5KUMA

Crystal structure of inward rectifier kir2.2 k62w mutant in complex with pip2
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
326
structure length
326
Chain Sequence
CRNRFVKKNGQCNVEFTNMDDWPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of control of inward rectifier Kir2 channel gating by bulk anionic phospholipids.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
molecule keywords ATP-sensitive inward rectifier potassium channel 12
total genus 88
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5kumA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 5kumA01
4H37A 3ABLC 3EFFK 4PA4A 3BEHA 2EILC 4PDMA 3SPCA 1XL6A 2WLIB 2Q69A 4RUFA 3RVYA 3RBZA 3OR7C 3FB5C 3OUFA 4PA9A 5EC1C 1LNQA 3SPJA 3IGAC 3GB7C 5E1AC 1OCRC 2HVJC 4TWKA 1QLEC 2DYSC 2IH3C 1BL8A 2X6BA 3F5WC 2GIXA 3K04A 3AG4C 2BOBC 4LCUC 3UM7A 1U4EA 3T1CA 2HG5C 2HJFC 4WFFA 1J95A 2Q68A 2R9RB 4R8CA 3RVZA 2EIMC 3IFXA 4X89A 1K4DC 4DXWA 2WLIA 4MVSA 4BW5A 3OR6C 3ATBA 3ABKC 2A0LA 4GX1A 2AHYA 4P30A 2WLJA 4RO2A 4WFHA 5EBLC 3SPGA 2WLMA 5B1AC 2E4FA 4XDKA 3LDDA 3OUSA 2AHZA 1P7BA 2DWEC 3OGCC 3ATEA 2ATKC 3F7VC 2DWDC 3E86A 2OCCC 3AG2C 4J9ZB 4JTCB 2HFEC 2WLKA 3SYOA 1R3IC 3FB6C 3K6NA 1KKDA 4PDLA 1OCCC 3T4ZA 4QE7A 4X8AA 1R3LC 1OCZC 2EIKC 1V55C 4PA3A 3LUTB 4MVOA 4HYOA 2Y69C 4CBCA 2WLLA 3F7YC 2IH1C 4XDLA 1V54C 2H8PC 4GX0A 4WFGA 5IY5C 5KUKA 3TCUA 4X88A 1U4FA 2ZD9A 4HZ3A 4JTDB 5EK0A 3ATFA 3K0GA 4MVQA 3VOUA 1ZWIC 1R3JC 2Q6AA 3ABMC 4PA7A 4PDRA 4RUEA 5CBGA 3ZRSA 3KG2A 3FB7C 4G28B 4R6ZA 4PDVA 2JK5C 4MTOA 3WG7C 3STZC 2A79B 5B3SC 4MVMA 1S5HC 3AT9A 4PA6A 4GX2A 3AGWA 2KB1A 3AG1C 2X6CA 3JYCA 3T2MA 3K0DA 5CBHA 5BZBA 4P9PA 1JVMA 2DYRC 2HVKC 3K06A 5EC2C 5KUMA 4H33A 3UKMA 2W0FC 4R50A 2NLJC 3SPIA 4P2ZA 3STLC 1N9PA 2ZXWC 3E8HA 1ORQC 4XDJA 5EBMC 2WLNA 2EINC 3SYQA 2QKSA 5B1BC 3LDCA 4QE9A 2QTOA 3E83A 3PJSK 3SYCA 3AG3C 3K08A 4KFMA 3X2QC 4F4LA 3ZJZA 3E8GA 4MSWC 2ITDC 1M56C 3ASOC 2X6AA 3LNMB 2P7TC 4MVRA 3T4DA 1G4YB 4LP8A 1R3KC 3E8FA 2WLLB 4GX5A 4MVZA 4JTAB 2K1EA 3E8BA 2BOCC 4UUJC 2YEVA 4MS2A 3ASNC 3ATDA 2A9HA 4OXSA 4MTGA 3LDEA 3AT8A 1M57C 4J9YB 3FB8C 4G27B 3ATAA 4QNHB 4P9OA 5J9PC 4EKWA 4I9WA 1OCOC 3AUWB 3E89A 1K4CC 1XL4A 2Q67A 4LBEC 4MW3A 3SYPA 3TETA 3R65A 4MW8A 3SJQC 4RAIA 4WFEA 2WLHA 3HPLC 5EBWC 4MTFA 4ZBMA 3VSQA 3RW0A 4R7CA 2ITCC 2EIJC 4MVUA 3K03A 3SPHA 3SYAA 5CBFA
chains in the Genus database with same CATH superfamily
4UV7L 2APWA 1Z9PA 3W82A 3SBPA 4WEBH 5IK3B 4NO3A 3EXAA 5DRXB 4AKPA 5KSAB 2Y7OA 1NAMA 2CKBB 4JDEA 1D5MB 4LF7O 3BH9A 3QQ9C 2ZKWA 5JPMA 5LYJB 1KCUL 4L5FE 3CSBA 4HK3J 3IDGA 4U1HB 3L3HB 1JJUA 2F54B 1QYGL 3KPRB 5DJZB 4ENZA 2ZCHH 4Y16B 5A2IH 1U58B 2D2CC 5LGTA 2LT9A 4KXAA 4TVSa 2ZF8A 3PLYA 2ZYSA 3ZHKA 2HTKD 1FGNH 1DJSA 4LSTH 3WJLC 1KGCE 2VDPH 4HCRH 4KOCA 3DYOA 5E79Z 3UAFA 4XGZA 5DRNB 1AQMA 4JJ5B 5F1SA 1U0QA 3OKOA 3FB6C 1D6EB 5D7KE 2QHRL 4QWWD 3SE3C 3RA7H 1NUFA 5BZWB 4OCSH 4D2NA 5AB9A 5L9DH 2DD8H 3BJLA 2LU5A 4PJ5B 4YL9A 4YHNA 2X3BA 2WC7A 1GM8A 1BE3H 1E8YA 4WJG3 4EO5A 3EO1A 1E9QB 1Z5YD 3FUFA 4IHOA 5F88A 4L1BA 2PUQT 1WQVT 2NY5L 5JO5B 2P80D 4QJ3B 4L8BB 1AP5A 4GZRB 5HDQL 3KLLA 4QRPB 3DV6B 1AI4A 1TDQA 4X7TA 2XG4A 3JTBA 1YQVH 1M7DB 2BNQB 2Y24A 4FADA 3IXAB 3EADA 2IQAB 3SQRA 2GDSA 1L0NH 1JGUL 3WFDL 2R2CA 4AH2B 2QWQB 3IFNH 1IC7L 4FXLA 4L9LA 3QJFB 4OX9B 4X9IA 2QLVB 2E47A 4KVNL 5EZOL 5J2UA 2X7LA 4E9WA 1XNRO 1ZJBA 3S37L 2WKLA 1HYSD 3RWHA 2AXWA 1RLBA 1X5HA 3ZHSA 3OLGA 3HLAB 5LCVH 4NBZB 1J9RA 1U3ZA 1AACA 3FT3B 3LCYA 3RGVB 2V9UA 2DLIA 3CC5B 4NB7A 3RX8A 3EO9L 3NCJL 1NCDH 2GB2A 3L7FA 5EMYA 3MU3A 3IAPA 4LB8A 4L5FH 1OGSA 1YEJL 3K0WA 3CJHA 5AVRB 4X1KB 2NY2C 5KA6A 2V3EA 2WXKA 2BK8A 2UXTA 3HNTH 5DFVC 4EN3B 4X4ZA 4OPHA 4JY5H 3VXOB 1UQSA 3O6KL 4P06A 3NGBC 2QJDA 1SUHA 1P7QB 1YY8A 3F3HA 5DRNA 3GSXB 3V4UL 1CD1B 1XSJA 5GRVK 1H15A 2BE3A 4HUWA 4KKCC 4KZ0A 5A16B 2ZE5A 3E0GA 4FULA 4P9ML 4BE5A 5IJKC 4U3JA 2VQ4A 3BRGC 5FO7A 1ZLSL 1TQVA 4O2CB 5I1CL 3MGOB 4JO3L 5D7LB 3GB7C 3TNNA 2X70B 4KTDH 4NAMA 4DR3B 1UWXK 3TLRA 5F3BA 4FI8A 1VSCA 2UU9B 3PWPE 4GW1B 4LIQE 2IADB 4YN3A 3T3ME 3DUSA 1EGJL 2BVOB 4ANXA 1UOWA 4JG0H 3ASNB 4PJHF 4YC2B 1S5HA 2QGEA 4G2AA 1TQSA 3UYRH 1N4CA 2H0FA 1DVFD 1SOQA 5C8JB 3D36A 3LH2H 5EO1A 1MI5B 3HG0A 4JM2B 1WBYB 5HYQA 2FLBT 3FKUS 5FYJH 4U1JB 3BZ4A 5K9KB 5B1AC 5HP5A 2J8UF 5E2UL 4F9PA 2XQBH 3S88H 1GKEA 3U6XA 1R3LA 3EJZC 4N9GA 3I3EA 5D1XD 3C6SA 4NS0A 5JW4M 2ARJA 2V8MA 4DK5A 4LP5A 2VWKA 2HVJB 5LMUO 1AVAA 3FRPB 4LCVA 4JZ2A 3MCKB 3FT3A 3RGVA 1JZ2A 4X99A 4DUXA 3U4KA 3U7WL 3PGCA 1MH5B 1SUJA 1JV2A 3UABA 1FZKA 4NYKA 1JNLH 3R06B 4MS8C 1NKDA 4AQYB 4N90D 4TF4A 5FYKU 4HPYL 5M7QA 4M6OH 3D8CA 3BVTA 5DRWB 1DSWA 1HINL 3NZSA 2R23B 3K59A 4R7DA 1H3GA 4ERSH 1WFJA 1OCCB 4CC5A 2OK0L 1MRDL 1N6VA 4EI6A 3HAEH 3PGFH 4PJAB 4TQEL 4YHIB 4ABUA 2OCHA 3QQDB 3VFPB 3DV6A 2EO9A 2VXUL 3VRIA 3L74H 3O4OB 2KHAA 2VJ0A 2J8UA 2MPVA 2BP8B 4MSWB 3UQ8A 1VQ4V 5BQ7B 5C97A 3K46A 3P73A 4MAYA 3W2DH 5I30L 4OZHF 1GAFL 3CVDA 1H15B 5DD1H 2DN7A 3DURB 4XC1H 1ADQL 4JRXE 4UUJB 5FGCE 5ICXB 3D87B 1Q8MA 4PPTA 4OGQB 3H9SD 4IMKA 4R4ND 1OOAA 4JPSA 5I74C 1EO5A 1U8HB 5IT9N 3WIIL 1YUKB 3HG3A 1RUQH 3JV4A 2LFRA 1E40A 2FB4H 3TASA 1L9MA 3MJ9A 1S2EA 1M56C 3CH1A 4EAEA 4MVRA 1AQKH 4H8WL 4LIQH 4YL4A 5FECA 2D2OA 2RCVA 2NZIA 1AXTL 3DVNA 3A8TA 1KTJA 4FLQA 4R2GC 4JM2A 5HYQB 5L3CA 1YMMA 5DMJB 1IXBA 5DUBA 5ILTH 1U8NB 2PCFB 1TGOA 4HH9A 3TETA 4G11A 4H5SB 2AZ2A 2ARJQ 2X89D 1JGVL 4U1GB 5F7FA 1QBAA 4H1LG 2NY6B 4D9LL 4I5BB 3A3YB 4PJXB 5EU6B 1E3ZA 4Y1AA 3HZKA 4ZMXA 1F3JB 3CVIL 3UTTB 2OYMA 4P3DB 1J05B 1TJGH 4XNZB 4PU2A 3LOWA 3GK8L 1J0JA 4G8IB 4HUWB 3ISWA 4N0CD 5C0RH 1WFTA 5TE7L 1AKJA 1BMGA 3BAIA 2BERA 5EU4B 3QORB 4EI5C 1Z6JT 2Y36H 3RVXC 1TQBB 1H2NA 5L4FA 2YD3A 2XG5A 4MZ3A 2HH0L 3TNNB 4PTTB 4LWSB 1G7LB 4DNLA 1N32B 4KJPC 5L6YL 3LSUA 3RRQA 3WNMA 2DQ6A 2GBUA 4AT6A 1G6VK 1VAHA 3O45B 1J86A 3D18B 3CC4V 2OXHA 3VXSA 2HKOA 2WXLA 2FKXA 2D4FA 1DBBH 1JHLH 1QD0A 3COOA 2ZUSA 3OSKA 2V8LA 3PXJA 2UXBB 1TOXA 3TWCH 1GC1H 4IK6A 1HW7A 3TTSA 4A2LA 4OZFH 4JKPH 1TLKA 5CSZB 2AW9A 3HFMH 7FABL 5CMAA 3O11A 1S3KL 1CB4A 3C2AH 3IJ8A 3BFWA 3TT3L 3QNXA 2X88A 1ZHNB 2J1KA 3I75A 3L4UA 2OTWA 2J5WA 5DMGC 3M1BA 1YUHB 2XVKA 2DWTA 4ASUG 3R0NA 3TCLA 5HYSB 1BZEA 3NZ8B 1U96A 1BQHB 1TZIA 3BVNA 1HVXA 1PMYA 3ES6B 2Y4SA 2XQYA 4MDJA 1KXHA 2WBJB 1Z1WA 3ML0A 4ES8A 5DWPA 3LSQA 1DCEA 1A8ZA 4NHUA 4IU2B 4W9CC 4LNRA 2WW8A 1EZJA 4DV1O 3EOAA 3DJ9A 2QGCA 5DDHB 4PV9A 4WWPA 5F7DA 4JI6B 3P30L 1IZJA 3FPYA 1HSAA 1FN4A 1KTLA 4RRPG 3TF4A 1K85A 3IGFA 3G6JF 5CSGA 2Q20A 5ICZA 1AO7A 3VGGA 2MNUA 1JRHL 3W5NA 1T0MB 1ETB1 1UXSB 1JWSA 32C2B 4PJIE 2ZDIC 1QSED 4BCZA 3BIKB 4HKBA 3G6AB 4MZ2A 4R2GB 2UXCO 2ERJB 3CAFA 3UZEC 1Y6XA 1P7GA 3C6EA 1R6VA 4GRLC 5DZPA 4MD4B 5PCYA 4DUYO 2NX5D 3Q01A 4YZFF 4AMXA 5DEDA 4H1LA 4UOJA 5MENA 3UDWC 2E74C 3QFJA 2BSCA 4P2QA 4ZSOE 4YR6B 4X6CE 3RTQB 3THML 4WBNB 1ECYA 1NBZA 4MTFA 2WIIA 3OAAG 5C8YB 1MCPL 2X9ZA 4YDNA 1KPRB 1CLVA 2J6EL 5ABZA 3PS6A 4FFTA 3ETTA 2UVEA 4WUUB 1MAKA 2WAMA 4KITB 1NIFA 5T3ZH 4JYYA 3Q1SH 4QPKA 4NBXB 2TAAA 2NSMA 3L7EB 2BDNL 2HWZL 3G4SV 3Q2NA 2GIXA 1ASOA 4TSFG 4HW6A 4UQEA 4ZUWB 2QR0B 5IFAH 2HG5C 1ZKAA 4F20A 4P4KD 1Y74B 1HC1A 4WO4C 1FLRL 2A74C 3OKEA 4QGTA 4G6AD 4X6CA 1U93A 2XFGB 3F62A 4LNUB 4Y89A 2WXPA 2P7TB 4JKLA 5J1AA 4AL8C 4NSKB 4MA1C 1JK9A 3QUZD 3NA4A 4L48A 1YHQV 2VLLA 1RPKA 1HHGB 3HC3H 3CHRA 2H6PA 3ERXA 1M9NA 4HOZA 1DBML 3OKYA 4JO4H 3X17A 3HI1B 3KPOA 4ISVA 2YN5A 5HHOD 4XPGH 4AJYV 3MR9B 4EVNA 4HWBL 5HI3C 4KC3B 5J2TB 3MXVH 1USQA 3VD1A 3OKMB 4AKOA 4UINL 5LB1A 4LMQI 2NNCA 5D9SB 2MQCA 1UT9A 2VZ1A 5HGAB 2D03L 2XXGA 4TSCL 3T3PE 5F9DC 1U8KA 4FQPA 4OLEA 1MDAA 4ZX4A 1AO7E 1LEGB 3EZ8A 1W6LA 4L2LA 4LLVB 4YDLC 4PJ7F 4G8GE 5EDSA 3V79C 1PL0A 4R7NA 4BFGA 3O3AB 2P5WD 2QPDB 1Q0YL 5E00A 2F2HA 2IDTA 5DJAB 3IU4L 3UP6A 5KVDH 4PJFF 4R4NC 2DQFA 3NP4A 1XB6A 3IMVA 5H94A 4U31A 3GHEH 2A79B 4L3EA 5GHWL 3UT5B 1AP2B 1MRCH 3QWRD 4NWTL 2PPFA 4FQHB 4J3XA 5J9PB 1XR9B 2C5DC 1RSFA 2MOVA 2A6DA 3BW9B 3LSSA 5EZPA 3ASWA 2CO2A 3TYFA 3DNKA 1RPUA 3ES6A 5DEGB 1M3IA 3VQWA 4HJGB 1DQVA 2GUZB 2ATKB 2ODHA 4B9CA 2EINC 4DV6B 2ZX7A 5LHIA 1PSKH 2GTZB 5E2WH 1R73A 2WXJA 3PNWA 3VGFA 2FSEB 2NW2B 4QEGA 1MLCB 4XCYB 5GGSY 5D2LE 3V6OC 4B27A 2FR4B 5FKAB 1BFOB 3TV8A 3PF2A 2JXMB 1EWHA 3ZMUA 1F4XL 1BQZA 1NKOA 2NX5B 5JH7B 1DJXA 1VFOA 3BP4A 1WJ3A 1G7MA 1NKRA 3GGWB 3PFQA 3R0MA 4PJ5E 4UM8A 1BPLB 1UURA 3DDFA 4JPIA 4RAIA 3LIZH 5E56A 2K9UA 3BLBA 1TCRA 4P5TB 1LE5A 2VSDA 3J27A 2FYUH 1NKGA 1J12A 4UQ3B 1FC1A 2EYTA 4JHUA 2G4GA 1KT2B 2ZOWA 5ANHA 2D0GA 4HJIA 1H0DA 2EDEA 4RUFA 4GOSA 1IGFH 2E7LA 3B2UC 1LO2L 3FU9A 5CJBA 5KVDL 4HK0A 3V6ZA 1SMAA 4GP5B 3KPSA 5FLVA 1SESA 4HUMB 4AUJA 5BRQA 4P9HL 3TONA 2AQ1A 2ID5A 2Z0UA 4L4TB 2PTMA 3PP4L 1WP6A 5IJ0A 2NZ9D 2OTWB 1TYEB 3OAUH 4Q56A 4GG8B 5SWZA 4GLRI 3VA6A 5JNYA 2FHFA 2WQUA 4OGYL 3EXJA 2JJ1G 1HQ4B 1SRDA 4LQFH 4DT2A 2KDGA 1F8TL 2EABA 4E0RB 4OT1L 2VDOL 2NDFA 3D85A 3PU7A 1XH2A 1A6ZB 3MJ7A 2XUMA 3QPXH 4ONHA 3WTWA 1UQSB 1KKDA 2OMYA 4X42A 1HHGA 3WAJA 5ESVA 5KVFH 1GSKA 2I9LB 1KXQA 3BZDA 3CRCA 3JAWB 5FNVA 3CFKA 3I6KA 3BUIA 1AIFB 4OBRA 2F23A 5AOLA 4ZFGH 1CN4A 2Q8AL 4XNMA 4A55A 2CLRB 3G7TA 4WFED 4ADJA 2ZD9A 1MOFA 2N1KA 2ZINA 1NCGA 2WKOA 1CTMA 2YUXA 4ZFFB 4WV1C 2ICWA 5EZOH 1ND0A 2A73A 3ZU8A 1H38A 1OAYL 2BSEA 2NY1D 5C9JA 4BFRA 3BDBA 3TBWB 3DUSB 3K71B 1E9PA 5IV2A 4NRYA 3O3AA 1QHPA 4HIJB 3NACL 2ZPKL 3GJFB 3MV7A 3JCUZ 4HWEL 4ENED 4GJTB 4QHNB 1RZQA 3W0WA 2DWSA 1AMXA 2VC2L 1RV6X 3OMIB 2DOSA 1AZBA 1B0GA 1PLAA 4JJOA 2WOBA 4TTDD 1FG2B 4R96B 3SYQA 4ZS6C 1HI6A 3HBQA 4PWIA 1P7HL 4EDXB 1A25A 2YUVA 3WJMB 3H9SE 1HHHB 1UCBH 1KJMB 1IQDA 2OI9B 1OVZA 1HHJB 4JZOA 4KKBD 2DMBA 4ODVL 4YO0B 3U0TB 3K80A 4OCLC 2QWNB 4KK6D 4PVBA 3PGCB 3QI9D 2L7UA 4UTAH 3BYTA 25C8L 2B1HH 2EP6A 2ENSA 1MQ8A 2F66C 4QPJA 2PP9A 3M86A 5AL8A 3CFBA 5KYYA 1SY6A 1TIUA 2X2JA 1IEHA 2GSIA 3UOAB 2FT7A 4PS4L 5A7BA 3TBVA 1KJVB 4CS4A 5E8DH 1AGFB 1OB0A 3BSHA 1MLBB 2WV3A 1L9OA 4OR1A 2KS0A 1BREA 2JQZA 3L3OB 3UTQB 1MFBL 4U0RB 3SBRA 1N0XH 4UQ3A 4QGYA 4ZQKA 2CLZA 3G5YA 4P5KA 5CJOH 3MLWH 4D7PA 2AXFB 1KIRB 1OP5H 5F6IB 5T3ZD 3QYMA 3EYQC 4RGNC 2WVSA 1GIGL 2ZG1A 2WUBH 4GW1A 4GUOA 4IOFC 5AZUA 3M7MX 5DHYB 2ZOUA 3QI9A 5CILH 5DD3L 5SWQA 1A3QA 1HZLA 5J0BA 1TZHB 2DLFH 2GK2A 4X7SL 5IB2A 2ZWLT 3LDBC 1ORQB 2F61A 4RMWA 1Q1JL 1WISA 2JKTM 4KRPD 5ERWA 4FQ2H 3QO0A 5AKSA 1UD8A 2RFXB 3BAWA 1Q86W 4NN5B 3JVGA 3MBWB 1WWWX 4PVMA 5EU7C 3TO4B 5LA6B 4HGWB 1V7NL 5DWUH 2XWBA 2H0JA 1NANI 5HYFA 2D3JA 4G6JH 4AYMC 3REVA 5LN8A 1VQKV 1XF5B 3H1HH 3I50H 4E0RA 4ETQA 4RAHA 2A9DA 1RP3B 4LL1A 1DVFB 2D3LA 4NN7C 2Z93B 3QNYA 2XAHA 5DK0B 4XMXA 2W65A 3CMEV 1KJMA 3PGFL 4JZNA 5CBAA 5I8CB 4TQFA 3KGUA 1V7MH 3A4AA 5CLTA 5DI8B 3BVUA 5D7LD 2XVGA 2JGDA 4UT6H 5E6IC 3ABLB 4FZEL 1CD0A 5D6CA 4FP8H 5DJYB 1ML0A 1XDTT 3KG2A 1KGWA 2XTJD 3ZS8C 1UD5A 4E68A 2O5YL 2RCSH 3ZZSA 4H8UA 4AIEA 4P2RE 5EN2B 2G2RB 1NEZB 3S97C 3UZVB 4NJAL 3E3QC 1G87A 2C1OA 4DGYL 4F7PB 4PRIB 3VE0A 2AK4E 3LIZA 2R0LL 4NQXA 2DMHA 5H2FZ 4QRTB 4PLJC 4KJWC 3QXAA 4LSQL 4APQB 2C7UA 1CXKA 1PYWB 1WA2X 5I1GL 2EICA 1ZT7B 5AW3B 3LNFA 1I3UA 2FO8A 5HYJA 3UH8A 1QSEB 1WLEA 4LRNH 1VF6A 1T21A 3LXUX 4Q4EA 3DVGA 3LQAC 1GY1A 1KBGL 2DYRB 4X6DA 2YEVA 1RUQL 3PQYB 4ZI8A 5BPPA 5FV2A 3KNBB 3FO1B 2UUCB 2V17L 1HHJA 5C08A 1K6QL 2J1WA 5GS2D 5E9NA 4NENA 3HR6A 3T2OA 3TURA 5HDLA 2F54A 5LA6A 1VPOH 4PJ8A 2Y6TE 2VXTH 3CX5K 1AC6A 3WFHB 4H44C 2W6IG 2JVUA 1AH1A 1WFNA 1ZE3H 4QHKJ 2NCMA 5B1CA 1ZDQA 3B7TA 3KYAA 3VXNA 5IMMB 4PA4A 5C07D 5J6GB 2E59A 4LCCA 2JSFA 4KRNA 2J4WL 4HCGA 4WU5A 3RBZA 3MRBA 2UZIH 1XIWD 4BFFA 3I6GB 2CCVA 4IU2A 5DZVA 3VFOA 1CDJA 4JL2A 1NGWB 4G43A 2F74A 4FHBD 3RWDB 1ZV9A 4M3HA 4J6IA 4RBPH 3SCMA 2FB5A 3K04A 3DOIA 2EJRA 2X40A 1KIQB 1ACXA 1CTOA 4RRPA 2RQ6A 2FO4B 5E7BA 3AG4B 1MFCL 1RUML 5G4NA 2VE6B 4NQSB 3WI9A 4XPAH 5D4HA 2IDCA 2DBJA 2QFRA 2A6JA 2X1XR 2VXQH 1IVLA 1Z3RA 1WAEA 2PCPA 3PIQB 2BZ7A 3G6AA 3QDMA 4GP8B 4LSPL 1MOEA 1QBLH 4K94C 5E4OA 3C09C 3O3BB 2JEXA 2JKNA 5F96H 2C1PA 2HP8A 2RQ8A 3C8KB 3X1NA 4OV5B 4HIHB 1R3IC 3I56V 5HHNA 2XTSA 4M5ZH 4M7JH 3GSNB 5A3IC 4PJXF 4PJ5D 4N0UE 1OT2A 4R6UA 5TK4A 5IOPA 1JNNH 4TVPH 4IYIA 4LF5O 3L3GA 1F4YH 1WFIA 2MSPA 4FFZA 4X98B 3LRKA 5SWSD 4DF9A 1A3RH 1CR9L 1HN1A 2VKWA 3HC2A 4AGLA 4GRLB 1T21B 3U2SB 1E5CA 3FN0L 4LASL 3FOMB 3EUUA 1CL7I 3CH8A 3T0EB 2CUIA 3FQXA 1GYCA 5DMIH 4ADGA 4LEXH 3L3HA 1GH7A 3CNKA 1YCIA 3Q3GA 3U7WH 4R97B 4FXGC 4KKLD 4KY2A 3TN0A 5CN1A 4JL1A 2ORBL 4XWGL 4JVUA 5FKPB 2OW7A 2WKOF 4GKSB 3CB2A 3C5XA 4QF1B 1RK1A 2XPGA 4MMZC 3MUHL 2PP8A 2ZZUT 1NCHA 4QNPF 3STZB 1SZXA 3IAGC 2CCLA 4HC1L 3WO4B 4Y4KD 5AZ2H 1KG0A 5E03A 3IU3B 3BD3A 5B3JF 3W38A 5JIPA 3QHFL 4UM9D 4X64O 1W72A 2HRGA 4FX5A 3MRNA 5IKCB 5KSAD 3TJPA 5D7HA 1MUJB 5AVXB 1UC6A 2OMUB 4A7VA 1WEJL 4F37F 3RFZB 4Y7OC 4ZDHB 4DV7O 1SOKA 5MEOA 4O4HB 1AZVA 2IBGA 4LP8A 3RGBA 1E9QA 1U91A 3DO4A 2FX9L 4JFFE 4QXGH 3ZYIA 3IPFA 4NUMA 5EC1A 3O4LB 4HWZB 3H54A 3TEWA 3ATAA 5IB2B 1SFDA 3V0GA 3X13A 4OLZH 3DVGB 1JNNL 2X41A 4DP2X 1OCRB 1B3JA 3D48R 3GZPA 5EB9A 4N2DA 1G43A 2CE6A 2Y3NA 2C1PB 3EDKA 3M45A 1AXTH 1EK3A 1BM3H 3MLZH 4IL6Z 2Q8BL 3RY5A 5JORB 4NNYB 2DJMA 1G6RH 2FZ3A 3TEUA 4UOW1 1EO8H 2G3ZA 3RKDD 5ILTL 1A7RL 3BFRA 4FFYH 3QIWB 4HUVB 2VNCA 4POYA 3BGFB 4J6RL 1VZHA 2C9XA 4NCC1 4XMPL 2GSMB 2EUXA 4AI8A 5IM7B 2CZNA 2RA1A 2R69L 5T1LA 4EE2A 4OFVA 1OE2A 2A1WL 4F3FB 3V0FA 2E3VA 4QGPA 2E7BA 2ALWA 2PYEE 1H3TA 1NCCL 3HHRB 1HESA 1NMCB 5C0AA 5F1OB 3VFOB 4R8CA 1CK0L 3BD4A 2YPKB 4KY1H 4X89A 4LGRB 3HI5H 3UBGA 1KV7A 2IPUK 5KBLA 2NNUA 1WPCA 1L5GB 3B09A 3QZOA 4MJHA 3DC6A 3O2DL 4OCXL 4PR5B 2VQEB 3QQ3A 5AOKA 1P7BA 5JDJA 2B77A 3D0LB 4LVHC 3CFQA 3X3FL 1HNGA 2XT1B 3MGTA 2GY5A 3FCBA 4U7MA 4Z7VB 5T1KA 5EG6C 4UQBA 3MMEB 2Y5TA 3IPBA 4WW2B 4KVCL 3D8MA 4B3SO 3HCVB 3IJSB 4QY8A 1Z9LA 5IVZB 4FZEH 2OMZB 3L5JA 1E4HA 5LXGH 2J44A 5AVQB 4OLVL 1T5WA 1PIFA 3IBEA 3NRPA 2DLHA 3ZE2B 1SZNA 4X7EC 4J3TA 3BIAX 3D0VB 1S5HB 1S3KH 3TWYA 4ELMF 1DUYA 2SODB 4JRXA 1SEBA 3QYCA 1J1OH 4PP2B 3OQRA 1HCYA 1LUWA 1MRFL 5IVXE 2QKAA 5HYIA 1ET8A 2V9TA 1UJWB 3DXAB 4KBPA 1KPVA 1VCBC 5GSVA 2ZDIA 1FYTB 3ZKMD 2R29A 3FN3A 3T1FB 4HSAC 3NIFB 1DUZA 3NTCH 5J9PA 1T0NB 5G5DA 5CIPB 2XIIA 1N8OE 2FQEA 2GYSA 4GAFB 3S35L 3GBML 4QXUL 3TEXA 1VQ5V 3NZHH 4N0YH 3CXDH 1SDYA 3SDDA 4MD5A 1CI3M 3MO1A 3V0EA 1DN2A 3PRZA 1UFIA 4DV2O 2DJSA 2YA0A 1VQ7V 3FSZA 1DLHA 3MJ8A 4GUCA 2EINB 1OZTG 1SERA 2P67A 3G5WA 3RWEA 3TJHD 3BY6A 4PCSA 2WLYA 1VA9A 3ZMVA 4P5MA 1B2WH 1TEGA 3NVQA 2V1DA 1RU9L 3V55A 5KG9A 2XN0A 5MEND 2MOGA 1KXVA 1IBMO 2R2EA 3SDCA 5FHBH 3JV5A 4BK4A 1QRNB 3CFTA 3LKOB 4KXZI 3PWUB 4JKWA 3LRLA 5HVWA 1HXYB 4GUNA 3HOGA 2QSAA 4NR1A 1I8KB 1M71A 1SHMA 1UJ3B 4HXBL 3KL3A 2OP4L 3MRPB 1E8WA 2CSPA 3P73B 3O41A 1HINH 2GAZB 4NI3A 1JWMB 2QDWA 1KJ2B 4WRLA 5JDSA 2WB7A 3VWKA 3W11D 1AGCB 2IVFC 2H9GB 4HIEA 4W81A 4B3MO 4GBXA 3MV7B 2BY2A 2MTPA 3ZE2F 2NY2B 2IH3C 3CD6V 2H1PH 1KN2H 4N86A 4MXVF 1VEMA 2CE4A 4LEOA 2B9ZA 2EDNA 3FTSA 3ULSB 3GKWH 1EHLH 3VG0H 3ILEA 4ZI7A 4HIQA 3BH9B 3CK0L 3HPJA 1NGPL 5I16B 4Y4HA 4MVSA 3SE3A 4I9WD 4CBZA 2DLEA 2WLJA 3H3KA 1NIEA 4PY7B 1BEYH 4C4KO 4A6YB 1Z66A 4TUKL 4L0YA 5B1OA 4I48B 2ATKC 4NZRL 3DLQR 4K3EL 3ECBB 4XWOC 3FH8A 3TL5A 1VERA 4WO4B 3OF6A 3IDIA 4JHVA 4JYCA 2JELL 4QRPE 5HVHB 1JUFA 1KLUA 3LKQA 3SDDB 5JQ6L 3VFSA 3ETQA 2EYSA 3CLFH 3IFPB 4Z2WA 4JRLA 3DYPA 1XGPB 1RZKL 4HJUA 4OLYH 1V3LA 1F3DH 1XCTB 4OQ1A 4KDTC 4GX0A 3EOAB 1ZHKB 2HHHO 2MWCA 2XJKA 5AENA 1PLGL 4IKLA 2H2SD 3SJVA 1MHEB 3PY9A 1WPBA 5K1XA 1MCOH 1F23A 2Y5QA 2AMUA 1PZSA 1Q9WA 1X5FA 2FUTA 3H4HA 5ANME 1RJYB 3KLAB 4O4JB 4XN1A 1ND0B 2A73B 3MNWB 4N8VG 3JWNH 5D1QB 5E70A 1CC3A 2YEZB 4ODTH 2JI2A 3K4DA 3HG1A 4PGDA 1I94B 1KYOF 3FB6B 4XMTA 2V33A 2VABA 5J3HD 2BJMH 2KZKA 2XWTA 1QYGH 4FLZA 1T0PB 2VN6A 4UDUB 5BVPL 3BDYH 1OM3L 1JWMA 4W9HC 2ZKXA 1BHBA 3J2PA 1CFNB 1XZ0B 3NSJA 1NCTA 4FFYA 1RJZB 4MLSA 4QCIA 5FA4A 4Y19B 2XZQL 3H1ZA 3WG7B 1CQYA 4Y4FA 4UILL 1Z5WA 2Z3YA 2K70A 3EIFA 4RIRB 4B7LA 4ZUVA 2W60B 3E7JA 4PRHB 1EJOL 1ILUA 2Y25A 3QUKB 5JCOA 1LEKA 4HT1H 4N2HA 3T71A 4LCYB 5JPNB 5FHAH 1P1ZA 2I69A 3B83A 4E9YA 2J1XA 5KVDE 1WNSA 2EACA 3D05A 3ARYA 3WD5H 1D5ZA 2NXZC 3HG1D 2WXHA 4HS8L 3TXAA 3HN8A 1JTOA 1MHCA 1GN4A 4MX7B 4Z23A 1PY4A 1QHTA 3OGCA 1UXWB 4FKKA 3BKML 1PKOA 3EFFK 4YHPB 4BWTA 2EZ0C 4NSKA 1DLFH 4NQQA 5EN2A 5KSUB 2G3MA 5HDBB 5AUMB 1IBDA 3DIFB 4PRIA 3NIDB 4CSTA 2EXSA 3QIBC 4HUXA 1MI5E 4KDWA 5FUCC 3IDXH 3B3IA 1QLEC 1HL4A 4YUEH 4PRIE 4OU3A 3OTOB 4FFVD 4LPTA 4YDIH 1E6JL 1EEZA 1BJ1J 4UB0H 5DC9B 4APXA 5BCAA 1UWFA 2YXHA 2QQQA 2ZIDA 3MGOA 2ZWZA 4OZFA 4UWQB 4N0UA 4UQAA 4D9QD 1YEGL 5HHQA 8FABB 2WUBL 5EBLC 1J0ZA 2A9CA 4R7LA 1EBAA 1FH2A 3K6SA 4CILA 4YFEA 3ALWA 4J41A 4P2RD 2YAHA 3TN0C 1WITA 3ATEA 3FZUC 3REWA 4YR6A 1I53A 4B3TO 3LEXA 2XTJE 2PR9A 1IAIH 4NN6C 5DJCB 2ADGB 1OF2A 4KTDL 2IAND 1D7BA 1UT2A 2BFVL 2VDRL 2IJJA 4TLKA 4NP4H 1M4UA 1FO0A 3PABA 5FCSH 3G08A 2RDCA 5H37A 4DP9X 2FEEL 2BS71 1N5YH 3TYFB 1J1PH 1KTKE 4AITA 3TX4A 4HPOL 4N6QA 3WIFA 1S7XB 2FRGP 3CE2A 4LAQL 4B9ZA 1EUUA 2OMNA 1OTSD 2GABA 4PA7A 3NTCL 3EYFA 3W0WD 1Y74A 5LNGA 3IF1B 2CDEB 5K1NA 1VKXB 3CBJB 4C4BA 2Z1KA 4DAGL 5B4MC 3L1EA 1UM4H 1FL6A 2ITEA 4JB9H 5LJYH 5FO7B 2Q0OC 4I88A 4LVOC 3EGSA 1ZGLP 3DJZA 4NQDA 2P4VA 5EV7A 4XBMA 5BZBA 1FWXA 4J3VA 1MW1A 5EZIL 1AR5A 1FL3A 3O41B 3SGJC 1AD9A 1ZX3A 2FJSA 2L0DA 5D7JC 2X4SA 3TA3B 2CK3G 3OPZL 1MW0A 2Z8RA 4Q9CA 5MEPB 3RUGE 3G04B 3UCRA 4DUZO 2WN2A 3LNMB 3ZTJG 4ACPA 2FBJL 4FNTA 3D9AL 4M4RB 1I5YA 4OCNC 4ATTA 3OKDA 3K8LA 1CE1L 3MRQA 4MS2A 4N0UB 2BW5A 2C7FA 3JV4B 4DKFH 5JQGA 2G5RA 4EOWH 3NSXA 4TUJA 3CH1B 4P48A 4DZBB 3O6FB 3QDJB 1RLWA 1YEFL 1KTDB 5L0QC 3HA0A 4FXKB 4D6TH 1ZVSB 3C75A 4WUKH 1I1YA 4ZAKA 1OTTD 3BZEB 1ADQA 1M5IA 5KAIZ 2ZCKH 2XC8A 1DYZA 2ICWI 2H94A 2ZE6A 3O3DB 1F4WL 1A1NB 3QIBB 2ED6A 3PE9A 3HW7A 1IT9H 4NUPA 4Y5XA 3EUDA 1NUNB 1UXWA 1HZHH 5CP7B 5H2BB 3T0ED 4FE9A 4R97C 3JAKA 2VGLM 3WFCL 3WS3A 2Q9OA 1U3HA 4HIXH 2K6YA 4DERA 3ARDC 1A02N 4XVJL 2VDLH 3MLUH 3VWJC 3RIAF 3F64A 2A3QA 2YQ3A 1GS8A 2PZSA 2CLRA 1S7QA 1SDAB 5AAMA 2IV9A 3RL2B 1BWMA 2BSTB 2VMCA 1QSVA 3DV4A 5GS0L 2RGSA 1WC7B 4HMCA 2FJGB 2JS5A 3APFA 4GT7A 1D6VH 5I1JL 2G60L 3O0RL 3D39D 3LZFL 4ZD3L 1K73W 1MFMA 5IWLC 5I0ZA 3HRZB 4MTMA 1RZKC 5EOCH 4GINA 1F4MA 3A4DA 2APSA 1XTLA 2GJ6A 3U9UB 1XEUA 1QBML 2DEYX 1TJIL 2W0KA 2I9TB 4Z7QE 3SGJA 4EKJA 1TQCB 2OX5A 4MXQD 1XSKA 4ZMNA 3ZN1A 3H53A 4N22A 2FQGA 3O0LA 4MQ7B 5GRZA 2ZYRA 3RVTC 4FA8A 5ID1A 2ZQKA 4RUEA 1JYNA 1QW8A 3TIEA 3W0WE 3KH4A 2JVDA 5HHVL 1CPYA 1QNZH 4W6XB 4K8ZA 2C9PA 3S48A 2J8UE 3DX9B 2Y69B 3FXIC 3PHAA 4BQCA 4DK0A 3K8MA 1NOFA 3G9VA 4PTUB 4FFBA 4KMTL 4MX7A 1KENH 1G4MA 1AP6A 2AI0L 3X1EA 1J88A 5KX5B 5FA3B 3ZT7A 4YHPA 3IE4A 4MCYB 2DWYA 3UBXB 1GN6A 4HFWB 5L6YH 3F7QA 2WLNA 2CUGA 1X9LA 3ZRFC 3MXWH 1PW3A 1RUPL 1K5SA 3NQIA 4J28A 2CIIA 1A9EA 2JCWA 4JO3H 4OF7A 1B9KA 2BSKA 1GZPB 1UVQB 5CUSH 4ZSOB 2JF1A 4K23H 2AXHA 5EEZA 5CAYB 5MHSE 1U41A 2Y2WA 3FMGL 3MRFA 2CK0L 4UT6A 4JFYA 4AQ8C 2JFCA 3TWCL 4KRPC 3GTTA 3ASNC 1M4KA 2Z64C 1I8IB 1I3GH 1BZOA 4KHXL 4BFBD 1WWCA 5ICZB 5KVFL 2WWMC 2BINA 2LW7A 1C8PA 1VQ6V 5EU5B 4WFHD 3MUZ1 3JWOC 2EXTA 4AUUA 1HL5A 2IF7A 3LKSA 4YHZH 4D7TA 3HPLC 2GFBA 1OCWL 3QAQA 4WKZA 4V1DA 2X1WL 4YDLB 1A6UH 4N2KA 1IAOA 1YEDB 2N01B 1H8HG 3HUJF 3HZVA 2GG1A 4H44B 2H32B 1UASA 3DJTA 5KVGE 1NFDB 3QIWA 4PV8B 2H0EA 3HTLX 4IMKC 1PL4A 4KUZL 4HD9A 3NGBB 1KP3A 1HAWA 3RY6A 2J56A 1ZANH 3IKCB 5DQJA 1E8XA 4DR6O 5IW1A 3SOBH 2VDRB 5DQDH 4NJ9H 1PX4A 1ZHNA 2R2HB 3W5MA 2LP7A 4XBGB 2ZX5A 3S8FB 3CCRV 3BMVA 1NMAH 2WUCH 2CBTA 4JZNB 4Z7OE 4JO8A 4WFHA 4X9QA 3WFEH 1J10A 3BUDA 2CKBL 3N06B 4KVCH 4N26A 5D4JA 3TT1L 4BDVB 3BXNA 2Y7LA 1HNWO 2DWEC 4FL4C 4NKIH 1UKQA 3K4AA 4M7LT 4PJ5A 4XZUA 2Y7MA 4YFLI 1IGCH 2G0KA 2ZX8A 5GS1C 2E7HA 4PLNC 1AO7B 3FF8A 4IBZA 1DBJL 4KRPB 1JPGA 4MJIB 2MW2B 2NUTB 3TYGL 4Z7VA 4FLUA 2UV3A 1XT5A 3PREA 4CBPA 2FX8L 4XMKL 4NB5A 1RUAL 3O45A 4OVVA 2FJGA 2PUSA 3L75H 3I55V 1VHPA 1L6ZA 3HE6B 4O02H 5G2NA 1VENA 4OIIL 2CIIB 2OPCA 5TPWL 4B60A 1KEGH 5B5EZ 4HCRA 3AY4C 1V3JA 3NFPA 4QYAA 3VFRB 3ZUNC 2B8OT 1DVXA 1F42A 1KCRH 2DBLL 2VIRB 2Y2TA 4G80B 1KB3A 4ZKIA 4GUPA 1YN6B 2EYRA 4L4VB 4NM8H 1OP5K 2EIKB 3RWHB 3BT2H 3AZUA 1HKLH 1S5HC 4G8GB 5KSAA 1OQXA 4JPWH 1CICD 3I75B 3CSPA 4WU7B 4WW2F 3SKUD 5B1NA 1UYWL 4OI9A 3OPZH 1RIUL 2OXGA 4Q8BA 3C3SA 1ZVSA 3VXRA 3BUYB 4JANA 1QLRA 1FJGO 4A7QA 1O9ZA 5T5FL 3AQYA 3ZCCA 4PJ8C 3D9AH 2YD1A 1ED3A 1WAPA 3ETSA 3IYLW 4N0FB 3MX0B 1MEXH 2CO4A 2AK1L 3QZMA 3QWOB 2OTUB 1N2RA 3AG3C 1CYXA 4XP1H 3DGCR 5GXBB 1XD1A 2ZXWB 4XN2A 3B9KA 3QFGA 4C55A 2Y6SD 3GJFH 1MG3C 3ARWA 3HB3D 4WQOA 1H3WM 1P7QD 2IWFA 5K93A 4MVZA 3R4DA 1J5IA 1DBJH 1ZCRA 3UJJH 1KPUA 3SKJH 4BIZA 1OAXL 5TQ2L 2X44D 2X4NA 3IGAB 3AT8A 1HOCA 3O9WA 1CI5A 5I5RA 3O6FC 3Q5OA 5DFAA 3MR9A 4ESKA 3KYMB 3SQOL 1LWRA 1UXMA 1FE8L 4MMXC 2C8NA 3SIKA 4KRMB 4JREC 3QUML 2NY0B 1TPXB 3BCCH 4U7NA 3K57A 3ECVA 4M1DL 2DEWX 4QHUA 1BEXA 3UO1L 3C6LA 4FMKA 4UFZA 5D5ME 4WNQA 3WNIA 3KXFA 3MLZL 3CRAA 1S7WA 4N1CA 5KOMC 4DK3A 2F19L 2JCCA 4NJAH 4XRCA 1ZT4B 3RI5K 5IMOA 5BRPA 3CC2V 5D5MA 2UVFA 5AAMC 3N85L 4LLVA 1IRAY 1JZHA 3ARZA 3HE7B 2F1BA 4I89A 4JFOA 5ESAA 3L72H 1DR9A 3OEHG 1IBLB 2YEVB 3PQYA 4F58L 4G83A 1LEIA 3ETBJ 2ZNWA 1EXGA 4UV4H 1L7TL 2VDPB 3TVMB 4K94L 1AZCA 2XSKA 5TDNA 4BHUI 3MROB 4HAMA 3VXUE 2QQLL 4CVWA 3ARTA 1PNLA 4NNPH 1BZQK 1KBGH 1D5ZB 4UZGA 2IJIA 4X2UA 2EE3A 3SDXF 4HJTA 4WO4A 3RVVD 3GWOA 3RDTA 1CXHA 1OARL 2K6WA 3TFBA 5E08L 1EIBA 2O93L 2Y72A 3ARPA 4A04A 1GJWA 3GBDA 2IWKA 1V54C 2NDGA 5E1QA 1TPXC 2YXYA 4K7PX 4P46C 1BD2E 5HYJE 5IFHH 2HLDG 1MCCA 1VZIA 2H5UA 4CH5A 3L5IA 3PNWB 3Q2VA 5HJ3B 4DKDC 2XZCH 1OAZH 2J25A 4P9HC 4IGBC 5D6DA 2ZP8A 2F43G 1J8HA 3ULVH 5D93B 4FXTA 4AVIA 3A0OA 5DJ0B 2VQFO 1BF8A 2AEIT 3GYRA 5ICXA 3CXCU 2VIRA 1DQDH 3LNNA 1SQQH 4XAWL 3S96A 1U8MA 3NJIA 3L54A 3DKHA 2F54E 2ZP0T 1EVTC 1OB1A 2FLRT 1M7UA 2OK0H 1BSMA 2QWOB 1Z3GL 2DM7A 5LMNO 3CPUA 2F8OA 3ZE0F 2FX7H 4YZWA 2B2XL 3ALPA 1GGIL 3PDOB 2APFA 3ZDWA 3KWVA 4P5SA 4KKCD 3S8WA 4EDWL 5A1AA 3LEXB 5GTHZ 3RG1C 1MWAA 4KXDA 4PJFB 3OAYH 5BV7C 1H2SB 1FZOA 3L2LA 3NJJA 2F5AL 2VL4A 5EH1A 4F6RA 1QRND 4UUJC 1SJVA 4XMLH 4ZTPL 5LDSA 4JFOB 5ESAB 4EDXA 1MVYA 2V7NB 5JNYB 5IB3A 4IOIA 3LQZB 4PVNA 3VTAA 3L2NA 4DEWA 4BDVA 1F1DA 4CUCA 4OCYH 2ZSWA 3CHOA 4FABH 1XREA 1I3VA 1XGYL 2ZCLL 5FV1L 3STZA 4BXSV 3HNSL 5KYWA 1OAZL 2DI7A 4KO6A 3V5DB 3S4SB 1B3IA 1AXIB 5IBUG 2XN9D 3NFSH 4XO8A 2HT3D 2P5WB 5F89A 2EVIA 1INDH 4L8SC 4X9FA 1AJNA 4XNQB 4F8LA 1WTLA 2JJVA 2DOCA 2YKLL 2ZKHL 3QIUA 2X42A 3RZCC 2JE8A 1X6LA 4RZCB 1JZ8A 3NFPB 3W9DA 2YUWA 2BY3A 1I5XA 1FC2D 4U7KA 4U6YA 3IFXA 3IWUA 4IDJH 2EAEA 4DXWA 5HFLA 5IMKA 4X80L 1TUPA 2OL3H 4GX1A 4N9OB 3AVEA 5HHOB 1LE9B 1HL8A 3CZFA 4HEME 4OI8A 1YHPA 1KV3A 3D34A 4PJBF 2D3VA 2P8MB 4HZLA 3U7YH 3LMJH 1MPAH 2ZCHL 3GHEL 3NCWA 4GI6A 2JKJA 2HFEC 1NGPH 2AJVH 2E3CA 3WJMA 2J20A 3REWB 3QUYA 2VC2B 4PHXA 2BCKA 4GQQA 5TTRA 4XMLL 4JO2L 4DP7X 1OCZC 3ZKMC 5DGRA 3Q6FB 2EVFA 3HZYB 5EFIB 4FJZA 3SZKC 4APQC 4XN4A 1HK6A 1AHKA 2X05A 3J07A 1XMQO 4PJFA 3RVUD 3CP1A 1TTFA 4GSRA 1KGJA 5HI3D 4YPGA 4F7EA 5I19L 3BVOA 3H9HB 4GSUA 4KHTL 4RCAA 1ZLUK 5I1IH 1PLCA 3DMMA 4HISA 4KNTA 4PJHA 1QVGU 4XO4A 4LLQA 3UAAA 3VU1A 3QNEA 2P8LA 5CP7A 5EO0A 3FB7C 2GC4C 4JM2D 5CHNA 3EYFB 3L9DA 1F41A 4P3DA 3EFOA 1A7PH 2HX7A 2XWXA 4XX1G 1WB7A 1EFRG 2X4PA 4ZNEA 1MLBA 1CFMA 1BD2D 1MEXL 3ZRXA 4YJZL 1UUSA 4ELMA 4JGMA 3U30B 3L70H 3N2KB 3TH2T 3RAJH 4TV9A 3D1MC 3ARSA 2GSIB 1QNIA 1XCQA 1D5IL 4Y1AD 5IQ7L 5J57B 1WZMA 1AG0A 2O4EA 4ZTOL 3NJLA 4WHYG 1AC0A 2ITDB 4X5WB 4WW2A 4XODA 1RZGB 2J88L 5EU7E 3T4YB 4L18A 1V7ML 4KVNH 2OAAA 3FUIA 3OMNB 2ITCA 4ZJ9A 4U1IA 4OTXH 1NMBH 5SX4I 1FGVH 1ZPUA 4UQIM 3FQRB 3E8FA 3RVUC 3TFKD 1FIGL 1FVEB 3AS1A 1RK0A 4PGBA 5CN3A 3QUXC 5KVGH 2V6HA 4MTGA 1TQCC 1Q3EA 3GEWB 4WWID 1O7VA 1JMZA 4AILC 2ALAA 3FONA 4Q9QH 4LLYA 4WI4A 3H42L 1R3HA 2W9LA 4U7OA 4OGYH 1FFNA 4IYHA 3LAFA 1OSEA 3IDGB 1QWNA 3VB8A 2J2ZA 2ZWYA 2P80A 1J9QA 1I82A 4B7EA 1I7UA 3BWAA 3ZTNH 1WD9A 2AW2A 3U0WH 4OAWB 5LGYA 3V52L 2IFFH 5B38B 4MCMA 3CYOA 3VGEA 5J56B 1JZ4A 3FUMA 1IC5L 5C07E 1SYVB 3VFVA 4FOMA 5K33A 2BWIA 4ZBJA 3MV9D 3H0TB 9CGTA 1XD0A 2FJUB 1I9JL 2WTRB 5MP6L 3RN4A 4UYQA 3EBGA 1HU8A 2Y23A 2GTAA 3JAKB 4LRIA 4WI3A 3MV8D 2DQJH 4X6EB 2V7HB 3DPDA 5FYLL 1BBDH 4L8CB 4XNQA 4F5CA 5I8CA 1HCZA 5KZCD 5INDA 3LQAL 3RX9A 3ARGC 2BCCH 2Z31B 1IXMA 3CGTA 4PBVC 3SJVB 4B41A 3GMLA 3V7AE 4HWUA 1A4JA 2IAMC 1U8LA 2HLFD 1HAUA 1QUNA 3T4AC 2VMEA 1IIIA 1AI1H 3Q2LA 4XVJH 2IOOA 2Z92A 2DQTH 2OYLA 3F7VC 2CIKA 2TRHA 3CZJA 3FQTA 1O9HA 2A9AA 5HDWA 3TNMB 3QFDB 3QCUH 2CTWA 1F56A 4DO6A 3NAAH 2CCWA 3PAUA 4JI1O 1NI8A 3MOBL 1FORL 3CXHK 4JFWA 1SS3A 1X5XA 2UY7B 3PIQA 4UCFA 3MRMA 4MMYA 2HFGL 5I75C 4I0PA 4PA3A 1US6A 2JLPA 3O3BA 3Q9QA 4A2EA 4KHPO 2MNJB 2W0FB 1YVWA 2AK4D 1TVHA 4BFJA 3UPCA 3ZJAA 1VZGA 4A2HA 3UX9B 2HEPA 1KGUA 1QSEA 2A74A 1HQRA 3JALB 2MCMA 3HC4L 1D7FA 1S46A 3FFCD 4KQ3H 4NP4L 1AR2A 5I6LA 3OJ2C 4BH8B 1NAKH 4UTAA 4LL9A 2ZUWA 5ACLA 1EEYA 1QA9B 1GW0A 4N87A 4RFNC 2EXWC 1RM1B 1QPPA 1TU2B 2VLME 4H2CA 4OD2A 3S34L 2IH1A 2R1YB 1P4LB 5E1GA 3UG3A 1T1XB 2CTPA 2VRZA 1DANU 1NMCC 4K8RL 4QXTA 5CZXD 1JDCA 5JXED 4LHUA 3HKFA 4HDIA 1GPOH 1EBOA 1QSFD 3J80N 1Q9OA 1L9RA 3OR7A 2APXA 25C8H 2B1HL 4GIOA 5DRWA 1BEYL 4IIZA 3IFLH 4LHUG 3MHZA 1A6WH 1A8JH 3K3QA 3QEUB 2Z35B 3U46B 1P7KB 1A7OL 3BP4B 3LPOA 1ZHKA 4NC0B 4QTIH 1FAKT 4RWYH 2JV6A 1N0XL 3L08A 5DS1A 4JTAB 5HFMA 1FAIL 3IFOB 3W39A 1CGTA 1ZTEA 4ZXBD 4F2FA 4Y5VC 4V2BA 2HT4C 3R8QA 2OMUA 2X5PA 4K2UL 1C12B 3SJBC 1ASQA 3FQ2A 4ZDHA 1AQKL 4H8WH 1U2CA 5FAAA 4U6HB 3BOVA 1EEZB 1T6BX 3O2DA 4OGQC 5BJTA 4NXKA 7PCYA 3B43A 4FZ0A 3QI9C 4FJ6A 1FVCA 3P3YA 5LG1A 5IHLB 1CEZA 4OGAD 2A3TA 4JCMA 3MCYA 2YPLD 1LO0H 3EDJA 2IPTL 2WNGA 2JB6B 3AMKA 2LU3A 3L4YA 4MZRA 5H94B 1ACYH 2ZJSL 4N21A 5SWZB 1JGUH 1A6UL 3BWAB 5EEWA 3TN0B 1IQWL 3IFNL 4DR4B 5CO1A 4QRSA 4TSAH 2ILLA 3VUAA 1IX2A 4CGUB 1MJ8L 2Q2EB 2CBOA 3U2SA 1R19A 1JGLH 4PJHB 4XHJC 3CSGA 1H19A 4BA0A 2YZ1A 4JGUA 1P6WA 4LEBA 1ZA6A 2K9FB 4UQCA 3DOSB 5IIEB 3GI9H 4BKLB 1GR7A 5ENWB 4KKLC 2RH0A 2KT6A 2GI7A 2HH0H 5BY1A 1B0WA 3DROB 3JAWA 5FNVB 4WENB 2OCCC 1HCVA 5D7JA 2EEBA 4OZIF 1AANA 4XZUB 4JY4A 5I0VA 1DCLA 1Z0MA 3WSQH 1GMEA 2R4SL 4AXWA 3DX8B 1AD0A 2PYFB 1QP1A 5CR8A 1E50A 1QUNB 2Y4UA 2D31A 3GMOB 4IRSC 4DP4X 2O5XH 1I7ZB 4HGMA 4OT1H 5C08D 2A6JB 1H8NA 4AZUA 3FQTB 2YXVA 4DR7O 3M8OH 1MCDA 4C83A 1UXLA 4NM8L 1HNXO 3I9IA 4J8QA 1CFVL 2P42B 1N68A 3HE6C 2G2NA 2ITCB 3WHXB 1PZAA 1D5XA 3WFBH 2LU4A 4J8RA 4HAGA 4MS6A 1DJZA 5FYJL 4FCAA 3VI4E 3GUFA 3Q4HA 1S7WB 1RIVH 4NQVA 4GUPB 3PG2A 4G71B 1DDHA 5GW7A 4PJ9B 5T5FH 2GK0A 1DN0B 4ODXB 5HSFA 4BM7A 1ZSPA 4WTZG 3HZMA 1IVTA 1OCZB 2AK1H 5F7YC 1XGTA 1FVCB 2NUPA 3WEBA 3L4TA 4U7SA 3L73H 3UTPE 1EEYB 1QA9A 4XVUC 2YUAA 5CU5A 5KBKA 4X66O 1N10A 4WFGE 5FYJE 5IVNA 4XAKD 4Q4IA 5FM8A 3VU2A 4BR6A 5INCB 4LDOB 1UYWH 4CKVX 1KIUA 5GZNC 1AQDB 4EIBA 1EZLA 4YBLB 2DMXA 1C5BL 3SDCC 4FYQA 1IBZA 3VQLA 4P57B 1QRNE 1ZVHA 3QUXA 4Q9QL 5JYMA 1A22B 4B53A 2YK1L 3P54A 4V1DD 5T33H 2VXUH 1N0NA 1UA6L 5LGUA 3CFNA 2YXLA 1FRGH 1TQTA 5H4ZA 1P7KA 1BVNP 1RH8A 5T1KB 4V33A 4HKJA 5DD1L 4E9SA 4M9OA 3RFZA 2X4RB 3CCMV 3S35H 3ZDZF 2E9JA 1TTAA 5D1ZA 2GW5A 2XN2A 1OAXH 3S5YA 3DHMA 5GSRB 3HVDA 2N0KA 5DGQA 3ZRCC 3AAZB 4JLRA 2P46B 1IZKA 5CN0A 3TO4C 5IFAL 2BS9A 4KJWD 2DQJL 1J1OL 1E8ZA 2BCMA 3I85A 1X7QA 4X6FA 5H37G 2I5YL 43CAB 2BSRB 4BZ2A 3D0VA 5D7IE 1JXJA 4K5OA 2ZNXA 3FO2A 4ZFOB 1T2QH 5F7MC 2CALA 2LQTA 4J8RB 4LC1A 1SY6H 5IYCO 4PYHA 2WTPA 4UYPA 4ZO9A 1A4KB 1BZ7A 2A0LD 4G9FD 4MNQE 5C0CB 2HFTA 5CEYB 2BSSA 3EFDL 3KYKH 2GJ6B 3BKYL 1JGVH 4UBDD 4XBPB 2BSED 4KI5E 5DRXA 4Z0XB 3U9UA 4A7UA 3OR6C 4KI5D 4NXMB 4N85A 3OVUB 3K8KA 4HZAA 4LLMB 1TT6A 3L1OL 2M6YA 4Y5VB 5L2KA 4TLTA 4GW5A 4Q6IC 1IQDB 2WZAA 1EAPB 1KDJA 3A24A 2AV1A 4LOFA 4X7SH 3SKMA 5EF2A 1DLHB 1QFWL 3MROA 3JD2A 1RVFL 2OMTB 3W7XA 1NEPA 3AABA 3C5SA 1XX9C 1UH4A 1CE1H 3B6SB 2QADD 1IO4C 5F9WC 2VJXA 2E5LO 4ANUA 4GS7C 1LTXA 3AREB 3MODH 3GWJA 4K7FB 1MFAL 1U93B 3VWJD 5C6TL 4HX1B 5CJQH 4XWGH 3QEUA 4CSSA 1K3ZA 1YEEH 2ZE8A 1JGDB 2NY7H 3K0GA 3MA7B 2FDBP 1FGNL 1KACB 3OPUA 5IB4A 1WPXA 2YC1A 1H6EA 3L81A 4PDRA 1JVOA 4QKXB 2VDOB 4QIRA 1HWGB 4UI2A 4QIWF 4TYUA 5DHMC 1HSAB 5IW6B 4KO9A 4PCKA 5AVVB 1J8HB 1BPVA 2P5WE 3B4NA 4JY6B 4QHMB 4D0CA 2CAZC 1IV8A 2CLZB 4P5KB 3VM7A 1FXKA 1NBVH 1VESA 3ZHNA 4KDTA 3PDDA 1SJXA 2V5MA 4X1YB 2BC4A 2JKIS 4GBXB 1XBRA 2WSDA 1NBCA 5CBHA 3ARDB 3QQ4B 3QE5A 2ZE7A 1G7HA 3BZ5A 3PGDB 2W0FC 2BW4A 4OZ4A 2RJZA 4XAWH 3C60A 1M7DA 3U6RA 1A6PA 4PS7A 5CN2A 3GNML 3PL6B 5IHUH 1TFPA 4M02A 4XAKE 5K9QG 3QFJB 2F1EA 2Q7AA 4P2QB 2X6AA 2ZF9A 3DIVA 3L5XL 1AE6L 5KLVH 1CGVA 5JHDE 3DETC 4YGVA 1QATA 4P05A 1C5DA 1GZHA 4L87A 2J43A 2IDFA 4ETQB 1PG7W 3ZDYB 1H8EG 1KF9B 5DURD 5IR1B 3CC5A 2EEFA 4LBEC 4YHYC 5IROC 5L0QB 2BM3A 3UIYA 1FHNA 1QBMH 1XOUA 1EX0A 1G9NH 3VSQA 3APOA 4GQ9H 2WCGA 5KSAC 3MPCA 2AEQH 4JJHA 5C2BH 3EYOA 3BH8B 2H3XC 4G43B 4LSVL 4DK6A 5MEQB 1NM9A 5BR8O 3D09A 3QK0A 2BLFA 3CU1A 3FU8A 4R7XA 2F7QA 1T66C 3QJZA 4AV5A 3IGAC 1XF4B 2CBMA 2X38A 3FT2B 3J7HA 4MMXB 4FK5C 4HLJA 4XR8C 1FFXA 4IBYA 1RP8A 5I75B 1XF2B 2R23A 3J81N 3L3OC 1ZLVK 3ZPDA 2WO3B 4NRXB 3HG1E 3QDGE 3D3QA 1IFHH 1P5UB 1D5XB 2CQVA 2FT8A 4ZT1A 5B8CB 1P9MA 2WWKT 3NIDE 4U6XA 4NQCE 3WELA 1KFAH 4K0KB 1KBBA 4PCYA 2WPDG 1EJ6A 2M8XA 2GI0A 3NYKA 2Z65C 5D9SA 4JM4L 5EBWB 2EYTB 3CMGA 6PCYA 4PG2A 3PP4H 1QSEE 3DBXB 3PJLA 1JPFA 5HY9A 3JWOL 3GMNB 1ZEAL 3FO0H 5KHIA 1JPSH 4BRVA 5DJ8A 4Y4FB 1A3ZA 5DLML 3MYZA 2EH8H 4XB7A 4HJJH 5AYQA 3C60B 2EIKC 2N56A 5E95B 2VDOH 4XO3A 1BQ0A 4A6YA 2A99A 3RB7A 3PWVA 1UA3A 5C0DA 1VEPA 2LFSA 3H9ZA 4EB6A 2VDQB 1ZXKA 4GLRH 4HZ3A 5ACZB 2YAPA 1AAJA 3EO0A 3ZT5A 3DHPA 5GGQH 1UB6A 4NDMA 5GRUH 4DR5B 5E8OB 4CMHB 1XB3A 1OAKL 3GC3A 2LAAA 1BA9A 1OW0A 4PVLA 1D7DA 2K4WA 1KNOA 3P11H 3Q1SL 3LEYL 5DO2D 4QNPE 4K7PY 4Y8DC 3QG6A 1WYJA 4U3FH 2HHHB 1EXUA 2DMGA 3IRPX 4IRJB 2HLEB 5F0LB 3HKCA 4P9PA 2V9QA 3KVDD 4MJ6B 2FGZA 5C07A 3MNVA 4CVZA 1BIHA 3CWGA 5I0XA 3KLAA 3ZEDA 1CFQA 4CJ0A 1D9KC 1CG9B 3F7VB 3EG9B 2WQRA 3SDYH 3K2UH 3MI6A 2DYPD 2EO1A 3U82B 5B1BC 4ZFFA 3DBSA 5T3XL 1LO3L 5EC1B 3O9WC 4OZGF 2ITDC 1UPGA 2AJXH 1KEMH 2IWGA 1V9PA 2L8AA 3VX1A 4I1PA 3BPNB 3K6SB 2W59A 2X4TB 5CU9A 4Z7UE 3BEWA 1QSFB 3D18A 3EGXB 4GH7B 4QRQB 2BOCC 1YNKL 3ARBC 3RYMA 4BUQA 5KSBE 2BSSB 4J4PC 4UT7L 3RUGB 4E42B 2A7WA 2VMFA 4I77H 5HDOA 1U8HA 4FG4A 3E89A 5IF0A 1BQUA 2IPKB 4RIRA 2COVD 1TETH 4P23A 1COWG 3GMNA 3B2EE 5AOZA 3ARBA 4G7QB 1M2VB 2ATPA 4AY0A 1N6QL 3MOQA 4JGSA 5FPRA 4NXNO 1EH9A 2EILC 4M8VA 3BUYA 3L48A 2FBOJ 4YGAB 3LZQA 3FB5C 4OAWA 3WDIA 1NIDA 1PZ5B 4YQXH 4S11A 1SJHA 3EYOB 5MEQA 4JX0A 3T04D 3OTOO 5BZDB 5IJ9B 5D7IF 1AHMA 4GRLD 3VH8B 1JF5A 3AG4C 3D3IA 1CL7L 2NMSA 4LHQB 5CMUA 1U3JA 2WZ0A 2ZP9A 2YXMA 2J72A 2ZCZA 4FKEA 3CFKB 3DA0A 2AHYA 5B1JA 2AVGA 3US0A 4CU8A 3QQXA 1G4RA 2E0PA 1GCFA 1FFOA 3BESR 3P2TA 3PHQB 4X62B 1YECL 2C34A 4OY9A 3E86A 5AYUH 3RIFF 2XNDG 2AHIA 4HS3B 4AHCA 4KY1L 4AG4L 3MRCB 3GI8H 4DR1O 1CG9A 1TZOA 1NCNA 3JVFC 4PJ7E 1VJSA 2V2TA 5D6DC 1GYVA 2LFGA 5EBMA 3F7YC 1SYSB 4R90H 2VISB 5LHHA 2Y0IA 1TZHA 3EJRA 4HFUH 4J3OG 2ESVB 2YSUB 4GKNA 1H6TA 5MEPA 1P9MC 2K1MA 4Z7NB 3WMQA 2UZPA 1L6XA 1N64L 2YQBA 4CC1A 2BVPA 1SF3A 4PG2C 2C9RA 4JFED 1UB6B 4NDMB 4OLVH 3O3DA 1GMIA 4YWGL 3PJNA 1SBSL 4QO1A 3AM8A 3QNXB 4OD2B 1I94O 1S9WA 2E7MA 2XVLA 5GQBA 5ESQA 3IFLL 3L1FA 2BHZA 3LS5L 3QNYB 2R51A 5DLLA 2GUYA 3BLKA 1ROWA 4UTBA 1MSDA 1JP5A 3VFGH 2LGWA 1FAIH 1Q9KB 1G9EA 3LDCA 4DFHA 2EDWA 2CXGA 2H45A 4DGIL 1A66A 3UPRA 5EEXA 1Q6HA 4G2KA 1EJFA 2O6FA 4K2UH 3WCYA 4NVPA 1GMGA 1T3FA 5J11C 2P5ED 5B7MA 2CDFA 4P2CG 4XPFL 3WTTA 2YZ8A 2H2SC 3F65A 1BAWA 4X7CC 3VQMA 2BVUA 5IUSA 5ELIA 3ESNA 1PG7H 3OWEA 4U2ZA 5IQ9A 1M57C 5CA0B 1HJCA 2OCCB 2HJFA 3E3QE 3H6JA 5HHPA 5EOCL 3QNZA 3RYIB 3G9AB 1NFDE 3II1A 3QZBA 1FFOB 4BSJA 4OUUB 4EZLA 2IV8A 1UEYA 4MA1B 4X9GA 3VOUA 5I1AB 1CDHA 2V5SA 4HBCH 5JHLH 3H56A 5D7LA 5I71C 5LNEA 3WUWA 4OLXH 2ENJA 3WN5A 1E0OB 4JZGA 2R0WL 1T7VA 3AXLA 1U2HA 3Q8BA 1PNCA 3P02A 3ULSA 4BJLA 5JZ7C 1EHKB 5AW0B 2VWEE 3JARB 4FXKA 4NQDD 1P1VA 4YE4L 3GZQA 1GSMA 2W0LA 2CUMA 1MHHA 4O58H 3EO0B 4G8GD 1TQBC 2XTJC 4PV8A 5AQ0A 2QQNL 2QKIA 1A1NA 3QIBA 4QHLB 1IDSA 3AC0A 2B2XH 5CZRA 1F97A 1I31A 4JRXD 4GXVL 4LVHB 3ZHDA 4F33A 4Z3GA 2CDGA 4Z78A 2OR7A 5K9JH 3CRQA 4LF6B 4LFBB 1QTSA 5E6SB 1LR1A 3OR6A 3QG7H 1VQPV 2BZDA 3BKJL 1JF6A 1FZJB 3D25B 3GSVB 2Y48A 4LVOB 3DROA 3OL2A 1I7RA 2FWOA 5AALA 3GZOA 2BY1A 1SZTA 4LSTL 4PG9B 3WKMH 1IBMB 3LNIA 3DMMC 5FA3A 3ET9F 3MRFB 4HMDA 2VZUA 4WI0A 4GNKB 3II3A 4HP5A 1PP9H 2A4CA 1KLFA 1A7QH 2OJZL 1A7NH 3IMRA 4M29A 1CQKA 3QIUB 4OBSA 4PJAA 5KHHA 4YHIA 3RBSA 1ZLVH 4FAAB 1F4YL 1R9FA 1S9XA 1XGRB 5D71L 1X6NA 1L9SA 3U9PL 2XOKG 3U2IA 1PFOA 3FOLB 2FCBA 3DURA 1TR7A 3AEIA 1BVKB 3OG6B 3VFRA 1L9NA 2IJKA 3EJUA 4M6MH 1E4WH 1EM1A 1ERNA 1ZMYA 3KPQB 3OJDA 4AOFA 4J2QA 3LNHA 5EC2C 2EQDA 2GFBB 4LSDA 1GCYA 4MBOA 3P3NA 1UENA 1IAOB 1YEDA 2A6IA 1KCSL 4ZXBA 3E8HA 2TSAA 3H2QA 3D07A 4QE9A 2GT9A 3QDMD 3SKMB 4LCYA 5JPNA 3X12A 3STLA 4FTDA 4ZMPA 3CJHB 1R24A 2KQNA 2LVCA 5FF6B 4WI2A 3X3GH 3BN9C 3IDYC 5ID0B 1JZ6A 1HJBC 1VQMV 2GUOB 4QTHA 1BVLA 1NT2B 2GITB 4JFEE 4NQCD 5CEZH 5D1ZC 3QWOA 1T3FB 3K4ZA 3W7TA 1Y6NR 3B9KB 1LO4L 2N4IA 2Q67A 4J6RH 4QRBA 3WBDA 5DVNA 4JPQA 3CFCH 3NOIA 4OZGB 1A4BA 2XASA 4YLCA 2LE9A 2VQEO 1S3JA 2VOTA 3MRNB 2YUZA 4ZS6D 4R4BB 2WPGA 5DD6A 1I1AC 1K9TA 2BY0A 2Z31A 4KQ4L 1M6OA 3FO9A 4PJ6A 4NHCL 4TV9B 4X4KA 1M56B 5JVDA 3B34A 4NKOB 3ZKQD 4IKIA 5D1QA 4PAZA 3WOVA 2NXZB 4DHLA 1NTKH 3RNQB 4WI7A 1FYTE 4KX9A 2FEJA 2WKGA 1G6RL 3KCPB 5KOVC 4XNZC 4JI4B 3RPBA 3VMPA 4I2XB 4KK5D 3CDGA 5LHGA 3HG2A 2NT0A 4QDGA 1Q6UA 5KANI 2OWOA 4AYBA 3P9MA 1PIGA 4TLUA 4RX4D 3RU8L 5I1GH 5FCUH 1IM9A 1AY1H 3JATB 5JORA 4RMTA 5D96C 2M7WA 4UNIA 2VN7A 4G5ZL 2FIRT 1G1OA 2ARJB 2VDNH 5BVJB 1R3HB 5HPOA 5T5NG 1N2RB 1CUOA 4P07A 2CO6A 2DQGH 3ARED 3ZKSD 2RALA 3LRSA 5BZXA 2H2PD 4AMWA 5CGYC 4QAMB 3CIAA 3OR6B 4H26B 2IW5A 4ZMVA 1IAKB 1BMZA 1RZ8A 4G1EA 4L9DA 3TVMA 3U0TA 4ERSL 4L4TD 4WHYH 2AJUL 1B4RA 2N3JA 1JHTB 2Q6WA 1EUTA 2J1YA 2PLTA 4FQIH 1MELA 3BE1L 1FL6B 1X5IA 1T04B 1ET5A 5EIQA 4J80A 1JTPA 2P24B 4NHCH 4L8CA 3EH4B 3LZPA 2ILMA 1N34B 4QI3A 2OSYA 1BLNB 4B50A 3B3IB 1ZL8A 2MCPH 4P49A 4RMRA 4NUJA 2D7MA 4JHWL 5CGBA 2VZ3A 1CFTA 2HVKC 4EZMA 3GSWA 4OCMC 1M6OB 3FO9B 4MWFB 4S1RL 3VFWB 5KYUB 2HRPH 4GKKB 1OCWH 2LTQB 2NT1A 4NQCB 4WTQA 5DMYA 1GYAA 4BSVB 5C0NC 3VXPA 2B59B 4JI2B 4PJ9C 1CDCA 5F7KC 1R5VA 2AANA 4M93C 1CLZH 1UT1A 3JTTA 5EU6D 1SGKA 3P2BA 4D0BB 3NR7A 1MW3A 1QVFU 2CJ3A 2RNBA 2E9WA 4O2FA 4WHTA 5EWIH 3L9EA 3PJSA 4ZHQB 5IBUB 2YJQA 4A7GF 4FQQB 4LVNC 4X4YA 1JGEA 1SOSA 5BNXD 3QO0B 3UC2A 1GZQB 3WUWG 3NCYS 1E4XI 5T1KD 3JV6B 1C5DB 3U4AA 2WXMA 4QHLA 2G3XA 5JR1L 1VMGA 1FG2A 5DJ6B 3IVKA 1ZSDB 15C8H 1AR1C 2F95B 2HKHH 1CR9H 3B2VH 1LO5A 4DCQB 3JSLA 1CF8H 3G5VB 4K5PA 3B9EA 1AXSA 4G1MB 3MO1B 3QXUA 4B9KC 3SPHA 2P45B 4MKTA 4AKQA 3EBAA 2ICEA 1CFSB 1IBGL 3UTTA 1XL6A 4NPYB 2F0CA 2E9IA 1MSWD 1QZNA 2B5IC 3PHOA 1D2OA 2XKNB 1H6FA 2P8PA 3KCXA 5D1QE 1RUKL 5CWSA 2WNWA 2FJFA 4R4BA 1S5JA 4Z6AT 4FNLL 5DJYA 5BOJA 5I28A 3N40P 1XF2A 2EDJA 4HLZG 5H9CA 1FKAO 5DRZB 4FNUA 2R0KL 4OD1L 3BZFB 1KB9F 3CZSA 4N90E 1KBPA 2VL5A 3GBLA 5IREA 3WYRA 3H1LH 4JPRA 4Y19E 2XETA 2AV7A 3ARQA 2FX8H 2WM0A 4ODUB 4CNIA 4X6CF 5DU7A 1J9TA 2KH2B 3AG2C 1KC5L 3OKMA 4UNVA 1A6VH 5AYTA 4X4MA 2I25N 1SA0B 1CURA 5HHOE 4BZ1H 1EHAA 3LPWA 1KLGB 5BOZG 3FAXA 4DWHA 2X6VA 1NOLA 2HT2C 4XMUA 2GJRA 2V2XA 4MRCA 5IMLA 2DJUA 3H01A 1S7UA 4PFEA 2CM5A 4Q2ZA 3MV01 4ZX6A 4JQXA 2BMKA 1C5CH 4O2FB 5EHFA 1NS1A 2AGJH 4C59B 1KBVA 1BHAA 1G0XA 5JIIA 4JKPL 4OJEH 3CDZB 4ZUWA 2BJML 2H3NA 2BOBA 3NZ8A 5I6KA 4JKNA 4ZPTA 3NEOA 4XTRC 5HDBE 3GKZA 2HPOA 1JI2A 5CKAA 1E43A 3TZVC 5I73C 1L3WA 5B3SC 3FQNB 5E5MB 2I60H 4Y9FA 3HVNA 3N1MC 1VLXA 4LESA 4YPGB 5GGRY 3NUKA 1BXAA 5F8RC 5J6GA 5EULV 3GD1C 4NFDA 2J6WA 4OPAA 3BPOC 5JMRA 3KLHD 1ROCA 2YWYA 4DZ8B 3QA3A 4LF9B 4ZAKD 1U95A 1OV9A 2LABA 5C08E 1NLDH 4TKWA 4WLCA 2H8PB 2HFFA 4L3ED 3VAEA 4KKRA 1JF1B 2WWKO 4TQPA 2PYFA 4ONFL 3DGGA 4GAJL 3RPIB 2X3AA 1PX3A 1TYJA 2P5EB 4XVTH 2J4WH 3QULA 3RYHB 3N5AA 4NGHL 3SQOH 2Q4PA 3LKRA 5E6ZA 1IKFH 5G4MA 1PFCA 3WNKA 5I2IA 1VGEH 3GLDA 4Y19D 1BVOA 2EX3A 4DK1A 1WH0A 4GXUM 4K71C 3VXQA 4XX5A 1I8MA 5HI4D 2J5LC 3EJCA 4U1MA 2G3NA 4ZYKB 2CMRL 3HRZA 4C8XA 4TOYH 1QU7A 5E8EA 4FQ1L 2Q8AH 3VFUB 5K59F 5AW5B 1DSYA 1SXBA 5CXPA 2GBOA 3B5GA 1I75A 4PY8I 1CDYA 2F19H 2BWDA 2MJWA 3BW9A 3DX2A 4Z7WE 1J8HD 5F1NB 3BEHA 1SQVH 3CFMA 2MK3A 3D39A 3V0WH 4LXFA 5A2JH 1DQTA 5ANMA 2QSVA 3HHSB 5GZNA 3PN1A 4R0LA 3MJ6A 1FGVL 1P5VA 5GGTH 3D50A 4KJPD 5HVGB 1OCRC 3D39E 2QR0A 4RFNB 4PGJA 3FQ1A 4GQRA 4JE4B 1YSOA 5FCUL 4CVXA 1ZA3A 1SVBA 3L3DA 1XZWA 1AFVL 1DEDA 1X7TA 4V11A 5EUOB 3ULUH 1CVRA 2B4CC 3O2VH 4X6DF 3T0BA 1ITCA 1W16A 4ZTOH 3U1PA 4QJ5B 2E46A 1SQ2N 4ONFH 1YEHH 1TAEA 2Y1AA 4FM1A 3FQYA 2NUTA 2XQYG 3GSXA 2CU9A 2OMYB 1LP9E 2EE6A 1A9EB 3KPLA 5EOCJ 3H7BB 3QQ9D 5ESVB 1V55B 1OGTB 4WVRA 4XC3L 5SV4A 2VCOA 3M6DA 3NPSC 1I1RA 3NACH 4RMUA 4TM9A 5AL0A 3MRCA 3OKLA 1KCVL 2I7SA 2QLYA 5J1TC 3T2QA 3RZCA 3TT1H 1TCMA 1W6WA 5MHSD 4IU3A 4BCXA 2EE2A 1D5BA 2AFNA 2D7NA 4DKTA 1LGVA 4X8JB 2ZOLB 3LEVL 3ARGB 3ABMB 1I7TA 3FO2B 3KM1A 3PL6A 3LNEA 2QVTA 5LN4A 2DQFB 3QBTB 2X53A 1I4FB 2PN5A 3T0WA 3ZDXB 4K7PL 3P2DA 1H5BA 4KMQA 4IEFB 4XPBH 5JXEC 2FTKA 1MY7A 4AQOA 1VFAA 4KP4A 4GRWE 3BPZA 4MVMA 2HAZA 3SDAB 4GEJA 3B8YA 5CJOL 4GI8A 4V1DE 3MV8B 5H4YA 2JIZG 2DBLH 2MRYA 3VRJB 1F11A 5MERB 1BOGA 4BK8A 1CP9A 1NICA 4OCSL 1N59A 3FQWA 1UOVA 1AFVH 2DIAA 3IU4H 5IYZA 1A47A 4J4PA 4CDHA 5AVSB 3WENA 3T5WA 1I7UB 1B6UA 4PJXA 1FFPA 1RZJH 1N9PA 2G5BA 3NN8A 2IGFL 2WIMA 1R3IL 4LT7A 3D3VE 4A39A 2QTOA 5JW4N 3OZ9H 5DD5L 4EOWL 4LDCA 4MSWC 1MCRA 2JXMA 3D85B 4K7FA 4E41B 3S5ZA 3QISA 4P46D 2AJYL 2OJEA 3N9GL 3TA3D 1ULVA 3A6CL 2VUOA 4QRFA 4A7SA 1TUBB 5E6UB 1JOIA 2B9AA 3LS4H 4DGIH 1G7IA 5F9OL 3PV7A 1DFXA 5MI0B 2B08A 3VXMB 2DTML 4M61A 1MIMH 4AJ0A 3RYHA 2K0RA 3HNSH 4LWSA 3JAMN 1G7LA 5F9AC 2Z35A 4EI5A 2EDLA 1FBIH 4KZCA 3FX7A 3FTZA 1U8OA 4JFFB 4X80H 4UUJA 1VADB 2GV9A 1NLBH 3O4LE 1IKOP 4X1YA 2BC4B 3GJFA 4H0LC 3L3OA 4CH3A 1HIMH 2XZQH 3UAJD 4HK0B 1NH2B 1KB5H 2FL5A 3CD4A 3ARDA 3EHBD 3EYSL 4NCDA 4QHNA 2V37A 5D5MF 3W0WB 3DO7B 1O7DC 4AVKA 4G6JL 4PJHE 3QC5X 4KFZC 5C9JB 1S9VA 1YEJH 4Z7WF 1MAML 4KKAC 2K8QA 2V2WB 1WA8B 2VLJE 5FDWB 3NCXA 4B6ZA 4LH6A 2R0WH 1P5VB 2RJMA 4XB3A 1SVZA 4LSQH 3L1GA 5IGXH 1DBBL 4HCIA 1KC5H 3JALA 3APQA 1RSOA 4K9EH 2R39A 4LBEA 1NU1H 1EEUA 1GPOL 1FO0B 2UXCB 2G0LA 2V9RA 3PABB 4YE4H 5F70A 2AQSA 4FN0A 5I76A 1HEHC 1PX8A 3SHSA 1YEWA 3UYRL 2WY3B 1A7RH 4FFYL 2BFGA 2KPNA 2IOIA 1A7OH 1PY0A 1YYML 4JG1H 4JO5A 5E2TL 1YN7B 3L16A 4XGZB 3S98A 3RKPA 1I7RB 2FWOB 3B7UX 4F58H 3IGAA 3JD0A 1FFPB 3WIHA 4KO7A 2HFFB 5B7FA 1UB5B 2P52A 5GS0H 2GVYA 1K6QH 3BWUC 5F7DB 2EVGA 4GO6B 2AEOA 2E9BA 3BPCB 4X5XB 1OAYH 3TA4D 3TCTA 2YD0A 4X20B 2VLKD 1FZMB 2ADFH 4LAJH 4NNPL 1XQ8A 4PUBL 4Z18A 4DKAA 2VXTL 1BG9A 1OLLA 2G30A 3VXSE 5C93A 1BJ1H 4UTBH 5JLZB 4XCNA 4MCNA 4DV6O 4M1GH 2WJ5A 1P2CB 1RQ5A 4Y4KA 4I3GA 1L0YA 1AD9B 2B14A 2Y6SC 3UFIA 1B2WL 2OZ4H 2XAJA 1A21A 1YCSA 2VXVL 3AACA 4LVNB 4OFQA 3U0ZA 4FQXB 3MTRA 4X7TB 3BAEH 3E22A 1I7TB 1MF2L 2ADJA 1MAMH 1AS7A 2K45A 3WSQL 1FUNA 4QXWA 1JPTL 1F3DJ 3BLPX 2P44B 2CO1A 4L29B 1EN4A 1PZBA 1XHZA 4XCEB 3ZZ1A 4FNRA 1NBZB 1SN0A 1FNGB 1QNZL 5FYKL 1EHNA 1QWHA 2IPKA 1A0QH 3QJOA 3DXAE 1TMQA 1L6PA 4FGMA 4F8NA 2E5EA 3NIFE 4MQ7A 3FSWA 5KVGL 1GGUA 4YXLH 1NTMH 4DZBA 1YMHB 3WJJA 1BFVL 3GBNL 1X9RA 3MBWA 2E7CA 1MRDH 2FYVA 3CFUA 3KNBA 1I08A 4U1KA 1U9KA 2CRIA 5AVYB 1DP0A 1CDGA 1GN2A 2VLMD 3OAYK 1UADC 4HUUB 1KN4L 4EUPG 1AQDA 1A9BA 3I9GH 1BBDL 3OKEB 4KQ4H 1YNTA 1SDDA 3IJ4A 3K5SA 3MJ8B 4LFAB 2PKDA 4QUOA 4IS6A 5ENWA 3SGIA 1W8EA 2RR3A 4WK0B 2QGDA 3T2LA 1TJHL 5KTEH 1MCQA 3CX2A 5F96L 3SOBL 1QFWM 1SBBA 3HKCB 2E76C 4NQXB 3UC0L 3RDTD 4ZMWA 5FYLH 1XF3A 1OD7A 3FFCB 3VDAA 3L3KA 2FQDA 1KELL 1L7IH 1U36A 3AT0A 1SETA 3OXRA 4GG6F 2QA4V 2GJJA 4WFBV 5TFSL 1FFTB 1JPTH 2PTTA 3WDHA 5B8CC 1IE5A 1TQUA 4O4JA 2ZXGA 4GSDH 1CXEA 3SDLA 4PJBA 3WHXA 2VT0A 1KJ3H 2ICCA 4I9WE 1SF5A 1MCWM 2Y36L 4D9LH 5AVZB 3WV0A 1YJDC 4A6YL 5ICYB 1P69B 2QFPA 2ZCKL 4J39A 4RFOH 4JYBA 2X9YA 1VACA 4Y4KC 4HSQA 3CDFA 4PJFE 3HZYA 5EFIA 3DXRB 3MCLL 4Y2OB 5D2NB 5KYXB 1ICTA 2GJ6E 4IOSD 3RX7A 5BVJA 1BZ9A 4HJ0D 4YSDA 3TVMC 3MCG1 4QE7A 2YSSB 3GXMA 3FB5A 4A2MA 2CO6B 3WFEL 5A6MA 4DUYB 3K6DA 2V5YA 4DKFL 4NERA 1UZ6F 2R29L 3MJGX 4I77L 1V7NH 4PRHA 5FO9A 3HR0A 3QUYC 3VFNB 1X9QA 1T1YA 2NY2D 1YDPA 2NY6C 1ZVYA 3QJUB 5I18H 3I3DA 3SCMB 3TPUA 3ROLB 1Q9KA 5CBGA 1Q0XL 3ZRSA 3UBXA 4PSPA 1QFUH 1JXDA 2VITA 2DQIL 4QOKB 1VEOA 3JXAA 2DKSA 3T1WA 1XXFC 1GRJA 1JGDA 1XR8A 1JFQH 1NGWA 3ZZLA 1GC1L 1OGAD 5AG2A 5L3DA 3CN1A 1X7QB 4XO5A 5TFSH 4N2MA 4J3UA 1RZFL 4ZUUB 1L3NA 1CLZL 1VADA 3VFPA 4G8EA 3VRIB 3MV9B 4FQXA 4K71B 2NQCA 2IU3A 2WAHA 4UDTB 4KJYA 3TBTA 2CNZA 3NJHA 4IHJA 2FGWL 3RYIA 4PP1C 1KMGA 4HVBA 1TVBA 2DDQH 1RXLA 4J27A 2HSIA 4OUUA 2QKSA 4BQBA 4X0KB 2IBZY 3E38A 2R8SH 1J1XH 2E8ZA 2DYPA 3IWVA 3KR3L 4BWWA 1FBIL 3P3TA 3D3VA 5I8EB 4UXNA 3WAKA 1XGUA 2F53A 4ODTL 3SKOB 3EFFA 1WBYA 1HHIA 1E3XA 4E2LA 3MBEA 1I9RH 3MUY1 4XXDB 5C0CA 1XMOO 1HIML 4L4JA 3K9AA 1KENL 2AI0H 3E6HA 1R3LB