5KUMA

Crystal structure of inward rectifier kir2.2 k62w mutant in complex with pip2
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
326
structure length
326
Chain Sequence
b'CRNRFVKKNGQCNVEFTNMDDWPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINEDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRCSAKDLVENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP-sensitive inward rectifier potassium channel 12
publication title Structural basis of control of inward rectifier Kir2 channel gating by bulk anionic phospholipids.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Metal transport
total genus 88
structure length 326
sequence length 326
ec nomenclature
pdb deposition date 2016-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01007 IRK Inward rectifier potassium channel transmembrane domain
A PF17655 IRK_C Inward rectifier potassium channel C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5kumA02
2.60.40.1400 Mainly Beta Sandwich Immunoglobulin-like G protein-activated inward rectifier potassium channel 1 5kumA01
5EK0A 4MVSA 1OCCC 4F4LA 4WFEA 4X88A 4R6ZA 3T4DA 2YEVA 4J9ZB 2HVKC 2QKSA 3ATAA 4MW8A 4G28B 5EBWC 4PDVA 4RAIA 3LDCA 2A9HA 4MTFA 2WLLA 3E8FA 2IH1C 3SPIA 3AGWA 3VSQA 4MVRA 3ASNC 3STLC 2AHZA 3AG3C 2WLJA 4I9WA 4XDJA 3SJQC 1OCZC 3E8BA 3LNMB 4JTCB 3E8GA 2Q67A 4MW3A 4MTGA 2DWEC 5B1BC 3SYOA 3ATDA 4H37A 4PDLA 4P9PA 3F7VC 3K0DA 4GX5A 4CBCA 3ASOC 3AT8A 2ITCC 5KUKA 1KKDA 3RVYA 2HFEC 5B1AC 3FB8C 2WLHA 3R65A 3OUSA 5KUMA 2GIXA 2WLLB 3SYAA 2QTOA 3EFFK 4UUJC 2JK5C 5CBGA 3SYQA 3AG4C 4BW5A 4DXWA 4X89A 4P9OA 4PA9A 3AT9A 3UM7A 4R7CA 3AG1C 1R3JC 2BOCC 2ITDC 5EBMC 3RBZA 3RVZA 4GX2A 5EC2C 1G4YB 2EIMC 4HZ3A 3OUFA 2DWDC 2A0LA 2WLIB 3SPHA 2X6BA 4P2ZA 4PA4A 4PA7A 4MVQA 1QLEC 1V54C 1P7BA 4LCUC 3E8HA 4R8CA 3SYPA 2HJFC 2ZXWC 3LUTB 4GX1A 4PDMA 3LDDA 4PDRA 1M56C 4WFHA 1J95A 3PJSK 3RW0A 4GX0A 3ZJZA 2E4FA 2R9RB 2EIJC 2X6AA 2A79B 1XL4A 3LDEA 4RO2A 1M57C 4TWKA 1ORQC 1XL6A 2NLJC 4HYOA 3F5WC 1R3LC 1R3IC 4G27B 4MVOA 3FB5C 2K1EA 3SPCA 3TCUA 1V55C 2Q68A 4JTAB 3SPGA 3SPJA 5E1AC 2EILC 3ABMC 5J9PC 2IH3C 3AUWB 3UKMA 3FB7C 1OCOC 1K4CC 3K04A 4J9YB 4MS2A 4LP8A 2W0FC 3OR7C 1LNQA 3IFXA 4MSWC 5EBLC 4JTDB 4WFFA 3X2QC 3ATFA 5CBFA 5CBHA 3ABKC 3KG2A 4RUFA 3VOUA 4H33A 2WLMA 3IGAC 3K03A 4WFGA 4XDLA 3TETA 2H8PC 4LBEC 3E89A 4QE9A 3BEHA 1U4EA 3K06A 3STZC 3AG2C 2Q69A 2HG5C 2KB1A 3ATBA 1OCRC 2P7TC 4MTOA 2Y69C 3FB6C 2ZD9A 3K08A 4MVMA 4QNHB 1U4FA 4PA6A 3OGCC 3T2MA 3SYCA 4EKWA 2DYSC 3ABLC 1N9PA 2WLNA 2DYRC 1BL8A 3E83A 4RUEA 3JYCA 4ZBMA 2X6CA 3ATEA 3ZRSA 2HVJC 4OXSA 4XDKA 3T1CA 5B3SC 2OCCC 2ATKC 3T4ZA 5BZBA 3K0GA 2WLKA 3K6NA 1R3KC 4KFMA 3WG7C 2EIKC 4QE7A 1S5HC 2WLIA 1ZWIC 2EINC 2BOBC 2Q6AA 3F7YC 5EC1C 2AHYA 5IY5C 3OR6C 4R50A 4MVUA 1JVMA 3GB7C 4P30A 4X8AA 1K4DC 4PA3A 3HPLC 3E86A 4MVZA
chains in the Genus database with same CATH superfamily
2J5WA 3ZDXE 1TLMA 2YEVA 2J6EH 3CFNA 3CXHK 2NYYC 5B8CC 4JK0D 3NT0A 3MBWA 2BSED 1XV8A 3U7WH 4JLRA 2MPVA 4WHYG 1OM3L 3HC0A 3ME0A 5DI8A 4ZX4A 5KTEL 2OYMA 3OJMB 5JXED 4AZ8B 4X8JA 1S9YB 4DZ8A 1ILUA 5LGKA 4CDGC 2VUKA 1XMOB 1MRCL 2VE6B 4PTUA 4Y2DA 1QFWI 2CLRA 4GSXA 1E27A 3OJDB 4PRPA 4AZUA 2WWKT 2P4KA 4RDQF 4N23A 2N3JA 3R4RA 4WVRA 5D7KD 3TCTA 4GQQA 2AAAA 3W7UA 2EO1A 2PABA 2VLKD 3FQRA 1T3FB 4G8GB 4HCIA 4JM2C 5CUSH 4AYSA 3L2LA 4JDVA 4F9LA 4I7ZC 1IM3A 4DGVH 4YGAB 3WO4C 3ZGHA 2Y5QA 3JTSB 1VF7A 2WINA 3EJRA 4NZTH 4FCHA 4PCKA 4C56D 4E0RB 5T1KA 2H1XA 2DI7A 1LO2L 1M4UA 3IMVA 4EBQH 1G1XB 2DZEA 1YEEL 3GEWB 4LXFA 4JGSA 3TXAA 1HVXA 2VDML 3EJCA 5GS2D 3P73B 1DQJA 1E4WH 3MFGB 4WI5A 2XN9E 1UM5H 4N2KA 1MHEA 1BFVH 3MREB 4IK7A 4Y4FB 3HMXA 3MN8A 2D0GA 2HFFB 2UUCB 4UIMA 4OCYH 3JAWA 1B9ZA 4PWHA 4KXBA 2P24A 2A7WA 3FQUB 1KGYE 2EVJA 4OI8A 4PJ5A 2MCG1 1LGVA 1TSRA 4GG8B 4N6RA 2JNZA 4DV3O 5LL6Y 2KQMA 4TOIA 2R1WA 2WZ6A 3MBED 1N12A 3QXDB 4WEBL 3RE0A 4LLAA 5H4YA 3N1PC 4K71C 2WWMC 1D5XB 3M45A 4Q20A 3WEAA 1IKOP 3CAFA 3DX8A 1KBHA 2F8IA 4H1LH 3A0OA 4TTDC 1G7QA 1XO8A 1A22B 1CG9A 4ELKA 4Z1PA 2VXSH 3WFZA 1ZL8A 2FD6H 4PV1B 2ITFA 2O26U 2ZYSA 2RFXA 3JWDL 4LLMA 3K03A 1XGQB 2JK5B 3OLEA 3KLKA 4G5AA 1UGNA 1OP4A 4GCZA 4Q9RL 2JKWA 1UADC 1D9KB 3A6CH 3KPOB 4N0FB 4NPYB 4BHUA 3P1VA 3H9YA 4OVUA 1N32O 1MIML 1A0QL 2AVGA 3OC5A 1SFDA 3X2QB 3JV4A 2CD0A 2AXFA 2MQ0A 1RAMA 3FKUS 4OB5H 3C6LB 4JR9L 4Z7WA 4EI5B 4ZX5A 1WP8A 4OLYH 2H3XC 4LHUA 1R5VA 3HB3C 3QQNA 4NUQA 3JXAA 3HHSA 3WEOA 2PR4L 2UU9B 1NI8A 5CLYA 5CZXD 4U7SA 4KNQA 3EDKA 5HGBB 4CS4A 4L3CA 3TN0D 4IOSD 1U8HB 1LQBC 2NTFA 4E41A 3DXAA 3HC3L 4DUZO 1ZRUA 1HEZB 4PDVA 3H9ZA 3WIAA 4ZTPH 5J8OA 2DE0X 3IVKA 2RCSH 3OTOB 4OI7A 2A74B 1G7LB 3BGMA 3MTRA 3STLA 3ZRVA 4DR1B 1R3KB 3QF7A 4MAYB 4D8PB 5HYSA 5GRJH 4LSRL 3OPUA 4JVPA 3BH8A 4XMVA 1N7ML 4LNVA 3BMWA 1N36B 3MRCB 4Q6GA 3RVXC 5B1JC 3V0HA 4DGVL 3QEQE 1FNSL 3BKCL 5I6PA 1J8HD 4LSSL 5JQGB 1QWHA 2NSQA 1XF4B 1QLFB 2WBKA 5FWQA 2ZP9A 2X9WA 3RAJL 3EGSA 2KMWA 2DYRB 5EYPA 2FQEA 2G30A 4DGWC 1J9RA 1PP9H 4JRXB 3TJTA 4CADB 5IJDC 3NZ8B 4HK3J 4U6HA 1HKFA 3P0VH 5ANHA 5DLLA 4Z7IA 4TQEH 5F44A 3AQXA 3DGGB 1OSZB 3T0WA 2CJ3A 1EEUA 3X13B 1C5BL 3C2AL 4OLWH 2PP9A 5EUKB 4WFED 3I2CH 2WMPB 3FBKA 4NO0D 4HG4K 2UXNA 1GN2A 3F12B 4NZDA 3RUGF 3IGUA 1TQWA 2XZAH 2W6JG 4L4JA 1G9NC 2CDGA 2JXMB 1B6UA 3OXSB 3N27A 1WITA 4LEEA 1NC4D 1AP6A 3L2NA 4Y1AE 1ORQA 1A1MA 1BOGA 2P8LA 2GT9B 2JCCA 4F33B 4HMEA 3EO0A 4MVOA 5BRZB 3PXHA 4WENB 3TNNB 3FT2B 4NYLA 1S5LZ 2VZTA 4TUOA 2JFCA 5HJ3A 5I66A 5LJYH 1ASQA 2GJ6B 3ESMA 5EN2A 4W4NA 1XF5B 4R96B 5BV7C 5FOBA 3X11A 1HH9B 4Y2LA 4U49A 3IU4H 4WFFA 3ARFA 3IDMA 5I8KL 5CP7B 3ZR6A 2FT6A 3JT0A 4HJGB 1ZLWH 4MZIA 4BDVB 4LQFH 1D7FA 4NO5A 5CMAB 2Y36H 1F86A 3VQYA 3NJLA 3L9DA 1F90H 4HLZH 3D2UB 3L5XL 1UH4A 3TPKA 3HE7B 4I9WE 5JXEC 5FIEA 1EEYB 1URIA 1R6VA 1IGYA 1ZXQA 4FOMA 3QDJB 4W93A 1RK0A 5D7SH 3FT3A 3MA7A 2M8XA 4X4ME 3WJJA 1S7QA 1ODAA 4H2AA 4K94C 4B3VA 1TU2A 2WBJD 1QSVA 3Q2CA 1IGIH 2ZUWA 3SEPA 4OXSA 1QR1A 4DTGL 3FCGA 2D7PA 5DHYB 4ZFZA 3H56A 1JHTB 1A4BA 5FYJE 3F7YA 4HC1H 3THMH 4FG6D 1OF2B 4U1NA 3QQ9D 4BWAA 4MJ5A 2AJYL 4W9GC 1NANI 3MUJA 1J0ZA 3K6FA 3GXFA 4FQQB 4MCMA 2BCMA 2YGVA 4N8CH 4XP4H 4ACTA 4F15B 2I07A 3W0WD 1I1AB 5INDB 1JFFA 1JZIA 4ELDA 5DRWB 3DX1A 2F7PA 1HAUA 2A9MH 2ZG1A 2PCPB 4XNUH 2EIKB 2OJ1A 3VCLB 5IB5B 2QQLL 4JTCB 1ZA3A 1JNNH 3AS3A 4KY1H 2P45B 1QLEH 2Q7NA 2W95A 4X98A 3ZTJG 1TVHA 4Q6KA 3FOLA 2H0PA 1CFSA 3FB8A 4TQEL 3T2NH 1KSRA 1LK2B 3FUNA 1DF4A 1FZKB 5F1NB 5IVXF 3DX6B 3DHPA 2X1QA 5GHWH 1N6QH 2R9HC 3SDCC 4FG0A 2C1PB 1JDAA 4XN2A 2O5ZH 3VGAC 3FU9A 3NCBB 1TSHA 3AT0A 5JHDA 4MA8L 1K3ZA 4O4JB 4GKLA 4X5WA 5T3XL 2RTTA 2XKSA 3L8QA 2IF7A 1D5IH 4IMKA 1SXZA 5ADOL 3W2DL 4ZKIA 2ZYHA 4OJEH 3ZQWA 1I8MB 2JELL 3IAYA 4KTYA 3RYFA 1N32B 3AROA 4W9KC 3GJFH 5ITZB 3TTYA 3ZUNC 1QATA 1CD1B 4IMLA 1JJ2U 3GIVB 4QXVA 3F5WC 4BZ1L 1K3EA 1OCWH 2XN2A 2AQQA 2FUTA 2OSLB 1OQXA 2OTUA 5AB1A 4ZPTA 2EO9A 5CD3A 2PETA 2VDLB 3UJJH 3QNXA 3L7EB 3GSVB 2GUOB 4Y4KA 3TN0C 3INUL 4XRCB 2X3AA 1NMCB 1IC4H 2OXHA 2AZAA 2Y1VA 3DWTA 3HS0A 4R0LA 1S0VA 2GG1A 3RTQC 5AUMB 3ZL1A 4N9GA 5HP5A 1PFCA 1BMZA 1A1NA 4PRHE 3L5HA 3GMLB 4FJZA 1O9VA 3IDYC 3STZC 2PTVA 4PJ9C 2YOAA 2AKRB 1IGIL 5FCUH 5KVEE 3SQBB 2CPCA 4IT5A 5F9OH 1FXHA 3MSPA 4PLNC 1MJJB 4PJFB 4XMKH 3WI9A 4KGLA 1IBHA 3KPRA 3O3AB 1MCJA 2AEQH 5KANI 2X6CA 3B9EA 2FX7H 4O2FB 3RU8L 5B4MC 1FG9C 1WEJL 1AFVH 2DPKA 1EA9C 1RZKC 2E6QA 3KW7A 1IC5L 1JG9A 1S8DA 4KU1A 3UJTL 3HI1B 2YRPA 1JRHL 1U92A 2R2EA 5DC4B 5DZJA 1EGJL 2BVUA 3CVHH 3VXQB 1CXEA 5J1SC 3S0PA 3DRTB 1BQHA 5DURB 4XNUL 4UQ9A 4LO9A 1AROP 4AV5A 1BSIA 4PJDF 4JY4B 1TIUA 1XH2A 1JNNL 5HGAB 4DO4A 4N1CA 4JPIB 3OKKB 2ZT9C 5F3BA 4GP8B 1YY9D 5D2NC 4UOQA 3BFRA 1ERNA 4AILC 3D09A 3UAFA 4HIHA 3DXRB 3ATDA 4JY5H 4ZW8A 2CLZA 2YXWA 1JPEA 1I8MA 1W15A 1Q0EA 4LHQB 1WCBB 1YVWA 3CFBA 1GOGA 1QASA 2Q7GA 4JGMA 5GGQL 2A6JA 3FCTA 5CR1A 4D6TH 4HJ0D 4Z9KB 3D3QA 1A7PH 4YDIL 3F84A 3NK3A 4NR1A 3VXRE 3NABL 3V0FA 3ARBA 2IALA 3K71B 5B3JF 4PYHA 4X7FC 3ECBB 4RIRA 5JVDA 3RZWA 1RPUA 2WP3O 1T1ZA 4U1KB 1TGOA 2XWTB 3RWJB 1SBSL 3O41A 3SQOH 2ZKHH 1MLCB 1HKLH 1L6ZA 4B27A 2BS71 2QFRA 1FFRA 3QORA 4L8SA 3US0A 2GJPA 4S1QL 3JWNC 2CGRL 5IQ7H 2QJ1A 1IBMO 4WNQA 2EVGA 1CDGA 4KI5F 3A23A 5TDPB 4YZFE 2YAOA 3F7PC 4Z7VB 1IXMA 5CBGA 4PJCA 2FH8A 1HINL 3BDYH 1CJYA 1B2WL 3ZKMD 4I3GA 1HILB 4QO1A 2AABH 4F3FA 2F53E 1UZ8A 3FHEA 4TLKA 1T1WA 1A32A 4W81A 5TK2A 5GSRA 4MMZA 4PGEB 2ICCA 3VG9B 1CLYH 3IFNH 5DRZA 5IWLC 3R4DA 4NO3B 2ZZUT 5E1AA 2X05A 4R26H 3QQ9C 3PDDA 4R97B 1OTTD 4C4UA 2WHVA 3HVDA 4TSCL 4U3CA 3C90A 3QCUL 3KLLA 5H37G 2YC0A 3BD5A 1RZPA 5C09B 5F9OL 3VFVA 4YHOH 4G1EA 3SJVD 4WO4D 43C9B 4YQXL 4Z77A 5DWUH 3P77A 5E4IA 3WKMH 4YEFA 2MOGA 5MEQB 3APDA 1JYWA 1BZ8A 2R59A 4ZMLA 4QGPA 5DLML 2FX9H 3FH7A 2RB8A 3GRBA 3C5SB 1F8TH 2AQPA 5FCSH 4BQ6A 4RDBA 2HRLA 2IBZX 1XCTB 1JWUA 1HNFA 3QNYA 2VH5L 5TE6L 5JYLA 1TCRA 4PPTA 4D7PA 4NOBA 5IYZA 4DV6B 1YEKL 1ZHLB 5KX5B 1RVFL 4JKNA 1Y07A 1VQ8V 2CM6A 3RVUD 2QWOB 2X4RB 2BNQA 1G7JA 4HCRA 1KJ2A 1L0NH 2L4OA 2LTQB 2FGWH 4G72B 5EZLA 3Q05A 2DF3A 4ZUSA 5E5LA 4R6ZA 4DW2L 4I55B 1YQ2A 3ETBF 1RURL 1T2JA 4HCGA 3AC0A 3DROA 3LKNB 3Q8AA 4XAKD 2R0ZL 4H25B 4Z6AT 2J2ZB 3NSCA 1N2RA 4N5EC 32C2B 3R19A 1M6UA 1EV2E 3CQPA 2KUTA 2X4UA 5T1MA 4GUNA 5F89B 1OPGL 4X6DA 4S10A 4CBCA 4AYBA 3HMXH 3W9DB 4GB9A 4WW2F 2JE8A 2AEIT 3G71V 4HZLA 1Q82W 2WLHA 3D36C 1CBJA 2WQAA 1QSFB 2E86A 2KPWA 2IGFL 3H9HA 4TV8A 3CP1A 3GMRA 5ABAA 3HG1E 1KIQB 1NIFA 4JYAO 5HYIA 1I1YB 3LEVL 4MJIB 3QHFH 4O2BA 4IS6A 2WCSA 4WFGE 1IBDA 4JFEA 5CIPA 4Y4FD 4V33A 3GBDA 3CJHB 5D7LD 4QJFB 4ZTEA 4FNPA 4IHJB 3K2MC 4YFLI 4UNVA 2F19H 4N6QA 1NCWL 5E51A 4JV5O 2GCYB 4L8DA 3U30C 3D9AL 2XNAB 4LCCB 1S6NA 5D1ZD 2P8MB 1E4XL 4F8QA 1QTSA 2WXJA 3NACH 7PCYA 4G7QB 1AI4A 4YHLL 4OD3L 5LHIA 2WO2B 3PHAA 2CLVA 4H8WH 2DWEB 4FFWC 1RFDL 2IQAB 4GSDH 4BFJA 1S4IA 3ZTNL 3B9DA 4PJBB 1J9SA 5AAWC 3RPKA 1AQDA 1MRFL 3PV6A 5C1MB 3F62A 2AJVH 4TF4A 1T66C 5IMKA 3ATFA 3GMOA 1NVPB 3HPJB 2OMYA 1KB3A 3JASA 3RLSA 5H35A 5KYWB 1G94A 2R1YB 1YY9C 3LPPA 5BS0E 2X1XR 4NXMO 4CBPA 4QNPF 5EO0B 4WTXA 1PLGL 3BO8A 3EYOA 2XFXB 1J05A 2IQ9H 4JJ5B 4MTXA 1A3RL 4FFZA 4YEEA 1JK8B 1H3WM 1Q8MA 1Q0YL 4IDJH 43CAB 3HAEA 3WLBB 5JQ6H 1AANA 3L1OH 4Y16A 2XWEA 4BK5A 1HWYA 2LQRA 3ARDB 3WNKA 2Z7YA 4BK8A 1CLVA 1E4HA 3BXNB 1T0MB 2O61A 4G2AA 1IDSA 5D7JA 5K9JH 4JFVA 4MJ2A 2IMMA 2RIKA 3Q5TA 3VJ6B 4UFZA 5KHJA 4XCEA 2WLIA 1GZPA 3Q1SH 1FBIL 1OGAB 2ICWA 3PCYA 2AZ0A 2NY5H 2WXQA 3GB7A 1KCKA 1DE4B 1EZSA 3IGKA 1ZLVH 1BQLH 4APQB 1A9VA 4WAFA 1MHCB 4YX2L 4NQCD 2GJZB 2NY0D 3TNMB 2GJRA 3FL7A 2A9NH 2ZAHA 4KRPD 4MTFA 1P9MC 2OXGB 1F18A 2R83A 3ZT5A 4OKVA 4EB6B 1FL5A 1NMBH 4PJGB 3ZKMC 5T1JA 3WU1A 3AREB 2GTZA 4XN8A 2CO7B 3TTSA 1UXMA 4MB4A 1L0LH 3C9NA 3VH8A 4FPPA 1EBOA 1F7YA 4X6FA 3QPXL 1XGUA 4XX1G 3CFCL 3LIUA 2DJUA 2N56A 3BP7B 3X3GL 4FM0A 4NAJA 2WY3B 3BLKA 1MZFA 1ECYA 2X2UA 1RU9L 1XH0A 1OTTC 2GSGA 5GJSL 3VFPA 4B3EA 1IAIH 3MFFB 1F41A 1MCBA 2BVYA 4CRPA 3C5JB 2F19L 1UJ3B 3G3LA 1JNHA 4FLRA 5TTRA 1ZLEA 1P6AB 4YXKL 1XSIA 4AEIL 1FYJA 2F6AA 4BJLA 1AILA 2DWDC 4JJOA 2VZVA 4NGHH 4N0RA 4TYUA 1IVSA 3BVNA 2FJFA 3LQAH 5IG7A 4GJTB 3V6ZA 2HJFA 1LWHA 2B1HH 1DVFB 2LABA 2QPUA 5BRZD 3MGAA 4JFTA 3IKCA 3EUUA 3Q8CA 5I76A 5E8PB 3OM3B 1QSEB 3RVUC 4PSRA 2YZ8A 4L29B 3MCLH 4B0MM 4L4VB 5FO2A 2XN1A 1JD9A 3QJSB 1X44A 2DW4A 1RPKA 5F0JB 5G4NA 1JZDC 3D2UD 3Q06A 3VRLF 1TR7A 3FH8A 1OAYH 4UTCA 5EOCL 5GGRB 5AEAA 3GSWB 2XVBA 3WTWA 1KMIZ 3QZWA 2HSIA 1ES0A 1BIIB 1ZJBA 5E94B 1DFBH 1E3ZA 3QDJD 5DMGD 5D5QA 3GMNB 5D72H 1KPUB 5GJTL 2BH0A 2GK0B 2HG5A 3DOHA 5AVWB 3K7UA 1P4BH 1TENA 2CO4A 3VXUB 2DQMA 5IK3B 1KOAA 4PA6A 4KVNH 2NNAA 3SY0B 3V6OC 1LD9A 1YPZF 4JY6B 1CC3A 5KYXB 5AOJA 5E08L 3TH2T 5L4FA 4M9OA 4PBDA 2B8OT 2NY5L 1XIWB 4JFQA 4EI0A 1ZGLP 4UT9L 1Y6MR 3E8UL 1G7MB 1E8XA 1RUAL 2FH6A 4NKIH 2YD1A 4CUCA 3CC5A 4W9FC 4QLWA 2P49B 3QJQB 4D0CA 5EUOF 5T33L 4QOKE 3QFJE 1PIFA 2OFQA 5AB9A 1SHSA 4F58H 4H26A 4EVNA 2WXHA 5FHBL 2PTTA 4A2MA 2GITA 4JYAB 1INEL 4FFVC 4LHJB 4PFEA 1NL0L 4OFDA 1SJMA 3SYOA 1N5YH 5I30H 1JUFA 4Y4FC 1PYWB 2MKLC 2CPUA 1K72A 35C8H 2EJRA 2WIMA 4NQSA 4Z7NE 2GI7A 1E9PB 1T04B 5KVDL 1BAFL 1XGPA 2XBZA 4JV5B 4DIXA 4IBVA 3GTNA 1AGCB 1IQWL 4G8FB 4U3SA 5CJ5A 4XDJA 4TM9A 2OW7A 4JN2A 4I0PB 4OBRA 1X5MA 5HDOA 4NTXA 5F88A 4FAAB 1UA3A 5I6MA 1SXAA 3M88A 1IAIL 4QHMB 1ZT4A 3MGTB 3ZRXA 2ITCA 2YEVB 3MV8A 4F1ZA 2GTAA 4PV1C 1VF6C 3QIUB 5D2LB 5DRNA 1MY5A 4LH7A 3ME0B 2JK5C 1FCGA 5FK9B 2EVFA 2OL3L 3HUJF 3LHPL 4MGXA 3VD0A 1LHZA 2ZWNA 3OPZL 4UYQA 3HE6A 4A7VA 2R9AA 4TUUA 3VNZA 3ZCCA 1A3LH 1A6VH 2WYHA 4PTUB 2CLRB 3T2OA 2DQUH 1MWAA 3KLSA 1G0DA 4NXMB 3RNKB 3B9KD 3U46B 4WWID 4UBDC 4PWGA 3WN5C 3QIWD 1OP5H 4LCUA 1VQ7V 2KL6A 3FQRB 4PDMA 2CTPA 3K5OA 5L6YL 3RGHA 4LRNL 5FNVB 5EBWB 1M9WA 1S9WB 4BE5A 1NBCA 4AC2A 5ENWB 2EE3A 2EDXA 2LQTA 5FO7A 5HDQL 5HGHA 4OX9O 3FO2B 3DHMA 4MXVF 4BYHA 4PGZA 4GKJO 1DLHA 2L7QA 1MFDH 4RBPH 4G7YL 5K69A 1NFKA 4KP4A 1L9QA 2F1MA 1GW0A 4ODTH 5CBAA 3EFFA 4BM7A 4CVXA 2A74C 2BXZA 3BDXA 4H5SA 4GI9A 5ESVA 5EBLC 1WAAE 4UIMB 4N8VB 3JAWB 5CB4B 2I60L 2NY0C 1KIUB 4JHWL 3BVVA 3II3A 1MFCL 3HKDB 1J0KA 2R1WB 2GUYA 2VMEA 3KL3A 3LH2L 4N6RB 3GSXA 3DUHA 3VQ1C 5K1VA 1YEJH 1WFJA 5D1ZI 4LZKA 3ZYJA 5CLWA 3DX8B 1ASPA 2ZR3A 1VACB 2H1LM 3EYFA 2BIIA 2YIHA 5L3DA 1A7OH 4L9DA 3F83A 3T2LA 1XAUA 4AQAB 3F6LA 2DYRC 3US1A 4LGRB 1BM7A 1ZAUA 4OTXH 4D9QD 3NCWA 2PI4A 1FWXA 3VWKA 2P42B 2ZNIA 1FRGH 2F7QA 1NQTA 1BJ1J 4NZUL 4E9SA 3ULVE 1KIPB 5DURD 4PS8A 4YSRA 1H15A 1YEGH 5EOTB 2EIJB 1PU0A 6TAAA 3KJ6L 3EHBD 1I7RA 1QVOB 2V7QG 1Z5HA 4MVSA 4GAYA 3OZLA 3JV4B 3MU3A 2AXFB 5IQMA 4HGMA 2HEPA 1JERA 2GIMA 1A7RL 4B96A 5I16A 5F6IC 2PPAA 5I8EB 1RLBA 2HFGL 1F5WA 2YKLH 3VI4E 3CFUA 3HZVB 4LHUB 5JQIB 3SE3C 3F58L 3C6EA 4LASH 3O6KH 1VQ9V 1D7CA 5DUBB 5IMOA 4MW3A 5BMFL 1UTDA 3G6AB 5MHSD 5F6HJ 3T3MF 1MVFA 3KPMA 3U0WH 1SYSB 1BWMA 4MMYA 5I17B 4Z23A 4X65O 4K5NA 4NNXA 3T4AB 1JXJA 2IPUK 3WEXB 2VQ1A 2BP8B 3Q7JA 4IRSA 4LRIA 5GW7A 3T6ZA 2ZCHH 2WVVA 3BGAA 3L45A 3HE7C 1S7SA 1EX0A 1TQCB 5DHXB 1SQQH 4ZO8A 4EUPA 3CYOA 3MX0A 3N42B 5DMGC 3L9YA 2OYQA 1NOFA 2A4ZA 4FLVA 2X87A 4DKTA 3R1GH 3T1YB 2NQDA 1GZQB 2KQNA 4GKNB 2ZX7A 1EXGA 3U1SL 1JA8A 3UMNA 4YLBA 1O7DE 3CCRV 1RJLB 3HZMA 4OFYD 3KWTA 1YY8A 3QPKA 3HKCA 3X1FA 4ZX6A 5EYPB 3DJRA 3KAAA 4QTHA 3UZVA 4PCSA 3GMQA 3RWIB 3NUKA 1QQDB 4YK4B 1BVKA 3HHMA 2X12A 4HOXA 4GH7B 1CIUA 2HPOA 3QEQA 5KVMC 2VAJA 2MW2B 5CJQH 3P4OA 2EZOA 4XHJD 3CXDH 4F15C 1I1AC 4OGAC 5T3ZH 1BBJB 2HKAA 1N8RW 1X9RA 2DWTA 1VFOA 4FZ8L 2WB7A 3SKMA 1SOQA 5JW4R 4PV9B 4HCRH 3ABKC 3L4CA 4AK1A 3V0DA 3L5WA 1KJ2H 1BOGB 1IBZA 2EDKA 2JQZA 2JCCB 2XKNB 3HJEA 4LBEA 3U36B 3EO0B 1LMKA 2IIJA 4OTXL 3QUXA 4I2XB 3EG9B 3TO4D 1P5VB 5J6GA 1R3JB 5HJ3B 3ZMZA 1OSEA 5C0IB 5JQHC 5EN2B 3DX9A 3X11B 1BZ9A 1JF6A 2A7BA 2PO6A 2EC9T 4WRLA 2KYIA 4AGLA 4Y1AA 3QDGB 4XHQA 5TDNA 5HYQA 1AJ7L 3CCMV 1MCFA 3K5RA 2X40A 4K7FA 5CNHA 2YN3A 3REVA 1TTCA 3IMBA 2IBZH 4P9ML 1YJDH 2ZUVA 4OBSA 4LLWA 3HNTH 3UGUA 1Q1PA 4B7IA 5JA8B 2NLJB 3MOQA 3KWUA 3S37L 1BZKA 2FTKA 1FFTB 2FEEL 4KROB 3DC0A 3WNOA 4ZOEA 3K5MA 3KPLA 1LDPL 4W70A 3TYGH 4F4LA 1F4WL 3KLHD 3K2UH 2ODHA 1NR7A 3E7JA 4NJAL 3B9KC 5ALCH 5KEZA 1J12A 1K4CB 1UACH 3TK1A 3CPLB 4OF5A 4ZYKB 2VLJE 5CIPH 1EFQA 4M5SA 1DJIA 1ZANH 3PP3K 4ZFZB 4QJ5B 4I9WA 1G6VK 4AUYA 4Z78B 5JPMB 1TA8A 1BFTA 4W9IC 5JDSB 1U8JB 4PJEA 4XVUC 5GISH 4ZW6A 4LB8A 2VS0A 3CGTA 4PY8J 3UIZA 1XWVA 3C5XA 3AB0C 3MRBA 2WVSA 3MLXL 3CHXA 3FTXA 4X4MA 4MS8D 5KYNA 4GKJB 1SJEA 1Z1WA 3LHAA 4I9XA 5E2VH 1NMCC 3VU1A 3ZGIA 4B95C 5KSAB 3OL2A 3IDXH 3N50A 1SF3A 1MAJA 5G55A 5F9JB 3BHBB 2CRYA 4MQXD 4G9FB 1NJ9B 3HC2A 5JTWA 4X6BB 2ZG2A 2BVTA 5IJ0B 4XZUA 5FLVA 3BP6B 5CA1B 1ZLDA 1K8DA 4GBXB 4FTVE 4FJ6A 1OY3B 5LQBH 1HYSC 2R69L 3KJ4B 3QZLA 4JRLA 3IJHA 4OD1H 3AQZA 4X98B 4P5TA 1NBYB 1CE1L 1WBYB 3P9WB 4L9LB 1QPKA 3BQUB 4P2AA 5E9DB 5B7FA 5KSVA 2YAPA 3FOLB 5EEUA 5J6HA 1OSYA 1IUZA 2R1XB 2LFRA 5L8LB 1IBYA 2OMXA 5BZDA 4Q9BA 4UB0H 1IKFL 4P4KB 1HR0B 1DZ0A 3II1A 4FFZH 2Q7YA 4PWJA 4HYOA 1IGJA 3ZO0A 5IMMA 3HAEH 3W82A 5EU6E 2K9UA 1Z32X 2HT2D 3S34H 1DQML 2JIXA 1KJ2L 1LILA 1T03H 2QQKL 3RFZA 2KERA 4HFUH 1WJZA 4NDMA 5AAMC 2G5BB 2AHIA 2CH7B 3VXSD 3W57A 2X2JA 5K9KB 1DUYB 4DV5O 5E1GA 1RK7A 2UVFA 4R90H 2AQ3A 1PSKH 4FQIH 4IMLB 4ICXA 2QV4A 4OZFG 3T8XA 2JJVA 3BY6A 1U8LA 4KPHH 2BOLA 5CGYD 2PMZA 1MCPH 3L3KB 1RLWA 1AHWB 2BSCA 2OTUB 1JTOA 4FDWA 1N70A 4FXKC 3BP5A 5B21A 1AGEA 4NLHA 4DRXA 1D6EA 4AL8H 5DK2B 1I3RB 3DX7B 5ES4B 3T0ED 3AS1A 4R0LB 4NZFA 4X65B 3RWFB 1I1FA 5EF1A 4DN4H 1J5CA 4HJIA 4PRDA 2G5UA 4XDKA 3LKOB 1HIMH 3TYGL 2EADA 4BUQA 3MGOB 3RI5K 3DRQA 2Y7NA 1AY1H 4AQYO 4OZHF 4XCNB 5E5UB 2DJVA 2AHYA 5IVNA 2WUCH 5GS0D 1DDHB 3MZGB 3OKMA 3NDZE 5CEZD 2JGDB 1EQWA 5GISL 3ARED 2Q8AL 5JHAA 2EE0A 4NQXB 1DVQA 4PRHA 1IGFH 3C3SA 3C6SB 4KUCD 2AQTA 5C07E 4X9IA 1PG7W 3OKDA 4HFWB 3SDXE 1N0JA 2LFSA 1TZOA 5EULV 1E5YA 5DEFA 4LF6O 1J9CT 2F1AA 2H8PB 5TDOA 4R97C 5FO8B 3GSRA 1B0GA 1INQA 4BSJA 2XWJA 3NIGF 3H0TA 3VI3B 3H7BA 1S76D 3TPUA 3WNNA 4XHJC 5IQ9A 2XX0A 3FN9A 4JNXA 3EJSA 3L3HA 4BBWA 2Q0AA 3V8CA 3SGJA 3CCSV 2AQRA 5EOQH 2ZKOA 4URKA 3S9DB 4NHUA 5K59F 2DM2A 4OF7A 1MRDL 2ATKB 1A6TA 1LYQA 2SODB 1TJGL 1S3JA 4A7TA 2AZUA 2H6OA 3BD4A 3LRSA 5EO9A 4DZBB 2A6JB 3RHWK 4HF5H 4ZSOE 1CT8A 3O8XA 1KTLA 3TO4C 1WAPA 3L4TA 4B5EA 2MIZA 3ZDZF 5AVVB 5EZIH 5IYBO 5C0CB 3QUKA 5HFLA 1QSED 1PFOA 5JVDB 3BFOA 5FYJU 4EI6A 4GXUM 4ESKA 1T1ZB 4PJHE 3P2BA 2QHRL 1O6VA 1E9OA 2YD9A 2MCMA 4OM0H 3L48A 3NESA 2WWOA 5F96L 4EEQA 2BVOB 4JG0H 1SM3H 2ARJB 2LTQC 5J1AB 3CX5F 5E1QA 3IMUA 3NFNB 4WNQB 1PPJH 5AWNH 4Z7OB 4HAKA 2KH2B 2PNDA 4JFDD 3VXRA 2UXXA 1G43A 4ZUVB 1HL8A 2XIIA 4MDIA 3N85H 1UUSA 2F54A 1VLXA 2CQVA 5HYJE 3APNA 5JCOC 4QO1B 3KLHC 4KXZH 2UWEF 2YMTA 3K9SA 1KXQE 3N55A 2C9QA 4HUMB 5IKCA 3K72A 4UCSA 3NPZB 5GSRB 4MMZB 1J0HA 1GO3F 2PF4E 2FBRA 4NP4L 4YVUA 3V6BR 1QMUA 2A0LD 3IXAB 4WHTA 1RHHB 5I73C 2D3OW 2R29A 2FGZA 2WOBA 4WI6A 4DN4L 1TQBB 5EV7A 1I0HA 1J86A 4FMKA 4P0DA 5DZOA 1KCRH 4X9FA 1RUKL 4MQ7A 2J8UF 4MS8C 1FFQA 1CUOA 2G3MA 2F53A 3P0GB 1MJ8H 2BMKA 1A4JA 1A4AA 1I5YA 5IR1B 3JSSA 4KK9C 1P1VA 4YIOA 4Z77B 1TJHH 1J88A 1KCVL 2WXRA 3VG0L 3ZHNA 4MCZA 1HCZA 2JIZG 1IEBA 1OT2A 4RMVA 4CDHA 3HR5A 4HAFA 1AQHA 2J12B 3WGUB 4YO0A 1A6WH 1VEOA 2V4DA 1V7MH 2WKLA 4X4ZA 5KVFE 3SJAC 2GIXA 1H6EA 4BWUA 2A6KA 1S7UB 3NZHH 3Q6FB 4RFEB 4LCCC 3QNYB 1NAMA 3E9TA 1NMAL 1IGML 2VJ0A 5CEYB 4Y5YB 1YEIH 4LSUH 3BAIA 5BOPA 3IS0X 1PS3A 5T1LA 3QTCA 2V3DA 1MWAH 2R23A 1CZ8H 1EH9A 2H32A 3LN5A 2P5WE 2WN2A 2XTAA 2BIOA 5CR8A 2WKOF 2DWEC 4WIQA 4XPGH 5IJKA 2AJSH 2E8ZA 3IMRA 3ZRWA 3SGDH 1N6UA 5DF0A 1N0XL 2W60B 3TYFA 4EIZC 2UXBB 4ZUSB 2WYZA 4KTDH 2HT2C 4PS3A 1UOKA 1MFBL 3FB6B 1AQ8A 1G7IA 1KB9J 2RA1A 2F61A 2X4PA 1MOEA 3O9WA 3UMTA 4IBWA 1KMGA 3MV9E 5I28A 4PTTB 2K6ZA 4YHZL 3KHQA 4P8QA 4Y5VB 3L72H 2KHAA 4WDIA 4WWKB 1U91B 4JUTA 1IE4A 1M71A 5EBMA 1FJGO 1ZHKA 4GW1A 5EIBD 5ERWA 5IJVA 5CGYC 2FECI 4QRRB 1XF2B 2RH0A 4ORGB 4NKQB 1NLDH 1T1XB 1T21B 2ORBL 4LNRB 3T1WA 2CKBB 1FGNL 3E8HA 1MIEL 4IU2A 4YSTA 3VD5A 5LBSL 1J95A 1H8OA 2QQNL 2GTSA 4OCRL 3H9HB 1E2WA 3GMRB 4XBFA 5I2IA 1AKJD 5CSGA 2H4EA 2MEJB 4LDLB 5D7KE 5KBPA 4G59C 5K9OA 2IDCA 2XTLA 1I8LC 3APFA 3V4VL 4APQC 5IEKA 1LEIA 3S4SG 3WDJA 3CXFA 5ELIA 1UB5A 4KK8D 1U8IA 3CZUB 1U2HA 2P4AB 1E40A 1OARH 5GS0C 2Z6FA 4HD9A 4LF3A 5GRVL 1VIBA 1E2ZA 3HG1A 3OAUL 5DJYA 3UACA 4N24A 1J18A 4GAJH 3AREC 5BOZG 1X5HA 4X4XB 4WFGA 2EIZB 4D0DA 2Y7SA 3HOGA 1BXAA 4GW5A 2WBXA 2QE7G 1EVUA 1U4EA 3FQNB 2YBRA 3IK2A 4HBNA 3KGRA 4NC2B 1IJNA 2FYYB 2WSPA 4BFEA 5ESAB 2P7TA 4XX5A 2VKWA 1QBLH 4X9BA 4JPRA 5FFLA 3KM2A 5I1IH 4LF6B 4FXLA 4WHDA 3CUPA 3PV6B 5AOLA 3QAQA 5GRUH 3E83A 3JATA 3C8KA 2OMYB 5GS1B 5DT1L 5FV1L 5D7IE 4C4BA 2NZIA 1M1XB 4F80A 3L81A 4OZGB 3FHAA 3G6DH 2GJJA 4X2UA 1ZIAA 3EYOB 2BOBC 1J05B 2XTJD 3OW2U 4OD2B 4KMLB 3WFDH 4ECNA 3RL2A 3HAEB 1QUNB 4GI8A 4Y16B 3MLRH 4N0UE 1DVFC 3RWCB 1T22A 2HVKA 2NZ9D 3BESR 4XPGL 5KS9B 1BS3A 4ZO7A 5L2JA 1KLFA 3FB7B 1B3JA 4EUPH 5D7JB 4XMPL 1UB6A 3SPIA 3AGWA 3V95A 5BS0A 5IT2L 4M6NH 3TV8A 2ZJSL 3UXFA 2FLMA 3AITA 4ALAH 1AR4A 5SX5K 3HA0A 5AYUL 2XX1A 4NB7A 4WZ9A 1P4IH 1ZEAL 3OC8A 3OAZH 4X9HA 1OM9A 2D2CB 5LDUA 1AP2B 2DJMA 3DOSA 4LCVA 3RX8A 3CDYA 4OQTL 1IM9D 1WIPA 2Z1PA 2AEPH 5LOVA 2AJZA 4XO4A 5E4AA 4CAGA 2BFVL 5DZLA 3DSNB 2HJLB 1JFQL 3HKEB 2DMHA 2QTSA 4PEEA 4TL4A 4LLYA 2UX7A 3ZPDA 2JF1A 3G6JE 3QT2A 4I0KA 4UB8Z 3SE6A 1BQ5A 3KH3A 3PV7A 1O6SA 5AFAA 3C9NB 4FX5A 2FWUA 4A7GF 4F8PA 1IJ9A 4MMXB 2DQ3A 4QRSB 3FDWA 4AKOA 1EJFA 2F1BA 2G2PA 2EINB 3K5NA 1B04A 1D5BA 2A0LC 3NN8B 5DD6A 3UH8A 2HJDA 2IDTA 4N22A 1XIWC 3DMMA 4IEFB 3QXWA 4D9RE 3S35L 4R7XA 5T8IA 3PNWB 3VD7A 3WNLA 2GSGB 5FLUA 2HX7A 1ML0A 3MOBL 1SY6L 3MCKB 1K33A 4K9EL 2GABA 4UV4H 4L4TD 3CLEL 4XGZB 1I7FA 1JWMB 2RGSA 2OQJA 4MX7B 5A2IH 5FGBA 1K73W 1AXSB 2JKNA 3SPCA 3D51A 4DVBB 1XGRB 1EFXB 5JW3H 3BVNB 4GAJL 4XODA 3OZ9H 1GH6A 4R2GB 5IG7B 3ZMRA 5J4MA 2C9RA 4XNYL 1PG7X 1KCLA 4KQ3H 4C7UA 1BM3H 1Q1JH 2F7IA 5I1LA 3IKCB 2KG7B 1FN4A 1XEQA 1QBLL 4NKOA 3SBPA 4I0PC 5G4MA 5I76B 2OSYA 1L6PA 3A4EA 2R2HA 4RRPM 4ZO9A 5TISZ 5D2NE 1UWEH 4G70B 5EOCJ 4ZFQA 1ZXKA 2E5EA 3Q8FA 4IKIA 2CRIA 3U9UA 4Q74A 2ITDB 2XICA 4DQOH 4PP2A 3VXMD 1U33A 3EFOA 3PWNB 3QIUC 1SLVA 2VLLA 1WWAX 5C0FA 5DUPH 3M17A 3FQWB 2X6MA 1NH2B 4JI8B 2WXKA 2X4OA 2GHWB 2H0JA 2XQYK 3PGFL 3WFDL 4D9LH 3DLQR 4GRWE 4YJ3A 2NW2A 5HGDA 1R73A 4L0YA 1X5YA 3BW9A 4NWTL 4DGYH 4DKDC 2XT1B 1DSWA 4P2YA 4S1DD 4Z7UB 2ADFL 1IT9H 1CP9A 3H2QA 1JWSB 4OV5B 3QWOA 4PRAA 5GQBA 3JWNE 3IDJB 4OY9A 3QZPA 8PAZA 5FYJH 5IZ7A 3OBAA 4UTAA 5EBWC 1ZVSA 4EE2A 3WENA 4WU7A 5CLTA 3KDMA 1FFNA 1NC2A 2IH1C 1P53A 4FVMA 3ZUCA 1KDIA 4JX0A 2VQ4A 1M7XA 4D0CB 5CZVL 4OCSH 5KSAD 2D3VA 4W4OC 1ZLSH 4EVNB 2PTTB 3ZMUA 3ZIYA 2JKSA 4CJ0A 1DVSA 4R9HA 4AUJA 3AG2B 2XPYA 3MLSH 1SDAB 2B4CC 4KBPA 4N8UA 4J10A 4GBXD 1PX3A 1FVEA 1I8UA 1XHHA 1EWHA 2LU7A 3MUHL 3PHOA 5EZJA 5L3EA 1Q4NX 4QOKA 15C8H 1GY2A 2NNXA 5E9DD 5E8NB 3AM8A 1RZGA 2X1WL 3W0WE 1F3JA 2YUZA 5F88B 2CUAA 3DUSA 1ZT4B 2Q9LA 1RERA 1ZWIB 2CBQA 3LEYH 4BZ2A 4HJTA 2VDQH 4P4KD 4E9RA 2YSSB 4S1SL 4TULH 5FPOA 4EDXB 2MOVA 2WANA 4G6ML 4Z3FA 2CSPA 5FKPA 2VC2B 1BIHA 5MERA 1VF5B 5FYLD 2YPKA 3PNRB 3OMAB 4Q89A 4G5ZL 4YHIA 4FLZA 1U42A 2EIJC 3CVIH 2XVLA 4HV8B 1URZA 2APVA 3GSUA 3HE6B 1I9IL 3ZE0B 2QLYA 4DP8X 4KQ3L 1AS7A 1PPIA 4S0TD 3FB5A 1RH8A 2PLTA 5K93A 4MXQD 2ZOUA 3GI9H 5I1CL 3QO0A 4NM4H 4AG4H 3MRNA 3TVMA 1OWWA 2XTJC 4ZNCD 4B9ZA 2AJUL 2EH8L 3MV7A 2WZAA 3BUBA 2OA9A 3GHPA 4OAWA 4XXWC 4ZI7A 1A6AB 1FJ1B 2Z3FA 4KMTH 4WCYL 2NZ9C 5ANME 3WDIA 4FYQA 4A2LA 4AXWB 2JB5L 5FO7B 3VXTA 4WJKB 1YEDA 5D5ME 1FLTX 2QLVB 3B1TA 1MNUH 4H0LC 5TFSL 2FJGA 4KTGA 3T4AC 3BPLC 5FUOH 1B2YA 4W4KA 1L7IH 2VDRL 5LNEA 4EIUA 5CBAB 2I5YL 3EFFB 3U11A 3IJ9A 2MK3A 2ITEA 1NCUA 3CN4A 4N3TA 5ESVB 1T6VN 3B2UD 2H6PA 4J41A 3FRPB 2EECA 4BSWA 5KVEH 2RQ6A 1VENA 1FORL 1TQCC 2YQBA 1AR1B 5IGXH 5E1HB 1IX9A 3UO8B 4J4PD 5FYJL 3P4LA 5D70L 3EYSL 2LJ2A 5AZEH 5SV4A 1XX9C 2ZIDA 3SJBC 1RD6A 2Z3YA 2PCYA 3EYFB 4S0HA 4OCSL 5FDWA 4U2YA 1WAAA 4KX7A 1WZKA 1S77D 2NXYD 3O2VL 3T4DA 5C08B 4AQ1A 1E5CA 4J3TA 3MJ9L 3VWKB 4OFVA 1IBBA 4G6FD 4X1YA 1IAOA 1RZ8A 2G75A 3MLSL 2IV8A 3PIQB 2LV4A 3CFJB 5D7EA 3SO3B 1AGFB 2OULB 5KA6A 4AM0A 2YFNA 1G0YR 4R7LA 3D7PA 2H94A 3FN0L 3GJEA 3ILEA 2J57A 3GSNA 1I7RB 4UM8B 4MKMA 1QVGU 3LRKA 4NKGB 1ZK5A 2WXFA 1MNNA 4RZKA 1W2KT 1FCCA 3EKCA 3BISA 3SDDA 3TGUH 1AXTH 2NNCA 5ABZA 2V0AA 1Z5LB 4B9FA 1ZPLA 3ZE1E 5B1KA 4OZ4A 2CMRL 3QH3B 1J0IA 1AZVA 3VFWB 4HJJH 1Z9MA 5L3GA 5HHOB 1ZS8A 1NGXB 1AG0A 1VCBC 4WSKA 5IMOB 4BGLA 2HUEA 2Y22A 3V52H 5D6CB 5FXCH 5C0DA 1R3JC 5I19H 2Z93B 3KYNA 1ZSDB 3KPMB 4QRUA 2M7WA 4FYTA 3IMWA 3UZEA 1VEMA 5C0CD 1KT2B 4AMKL 2VXUL 5EC1B 4F37K 4NNXB 3TJEH 1NTDA 3QUYA 4L0PB 2VDKH 3VI4A 5BO0D 4R84A 3SIKA 4IRSB 5ESQB 3L6FA 3LVTA 1JNJA 1ZHNA 3RZCB 3D85B 3ZMEA 2R29H 5E56A 5IBTL 1C9SA 2NLJC 3QJZA 4UT6L 4KROC 2VMJA 2V9RA 3QJHA 3BZEA 1NGZB 1UOWA 3Q3GB 3H1IH 1NCBL 2EH7H 3AGVA 4D2NA 5B38A 1Q9OA 1OO2A 3CPWU 5D4QA 2WZPA 3B3BA 1K4CC 2XU9A 2DQTH 3UTSE 4QTHB 2HR3A 3UZVB 1IZ3A 4P23A 2DIEA 1T5EA 2HFEB 3C5ZB 3QS2A 4QGYA 2BIHA 1QKZL 1G5AA 3GMQB 2IU3A 2VZSA 4XN4A 5BRQA 4DPAX 5JPMC 1GTOA 2PKDA 1DBAL 4JG1H 1Q90D 4PUBH 3GINA 1AD0A 2WD0A 1OAXL 1DVUA 4LFBO 1MHPH 2XDHA 1BGXL 1NAMH 4KKRA 5KSAC 4DEPB 3ROLB 2Q7HA 4DR2O 4CVUA 1NA8A 1F11B 2VWEC 3SKMB 1WD9A 1D6VL 5F21B 3KVDD 2H32H 4WI2A 3ULAB 3VVWA 1R5WB 3L5WB 1KN4H 4GBXC 3TA3B 5IESH 5KVGE 4IKJA 1D5MA 3KJ4C 3AS2A 3MTXA 4P5KA 1E43A 3ECVA 3V4PA 5BY1A 1FFOA 2VUYA 5J6GB 4L9LC 5FA3B 4DR3B 3BQUC 5EWIL 5AAPA 5JIHA 3SJVE 3MDJA 4JYCA 4HIPA 1BZ9B 5TE7H 5HHQB 3WXWL 2F15A 1MCRA 3I75B 4X80H 2VERA 4P4KC 3UTPE 1LO0L 4HKZA 2F1EA 2XZZA 3DJZA 5FWRA 3REVB 1GM8A 1EHKB 5EIVA 1J8RA 3N40P 3KCPA 3PL6D 2FX8L 2W65A 3RA7L 2VDOL 4LCYB 4UT7L 1MJUH 3KCYA 2HKFL 4YNYB 5JXAL 3KL5A 3NYKA 3A67H 1FYTD 3TFBA 2B5IB 2ZPKL 3BWUF 4K5MA 3CMAV 2P9RA 4CW1B 4PB0L 1TMCB 1YNKH 3LKSA 4MT8A 4R6UA 5MP6H 1WRFA 4HXBH 1DHKA 2X2YA 1AHWC 3F6IA 3PHQB 4PJEB 2NPLX 4QY8A 3ROOB 1F4NA 4BD4A 4R4ND 4XAKE 5EC2A 3VFOB 4BGDA 4M1DL 5L88H 4J80A 4ZNEE 1M2OA 4RISH 4B9JA 1ZTXE 4LF4O 4EEEA 1IIIA 5E2UH 3V0EA 3HI6L 3RWEB 3A6BL 5DJ2B 4AQ8C 2VLJA 5IIEB 3NJIA 1QNZL 4M03A 5AALA 1G84A 3V6OE 1KU9A 4G8GE 3AG7A 1TG8A 4XCFL 1HXYA 2DKSA 2N7AA 2WBWB 5D96B 4Q6YA 1HQ4A 3O4LA 1NFIA 1SMOA 4Q0XL 4IJTA 1TFHA 1GS8A 3S48A 1A7NH 1EJOL 5H6RA 2ZOLA 4R4BB 4J4PC 5B1BB 5HI5C 1IE5A 1BV8A 3P0YL 3N06B 5J9PA 1JXFA 2COVD 2OYLA 4LSVL 4RFOH 3SE9H 2GTWB 4AVIA 4U1MA 4HNAB 3QO1B 2BSTA 3TBYA 4W68A 5BMVA 3GKWL 4FTVA 4MA7L 4I5BB 2Q7YB 2ZX5A 1IURA 2QKIC 2IW5A 1E28A 3WJLA 1FI8C 1I82A 2H8PC 3H8NA 1UCTA 4B41A 4IRZL 4GXFA 4P46B 7FABL 2FHCA 5SX4H 3B77A 1UJTA 4JPWH 1DK1A 4RAUA 3NIFF 1UM6H 4MXWH 4JI4B 1JPSH 4NDMB 4X50A 1SHWA 2R0LL 2OJEA 1U4FA 1ENVA 1VQPV 2CIIA 2D7QA 4LNUA 5C70A 1ZV5A 4KJWC 4PQXA 1IC7H 1JTTA 3V5KA 2HRPL 1UKTA 3T8XB 2VQTA 2ATKC 5EU6A 3AADB 3C08H 2Z8WC 3LCYA 3P4NA 1IQDA 1X5KA 4FFYA 4DVRL 3RGBA 4HKXA 4KVPA 2FIKA 2W88A 3AQYA 4Q8BA 5DMKB 3CDGB 1X9UA 1TJIL 5BXFB 3ARGB 5B8CA 4J9ZB 2HVBA 1I1FB 1DR9A 1JV5A 2V5SA 4XVSL 2A9HA 3CCVV 4HUKB 3T4YB 4M48H 5I75B 4OZIF 2AHZA 2CTQA 2F5BL 1CO1A 4HIXL 4PRIA 1FAIH 2ADIA 3CLWA 4CC4C 4JCLA 3TOPA 2YC1A 4EAEA 5CA0A 2J1XA 5DD3H 5JR1H 3KCXA 1HWWA 4BSVA 4N2MA 4GKKO 4JAMB 3UBXG 2H41A 4JM2A 4X7SH 4CSZA 4Z76B 1ESOA 5DQJB 2C3GA 3S8WA 4UB6Z 1EDQA 1I31A 2EZ0D 3OKDB 4H1LG 3WDHA 3SGEI 4M7JH 2JWYA 3I84A 4QRPD 3UPAA 1KWGA 4KK6C 4ODVH 2J88L 1TQBC 1DQDH 2A83A 4GUCA 2C2AA 2QHLA 3U4BH 1PKXA 2FNWA 5A6IA 3I6KB 5DZVA 5L7XL 1WWCA 1I7UB 1L9RA 4LFBB 2ARWA 4XCCH 2YAQA 2D2OA 1IGCL 3N41F 1OOAA 1KYFA 5CU9A 4DR2B 5AKSA 1KTDA 3FFDA 3A2FA 1UUNA 5C07A 3WY2A 3DO7A 4F2ME 4RX4A 3SDXA 2L04A 1DBJL 4JRXE 2WTOA 3BI9X 1M53A 1Y18A 3L9RB 4NHUB 4R2GD 4WSGA 1VQMV 1N5AB 3WFCL 1LR1A 2F4VO 3LRSB 3D05A 3V0VB 4X20B 4X4YB 3MODL 1GW6A 2ZCLL 1T0NB 2Q8BL 4PIRF 2LU5A 4MS6A 2P1YA 4Y5YC 2Y1AA 2YBGA 5I82A 1M9SA 3T3PB 3MLWH 3OR7C 3PXJA 4MKTA 4FQ1H 3FCSA 5J5EA 4F20A 2XHNA 1E9OB 3ET9F 3B7RL 3LKPA 2K9PA 3ZHTA 5J2TA 3GT6A 3PP4L 4JANA 3WUWG 3L4YA 2XYBA 2GPZA 3DUUB 4N2IA 2FATH 2DEXX 1FAFA 4PD4J 5F0LB 4EFEA 1K6QL 5BRZE 2IOIA 4ZSOA 3J7AU 2WYIA 4HQQH 4I85A 1NH2D 3PL6C 5HVHB 3VXRB 4BFKA 4UTAH 4KQ0A 1QPXA 3FB6C 3P9MB 2GJ6E 5IB1B 1MELA 4JDEA 3SZKC 4PB9H 1ZA6A 2F54B 1N9PA 4PJHA 4LH6A 4QHUA 5LA6B 1OALA 5IKCB 1QEWB 4Y5VC 1S9KC 5DJAB 3ES6A 2BSKB 2BHZA 3NP4A 1KN2H 4WWKC 1COWG 1FG2A 3BPCB 2VNCA 5TQ2L 4NKDA 4XVJH 4WHTB 2ILLA 4PJ7E 4HLJA 1JV2A 1QLRB 5CILH 4IHOB 2V8MA 1BEYH 4XVOA 5HHMD 3E80A 3UTTD 2A6IB 4R4NC 4GMSL 3QDJE 5HYJA 5CJOL 1EUTA 2IVFC 3MPCA 4X5LA 2QL1A 2F53B 4LF4B 1KXQA 4V1DB 3NCJL 3RILA 5EZYB 4ONOA 3TIDA 5IDJA 4AVHA 2J4WL 4ZS7H 3W11D 4PAZA 4QHNB 2BTQA 2CXKA 4B7LA 1Q9LB 4B3MO 3OTTA 1AGDA 4O2EA 4BFIB 2AXHA 4NENA 4BZ2H 1SDYA 4ODWB 3G5YA 3FH5A 4TXVB 1BE3H 2CXGA 5M7QA 2LLGA 4XNQB 3S5LG 5B1JA 4GX5A 1DP0A 1M7UA 5JOEA 1OHZA 1F3DJ 4XR8C 4U1LB 2PYFB 3VXOA 1OCRB 3O6MH 2Y7MA 1PZDA 3ETGA 3CD6V 1C16B 1ZJAA 3R65A 1LQSR 3NH7L 4BR6A 4J42A 5T1LB 3IKKA 3V7AE 2R23B 2WYTA 4XMWA 3LN5B 1KXTB 1ED3B 1Z3GH 2QPFA 3MUGB 5HI3D 4CC0A 3UTZB 1KZYA 3ZRWB 4JFOB 3GHEL 3VAEA 3TYFB 4HBCL 2K4WA 4G6AD 4HLZG 1IVTA 2W94A 2MPAH 3KWXA 4B0MB 3E35A 1FFXA 4P59H 2GAZA 5GS1C 3FMGL 2O6EA 4TPRH 2HLFD 1PD1A 1QFUH 2HHHB 5DQ9B 1P84K 3MNVA 5E2JA 2P5WA 3O3DB 4KXDA 4X8CA 4AVKA 3OTFA 4TWKA 2ZM6O 4GW1B 4EDWH 3VX0A 5IJVB 2VT0A 4FKEA 1E9QA 4FQ1L 5EFIB 5C7ZA 3WEMA 3WTVA 4HDIA 1GS6X 4Q6IB 4CJ1A 1ADQL 2X2IA 4YSCA 3O11B 2CO3A 2XT9A 3SPJA 2FDBP 4JEGB 3VE0B 4YDLB 3FTVA 2NYZA 1PG7L 3L3IB 3GS4A 4XC1L 3FB7C 3Q2VA 3BUYB 2AC0A 5CLZA 2L8AA 3FFOA 3MV9A 2XQBH 4Y8AA 5TJWK 2O5XL 3KGUA 4ZD3H 2TSAA 2WP3T 3MRDA 1JCHA 5E00A 2BSEA 3V4LA 1TUEB 3ZIAG 5FB8B 4XC3L 1DSYA 3HBGA 4J3BA 2D2CC 3C87A 1VGEL 3K81A 5JXEA 3WY4A 1LEIB 3HTLX 1A4KB 5FV2A 4CU8A 2VR9A 5KSUB 2QSTA 4TKWA 3MNWA 3VDCA 1XEUA 2XOKG 1PNMA 3IFOA 5DJYB 4DP5X 5JLZA 5HDWA 4NQDD 3GSNH 2VLKA 1JZ7A 4GW5B 4Y19B 3BUIA 2YBRB 4MMXC 4YR6B 3A3YB 2LR4A 3VWJD 1M57B 2EINC 4J3OH 4TVPL 3ZHFA 4DPRA 5KW9L 1G9MH 4ODUA 5EZOH 2QVFB 3ULVH 5B7EA 2JLPA 3KS0H 3L3JB 3X1BA 4HGKC 4PJFE 5MI0B 1V55B 5ECJE 2DQGH 5GZOD 1S2EA 4JI0O 1TTFA 2Z92B 2V17L 3C8KB 5MEOA 2GUZA 1QP1A 3GZKA 2DM4A 1ZMYA 2YGQA 4N2EA 2E6PA 2AJXL 3O6ML 5AW1B 2EDYA 2OKMA 2R8SH 2RMKB 2GBAA 3DIFA 2MH4A 4CS2A 2I24N 4R2GC 3BT2L 2ROXA 1BHAA 3OHXC 4N20A 3RG1C 5I0YA 3ABUA 4C57C 2F4VB 5I8CB 5HHOD 1UD2A 1T22B 4NXNB 5D93B 4G7RB 2FO4A 2AXTZ 1IX2A 2WQUA 4DHLA 5D7IA 1KLFB 1OTSD 4HHWA 4M5TA 3EZ8A 3PWPD 2KDGA 4BFRA 3OHMB 1GGIL 1CQYA 2MPAL 3VD1A 1UKSA 4P59L 3G67A 4P2OB 1J0YA 3SDCA 3GF8A 5F7FA 5LXTA 3L4WA 5LXVA 2ITDC 3TBBA 4FQJH 2QSCH 4N0YL 5ISZB 2FZ3A 5C7XH 2A73B 4N0UA 1S3KH 2W92A 1U6AH 1QQCA 3RZCD 2ZSWA 3RIAK 2F58L 2A1WL 5LOVB 2AJZB 1U8CA 3H6JA 5F7DB 3P11H 1QO3A 2AV1B 1N8OE 3IPBA 3NR7A 3QDMD 1G7HB 5F7BA 4U3FH 3CU1A 4CVWA 2QM4A 3JD4A 5E6IB 4IBQA 1WAZA 3F5WA 1X5IA 1HOCB 3DPBA 4KNSA 3DTXB 1ETZB 4F7TB 2CDFB 2Q8VA 1E4KC 1JTPA 1LO3L 3P4MB 3VRIA 1VHPA 1DJZA 2H3NA 2IAMD 2JJSC 3MI6A 4P2RB 1RZJH 1BD2D 1UFGA 4PR5A 4WY7L 4Z7VE 3ZHSA 1X4YA 4IOSA 5DMIH 4MDJA 3TN0A 3L9BA 2ZP0T 1SEBA 3DC6A 1F00I 3MAQA 3G6JA 3JZYA 4U1GB 1JGIA 1Q9KB 3RTQA 4Q9QH 3V4PH 1E3FA 2VOTA 1MCEA 2CHXA 3GM0A 3PPEA 4EO5A 4GOSA 3DBXA 1H3VA 5C6PB 3W11C 4XP1H 3STZA 5IMLB 4PJ9A 3AG2C 1T7YA 4X8XA 4A6YL 5FDYA 5IBUG 4OSUH 2OMNA 4UDUB 1G4RA 1TTUA 5TF1L 2J1KA 5CSBA 3H9VA 1EAJA 2CALA 2AXJA 4WFHD 4YY3O 5G5DA 1QBML 4DW0A 1CF1A 2QPSA 1DBMH 1NPNA 3HJ0A 4UV8A 1G9ML 5C0AB 5DD5L 4KK5D 5E8OA 5L2KB 1S9XB 4PJXB 5C8JA 2W59A 4EXPX 1MCKA 1RULL 4WK2B 4TQFA 2BWIA 5EB9A 3FU6A 3ZE2B 4A67A 1Q43A 1UXSB 3G5ZA 1MCWM 5SWSD 1JVKA 1ZWIC 3RYHB 4ERSL 5CCJA 1AAJA 1ACXA 1JHLL 4ZFOA 1UD3A 1FZMA 2UUDK 3ECQA 3W1ZA 2DIAA 3DOIA 2VLLB 4KKCC 3M1BB 1GY1A 1T89C 3JWOL 4NQED 3WSQL 2MHAB 4WFEA 4LKCA 4G6AC 3QRFM 1L9NA 2JJWA 2R8SL 1QRNB 2X4OB 1JF1A 2UZIH 4NO0A 5IB3B 2YPLD 4X1IB 1YMMB 3NA9L 5D2NA 3SPVA 2NW2B 1F4XH 2HLFC 4OKDA 3RVVD 4FLSA 5C9KA 4R8WH 4A2GA 4LLDB 5L8JB 2UXDB 4Z3HA 1E7UA 3F7VC 2FO8A 5AVUB 4AV0A 5I1KL 4J28A 1RIHL 3KL0A 4L2YA 4M8QB 1M1SA 1ZGLA 3UYRL 3FQ2A 2WJ5A 1ZVSB 2A3QA 4WU7B 4DP0X 5IWAO 2H1PH 2NCMA 2YJLA 1QFWH 2KQXA 1OIOA 3QI9B 3KLAA 1M1KW 4QIRA 5H2BB 2VZUA 3BWAA 1HI6A 2DLTA 1OAUH 1A14H 2G3ZA 3JWDC 5HHXL 1CD0A 3JD2A 2IJHA 1MJ7L 1XDTT 3NTCH 1G4YB 3MRHB 4K7PH 1O0VA 4TOYL 5DD1H 5E4EC 1UXWB 4U0QB 5T3XD 4H20H 3GEFA 5HPMA 4RGND 3VMPA 1UZ6F 3VFUA 2EE2A 4L5FE 3ULUC 1J1PH 1PVHA 3VFTA 3LS4H 1AR1C 3WHXA 4CU6A 1QSFE 4PGJA 3CC4V 1JGEA 2K4AA 5BO1H 2ZNXA 2BE3A 3NJKA 1YMHA 1GJWA 5BVPH 1N3NA 2VABB 1Z3RA 4IIZA 2DQCL 1PZ5A 4MJIE 3DUSB 1AO7D 3OX8A 2YPVL 4RMBA 5KSBE 2I7OA 3O6LH 1GHFH 3EH2A 3V4PL 2J72A 4H2CA 1OQOA 4LSTL 2CGOA 3V2AR 3UAJD 3VWJC 5HBBA 5IWLA 2JJTC 1MHHA 1UKQA 1GSMA 4LQ1A 1NKOA 3IFLH 1OCOC 3C60B 5CEXA 2K0RA 4NBZB 4M3HA 4JZOB 4P46D 1KPVA 3OE7G 4FFYH 2YUWA 3SO3C 4XH2B 3GSQA 5GZOC 4JI0B 3GWKC 1YEFH 3EADA 3W0WA 2X7LA 4LESA 4U4IA 5DVLA 3DVGA 4WEEA 3VXPB 4CH6A 3GBEA 4N8PA 1GJIA 4JFYA 3QO0B 4G9DA 3CZFA 4PJIB 3MRNB 3LZFH 3QZMA 3ABMB 3MXVL 4IOIB 4EMZA 1GKEA 3F65A 2FT8A 4PJBE 2OR9H 2VJ8A 3MV7B 1PNLA 2QT6A 4U3HA 5AKTA 5GGSB 5HI4D 3ZK0A 1M05A 1UM4H 2BCKA 3L4XA 3SBWC 4BEIA 2A2QT 1M5IA 2VN5A 1OANA 1OTSC 2I85A 1R34A 5AOMA 3VXTB 1D5ZB 1RMFL 1YEDB 3VXSE 1A8ZA 3ARGD 1CR9L 4ZPVB 3UC0L 4DO6A 3GHBH 4OLEA 2PWFA 2F08A 5EC1C 3KYKL 1TTBA 4BKTC 3UG5A 3IDNA 4JZ2A 1NAKL 1A47A 4U6YA 3ML9A 4MA1B 4OT1H 2WB1A 4NT6B 1Z2KA 3R06A 3RZCC 5DA0B 5IW1B 1F0LA 5ANMA 3L1EA 1INDL 1R3HB 4LVEA 4GS7C 1RJCA 5EBGA 4OLZL 4AIZB 4YXLL 1UURA 4CSSA 5D5MA 5AVSB 4I87A 1NGWB 4J11A 2C4FU 4M9PA 1WTGT 3ARSA 1JZ3A 3PWLB 1UWXK 4JKMA 1ETA1 1QFWL 1XCQA 4QCIB 1Q72L 2E27L 4U1SB 1WJ3A 5TQ0L 5DTFA 1K2DA 3D8CA 2P8PA 4LDEB 2H9GB 1GMIA 1N4XH 2YD5A 4FXGB 4PJAF 4U6TA 1BG1A 2HFEC 2WJ7A 3C5ZC 2IBBA 3D36A 4G1MB 4G8IB 3JARA 1YITV 4RGMB 2EXWD 5DD1L 1RZ8B 5EHFA 1KBGH 3IETB 5F1IA 4QTIL 2ZNJA 3NXSA 2EYRB 2ZWKA 1P4LA 1AG6A 3WL9A 3M7OA 4JO2H 4PJGE 4JAUA 4I4TB 1NBVH 2R2CA 3MRLA 3PGCB 4TV9B 4JPKH 5F6HI 1FHGA 4GRLB 3SDDB 1JDCA 4G7VH 4RMSA 4JQIH 1AZRA 1XQ4A 1GYAA 1JCVA 1LLAA 2DMCA 2EDMA 3TA3C 1GN4A 4AJYV 3D0VB 2IBZY 2HLAA 1XL4A 5HYSG 3CJJA 4KK5C 2JGUA 1GPOL 1VFBB 5C0DB 4Y4HD 2D3NA 5E0QA 1L9OA 1KGJA 2XAHA 2K1EA 4FFYL 3J81N 4LPCA 4S0SD 1AR2A 3HZKA 3ZX1A 1IRAY 5C0EB 5IP4A 4PJ8B 4XPHH 3Q6GH 3FU8A 4QYOB 2VXQA 4XPFH 5AAWA 4B53A 1PQZA 1VQ4V 1I1CA 1BQ0A 3DTUB 3QUZB 1BDYA 2X9XA 3IDIB 3CFKA 3P30L 1H8NA 1CE6B 1KFGA 1WA2X 4H8PA 3CHOA 3DVIA 1UWGL 3BPOB 4JQXC 3QIBD 4PCYA 5I0XA 1EHXA 5IHZA 1MKFA 2ZCKH 4F57L 4GG6B 1QBAA 2X44D 3QJHB 3X12A 1MUJA 3AXHA 1T1YA 4ZMZA 5BUPA 1QSEE 6FABL 3RVVC 3QUML 2B5IC 4BZYA 5B38B 4IW4C 4ABMA 1T5WA 1DBBH 2NX5D 2ESVD 4M7KH 1ZDSA 3ASWA 1MCCA 2F43G 2VITB 2XA8H 3D69A 3A4DA 1Z5WA 1FVCA 3GFUA 5F7EH 1OOWA 1FAKT 1E6OL 4AQOA 3TO2A 2YGNA 4JFDE 2Q4PA 5BZWA 2P4VA 3EUDA 1CFTA 3EOYG 4CN1A 1R3IL 2BHYA 1Z9NA 4NUMA 4QR7A 5E5RB 2VQFB 1C5CH 3PREA 2J8OA 1ZLVK 4JI7O 3PP3H 4I3RH 3LKRA 4JCMA 4XP5H 2MCPL 4KZEH 3NJHA 4K2UH 3IDGA 1QSZA 1Q9WA 4MD4A 3IE9A 4U33A 2IJIA 4P30A 4ELMB 4IKNA 3DO3A 2XXGA 3X3FL 5J6SA 5JW4N 1RIVL 3CMOL 3IS1X 4QD2E 1ZDQA 4TUYB 5D96C 4RGNC 4GKSA 1VZIA 3AK1A 4RAIA 1EZLA 5KVFH 1P9MA 3QYNA 4ODHH 1JPFA 3WD5L 4HUVA 3BN9D 1H3PL 1NANH 5AW0B 4O58H 4GAGL 4UOW1 1MWOA 2Y06L 1UYWH 3HCVA 1NTZH 4PRBA 3ZL4L 5B1BC 4Z7WF 5JJNB 1ADWA 2JSFA 5C9JA 1NGQH 2DB8A 2ICES 1H2MA 3M86A 5LGHH 3IEAA 5EIIB 5CCKL 4HG4J 3KXFD 1G9NH 4K8RL 1HXMA 3NAAL 2HWZL 1XGTB 3U6RA 3RVYA 3O45A 4M61B 3UAJC 1KCUL 3UYPA 1NCNA 4HKZB 4U1HB 5A16B 4G83A 2UZXA 5CM1A 2Q5ZA 1MF2H 3O6FB 4M5YH 5C0GA 1M6OB 2VDPH 2IAND 2Z0AA 4FQLH 3V4UL 3AU1A 3KCPB 4P46C 2K9FB 2BVPA 1C5DA 2W65B 3CZSA 4NN6B 2R4SH 4QT5B 4YHKL 3SJVA 5BV7H 1NEZA 4PY8I 2DWDA 4NZRH 2HRHA 2V2TB 1MFVA 4LOUC 1Q7YW 4D7TA 1YQVH 3FO0H 2RNBA 3DGEA 3LDDA 3BT0A 4RAVB 7PAZA 5D2LE 2JI3A 3HC4H 1WT5C 3Q6GL 5JORA 3IF1A 2EYSA 4X62O 5HI4C 2E9BA 3LX9A 4XPFL 2QADD 3D4ZA 3ZN1A 5LP6B 1RSOB 5CFHA 2EUVA 4FTDA 1A25A 2JKIS 3ARGC 1D2OA 4K94H 3MUZ1 3PLYA 1A2YA 1TVBB 5EF0A 3J80N 3M7MX 4NBYB 3T77B 1FO0L 1R19A 1I7TB 3ZKXB 1HP8A 1UFUA 3RX7A 4TRPH 4ZK8A 5DGRA 4JDTH 5I75C 3S2CA 1SNRA 5HDRA 3O4LB 2NNRA 1S9YA 4LAQH 1NCHA 1REIA 3U0PB 2VE6A 4ZNEA 2ZOLB 3OJDA 4EZLA 3B2MA 5FUOL 1NCGA 3VMNA 2ZDIC 3BEWB 2E75B 3VFGL 3V6OA 2ZWLT 4NEHB 1IILE 1A9EA 1T3FA 2YK1L 4G8GA 4I3RL 4PRPD 4Y19D 4HAGA 5K9QI 2FRGP 2E5LB 5BMVB 1UH2A 4FRWA 3JTSA 3HLKA 4O9HH 4OIAA 4E0RA 4H88H 4LDOB 3LSSA 1XXDC 4LGSB 1FIGH 4LCWB 4HCFA 2FSDA 1IM3D 1L8DA 5FHAH 1CL7L 1K5NA 4LEXL 3TH4T 3BUDA 4ZFFA 1IBKB 2YS4A 1VQLV 3IWUA 3MREA 4P48A 2D0FA 1YYCA 4TSAH 3MHZA 2OJEB 4D7BA 2R56H 4Y4FA 1V8HA 3QEGL 1SC5B 2PCFA 2A38A 1JGUH 1AOHA 4DR7O 5IFAH 2E7HA 3M1OA 1IO4C 4HSAC 2CA3A 4GG8A 4PWEA 4JI2O 2H2SD 2WXPA 3QXDA 3EFDL 4BIUA 1QW8A 3V0WH 4B3TO 4UYPA 2DKMA 5AL8A 2OIGA 1EHLL 4P04A 3QAZB 3VSVA 2K7PA 1D5XA 5JDJA 2VXTH 3K0DA 2DLIA 4JQVC 3CZGA 3PFQA 1F4HA 1JRHI 4GT1A 1F1AA 3CQQA 4ENED 4MD0B 2AQ1A 2XTJE 1VF6A 2RJMA 4NQVA 3U7YH 4YL9A 4TSBH 4M6OL 1XGQA 2JK5A 5EO1B 3GMPB 4PRIB 3B43A 2WA3A 2FWSA 1QCEA 2UY6B 3FQYA 3FO0L 1YYMH 4GQ9H 5GGTA 5HVHC 3KPOA 4JKWA 4N0FA 2HRGA 4NPYA 5CA0B 4BCZA 3WKQA 3HBPA 4BUHA 5D71H 5E6UB 1BQHG 3GVMA 4OLXH 3ZZSA 4PA4A 3WN5A 4ANVA 2BZ7A 1JVLA 5A43C 3PQYB 2MSPA 6PCYA 1FZOB 3UPRB 1UEMA 2MNWA 4M6ML 5DK0A 1EXUA 1JGVH 3GTVA 4F92B 5I0WA 4KAQH 4OCMC 3IDUA 4LLUA 5KYYB 4EN2A 4EIBA 1U8HA 3B7YA 4JDTL 5A2BA 1QHOA 4Y9FA 2D0HA 3RGVB 3ZDWA 5LYJB 2Z0BA 1AHKA 1HWGB 3SCMD 1A5FL 1HEZA 2OJZH 5DJZB 3MA9L 4QHPA 1RZKH 1G7LA 2A74A 3I6SA 3Q5YA 1CBVL 4E41D 4W9DC 5EBLA 3DXAD 4D8PA 1BF8A 1FS0G 4NQCA 1QHTA 3CHPA 4UILL 4AGPA 1G87A 1YECH 3CBJB 2OMUA 3QZOA 4P9HL 4ABQA 3MRCA 2DTMH 1TTRA 2G3XA 1CFVH 4YLQT 3UAEA 2XY1A 5JQGA 1OCRC 1PAZA 1OB0A 1XF4A 5L2KD 1QLFA 2BSBA 2JEUA 1FIGL 3PDGA 4L4TE 4FN0A 2VR8A 2IMNA 2EEDA 5TH2B 4F2MA 3R18A 1ZVYA 3BIKA 5T5FH 3MOAL 4POZD 5EIIG 3N44F 4X66O 3T08A 3T2PA 2R56L 4UIKH 1LJMA 2BNRB 3DGGA 1L0QA 4JVUA 2B1AL 2BS9A 1BXUA 2JCCE 1QYGL 2MNJB 5CSZA 3X13A 5D8JH 5EUKA 4MNHB 2WMPA 1QRND 4WFBV 4I2XE 2FQGA 5LAXB 4GRWH 3GIZH 4JDEB 3V0WL 4MVZA 3Q01A 2BERA 4TUKH 1U8KB 1RP9A 2JXMA 5A2JH 1UH3A 4QHUB 4I13B 4P05A 3PDOB 4S1RL 1WUNT 3ES6B 3QDGE 3QEUB 3LDCA 1KELH 3K5SA 4FLTA 3HB3B 5KHIA 2GT9A 3BSHA 4UQCA 3SE3A 1WN7A 3JWNH 5BRZA 4F33A 3ARYA 4RLDA 4Q6IC 3TEZA 3TNNA 2UUBO 3FT2A 1JV2B 3AXLB 1FPTL 3H01A 2GJ6A 4RETB 4TSBL 1BMGA 4YDLC 3SDYH 4Z3JA 3EGXB 4R96A 1BZDA 5ICYA 3V55A 2QVKA 5JIPA 3TFKC 25C8H 1HH9A 2A06H 1FV1A 4KVCL 5KAIZ 3ETBJ 1DZBA 4N2NA 1WWWX 2F2HA 4L8BB 3TIDB 1WZ1H 4ODXB 5BZZA 1SJXA 3QJVB 4XMLH 3UO3A 4BDVA 5CMAA 2DYSB 2DQJH 4HS8H 3ARFD 4FQXB 3D2UA 4PJ7A 4HK0B 3SYQA 5AG8A 1YC7A 3HE7A 1QWUA 2DYPB 1MXGA 3BDBA 4XPAL 1KCWA 3ZS8C 5GONB 2EXTA 4N2GA 4HZAA 4NS0A 3QDJA 3CFDB 3VXOB 1MW1A 3K8MA 1KEGL 3MCG1 4LOVA 3NIDF 4MVQA 3OR6B 4LPTA 4LVNB 4E9YA 4APXB 1WGOA 4N3UA 2VWEE 3LXBA 1LO4H 4G9FE 1HCVA 1JHTA 1K7DA 4DO2A 2Y25A 5BJTB 2Y07H 3Q44A 1OF2A 1M57C 2NUTA 1IEAB 2PCXA 3T6XA 1P7QB 5H37A 1MNGA 3C60D 4CVZB 3OKLB 4J23A 4NZJA 1MI5B 1HSAB 3IT8D 3L16A 4QF1A 4PBXA 1KJVB 4FQQA 2FKXA 1V55C 3RB5A 5I1GH 5E9DE 4G6JL 1L5GB 1FFXB 1I1AA 5INDA 4ZFOL 5DRWA 4HWEL 1M7IA 2J3SA 3QJFA 3WTUA 2Q3AA 4OUOA 3WFBH 1EZVX 3V4VB 1LP9E 2PCPA 4KKBD 2P5WB 3VCLA 5IB5A 3RJQB 2CE4A 2FLRT 4PJCF 4F27A 4UUJB 3T6QC 3TETA 1UVQB 4IM8A 3AG4B 2H2SC 4X0NA 2VR7A 5FYLE 5T5FL 2ZXBA 3DO4A 4HIQA 4PIBA 5D93C 4NNPH 5F7NC 1F6LL 2HTLC 1PM9A 1E4XI 3M6DA 4Z7QF 5HSFA 3NEXA 1E5UI 4PG2C 5IBLD 1LK2A 5IF0B 1FZKA 5F1NA 3U10A 2FYVA 2CK3G 4JASA 1JD7A 1PZSA 2K1MA 5I6LA 3ZDYF 4ENEC 1YRKA 2H0EA 4LVOB 5E00B 4P2OC 5AVZB 1ACZA 1JF5A 3GWOA 2D8KA 4KHPO 5DJDA 4LFHG 1UA6H 3L08A 1NGPH 4AJ0A 4O4JA 3QG7H 2EEAA 5SX5H 5F9AC 1PNCA 3WAKA 2CTRA 1EANA 1XD1A 1EERB 1F58H 2EDRA 1KGCD 2UXVA 2WQRA 3EW3B 3TT3H 3IFOB 3B9KA 2BPBA 4JN1H 4DR6O 3VXNB 5JLZB 1DQVA 2VMCA 1CD1A 3ISYA 4NJ9L 5E6IC 1PZCA 1V7NL 1S7VB 2VLKB 4UI2A 3RIFF 3QXAB 4KGJA 4HX1B 2EDNA 2OSLA 4YZWA 4C56B 3QCVL 4PW3A 5GIRA 3UO2A 5HJBA 4XMLL 1BP3B 3EOTH 3L7EA 1JL8A 3GSVA 1IFHL 2GUOA 2WCGA 4Z3IA 5KZCD 2APSA 2Z91A 4U1GC 3VQMA 1AQKH 5LN8A 1N67A 5AUMA 4DR5O 3SCMC 2ADPA 2GUZB 4KO9A 1XNRO 3VM5A 4ZTOL 1DSFH 3I9GL 2MQCA 1H2NA 3BAEH 3GMLA 4X1KB 5IFHL 1I8IB 3QHZL 4HEME 2Q6WB 4A7QA 2AKRA 3GC3A 1EO8L 4GMTH 5AVYB 3OGIB 2WM0A 3SQBA 4PS4L 2BY0A 2VXQH 1ASOA 1MJJA 3BZFB 2R0KH 1TNMA 1S78D 4PJFA 3VQ2C 3MBEB 3NSDA 2QEXV 2Y07L 4HIEB 4I77L 5HD8C 4M1CC 3O3AA 2DD8H 2Z31B 3VI3E 1OZ0A 5EDSA 4X6DF 3QWRA 5ACZA 1NZRA 3HPLB 4O2FA 3CE2A 1SN2A 4X5XB 5D4JA 1LVEA 1TZAA 3KPRD 1XGYH 2EXYD 3HI1A 1KBWA 3W5MA 3CN2A 1USQA 4EZMA 4POZC 4U0RC 3FSAA 1E1RG 4AM0Q 3WFBL 2FZ3B 3DRTA 1B6DA 1QUPA 3QUZD 1YAZA 4MDRA 3TCUA 5EU4B 3VH8G 1XT5A 4JY4A 5HGAA 3TASA 3QO7A 4JPIA 3ZQXA 5E23A 5A40E 3OKKA 5DRXB 5AAMA 1I3UA 1OGTA 3OV6A 5I24A 4J9YB 4JE4B 4Y88A 5C0CE 4FYRA 4MZRA 2BJMH 4YN3A 4NNPL 3CBKB 2CJUL 2OK0L 3DXRA 1S7XB 4PLOB 4M4RB 3F5WB 4RWUA 1TVDA 3DPBB 5C6TH 3HS9A 1WCBA 4IBZA 3RYMA 2Q3XA 2ZOKA 3VRIB 3SKUD 4CC1A 4FXKA 2Y6SC 3P3PA 1FGVH 5HDBF 1X4ZA 4Z7OE 4ZMXA 4JL1A 3GPSA 2M2DA 5C0JA 4PR5B 3TN0B 3RDTB 4JFPA 1NGPL 4LPYA 3ZRFC 3K71A 3ECBA 1WBZB 1B0WA 3EDDA 2C26A 1KLGA 3JQOB 3QI9C 3RTLA 1FVDA 3PUCA 2XWTA 4U1KA 3S36X 3RWJA 5DYFA 2XXFA 4C8XA 3K57A 3DBXB 4NCC2 3ZYIA 5EORL 2WLKA 5L3FA 2BRQA 4GKOA 3TV3H 1AB3A 2J7LA 4ONFH 1J5OL 1XNQO 3UYOD 4TUJA 3QORD 5KVGH 2DLFH 4Z7VA 1GH7A 2HJKB 3GK8L 1XB6A 2FBJH 4M8VA 4YIQB 4BFFA 1RZ7L 3HEIB 3MUY1 3SKJL 5KYUB 1J8HB 1HILA 1FH5H 2B08A 1JMZA 2VDNH 5C8JB 1AI1H 1JZFA 3K80A 1L9PA 3B8NA 4PGEA 2NW3A 3ZYOA 3QZWG 4OFYA 1I9JL 3VQXA 3ETDA 4GXVH 3LNMB 4MTGA 1QX1A 4NO3A 1NFDE 4FM2A 4K3DH 3HRPA 4LSQL 2K8QA 3MBXH 3O6FD 4OGYL 3C60C 3MXWL 3UROR 3H1KH 3WB1A 2L7UA 4Z0BH 1R9FA 4NO0B 1C1EH 3G5XB 3TL5A 2CO6A 2HT4D 43C9A 1TOXA 4BINA 4QXUL 4R7DB 2RACA 4WF9V 3BGFC 4ZJ9A 4DXWA 4KKBC 4FJCC 1NC4B 1CD9B 3WN6A 1NCDH 1I08A 4IBYA 5AW7B 1MFNA 3C5SA 4K23H 1WFIA 1FXKC 1CWVA 3I9PA 3FSVA 3TO4A 3VGEA 4YBHA 1ET8A 1CGXA 1ZHLA 2XWBB 4GRWB 5IBLC 5KX5A 1IAII 4UTBA 1I7ZA 3T1HO 1J9QA 4KHXL 1ZTXH 3AY4C 4D3CL 2CK0L 4ZMWA 3AFLA 2C3VB 5HJDA 1Z66A 1JJUA 2IJ0C 4YPJA 3JV0A 3QNFA 3IGLA 2C9AA 2BNQD 4KHPB 1S7WB 2VO5A 4QRRE 4MA1C 1F4YL 5FYKE 1DJWA 2ZXQA 4I55A 2A6DA 3EO1B 4XP6H 5SWZD 3UDWC 2HUHA 3LKNA 2J2ZA 4LIQL 4XN5A 3VFTB 3WHXB 32C2A 5JPNB 5JCOA 4MSWC 1LNQA 4AGMA 1JGEB 5IJBC 4O4LB 1P0SE 3NFPB 1DO6A 1FGVL 1GMGA 2X0LA 3EJTA 4ZDHB 2WBJB 2FWOA 2NSMA 1GYVA 2H2PD 5F89A 2V33A 2DIBA 1P7KA 3F05A 2VTFA 1S5IL 2X4QA 3W9DA 4GINA 1OAKH 4N1EA 3ATBA 5IM7B 2YIBD 3NCYP 4DV0O 4FXGC 1KYOK 3EAKA 3D3VB 4K5PA 3SD2A 3D39D 4YBQD 1KPVB 3U0TB 5D9SB 3GSQB 4JQIA 1KIQA 2VDRB 2XETA 4F8LA 1I1YA 4B50A 3DVGB 4MJIA 5KSBA 4ANUA 4J3UA 4GRLC 2DQ0A 2G38A