 5C0CE 1L0LH 5C71A 5L2KE 1Z32X 2GBAA 4FM0A 4KO6A 3BUDA 4PREA 3WFBH 3STZA 3RZWA 4MHHI 4PLOB 2UUAB 1YMME 5I18L 3BN9D 5C0GB 4IIQA 3MLXH 3S3JA 3F7LA 2MQ3A 5DQDH 5LMNB 4AEHL 3CTTA 3V7AE 1WC7B 4RMVA 3NIGE 3QJQB 3DX7B 5C6PB 1I3GL 4G82A 3ATDA 4GMTH 4QIWF 2EX3A 2DWDC 1A6TB 1IC7L 2OZNA 2R2BB 3ABGA 4OGAC 4QOKE 35C8H 5ENWB 3RVUC 3EZ8A 1ZT7B 3QDGD 4FQLH 3BC9A 2H8PA 1XAKA 3HNVH 2IH3C 1AR1B 1JPFA 4YXLH 1J0JA 3F00A 4UZSA 2FMLA 2R9IA 3W7SA 4PJ5D 1P2CA 4OD2A 4WWID 2OMXB 4EDWH 2FSEA 2ICWB 4PP2B 4XBEL 3VXRD 3BPOC 2Z92B 5ALBH 3FBQA 2QSCL 2Z6FA 3RZCA 5EEXA 2Z1KA 2W07B 4HC1H 2D3OW 4CH5A 4ORGA 3MA7B 2JS5A 4PV9B 3BSHA 3DMMD 3NTCL 4G43B 4IW4C 2AXWA 3FONA 1BV8A 2D8KA 4JHWL 1XUQA 2XWDA 1H2KA 4IOIB 3QDHA 2H1XA 3GEWB 4WNSA 4JYYA 1V3JA 4UQCA 2AANA 1CGYA 4Y5XB 4AI7A 2RN9A 1L9TA 2UUDK 3OR7C 3OF6A 2DDQL 4N24A 2V4DA 1DN2A 1HNFA 1WAAE 2DBLH 3HOGA 4BJLA 5A6MA 5L3BA 4LHUD 4DAGL 5DLLA 3HAEH 2WLNA 3HAEG 3CZFA 5AOMA 4JDZA 4QD2E 3T4YA 3QA3A 1J1OH 2B1AH 4KKLC 4F8NA 5J12B 5LUMA 2Y22A 1U9KA 2HG0A 3T0EE 5JXEC 4AI8A 5FX3A 2ITDA 2CZNA 1IQWL 2QMKA 3VXSA 3SE3A 3FCSA 4YH6A 4G6FD 4F9PC 4DK0A 4H40A 1DTUA 4JFDB 3ZS8C 4N0UA 3VH8A 1A65A 4XO3A 1J1PH 1YIJV 1R73A 3IRPX 2Y2WA 4AVJA 4OGXH 4WEBL 1SXSA 5DTFB 2XWTB 2FECL 4PP1D 3QUKB 1Q6UA 2BS8A 1M56C 5F97E 4LF5O 4O51B 4FAAB 3UBHA 2E8YA 3OXRB 1QI4A 4XNYL 4NB7A 4Y5VA 2Q3XA 1R5WB 3GHEL 3OTOB 4QHKJ 4JPWH 5JW4N 4NRZA 1WP6A 2Y25A 3M17B 4YDKH 2OSXA 1QRND 3I84A 4F1ZA 3MRHB 2ZJSH 1TZOA 2WTRB 2P4KA 4YQXH 5DMGC 3DBSA 3F7YA 5L4FA 2UWEF 1QPXA 2IBZY 2VXVH 3LV3B 1M90W 1FLRH 4LSPH 4J3OF 3FMGH 1I0HA 1EEZA 2YPLB 2X05A 5DD5L 3UO1L 4XI5D 3D0LA 3IJYA 4N28A 4N8VA 5EIIG 2YD8A 2X12A 3KJ4C 4NQVB 3UADA 4TSAL 1J0KA 1ZD6A 1PPIA 3NN8A 5FLVA 1ORSA 4MQ7A 1FL6A 3L4VA 1XGQB 3C6SA 4HD5A 1UWYA 3NJXA 4Z7UA 3B2EE 4HZAA 2VXQL 3TV3L 2ED9A 1SPDA 1WH0A 5GGRA 5J6GA 3B6SA 1P4UA 2QM7A 2YUXA 5E8OB 5HPMB 3UIYA 2FO4A 2GEQA 1I3UA 4PJ5E 4BFKA 4WNJA 1AQ8A 1OSZB 4JKKA 3G5VB 2CGRH 3BSZH 3GZKA 4M8VA 5L3EA 1U92B 1Q9KB 5KSAB 5BRPA 2Z5UA 4DYLA 1U93A 1S9WB 2X70B 1M57B 4K7PL 5EU6D 5AYUL 5TPWL 3RWCB 3N40F 5A16B 3L4UA 1KB5B 4BW5A 2NPLX 3DHJA 3FBKA 1OE3A 4OLUH 1KBBA 1CGSH 4NN5B 3FB6C 1F3JB 4WV1B 4G7YL 3SN6N 2ADPA 1MUJB 5JVDB 5F7MC 4IEFA 3GSUA 3W5MA 4OCXL 3TBSB 3P30A 3MRCB 5E23A 1E8YA 5AW6B 1BAFH 5F1NB 5F89B 4M3HA 3VU1A 1W8EA 3DXAA 1ZLZA 2ZOLB 3Q2LA 3WGVB 4W9ZA 4O2AA 1FGVH 1M6UA 3RL1A 1LEIA 5H6QA 4KI5F 3CBRA 1JAEA 1MFAL 4NP9A 1A32A 5IT9N 5E9AA 1ITCA 4LF3B 2WVUA 4PJDB 1GN3A 2FQEA 2A9NL 2NY4B 3H2PA 4JJOA 1YY8A 4O02A 4KMLB 3BLBA 5EUOB 4G7RB 1JPGA 4GQZA 4X7DC 4JFQB 1KNOA 2VN7A 3LN5A 2B3IA 4NZTH 1E50A 1TZAA 1YN7B 1FRGH 5GRVL 4JRXD 5I8KL 3VYOA 4QJFB 1I94O 1J12A 4PYGA 1DO5A 2F8OA 3RWHB 2H6PB 1JK8B 3ASWA 3MRNA 4W9JC 1GAFL 1FSKB 4QRSB 1Q8IA 2A3QA 1LO3H 3GSQA 3P4LA 3CC2V 3S3BB 4PMFA 5IB2A 3QNYA 5I66A 3UQ8A 2Q4PA 3DUHA 4FQ1L 2JVUA 4M1DL 4OSUL 1TQTA 1M9WA 1CU4H 1Q9WA 1R33A 5B7MA 4JFFA 3B5HA 5HI3D 3W57A 1YYLL 2P49B 1HCYA 2BM3A 3ECQA 3J27A 3JWDL 4YOKA 5HJGA 4NXKA 4WO0A 1EZSA 1YEKL 3K5LA 1BD2A 3JVFC 3MRGA 4N68A 3CH1B 4A04A 3FUKA 2OTUB 5CSBA 5CM1A 2W6IG 1AC0A 1T1WB 3SGDH 4XMLH 5IHZA 4NXMO 3KXFA 1AP2B 2WQXA 3JWOC 5DMIH 1I1AB 4XHJC 4S2SA 5KVGE 1CLYH 5I8CA 5E2VH 3ARGB 2C9UA 1KLGA 4LBEC 2AHYA 4JKWA 1T5EA 5TDNA 4JO3L 1L0PA 1AR5A 3H9SD 4DT2A 2WNKA 1DQML 4WO4C 3UACA 5B38A 5F7UA 5EZJA 5GSVA 1QO3A 4L4TB 4C47A 1WHOA 4A2HA 4AYMC 4DV3B 2IPTL 2QELA 1OHHG 4FLUA 4LGPB 4NNXA 3REWA 3TEXA 4I3SH 4DO6A 1C7TA 1BGXL 4ZFOA 4P0DA 3RPIA 3SGDI 2Y1VA 1N12A 5CEYA 3K8LA 3AQDA 3LKRA 1A4JA 2W0KA 2NQDA 2X4UA 3BZ5A 5D7IB 1TTUA 1JUFA 1QFUH 5JW3H 4LLWB 1LWHA 1G6RL 3BH8B 4JG5A 4N2GA 3A67H 1LD9A 3KPQB 3ZYIA 1BQ0A 3FT4A 1EGJA 4UTAL 3EYQD 4GZRB 3BFQG 2H47C 2JDIG 3FB7A 3BCFA 2AVGA 4FYRA 3S3PA 5BV7H 4I2XE 1JGLL 2R69H 3IDMB 5HHOD 2CHXA 1MREL 3D39A 4R5XA 3FB8A 4RBPH 1XXDC 1O7DC 5E8DL 5J1AA 1NT2B 1IM9D 1BM3H 4BHUA 1TZGH 4NZUL 1ZJBA 1AZZC 4EUPG 4EUPH 4BSWB 5CEZD 2Q73A 4U6YB 2WVTA 1OAQH 1BZQK 4E9WA 1U8OA 2DI8A 2HUHA 3N3EA 4HIHA 4Z7UF 3ULUD 3GKWH 4L4JA 1HDJA 1RXLA 4S0HA 3HUJE 3VCLA 5IHHA 3CSYB 1FNGB 1KXTB 3D3VD 1IBMO 1OARH 2BDNH 4PGZA 1KCBA 1NCHA 3AC0A 3M07A 4G71B 4NQEA 4Z7NF 5DVLA 5MI0C 3DX4A 3NPZB 5BXFB 5CA3A 2FGWL 4JM4H 4Y8AA 2F66C 3FRUB 4PPTA 2R0ZH 4L1BA 1R3LB 4K7FB 1JGEA 3UERA 3HPJA 3NJMA 4QRFA 4PW3A 4UV4L 3UBXI 5CN2A 2HVJA 1P6WA 1T5XB 1U2YA 3JD1A 3ZMEA 2F8XC 4WGKA 2EJRA 1ZHLB 3H9HA 3UBFA 4PJGA 4NC2B 1K73W 1FXKA 5IK3A 1H8HG 4NNYA 5I30H 1CXKA 1NDTA 1CDJA 4OF8A 4A39A 4F5CA 2QVMA 4KJQC 4TWKA 1IAIM 1ZLDA 3RU8H 5KG9B 1P7BA 3G6EV 2OP4L 4FFYA 1T7XA 1W15A 1XGYH 1O0VA 2AXFB 3D1MC 2GUZA 4YSOA 3KNBA 5IR1B 2HJLA 5I6LA 2YZ1A 3QQDA 5ANMB 3OBAA 2R59A 1KJ2A 1JXGA 3DI2B 1Y0LB 3PDGA 3MGOB 4JI0B 3BP4A 1DQQB 1MA1A 4I50B 2WXIA 4APQC 2GY5A 3L3HA 3O4LA 3MXWL 4POYA 3FZUD 1AS8A 3L5HA 3I2CH 3ZDYE 3BQUB 5F1IA 3H0TB 3EFFK 3FKSG 3H9SE 4G9FA 4QCIA 4TLTA 3WS3A 3UTSE 1PFCA 1R3KB 3I9PA 3W9EB 2EKJA 3NABH 2VR9A 2I60H 3OKKB 4NAJA 2A6JB 4G6MH 5D70H 5D1QD 2YK1H 4R4FL 5L0QC 4NT6A 1Q94A 3QI9C 1RJLB 4PH8A 1TYJA 2QKIA 1TNNA 1FL3A 4B9FA 2ZWNA 5HHNA 1UWEL 1CQYA 3FH8A 4ZTOL 1H8NA 2DQIH 3LY6A 3O9WB 4FG6D 2YKKA 4XBPA 2OK0H 1PKQE 1UA3A 2GITA 5D2LE 1CXIA 5E99L 4AM0A 5HHOE 2B20A 5D7EA 3VGFA 4KKAD 5EZPA 3CPLA 1YZZA 2FHFA 3LHAA 3QPXL 3KDMA 4WW2B 5C92A 1FS0G 2YEQA 5T1KA 3TCLA 3T4ZA 5G55A 2CAZC 4LSDA 4C4BA 5CEZE 3QWRA 1R3IC 5EULV 1LVEA 1HP8A 1GGCH 1HXMB 1S4IA 4UDUB 1E4HA 2RACA 1X6NA 3ULUE 2WIMA 4L3EA 1JFQH 1CCZA 3PCYA 4OJFL 4WJ5B 4FZ8L 3QUMB 4P5RA 2AQRA 3RVZA 4B9YA 4XPFL 3M99B 4NUMA 4DTGL 3VW3H 1CFQA 2CKBL 2OTJV 4YPJA 4XH2A 2BC4B 4AVIA 1K3ZA 1EO5A 5D5MA 4OQTA 4G7VH 3KLHD 3GMLB 4HV8B 4JGNA 4NO3A 1BJ1H 1EZLA 4H8WC 3N1PC 3S4SA 3T6VA 1CC3A 5I1GH 1HZKA 4ZDHB 3BESR 3N85H 4UV9A 5DS1A 5A6IA 2X38A 4XCCH 1FYTE 3QNXB 4E42A 3EF7A 3C6EA 4G9DB 4JG0H 5T3XE 1ID2A 3K4DA 3TNMB 3GXIA 3OSKA 1ADQA 1S7WB 3PWNA 4RGNE 3V0VB 2VGLM 4L0YA 3RTLA 1RAMA 3RY6A 4AMWA 5M7QA 4YBQC 4MGXA 5DUPL 1C7SA 3GUTA 4X5XB 2LE9A 5EOTB 4FQ2L 3H9VA 5T3ZL 3K6SB 1HNWO 2UU9O 4QRRB 1WZ1H 2E74B 3LEXB 4LSQH 1ZLSL 3BT2H 1AHMA 1XDCA 3ZL4H 3FYEB 3O3AB 4TLKA 1ODAA 4QUOA 3ZRFC 2RH0A 4D8PA 4PRPB 3KWTA 1WBXA 4GSQA 2JKNA 3QORA 1B0RB 3SQOH 1RHHA 1TFPA 3CMOL 3NA4A 4ZXBA 2JKIS 3ZE2F 3VG0L 1CVSC 1Z9MA 2IQ9H 2IV8A 3F7VB 4P57B 4N2EA 5MP6H 5BS0A 4EOWH 2P8MA 5DD6A 4QXGH 3H2QA 2FHCA 4GAAA 3U82B 1WBZA 2R1WA 1WGVA 1V7NL 3TBVA 5T5FA 2FB5A 1HH9B 1U8JB 3SQBA 3KYMB 2XX1A 1MCPH 5HBBA 2RJZA 1FG9C 2A0LA 2Z4QA 2HHHO 3D09A 4KX9A 4PJGF 4KXRA 2JKJA 5CWSA 1F18A 3VWJD 5DJDB 4Q58C 3BA9A 5DJZB 1P4IH 3F05A 4MBOA 3RJOA 3T2LA 1I1RA 2PI4A 1I8KA 3QT2A 4FNUA 2YEVA 4UUJC 5AW3B 4YIQB 3SDAC 2BX5A 3GD1C 4Z77A 2L3BA 2PR9A 1JP5A 3VTMA 4Z23A 3CZUB 2UXDB 5I8OL 2ADQB 1SLVA 3R1GH 4NO2A 2FJGA 4JKPL 4HOMA 5LXVA 1KB3A 2WBJC 3FU3A 2H2SD 3ZT7A 5DFVD 1GYWA 1MCWM 2YAFA 4N0FA 2AJVL 2XXCB 1SY6L 2DTML 2FBJL 2A9DA 1DBML 5EIIB 4MQSB 4ZMOA 3QO1A 2NN4A 1M71B 1HHGB 3EJRA 2Y7SA 4LVOB 3VDAA 3GSXA 4JNXA 4X66O 1A25A 3CXHK 4A38A 4I0PC 4PJ0Z 1BQZA 1RJZB 1KWGA 1YEJH 3FN0H 1RMFL 1RPKA 2XYCA 2PW1B 2ZX7A 4KC3B 1I3VA 4OZGE 5EOCL 1FV1B 3L1FA 4G7SB 4X7TB 5AVYB 3MC0A 5JW5A 1D2PA 1DUZB 3DECA 5LAXA 5B3SB 1UTDA 1ZTXH 5CO1A 1US6A 3K08A 5FWQA 4AQEA 4C55A 5HYIA 1THZA 4J1UA 1L4IA 2G3MA 2WMPB 1VB9A 2C7FA 3L3DA 2R9RB 2PW2B 2AEWA 2ZP9A 4M5TA 3QIBB 4MNQA 3Q13A 2WB7A 5C0JA 5HHQB 4NR1A 4GAFB 4MAYC 4MDIB 2W60A 1WISA 5ID1B 4U1NB 3A4AA 4L29B 3CSPA 1SN0A 3CSBA 4FP8L 5K9KB 3B9KB 1BG1A 4YJ2B 1MJ7L 2RBLA 3KM2A 2WV3A 4ZX6A 2J4WH 3X12B 1EFXA 7CGTA 2R9HD 4HHAA 3BOVA 5HPOA 3MMEA 1EAPA 3C2SA 5DEFB 1UB5B 4UQ3B 4YLBA 5EBMB 1SJHB 1FZMA 3IJ7A 5DFWH 2CKBB 2MFNA 4JQXA 4DWHA 4W4OA 4X98A 4Y8DC 4M5YL 1MHEA 4L3AA 1BQ5A 4JO4L 4KTGA 4U2YA 5IROA 4WI3A 3FO0H 4TNVF 1T7ZA 3JWOH 5E00A 2ITCA 5EU7E 3DPBB 3AACA 5FGRA 3WIAA 5BUGA 5D5MF 2WHVA 3ASNB 1SERA 1LO4L 1N6UA 3EYFA 4PGJA 3LH9A 1AY1L 4XN8A 2IC2A 4X99B 5K39A 1FH5H 1A6WH 2EVHA 1KJ3H 2FTKA 4XB8A 4F57L 4U1GB 4BGLA 5IMLA 3VD9A 1OXYA 3HKZA 3TGUH 2IWGA 1QLEC 1C5DA 3R0MA 3H7BA 3D69B 4PW4A 4X80H 3P4NB 5IOKA 3MAWA 2YEZA 1ZPLA 3U1SL 2QR0B 1AIFB 3IETA 2XA3A 5AAMC 3WJJA 1B0WA 3IDJB 3K5MA 5FYLH 1Z1WA 3AY4C 3QNZA 1MSPA 4TTGA 3PWVB 2H41A 3VFOA 4X1YA 3EDFA 2NNFA 3CZLA 3Q6GH 4UCUA 4UB8Z 3BP6B 1MEXH 4JO2L 2EILB 2G5BB 4OGQC 1EPFA 3K3QA 4RSYA 4NGHH 3UAEA 4ADGA 1HX0A 2HH0L 3MUZ1 3ETGA 1UACH 3U79A 1RJYB 1NH2B 2GJRA 4XMKH 3T0AA 3U25A 3HE6C 4X4XB 2VQ1A 1BHBA 1D6EA 3KR3H 3VJ6B 2AJUH 2MEJB 4BK4A 3EGDA 4HOZA 2XN9D 3IDIA 4GEIA 4OX9O 3NJIA 3ZHSA 1HU8A 2UY7B 4YJ3B 3QG6A 2JXMA 3DJ9A 3PV6A 5D9SA 1G4MA 2YXLA 1UENA 2OMTB 1TAEA 5EN3A 2R83A 2PCFB 4TVPH 4YSUA 4Y19D 1NSNL 4BFIB 1IGJB 4H44B 1FYJA 4Z5RB 3LKPA 2QADD 3A47A 2ZINA 4NYKA 1X4XA 1R1BA 1ET7A 1QW8A 3KPSA 4FNTA 1NGWB 4BH8B 4DZBB 3QDJB 5ISZD 1F00I 4B3MO 2B39A 2EVIA 3ILEA 2VQEO 5IOPA 1HL8A 3G6JB 3D30A 2WN3A 2YGOA 4XPHH 4HUCA 5I1KH 4NUJA 1Q1PA 3UPRA 4P23A 5AVVB 2QDOA 4K23L 1J9RA 2N59A 25C8H 3ZHDA 4FLYA 1AKJB 3GMNA 4EDXA 1CBVL 1W59A 1TUBB 2FJFB 1UXMA 5LMUO 2JCCA 3BI9X 1ZS8B 4G6KH 2Q0AA 4J7RA 3FCTA 4ODVH 1DP0A 4Y2LA 3SD5A 3ULVL 2FL5B 4XO4A 4NUGH 4KI1A 2B3RA 2WA3A 2LVCA 2XWXA 5TD4A 2XAFA 4I4WA 4XPTL 4QHMA 1U96A 1AO7A 1DQLH 32C2B 4C8XA 2R7EA 3WEAA 3QUZD 4GRLA 3RBZA 1QZNA 2A4EA 3HHSA 3OGCC 5I1JL 4ZUWB 1TKWA 1IGMH 1H9DA 1VQKV 5GJTL 5BUPA 1XDTT 3P4MB 1AKPA 3NH7L 4L0ZA 3HEIB 1ZJAA 1TVDA 2V2WB 4A5UB 3KCWA 2OMYA 2W95A 2NXYB 3GXNA 3Q2CA 1KTDA 1C16B 3W1ZA 3DX6B 4KVCH 1UA7A 3JD0A 2C34A 1FGNH 4B7KA 4PTUB 1FVDA 4YHKH 2EVFA 4HC1A 4GUPB 3T65A 4JZ2A 2GCYB 2AXGB 1ERNA 1VRSA 5LOVA 4ZOEA 1EFRG 1YQ2A 3NA9L 4JZNB 3BIKA 3CVIL 2ODHA 4ODWA 4U3SB 3RUGE 2BSSB 2OIEA 3BA8A 1MQKL 3KVPA 3CRQA 1HNWB 1HHIB 1CYXA 2CRIA 1F1AA 4J3XA 4UILL 3REVB 2UZIL 4ERSH 5KVEE 2AAAA 2HFEB 5AG9A 4ODUB 1DANT 5J6SA 4CJ0A 4YDJA 4QLRA 4WFFA 1LJMA 3HAEA 4NTXA 3EFDL 3LH2L 1G7MB 4O2EB 4JKMA 3ZLQC 1KPUB 2Z7WA 3VM5A 1GC1C 1KY7A 3C3TA 1Y6MR 5ADPL 5B7EA 1YEWA 3FUDA 3ISRA 3KPPA 1YJ9V 1R3IH 4U3JB 4PJAB 3J7HA 4P9HL 4LMQE 4MVBC 4CJ1A 1HHHB 2PNDA 3WG7B 4OLZH 1YEIH 1A8JH 4PJ8A 2DWDB 3EH2A 3MLUL 4FULA 4BQCA 4DV0O 2DM3A 1S3JA 2F5AH 3WIIH 3GBNL 4KROC 4MNGE 1U8MA 3STLB 4Y19E 4BK5A 1X5AA 2FLBT 3LDBC 5HGDA 4KKCC 2ATKC 1M7DB 3GDCA 1A7BA 5JZ7D 3JZYA 5FUOH 2NSXA 1B9KA 4UTBL 2BP5M 5AZEH 3VFNB 4FC3E 3G5XA 5JPNA 1CFTB 3U0PB 4H8WH 3H01A 1SA0B 4X9FA 3NYKA 3HI1A 2AQSA 3CCUV 3P0YL 5DWPA 3RVXD 1Z5VA 1I8IA 2PTTB 5CEXA 4PJFB 1T2XA 2A9AA 5IBUB 1WAEA 1JXKA 5JA9A 2WINA 4AGOA 4JASA 4FQXD 4P3DB 2PTMA 2B9AA 5EC1C 2CJUH 3H7LA 2FVNA 4L48A 2X3CA 2Z93B 5EORL 4XWGL 5C0RH 3KZIZ 1C1EH 1DFXA 4QNHB 4BFOA 3OJ2C 2KZ1B 4JM0A 4PLJC 1UD6A 4NN7B 5E7FA 1H5BA 4RMRA 3QEQB 3FB5C 1MRDH 4HS8L 4WEUD 3RVVD 3GGWA 5D2NE 4JM2B 5E03A 4JPRA 4POUB 5MEOB 4JFUA 4L37A 4B95C 5HHXL 2DWYA 2OJEB 1OEZW 1JTOA 2MRYA 1A1MA 3TVMC 1ZDQA 2OTPA 3CQPA 4WI6A 3VMPA 3NZ8B 3VFTB 2PPCA 5I5JA 4UVAA 3BSZA 3MRIA 1DSWA 3KCPA 4AGLA 3SCMC 1P7GA 1Z2GA 4ZYKA 1R19A 2X4QB 1YEFL 5DSCB 3GJFB 4HWBL 3ETTA 1M2VB 3Q8CA 3DK0A 1MLBB 4FNLH 4NO5A 4U1MB 1QNZH 4PJBA 4DN4H 2P8PA 3VYNA 1V8HA 4D94A 3BKML 3I3DA 4L1TA 1QATA 2JCCF 1AACA 5HJ3A 4ZUVB 4XVTH 1BEXA 5CJQH 2E75C 1MRCH 4Z3EA 3VXME 2G0KA 3NIDE 2FH6A 4K73A 4ZI7B 3DETC 3MBEB 5DYOA 3W5NA 1RQ5A 3MTXA 4TLUA 1S5IL 3EO0A 4DEWA 3BKJL 4LC1A 3VB9A 2G38A 3CFJA 3IDUA 5FEBA 2ADIB 4E0RA 2AJZB 1U8HB 2B14A 3EDEA 4RFNB 2WVVA 3BD4A 2LU4A 4KKBC 3PDOA 4UCSA 3L1EA 4KX8A 3RDTC 2GJPA 4R6UA 2B5IC 2HYMA 4U7OA 3BIAX 3HG5A 5F7EL 1QI5A 3S36H 4LLAA 1LNUB 1OP9A 3PHQA 2X4TA 5FHAH 4BKLA 5HTSA 3ZQ9A 1N0LA 4U0QB 4J3BA 3TIEA 4XBFA 1FZOA 3GSOA 3MCKA 2JGUA 3X17A 5EU5B 4U1KA 4H88L 4MMYB 1CL7I 4BRVA 4EBQH 5DHVH 4K3GA 3ZN6A 1OGAE 4GKOA 5IHBA 5KSUA 4DV6B 4XCEB 3Q7JA 3FTYA 2NRDA 1UWGL 2KPWA 4GAGH 5ETUB 2JELH 4GI6A 3D33A 4IGBA 1RUKL 4N0YH 2Z7ZA 3K5OA 1PIFA 2X1QA 3JWDC 1MCLA 3B34A 3VRJA 3U4KA 3HR6A 1BQLH 2C4FT 2QPFA 2X3AA 2VRAA 2WXKA 3A6CL 3IMWA 3ME0B 3I85A 4FJYA 2ZSWA 2A9ML 4KRPC 4FEIA 1TU2B 2VL5A 4FCHA 3BFRA 5D7LE 2XYBA 2NW2A 3B83A 4G72B 4ES8A 3EO9L 1BVNP 3IGKA 1F4HA 4XBMA 3UT5A 2Z0AA 1NGZA 1E2WA 4E9LA 3BVNB 5EO0A 2JJTA 4GAJL 3WXVL 4QXVA 4J3VA 2ZM6O 1C5BH 3GT6A 3ATBA 3S2AA 3FX7A 3FQ2A 1HINH 3OQ3B 1KEGL 2VLKA 4IMLA 5KN5B 1GOHA 4NPKA 5E4OA 1NBYB 1J9SA 4WY7H 5IEHA 1J8RA 3SKNB 2FYUH 4I0XA 4D7SA 3TA3C 3T09A 3PHOA 5HJDA 4AGPA 1OCRB 2OZ4H 2AEIT 3MN8A 1FZJB 4NRXA 2C3VA 4HYOA 2PETA 5GGTH 1RZIA 2EIBA 5DQ9B 1Z0MA 2J1YA 2C5DC 3QUXA 5J4MA 2CTPA 4WHDA 1WVZA 2ZF9A 4I0KA 1ND0A 3MA9H 4M8QB 1K8AW 1MCJA 3M6DA 2R69A 1CICD 1DVFA 4P59H 4ISVB 4I55A 4V1DD 1QLEH 5HVGB 5CBEB 5L7XL 1XTLA 5E2WL 2YSTA 4RFEB 4P9ML 1ZAUA 4KHTH 4PJCA 5CSZA 3L45A 2BP8A 2XQBL 1AQDB 4MASA 1OLLA 4LF9B 4FL4C 4GQQA 5JQ6H 3UBXA 1F4WH 1XCQA 1E6OL 4LSRH 3L4WA 2BY0A 5CKGA 5FA3A 1N5YL 1QEWB 1X4ZA 2DL2A 2GEEA 2WGXA 3NJFA 5GRZA 4AG4H 1IEHA 4JPVH 5IWAO 1DBJL 2EXTA 3KWUA 1F23A 4YNYB 1MCKA 1MVFA 1UM4H 3M7MX 2WXQA 2YAHA 2YXHA 2A6DA 4WNQB 1D9KB 5B1BB 1NZ6A 4QWWC 2PWDA 3L8QA 3QDME 4QAMB 4WVRA 1I7ZA 1SMDA 3BW9A 2KT6A 3KG5A 3QQ4A 2VXUH 3A23A 3DSNB 4JREB 4A68A 4XC1H 4PR5A 3NIFF 5BJTB 1DFBH 2CO4A 2N04A 1KEMH 3ABKC 2H45A 4M61B 4WO4B 3C60D 4DGYH 4PJBF 2YUAA 2ITEA 3PFQA 3LEVL 5ESVA 3UYRH 3MLRL 5GZND 1NPUA 5FM5O 5IM7B 4XXDA 4E36A 3U6RB 1ZGLP 1JS4A 2W9EH 3QNFA 4PS4L 2MCPL 4LXFA 2YDEA 2WZPA 4ZW5A 1ZGLM 2RB8A 4AQ1B 4DN3H 1BVZA 4FMTA 2GYSA 5IW6B 3PJSA 3E22B 4A66A 3BH9A 4EIZC 5KBLA 1BAWA 3DJRA 5CLZA 4JTCB 2KLTA 2Z31C 2WBXA 3J80N 2W0FA 4HJGA 2L6LA 2ZYIA 5JW4Q 3TFKD 2BNQA 2V2TA 2XZQH 5CIPH 1MCDA 5GSRB 1DQJA 5J9PB 4KVPA 4A6YA 1GKEA 2NX5B 3FCUB 3ABTA 1JYXA 5I18H 2PWHA 3X11A 2OKMA 4G6JL 5TQ0L 4KTDL 3SBPA 4LSVL 2W5PA 1XF2B 2CO1A 2J8HA 5E9DA 5SWSB 4ZW3A 1H2SB 2EZOA 2UZXA 4YEEA 5C0AB 3P77B 5ABZA 4FFWC 5KZCD 4JCWA 1IC7H 4OCRL 3EDJA 2YIBD 2Q7GA 3CLFL 1U41A 4ZSOE 5F1KC 2IH3A 4GXUN 1I7TB 1ZSHA 1F4YL 3L3IA 1QBAA 2JIXA 2FO1A 4TYUA 3ZZQA 3IF1B 1SKVA 1JGUL 1MH5A 1CK0H 2CE6A 4GKZB 4OM1L 3B8NA 5DO2D 4G3YL 1PIGA 3KH3A 3MUGB 4QE9A 3UL4A 2R2CA 3BVOA 3AREB 3C09C 3GRWL 1PL0A 3OSVA 3Q5TA 1VF7A 1CS6A 4XBEH 4X5WA 3QIWA 2H4EA 4O4HB 3FU8A 2FL4A 5BVJA 4FQHA 3SJQC 1FI8C 4W6XB 4V1DE 2JCWA 1CFSB 4FLWA 1OTSC 2QFRA 3BX7C 4JHWH 3QJOA 3OR7A 1MNUL 2JVDA 2ADJB 2Y1ZA 4LIQL 2ZUQB 4N2FA 1GGIL 1HQ4A 1RZGB 4DR6O 5FM4A 4PHZA 2DDQH 4CH6A 3AK2A 3IM1A 4FM1A 4KZCA 3SKOA 1GPOL 5BZDA 2BVPA 4QXTB 5DK3A 3UGEA 2GG1A 4ANUA 4DAGH 1GC1H 3MDSA 1UFIA 5F0JB 3WFEL 5FYJU 5D1ZC 4APQB 1O5DT 4F9PA 4I7ZC 1UCBH 1UOLA 1WJ3A 1XGTA 4KRLB 1YVWA 1A22B 4QI3A 5INDA 5SV4A 4Y4KB 4P06A 5KTEL 1JYVA 3EJJX 5EZOH 4O4IB 3MUHL 3L3JB 5IYDO 5CXPA 4A2DA 4HZ3A 2GJ6A 2YAMA 1F6LL 4WEBH 5TE7H 4YL9A 3VFGH 1A7PL 5D96B 4RZCB 4UBDC 5DC4B 1CJYA 3IKCB 4MA7L 1PLGL 5I5MA 2K9UA 3N42F 1CTNA 2O6EA 3LYRA 4XNYH 2KDYA 2ARHA 1M05A 5IVXB 4WUUB 3GHEH 4NKDA 4P5TC 4OPHA 4JGJA 4JFOA 4NHUB 2ICEB 1DDHA 4ZPTB 3O45B 4PG2A 2LO1A 4UAOB 2XV3A 1E27A 3V4PL 1KGWA 4HIJA 3TZVC 2J1ZA 3ZN0A 3CHSA 1Z9LA 3MJ8A 1NEZG 1A6VH 2FECI 1HOCA 3UO1H 3DIVA 1JD7A 3BGFB 4F3FB 2F58H 5C0CB 3WIFB 1KGUA 1HJBC 4K71B 2IJ0C 5L2KB 4WI4A 5CU5A 1BBJB 2BSEA 1B6UA 4FYTA 1YMMB 4M62L 1GL4B 3QC5X 2CTQA 2NTFB 4Q52A 2F53A 2M8XA 2V3FA 3F84A 5DS8A 2KL6A 3NUKA 4FABH 1P1ZA 1CF8L 3ZHVA 3QVNA 4XVSH 2VXQH 3NIGB 3TV3H 4ETQA 5INCA 5E1AB 2DMBA 3F01A 3IDNB 5TE4H 1T0OA 4QOKB 3DX9A 3S96A 3KYKH 3H1JH 1FFNB 3MFGB 2AV1A 4FDWA 1F4MA 1BOYA 1S9XB 2IGLA 3MX0B 2HVKB 5JOPE 2QR4A 1XFPA 2XQYG 4G80A 4HKBA 2LGNA 1RJCA 2VIRB 1TT6A 2WSKA 2R29L 4K7PH 5TPWH 5AYUH 2EC9T 3P3TA 3GXPA 3U48A 3SSGA 5F9JA 3QIUA 4EN2A 4OV5A 2ZXEB 4MYPA 2YBGA 3FB6A 4YUEL 3K91A 5AW7B 1AGCA 2BSDA 4FN0A 1TJIL 2UXBO 3FCBA 1G7HB 5CR1A 4G7YH 3AQYA 2J5WA 1X4TA 4RH4A 4R7DB 4LKCB 4UCVA 4MVOA 5FYJD 3PJNA 2ZE8A 1SBSL 2XG5A 3SDXA 3GSWA 2LU5A 2EKSA 1T66C 4IOSA 5FUZL 3MTRA 2QTSA 3B8YA 4LVNB 3LD8C 4KQ4H 1OTUC 2VSKB 3DIFA 1OW0C 1U58A 5JHAA 1MFAH 4I4TA 3PPSA 4LRIA 2R0KL 1A7RH 2YIHA 2VWEC 4G8FA 1NCCL 2A9NH 2I26N 1W16A 4M9PA 1PAMA 4CS4A 2JGDA 2PO6D 3CLEL 2XQ0A 4X6DF 2VMCA 4WFAV 3HRZB 1D5BB 1UG9A 3QWQB 3ZRVA 5EBWB 3KH4A 4Z0XA 4BQ8A 5ESAA 1YNTA 5AUMB 1BJ8A 2DL9A 2XV0A 3BKYL 3MRJB 3PWLB 3RWDA 5IJVB 2BVYA 1N36B 2A9BA 5TQ2L 1LEKA 1ZLEA 3AROA 4XP5H 1LE5B 4HUMB 2JIZG 1UJTA 2DEWX 1VERA 3EOTH 4MZ2A 2PYFA 4I77H 4GRWB 1T2JA 5KHKA 1YYLH 4PRHD 3JWDH 3SDAB 3M1CA 4ZTPL 1YEKH 5IWAB 1HL4A 1T80A 5I17B 5JXAL 3OMIB 4PY8I 1NL0L 2UXGA 5C07D 3FU9A 1SOSA 4W4KA 2K6ZA 2RCVA 3MOBL 3CDZA 4ODXA 4MAZA 5IQ9B 1ONQA 3CH8A 1XGPB 1ACXA 4M5ZL 2VQFO 2KI6A 3KMDA 3CFMA 4GUCA 5HFLA 3CDCA 1J5HA 4LBEA 1N3NB 4XAKD 3ICXA 3ARRA 1MWAB 5BRQA 3C9NB 4FXTA 4WBNA 4K3DH 1N33O 1OT1A 1NINA 2VDNL 4JO3H 3O8XD 4WGVB 2EDHA 3FFCA 3VTTA 3O3DB 1DQMH 4YLQT 1A9BB 1JE6A 4P8QA 4YHYB 1U3HD 3JSLA 1EXUB 5E5RB 3Q0HA 1HYRC 2WXPA 4HKJB 2JJWA 4L9LB 1BGXH 4X9YA 3K80A 1FO0H 5T1MB 4B50A 2BY3A 3V4PB 4PJ5B 5M94B 1J8HE 3MROB 5I26A 5HVHB 5AENA 3BPNC 4AT6A 5DZVA 2ZE7A 2G75B 5CZXC 1OL0A 1FG2B 1U8NB 1A9EA 4MAYB 4UTAH 3RWEB 2H9GA 2ZAGA 3MFFA 2VLJD 4MB4A 4EJ1C 4YFEA 1JGLH 4NRYB 4NCC2 1V3MA 3FO2B 5SWQB 1JL8A 4I1PA 4L3CB 3DMMB 1BQRA 2VN4A 1QHPA 4RRPG 3QFDB 2QPSA 4JI7B 4NZUH 1ASOA 1XMEB 3WFDH 4Q2ZA 1MCCA 2WUBL 4G27B 2YMTA 4PCTA 5IGXH 2E6JA 4LQFH 1OGTA 2RHEA 5FGCE 4EB6B 3B09A 5H2FZ 5KHIA 1E40A 1HQRB 2OL3L 2I5YL 2XZAL 3BO8A 2O1AA 4Z0BL 1NFIB 5IJBC 5LP6C 3BEWB 3HJEA 3G9AB 3HE7A 3GB7C 4OFYD 4L4VD 4MMZA 4YGAB 3PIQA 4GBXC 2C4XA 5LHHA 3HB3D 3S9DB 4YDLC 5SX5H 2FGWH 4G6FB 3ABLC 3T2PA 3HC3L 2GB2A 5BXZA 4KITB 3HKEB 5JH7B 4TV9A 1JV5B 3DX0A 3JAKA 1HXYA 1TEYA 3LPPA 4HWEL 1JDCA 1O6VA 1UOVA 3SPGA 5EIVA 3UZQA 4L1LA 4HU8A 3ZOAA 4HS3B 2DOCA 4HBCL 4X8CA 2QWPB 4CSZA 3CNKA 3T0BA 4MBRA 5TH2B 4NM4L 3UP1A 5BZZA 1IKFL 2OI9C 2YWYA 3GS7A 1VFUA 4PRHE 4JI6B 2WYZA 1UOKA 2YMXL 2RR3A 1BX2B 3O2VH 4U1JB 4Z3HA 4OW6A 4DUWA 5IE9A 4WCYL 5C07E 3VNZA 3ZY7A 5D1XD 1E2VA 2F4VB 3V9EA 1P6AB 3CC5A 3WUWA 1UB6A 3GSNB 4ODHH 1TFHA 2A5UA 2BY1A 2VS0A 3C5ZC 3HKFA 2H6UA 4NZFA 1VGKB 1OT2A 1AZBA 1KB9J 4Y4HA 4B3RO 3ULSA 4AQAB 5A2QN 3MXWH 3HE6B 3D2UA 3ECVA 5FDWA 4FFVC 3L9YA 2OAAA 1ZXQA 1DR9A 2E8ZA 3C6LC 3BP5A 2ZAIA 1WA8B 3PGCB 4UT7L 4ZPVA 1CE6A 3FTVA 2CGYA 3WNOA 4YDVB 3FQTA 5CEZL 1AYRA 4OBRA 4PVBA 4LFAO 1P4BH 3OKDB 5A3ID 1WAZA 3ZRXA 5IREA 1Q90A 1XSOA 2MWCA 1JWMA 2YJQA 3ULUL 1FHNA 1S0VA 4PRID 3CX5F 3S98A 4BCYA 2Q76A 2HFGL 3L72H 5GS1A 3H4HA 3QRGL 3ARFC 4JFHD 4GO9A 4ZTOH 2FT8A 3DRQB 4PV8A 4O58H 3L5XL 5F3HA 3T3PF 1TJHH 1HNXB 2VLJE 5E99H 1ZHNB 5EOQH 4PRNA 1YPZE 4JHAL 5EA0L 4JY5L 1CDCA 3QPXH 1USQA 1QSFD 3F83A 1L9OA 4I2XB 1TCMA 1RZPA 5I15L 3JTSA 1C12B 3PS6A 5E94B 5F3BB 2J8UE 3L3GB 3OG6B 4E9YA 1E0OB 4ZFFA 1N8OE 3CCMV 4N5EC 4P9HC 2XUMA 3NGBC 4R9HA 4H13C 1YECH 4O9HL 2YBRB 3S35H 3BP7B 4KK6D 3VX0A 4QJ4B 1ILSA 4OJFH 1OCCC 4L1HA 4Z1PA 5IQ7L 2CHWA 3LRMA 5DM6V 1L6ZA 3EG9B 3HUJB 3TYGH 4DTGH 4ONHB 4L4VE 3VQXA 1H8SA 1IAOA 3LNIA 3ZUCA 1NAKL 4EQ2A 4K55A 3HNTL 5IYCO 1SQBH 1XZ0B 4N0CD 3FK3A 1GXEA 4X6FA 1NTMH 3IDYC 1HE7A 4HU2A 3GINA 3DUSA 5EYPB 3M86A 4AYGA 4A2GA 4OF6A 3KVQA 1WLHA 5GIRA 3ZEDA 3IDGA 4OTXL 1ZLVK 4YBLC 5BQDA 3S8FB 3DO7B 1QBML 4G1MB 4NSKB 3WHXB 2ETWA 5JMRA 1J5CA 2NY1D 1QNMA 2BXZA 3IDXH 3ZMVA 1O9WA 4I8DA 3QE5A 4WKZA 3V0HA 3WN5B 3RFRA 1I1YA 1TCRB 5DUPH 2NXZC 5DLMH 4FQ2H 3CCLV 5T3ZH 3S5LG 3CWGA 2WTOA 5JHDA 3O6FC 3LXUX 4YBHA 1ZLSH 3RFZC 1VEPA 1QRKA 2NQ3A 4JQIA 2XA8L 4ES9A 3SO3B 4FG4A 1CPUA 3ATFA 3CMOH 3QXAA 1IGYA 4MWFA 3V6OA 3QJFA 4KJPC 2Z3YA 2FB4H 2YS4A 4LP5A 3QUHA 5C6TL 2F1MA 3BXNA 4W9LC 5K59F 4QRUA 4PDRA 2VXTL 3ET9F 3N1MC 2VUKA 5IHWA 3N04A 4OCNC 2OTWA 1RM1C 4PEEA 3T6WA 5FB8A 1V7NH 1WFIA 2MW2B 3ZDYB 3MRLA 3N55A 1YO4A 4X9GA 2GFBA 3G5ZB 3H9SB 1KDIA 5IY5B 1L7TH 3UTSB 4PJHA 4DR3B 3L7FB 5DA4A 3UH8A 2OMVA 2UZPA 1JV2A 1Z9NA 5D93B 3RIFK 3CRCA 2XFXB 4PRIE 1NDMB 4AE0A 2Y07H 2XNAB 1GCFA 4JAUA 4UUJA 4Z6AT 5I0XA 3HKDB 2GI7A 5D4QA 5I1AA 2LU7A 2X42A 3WE6A 3PAVA 3HHMA 3MACL 4AKPA 3JV6B 3ZTNH 3SDDC 5C8YB 2WBJA 5E79Z 3MJWA 5IFJA 4F7EB 1ODUA 1QSFE 4IRSC 2XXMB 2KZBA 2LAGB 5D2LB 2VQFB 5HHOB 1PLAA 3VE0B 1SY6H 2DTMH 5A7BA 1UEYA 4IS6A 3E2EA 4LCWD 1L7IL 1IM9B 2O5YL 4KV5F 4I0PA 3A6BL 3F7RA 3W0WD 5ACLA 3AGVA 2Q86B 2CALA 5LCVA 3AWFA 3C8KA 5C0GA 4X9QA 1RMFH 1JJOA 1PJ9A 4I89A 5DHVA 4DV7B 1IGFH 5EOCH 1GVIA 3HG3A 4PMEA 3S8GB 2R2BA 1ZVNA 1FFQA 2BNUA 3QZWG 1NCGA 5ENWA 2ICCA 4R4BB 5C08B 3UTZA 3U1QA 3SCMB 4OLYH 5GTIZ 2VDRL 4D0CB 4LNUA 2ARWA 4PY7B 5DA0B 5HYQA 2IDFA 1PQZB 2K4WA 1NQTA 2WZ0A 2VWJA 1JF1A 4NC0B 3GK8H 2VN5A 2WQAA 1SJXA 5FO9A 4Z18A 1L5GB 3V0GA 4OFKA 3EBAA 4Q0XL 3TN0D 2DQTL 4HWZB 4NX0A 1UA6L 4X5PA 4KAQL 2BZCA 1SC5B 4FERA 1Q86W 1FYTB 1PG7X 4D9RD 1TO4A 4H8QA 1MJ7H 2DS4A 2WAHA 4DR2B 5JHMA 2AEPL 1HYSC 4RGNB 2Z7YA 3R18A 1UGKA 2IQAA 1G4YB 3PABB 4FI7A 3AS2A 4R83A 3PNWB 1B0GA 1NANH 3ZT5A 3LB6C 1J5EO 1PCSA 3OHMB 2CK0L 2VR4A 4M5YH 1MJJB 3Q6FB 3X1NA 4EPSA 2QJ1A 3RDTB 4JO4H 2FUTA 4QT5B 1AHWB 3TJHD 5EC2C 2CDGB 5D72H 3ZJZA 5F9AC 2E9JA 1M2OA 4WTZA 4ZO9A 1VKXA 4PHXA 5AAPA 4Q8BA 1LO4H 1F58L 2ZXAA 1DVSA 4X8XA 1AY1H 5JIKA 3ESMA 1MKFA 1IGTA 4UU9B 3GYRA 4EEEA 1OALA 1KBKA 3NSYA 3AS3A 4POZD 4J9YB 3BUYB 3MHHC 2PPEA 4DR4O 2YAEA 4F57H 1A0QL 1ADWA 1P4LB 3DYOA 2JJUA 2XWTA 2VM4A 3FO9A 4MX7A 5AAMA 4JHVA 1G6UA 2C3HA 3W9DB 5DD3L 4FHJA 3U1SH 4I5SA 2C3XA 5B7FA 1AQHA 2CBPA 1QHTA 2CLZA 3JV0A 4L5FL 4OJDH 4Y16C 4MCYA 4QPEA 4ANKA 1HR0B 2J8OA 5AW1B 2DI9A 2AK1L 2AJ3B 5I0WA 3BVXA 5HGHB 1XIWC 2AABL 1EHAA 1VZIA 1BBDL 5CJ8A 2RIKA 3MRHA 4PLKC 3D85D 4KKQA 2WTRA 1MCWW 1L6PA 2ZUSA 2HH0H 4B3RB 4DPBX 4F58L 2ZXWC 3PL6C 3IJ4A 1YQVH 2WZAA 3W0WE 4NQCE 1I8MB 4IYHA 4UOZA 5AOIA 4LFBO 4RGOL 5BZWB 4FZ1A 2ED6A 3F04A 5TE6L 2AW9A 2BZ7A 2ZE6A 1SF5A 3K1KC 2C9RA 2K1EA 1XILA 3CU7A 4PJHF 4LFAB 1V54C 3GM8A 1D5XA 4F7TB 1JOIA 5AZ2H 3U2SA 1OO2A 5I16A 4OZGB 4X6CA 3J2PA 4GKSA 2DJUA 1NSNH 4TVUA 3ROOB 2ESVA 4IRJD 4P2RD 2BO0A 4J6IA 5E8OA 5I75C 4KNQA 1THCA 2KH2B 1P5UC 1TMQA 3WEBA 3DA0A 4DQOL 2G3NA 4M6ML 4BWWA 5EF1A 2QSAA 2VRKA 3G5VA 1R9FA 1I8AA 3KBFA 4KGLA 1XCTA 2DJVA 4WK4B 5A40E 3HZMA 4KI5D 4K23H 5CIPA 2Y7OA 3DVGB 3SB3A 1J9TA 2O6FA 4IMKC 5KX5A 4PGDA 4P99A 1Q5OA 1E7VA 2ARJA 1UPGA 3RVYA 1MW1A 4HFWA 1CBVH 1B3JA 1NC2D 1Y18B 1F3JA 1A3LL 3AUVA 3HR5B 5IQNA 4XPTH 1MUJA 2YWZA 3OGCA 4WAFA 3S6CA 3VO0A 2C4FU 1H6UA 5I1JH 1RIVL 3AXIA 2NY2C 3P3YA 5GJTH 4HMDA 2BE3A 3NH7H 4PJIA 2GY7B 3CZKA 4GW1B 4X20A 3JCUZ 4PJXA 4QF1B 5KVEL 2G4GA 1Q1JH 2HFFA 2HT4C 2ICES 5GONB 5JWPA 4PJDA 4XP9H 3VSQA 2YGQA 3SYCA 4K8RC 4LLQA 3RX8A 3W11C 1FNEA 3COOA 4GKKO 1SZXA 1XF4B 1B0IA 4JFQA 5ACMA 2UWEE 4MVSA 4MZRA 1O7VA 4JVWA 5AVXB 2ZOKA 3RWHA 4UQBA 2OSLA 3VFVA 4Y5YB 1YZBA 3CVIH 3TBWA 5T1LB 3VWJB 1MCNA 1GKOA 3KPRA 4EI5C 1MQKH 2F74B 3OAZH 1I9EA 1MAKA 4O4JB 3FO1B 1YDPA 2UZIH 1U8KB 2V17H 1TVKA 1I3RA 4R4ND 5F7FA 4TNGA 1J8SA 2WOYA 3EFDH 5MEQA 1FORL 1QCEA 1WCBB 2VH5H 3QQ9C 4LLDB 5ADPH 2LLLA 3OAUL 5AD0B 4HKZA 4FNRA 4WEMB 3CJHB 2QVFB 3ROLA 4HA1A 3RTQD 5I2IA 4P9HH 5L3GA 2NUPA 1KLFA 1UM5H 3OUFA 1WIOA 1HK6A 1X7TA 4YXKL 3MLUH 1JMXA 5K1XA 2N56A 4P2OC 1HDMB 3OAAG 1RV6X 3GBNH 2BS71 4CMMA 5I5IA 4I18B 1X7QB 2CGOA 1P7KB 1U6AL 2ATKA 2D7TH 3CZJA 2LFRA 3JD4A 4P2RE 4HZLA 1VQOV 3LZQA 1JMZA 1B4JL 4R3SA 4UTBH 4PJ9B 4X4YB 3CLWA 1XXFC 2WWKT 5FCUH 1ZV2A 3KPNB 3MNWB 3MV7D 3QRLA 4UQEA 3TBYB 3PYCA 3VXTA 1TZ8A 2P5PA 3P0YH 4PWEA 4NS0A 1VF6C 2J72A 4KI5E 3QS2A 4HSAC 5J11C 2ADFL 4DK3A 4NKOB 3QQNA 5A9GA 4Z8FH 1KECA 2FLRT 5EC1A 2NLJC 3T2NL 3ZTEA 8CGTA 3MJ6A 1R1CA 3K81A 4JPQA 4XP4H 4ENZA 1KKCA 5IB5A 2QWOB 2IH1C 4JFED 1EO8L 3OW2U 3IGAA 2O72A 4XNUL 5L9DL 1HXKA 2DYPB 5CKAA 5EORH 4XWGH 3FB5A 1S2EA 4C83B 3EUDA 2BSBA 2EXWD 4H0IA 4QHUB 2DMKA 2E76C 1RURL 4HS8H 2VXQA 1M7IB 3B9EA 3PWUB 4H20H 4B27A 2GBVA 2IAMD 3HZVA 2QT6A 1K4CB 3MRKB 3EZJB 2JNZA 1PYWB 4X6CF 4I7ZB 4NXNB 2AGJH 2IPKA 2YPKA 5F88B 1KXTA 1ZANL 5KYUB 3T71A 1LMIA 3GIVA 1N7ML 1SQVH 2XQYA 2DWTA 1MIEL 3HCVB 6PCYA 1YEFH 4NQXB 1FP5A 4HWBH 2HEPA 4YE4L 3EGSB 3MZGB 4LGRB 3MYJB 4HJIA 1WZKA 1T0MA 3MV8D 4XOBA 5IMKB 1TQUA 2JI1A 2W81C 3O3BB 3OPZL 3PXHA 4YHIB 4OZ4B 3I9IA 2WLLA 5JUEL 1YNLL 1KXVC 2QGCA 4NM8L 1NTKH 2R0LH 5TFSL 4B7LA 4BZ1L 3LMJH 1NGYA 4PGEB 1ZHLA 4J6RL 4TUOB 1M53A 4ZUUB 2I7SA 4N0UE 5FYKU 1JNJA 2D73A 4A37A 3RUGB 2XZCH 4MZ3A 1XV8A 2R27A 2VC2L 3K59A 1GW0A 3NSFA 1INDL 2BERA 4W9FC 3PPEA 3LS4L 4Y2DC 4WENB 4PJIF 3NSJA 4UDTA 1FFXA 2X6MA 3B77A 2EYSA 3OKYA 3OR6C 1WT5C 3AU1B 4PJXF 4J4PA 3RYMA 1JNLL 4BZ2L 4IDJL 4PA6A 4WHTA 4QHKI 2GHZA 2GSGB 2VSMB 2V4LA 3KBEA 5ANMA 5FGSA 3ORJA 4IBVA 1L6XA 5H37H 5H37G 3NJGA 4KUCF 2CUHA 2LVEA 5EB9A 1KIQB 3DV6B 1S9KC 3I6LD 4NAQA 4Y1AA 2W0PA 3BQUA 1BZ7B 1BGYH 3OJDA 4G11A 5I74B 3LZNA 4H88H 3X1EA 3KXFD 4HAFA 4NJAL 1U91A 5DMJB 4MNGB 3E6HA 4Y19B 3M88A 1M7UA 1JERA 1E7UA 2IBZH 3CG8A 5DUBA 1JWUB 2FEDD 3MV7E 1BVLB 2Q9OA 1RUKH 1DZ0A 2PKDA 1RJLA 2X9ZA 3K8MA 5IVOA 4YEFA 1U97A 1RVFH 3C5XA 4Z7UE 4YSRA 2EH7H 3HKBB 1T22A 3Q9PA 4HQQL 2YOAA 4E5XG 3CFDA 3BDBA 5MEPB 3ZHKA 5GRVK 3A6CH 4JN2B 1NCTA 4ZHQB 3CE1A 1JGVH 4LEBA 4X6BB 5DFAA 4Z7NE 3D0VB 3GRGA 3K2MC 1YEDA 3ZXAC 1P7QA 3ARTA 3N2GA 2AK4A 2A38A 3DOIA 4Q89A 3BKCL 3MNZA 1DO6A 4LFCB 4HH8A 4NZRL 5L3CA 3E8HA 1MIMH 3UYPB 3WXVH 5F9WC 1HXMA 1FAKT 1RLWA 4X65O 1XR9A 1FNLA 4W68A 5D2NB 2YXMA 4OI8A 5T1DL 3TA3A 5I6XC 1IJNA 3QZWB 2UXTA 1FO0A 3F7PC 4TNWF 1AXIB 2VLLA 3ILPA 5ACZB 4KK5C 3O6ML 1UWXH 3QJZA 3EGXA 3K2UL 3POHA 4DGUA 2J88L 5JIMA 2AHZA 3IMTA 3DXAE 3MGTA 1G6RA 1KG0A 3MRPB 4AKQA 5FYKD 3DOSB 4HJTA 2DYRC 3PQYA 1U21A 4UTAA 1TITA 1I85C 2CIKA 3BAAA 3L73H 3SY6A 2FYYB 4MD5B 4NUQA 1QVFU 2GW5A 5L7XH 4RRPA 3IN2A 3MODL 4HUWA 1GGBL 2NY6C 1Z7JA 1OLZA 2P8LB 2ZUUA 1IMHC 2CO7B 2IH9A 3F62A 4P4KA 4P9MH 5HY9B 4AENA 4ZBJA 2XQBH 1VHPA 1G84A 2EC9U 1PJWA 4G6AD 2DW4A 3VXMB 3L3KA 1E6OH 3NIDB 1UT1A 2MKWA 3UZVB 3OWEA 3RYCA 4YVUA 1N5YH 4LNVA 1J05B 3SE6A 4KZDL 3NDYE 2G0LA 4DKDC 1DBJH 4R8WH 4ZTEA 3B2UC 2RFXA 1HSBB 4LLYA 3FHEA 3T2QA 1X44A 2MNUA 3IU3A 5HI3C 1KLUA 1PAZA 5JHLL 1I53A 4IU3B 1CFBA 1K5SA 3MR9B 4AIXA 4BSVA 2XTJE 4JFFE 2Y69C 1GM7A 2YD5A 3QZPA 3MREA 4E9RA 4Z3JA 2F9BT 1H19A 3I6LE 3V2AR 4JPSA 4GINA 5H2BB 3S3SA 1BD2E 1I8LC 1MFCH 2Q6WB 2B1HL 1RU9L 2AQ2A 4FFZL 1JXJA 1FJ1B 5J6HB 2F2HA 3LEVH 4B97A 1Y6NR 5DK0A 5SX4H 3KXFE 2FBRA 1T04B 3MLRH 2HN7B 1HH9A 4H0LB 3D4GA 4JYAB 2HFTA 4RAUA 2A9CA 3VWKB 2VC2B 2LU3A 4N21A 1MN4A 2MCPH 2R4RH 5B1AB 1F6FB 1OGAB 3JWNC 4EXPX 5KVMC 4KXZI 3A2FA 2XG4A 3L9EA 4UCFA 5A2AA 3CQQA 4FLQA 2Z31A 4LPUA 3VXUA 3PAZA 1IT9H 3A5VA 3WIHL 2BH0A 3AG2B 4UI2A 1KPVA 1NICA 1JZ7A 4UVCA 4LASL 2CPUA 3SGIA 1AE6H 2QQNL 5LXGL 2GHWB 1U3NA 1V55B 4R97B 1SDDA 4FQXB 4GW5B 3NACL 5GZOD 3CK0L 5D7LB 1N10A 5TQ0H 3KBHE 4KTDH 4HVBA 4LSVH 1MCOH 5K9JL 5BR8B 4X4ZA 4DUZO 2EJ7A 2A4CA 1VADA 1NI8A 5JQGA 4HPOH 3RIKA 3K0DA 3ETEA 2ITFA 4ZD3L 1KCWA 2X6BA 1HKLL 4HIIA 4DP4X 5LP6B 4KJYB 4OCRH 1CXLA 4G8GA 3CLFH 4H2AA 3IFPB 3AB0B 7FABL 3D39E 3GB7B 1BMZA 1F4YH 1TNMA 4YO0B 2YPLD 3SDCC 5DURD 3IJ9A 2OYPA 4OM1H 5F0MB 3BD3A 1VFOA 4G3YH 4XHQA 1G7QB 3AXLA 4U3CA 3ABLB 3GRWH 3EJUA 5J89A 2IU3A 1SF9A 3AEIA 3D36C 1UYWH 2VDKH 3O9OA 4K3JL 4OLXH 4PWKA 4URKA 2Y7QB 3KS0J 1WLEA 1BIIA 4YPGA 5IT2L 1QYGH 5AQ0A 3ZE2E 3LZRA 3CVHL 2G2RA 1EZVY 4AMKH 2ZKOA 1K3IA 3N41F 2YIDA 1UEMA 2A74B 4JY6A 5I1CH 3RB5A 3VXOB 3HPLC 2CUIA 2I69A 5C0NC 3CN4A 4EZLA 4YJ2A 4X8GA 3RKDC 2OX5A 4LIQH 3X12A 1GGIH 1HIML 4AYBA 2IOIA 1N59B 1MFBL 1UB5A 1VF5C 4XMVA 4NDMA 3QPKA 5D1ZA 2CKBA 4MJ4A 4PJGE 4Z78B 4J23A 3SO5A 1X5FA 3AG3B 3ZHFA 4NPJA 4TTDC 1EWHA 3WFEH 3WFHA 2XETA 2QJDA 4YY3B 2H3NA 4LFHD 4LP8A 1UM6H 4BUGA 3QDMB 1OSPL 4QTHB 3EYOA 1ZRUA 3EFOB 3OFNG 5C3LD 1AD0B 1JFHA 2WUCH 1S5HC 4MA7H 2PWEA 2JS3A 2QKAA 4ZXBD 1QR1A 1NPJA 4OBSA 3WS6C 3H1KH 3UKMA 2NY4D 4P5TA 3SJVD 3WB2A 2AI0H 4I85A 4K5OA 3ZGHA 3S5LA 3CIAA 1HWWA 1PMYA 4CN1A 1QSEA 4G9FE 5GGUA 3M45A 5D1QC 5DVOA 1QABA 4XC3L 2WXOA 3K72A 3TZVA 4RQQA 4LSTH 4BFBD 1Z3GL 4GKJB 4ZX5A 1NMAL 3UTOA 1RY7B 4LCCB 1U95B 3GXUB 5E4EC 5JR1L 3E8FA 2P4AB 1E43A 5I23A 1A3ZA 2R0WL 4YS4A 2IGFL 3BP6A 4PCKA 3QEHB 4Z3FA 1G0DA 5EN2A 6FABL 1MVYA 5LVEA 4PN6A 2MH4A 3ARBC 5FNVB 4TULL 1N8ZB 5GGSA 3VDBA 4AIOA 4YHHO 3H56A 4FG6C 4N6QA 5DJAA 4PTTB 4LSSL 1ZLUH 4H13B 1VJSA 5JTWA 2B2XL 3KZ8A 3US0A 5IV2A 2G2NA 4FXKC 4MSWC 3Q48A 1CF8H 1RFDL 2CMRL 2MIZA 2FWOB 3ALWA 4P3CL 4X4XA 3VJ6A 1GZPB 2FQFA 2UXVA 3SPVA 3FUFA 1KGIA 2J56A 1DCLA 4ZSOB 3TBTA 3MPCA 2UY7A 4YJ3A 2MJWA 5BNXD 3P32A 3TO4D 3BPLB 2WCGA 4AKOA 2PCFA 1PY0A 2B7DT 3WU2Z 4PB9L 4QRTB 4ZMTA 5BMFL 1TVHB 2ENPA 3IMSA 4HXAH 4L3EE 5FA4B 2VLRA 1OP3K 3R4RA 1CUOA 1R5IA 4KY1H 5DVNA 1FDLL 2R29H 4IIQC 2ZE0A 5MENA 3WTWA 3QRFM 2C7UB 2ETNA 3MUUA 2CR3A 3O41A 1ROCA 4L4TD 43C9A 3QYCA 2IDTA 3JAWA 4L9DA 1SY6A 3BIBX 4V1DB 2ZTBA 2RA1A 5D5ME 3LKOA 3C08L 1AKJA 3MRBA 1F41A 4F7KA 5E9NA 2A1WL 2EECA 3BAEL 1Y74B 1SBSH 3F12B 4ZNCD 1XCXA 3MV9A 3LZLA 1NBZB 1QVOB 2BIMA 3LTVA 1UZ8A 5FUZH