5KVEH

Zika specific antibody, zv-48, bound to zika envelope diii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QVQLQQPGAELLKPGASVKLSCKASGYSFSNYWMHWVKQRPGQGPEWIGMIHPNSGNTKYNEKFKNKATLTVDKSSSMVYMQLSSLTSEDSAVFYCARLGNDMDYWGQGTSVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Zika Virus-Specific Antibody Protection.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
molecule keywords ZIKA Envelope DIII
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2016-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kveH00
1J88A 5C6TH 2GI7A 2IPTL 4Y5XC 4LVEA 4F8QA 2DTML 4NJAH 2FBJL 1DLHA 4MLIA 3CGTA 1NBYB 1CGWA 3SGKA 5JMOC 2VQ1A 1L6ZA 3QQ9C 4NKIL 1D3CA 3VGBA 3WJJC 4Y2DA 2AGJH 2GK0A 3PWJA 4KGLA 3VA2C 5L0QB 1FV1A 4OJFL 2P45B 2HN7A 4K3EH 5EC2B 4RQQA 5HYQB 3EGSA 1AP2A 5E8OA 3STZB 1UWXK 1WFOA 5ACLA 3FQWB 4NQEE 4ZO7A 4IMLA 2B4CC 3VWKC 4M43L 4WFHE 5ECJE 1LE9A 3SPVB 3NZHH 3QFJD 2UZYB 5KVMC 5E2WL 4G80A 2FWOA 3FONB 4JZJB 5I1JL 3FT4A 5DD6B 4TOYH 4S2SA 3HB3C 4GMSH 4PJAF 3HZYB 2RIKA 2XWBA 1E4KC 4K8RH 2IBZY 1MJJB 1FVDB 5F7HA 2DL2A 3RP1A 2DJ4A 1AP2B 5E8OB 4C4KT 1L7IH 3FO1A 2X7LA 4RIRA 3PHOB 3D18A 2IG2H 2X4OA 3GO1H 2F19L 5E00B 3I9GH 2DQHH 2AK4B 5L8JB 1G6RA 3L3HB 3OGCA 4A2MA 2FRGP 4L8SA 3V5HA 3MRLA 4XNYL 3VXSB 3OB8A 1X5HA 5F96L 1IJ9A 1YY9D 3AM8A 5GGTH 1TZIB 1MEXH 2X1XR 4GXUM 4V2CB 3VDAA 5F3BB 4X7EC 2FATH 4ZO6A 2JIXB 2EDKA 4UU9A 3U7YH 1QACA 4LLUA 2WQRA 4Q6IC 2YR3A 2XFXA 5E9DD 3X12B 4H25B 5HVFB 2F5BH 1X44A 5D2LA 3NIDF 4L8DA 2C9AA 4EUPB 4ENEC 2EIZB 3BDXA 4GBXC 5B21A 4L29B 2W92A 25C8H 2FCBA 2A83B 4K2UH 1P84J 4HWBL 3O2DH 3WIIL 5C0GB 2NX5D 4LMQI 5B38G 2FIRT 4KY1H 2ICES 5B8CB 5E2VH 4P46D 4YDKL 3OAYH 4YIQB 3WS6C 5I1LA 4DN3H 5GS0C 5HI4C 4XI5C 5IVXF 4JZNA 1BOGA 2DWDB 3QIUC 2EDOA 4ZFZA 5IM7A 1NBVH 2YZ1A 5CZVH 4YBQD 2H9GB 3DV6A 3X11B 4DGVH 3X12A 3IKCA 1GGCH 2OP4H 4JFDB 4PRAA 1RY7B 3FZUC 2WWMD 4MQ7B 1FL6B 4ZS7L 2AABL 2HT4D 5DXWA 1FPTL 3EHBC 2P7TA 3OHXA 5CKGA 2BJML 4KROB 2AQ2A 3M1BA 2QHLA 1D5BA 4L8SB 5IMKB 2VUOA 2ZSVB 5GRXG 4M00A 4A2LA 2N7BA 3W11C 4YWGH 3BVNA 1LO2L 1AHWC 4DTGL 5EULV 1QPXA 4PR5A 4MNGA 3VMOA 4JM2F 2PF6A 2V6HA 4LASH 5CWSB 1I3UA 4U1JA 1LO5A 2NY1D 4XPTH 1NCDH 2F9BT 3U2SA 5JIIA 1U95B 3DXAD 3JXAA 1ZV5A 3PV6A 1X6LA 3GSVA 3P4NA 2XYCA 3QIUD 1L7TH 2YRLA 4GSDH 3S88H 3HZKA 4AMKH 4JY5H 4PRHE 4LQFH 3L3GB 1IZKA 3HPLB 4PJ7B 4PRIB 4FQJH 1JK8A 3QDGD 5EPMA 3V79C 2DQUL 3OAZH 4YHYB 3IJYB 4LSRH 1LILA 1OAKL 5T3ZE 2C1OA 4DKEL 3S34L 1Q9LB 1QR1A 2Q8BL 5F6IB 3PQYE 3RHWF 1WWWX 2P48B 5KOVC 4F15C 3QCUL 2BHUA 4JB9L 3VXNB 5IHZA 5J1SC 4L9LC 4ZFOA 3U6RB 1CIDA 1XIWC 1NGQH 1CR9L 1MAML 2LAGB 1D9KA 1NGPH 4BKLA 3VXPB 5BVPL 3DHJA 3OSKA 2D7TH 4MQXC 1R5VA 2E5EA 4NRXA 3RVVC 5I6XC 3VFUA 2VKXA 3BI9X 1I7ZA 2OX5A 2DDQL 3IDXL 3JWOH 3W5NA 2NY1C 1K4CA 2QHRL 4HDIB 3RWEA 3Q5OA 4MD4B 4N0CC 3IAQA 5HY9A 1AQKH 3U9PH 5E7BA 4HJGA 5JXEC 3DI3B 3P9LA 1GAFL 1KB9J 3VXUD 2R1YB 3PGDA 3FO2A 2ZCHH 4QRSB 2OK0L 3HMWH 4PBXA 4ALAH 3MUHL 1XGQB 3VWKA 5CLWA 2UUDH 4OD2B 4V1DA 3ARYA 4HS8L 4W81A 1IMHC 1QO3A 5KANI 2YUZA 5IEKA 1AJ7L 4YGAB 4IDJH 3IRPX 1IQWL 4GAGL 2WV3A 2H2PD 3HNVL 5A3ID 4JM2C 2A6JB 4DEPB 4O02L 5B39A 5FYJU 1G1CA 4Y5XB 1FIEA 1I8LA 4NM8H 4XB7A 1AFVL 1DSFH 4YNYB 1G9NH 5T3XH 4IOSD 4OLZL 3K1DA 1KJ3H 4YR6A 2IPUG 2PTVA 1BOGB 3D25A 3HZMA 4JN1L 1H5BA 2BOCB 1OLZA 3M8OH 4JFHE 3O3DA 4EDXA 1HYRC 4HBQA 2XNAA 4M7KL 3U4EA 2OSLA 5GS1B 3AM8C 5IMLB 2EDTA 3J8F7 1PBYA 1S9VB 1OF2A 4K3DH 1CD1A 1Q0XH 2VLRB 4OQTH 5JW4N 2YS4A 1FNFA 2FB4L 2XXMB 3W9DB 1YUHA 1WBYB 4K7PH 4N5UA 3ZDYE 4PJHB 3HG1B 1CGYA 3TA3A 5AAWA 1Q8MA 3ZDZF 1B4JL 3UTSA 3ULVE 1AGFB 1FLRH 4GBXA 5I75C 2AEPH 4QGTA 5EIVA 2HVKB 3HE6D 4IBLT 1BJMA 3QO1B 1JUFB 4PJ8C 5MENA 4LCIH 2DIAA 1MFAH 4UIKH 3IYLW 5DMIL 5BJTA 2OP4L 3GJEB 4HEME 3L5IA 3U0PB 3MJ8B 3T4YB 3VXTB 1KN4L 3QUXD 4WI4A 4QY8A 2D03H 1MCDA 4ZUSA 3GMMB 1MREH 5BW7A 1F4YL 4KK9D 5J06A 1MI5A 1QYGH 2I27N 3WNOA 1M4KA 1MRCL 2YBRB 4AEHL 1IARB 4YLQT 4OCYH 3QUMB 4LGSB 4R4FH 2XWJA 3JV6B 2QR0B 5BZDB 2XQBL 4ZPVB 1IGIL 4P49A 4WNQB 5J57B 3BMVA 4ZFGL 1MHCB 3GBML 2APBA 5IHUH 1YEIL 1DQJA 3V7MA 2DWDA 2P5EE 4PUBH 2H41A 3QJFB 4M62L 3FO9A 1A3LH 2XXCB 1NC2A 4ZPTB 4LQFL 4JM4L 1J87A 3MLTB 4PJ8B 5F7KC 1N5AA 4L1DA 3U36A 2KH2B 3OBAA 5HDBE 4LPWA 2X1QA 4PD4K 1HK6A 1S8DA 1H8SA 2XTJE 4Z7QE 2D7MA 3GMLB 2X4TA 3WE6A 2CRMA 4G3YH 2X4RB 1I8KA 4LGPB 3DTXB 4DKEH 5IT2L 3JV4A 3G04B 3VI3F 3GKZA 1T2XA 2NY5H 2K9UA 3MZGB 2E7MA 2Z92A 3ARBB 3ARUA 2XWTB 1MSPA 3HC3L 1CU4L 2C7UB 1HH9A 1VPOL 1A7BA 3ULUF 3AY4C 5DA4A 1WIOA 4UI2A 3EYOA 1X5IA 2OZ4H 4IRZH 5I74B 3SCMA 4NC1C 2P44B 4PJ5B 1V7MH 3MRDA 1YC8A 2NTFB 5BQ7B 3O4OC 4U1IB 1OTUC 3DTXA 1IKNC 4YO0B 2A6JA 5IB4B 5DS8A 1F97A 2DD8L 3QIBD 5BVJA 3TO4D 3UTPE 3QI9A 3T4AB 4CBPA 4FQXA 4YPGA 1KB5B 5D9SA 1JYVA 4F8TA 3S36X 5CGMA 4CUCA 3C9NA 4EI6A 4RMUA 4KJQD 3ZT7A 1E4KA 4WJ5B 5GISL 4GG6F 4GAYB 1BX2A 2BY0A 3BEWA 1JBJA 4OD1H 4P4KB 3THMH 1A64A 4EQ3A 4NN7B 4G7VL 1KTLA 3FQRB 2Q8AL 2BNRA 2HN7B 5EC2A 4EBQL 5DD1L 5DRXB 5IV2B 1KIRA 4NO5A 4XVSL 3MLWL 1EEYB 1U8IB 4JPVL 4N5EC 4WWKD 3GIVA 5J4MA 4WV1C 4GJTB 4DN3L 3KVQA 3VRLE 2DJUA 5EBWA 5E6ZA 4PLJC 3DGGA 3O2WL 4P2RD 4Z7VB 5CBEB 1DEEB 3DX8A 3MCG1 5EIIA 3GNMH 4WO4B 5J89A 4WEUD 3CUPA 3VXPA 4HQQH 1I9RH 4AJ0A 3O4LD 1KLFA 3DIFB 2G75B 4OKVB 3TCLB 2WBJD 4PJEF 1T1XA 5CEXB 3G6DH 3QUML 35C8H 1GHFL 4HSQA 3QQ9D 5IVXE 1NAMH 1QFOA 2ADFH 1OAQL 5CEZE 3ULVC 2UWEB 1H5BC 3P0VH 5J0BA 2PW2B 2YOCA 3D9AL 2NR6D 4UQ2B 1MCWW 2P8MB 4JANA 1V05A 3VFOB 4MMZC 4JFPB 2G60L 4IRSD 4KKLC 2OJZL 4KMLB 4XNMA 5ID0B 5JOFA 1AXSB 4Y5YC 3KPLA 3PF2A 4DW2H 1FC2D 3HHRB 1Q9OA 1LO5B 4JQVA 4WWKC 1RVFH 3O8XD 4P99A 3MLUL 5HYQA 4S1RL 4Y88A 3IXTB 3LAFA 5GRVL 1IC5L 3KDMB 5IHBA 3H3PH 1KN4H 4O2CA 1NSNH 4RZCB 4NWTH 4ZSOE 5C0JB 3NMEA 4RFEB 1JGLH 4P9HC 5FKAB 5E08L 2CJUL 4S1DD 5TDPB 3VFPB 4LPYA 2PTTB 4LKXB 3BFOA 3FB8B 3UC0H 3DUSA 3PABB 3RQ3A 4NQCB 4WFGD 1YY9C 3REVA 1NFIA 5HVHC 3P0YH 1TQBC 1EAPB 4XPGH 3N1PC 4MDJA 5C8JB 1IKFL 2P8PB 4MQ7A 3D85A 1KB9K 1ZXQA 2QQKL 4WY7H 1H3WM 2DQJL 2X1PA 3GK8L 5D9SB 3B5GA 1T89C 3NFNA 5EBMB 4BFIA 1D5IL 4LSQH 5M94B 5B8CA 3SKUD 3T1FA 1FFOA 1BQSA 5JUEL 3OKDA 4JZNB 4PJXF 4ORZC 5E8EA 5MHSE 2Z31D 5SWZB 3RIAF 3O45B 4RGNE 4I48A 4FP8L 3IDNA 1N6VA 3QEUB 3E2HC 5I73C 3QIBB 5MEOB 3HI6H 4M8QB 4I3RH 1QSFE 3C2SA 4HBCL 4PJIA 4P59H 1JF1B 5D7IA 1CFSB 4NQVA 1I1AC 4EUPA 3RL2A 4PGDA 4L4TD 3R1GL 1GXEA 1MJUH 5JHDA 1FJ1A 3O4OB 2O26U 3BP6A 4AYFA 3ECBB 4LLAA 1AD9A 1DLFH 4NC1E 5ERWA 4JM2B 4NO0B 1CXFA 4JPWH 2BMKA 3T2OA 2DLFH 4QRTB 4JHZA 3RVUC 4IDJL 3H42H 3I75A 3NN8B 1FFQA 3R8QA 5B3NA 4HXAH 3GMLA 4CU7A 2J6EH 4MXQC 1P7QA 4XPAL 2BOBB 2VR9A 4QRSA 4F37K 4HT1L 4MMXC 2QKIB 3QQ4B 1TXKA 5C07E 4M48H 2COQA 4YDVA 4DUVA 3C87A 2NY0D 3GBMH 1NEUA 4ZAKC 2Y23A 4U49A 3HLAA 4HAGA 5LGHL 1T20A 2CIIA 5FF6A 2BZDA 1IGML 4HG4K 2B2XH 3MFFA 3PWVB 4E0RA 5KS9A 4OZIE 2YPLB 4F58H 3ARQA 4NRXB 3FAXA 1JGVL 3JWDH 4OIAA 1EHLL 5I8KL 4KJPD 4KXZI 2MPAL 3PWPA 4CMHB 2FNBA 4H0IA 1PG7W 4G5ZL 5L88L 1PFCA 3B9KB 3M17A 5DD0L 5DJ6B 4YHZL 1LMKA 2UVEA 4HIHB 5F21B 1YPZA 5DVLA 1ZMYA 4D0CA 3RZCD 4JKPL 3MJ7A 1IL1A 3T4YA 4P0DA 3IJYA 1ZWIB 4DCQB 4IHOA 1C7SA 3HRPA 2F54E 1PD6A 3F7VA 2BMKB 2YA2A 1HHIB 5DVOA 1Q9WA 4NKDB 4U6YA 2IADB 4HMCA 4OM1L 2C3VB 2IBGA 2WMPA 3TFKD 5CSGA 3GI8L 3VXUB 4GRWE 5E8PA 5MEPB 1J8HE 1XH3B 4NQDB 4OCMC 3QNZB 1AH1A 1S7SA 3ALPA 1JNNH 1QFWM 5C0RH 3L5WA 1NGXA 2LV4A 2D0FA 5D7KD 3T08A 5A16A 4NJ9L 1ZK9A 3H7BB 4HUWA 4YEEA 4JGUA 1UKQA 1L4IA 2IAND 3G6JE 3F7PC 1XGUA 4LARH 2DF3A 3O3AA 3QNYA 3KPSA 4MXVE 5DGQA 4I18C 3EDDA 2OMBA 1N7MH 1VDGA 4I3SL 3T1WA 5EORH 1EDQA 4GW4B 3PHQA 5HI3D 1U8QA 7CGTA 4R2GD 1DUYA 4OGYL 3VRJB 3O6FA 5D7LE 2Z4QA 15C8H 1E4XH 4Z7VE 4D9LH 4WFHD 3SGJC 2VXVH 2R69H 1JI2A 3OZ9H 3U4BH 1U8IA 2ED9A 4U31A 1LP9E 2X40A 4HLZG 5GGUB 3CXHJ 4HS3B 2ZUXA 3L6FA 5EBGA 5I17A 4JY4B 4UINH 4UDUA 2F74A 1KYOK 1W72L 3FO1B 1T21A 3QXUA 5CZXD 1F4WL 2QQLH 4K9EH 3ZDXE 1MRFL 1CFTB 1A1NA 5DJ0A 4YHNB 4PJXA 5LWYH 3L3DB 3L5WB 3RGVC 1UWEH 1BZ9A 1RIHH 1ZA3A 2ITCA 5MEPA 3ZSSA 1T04B 4YH6A 1DQLH 4FP8H 4C59B 4DW2L 3VFGL 4GT7A 1JPTL 3ULUH 3G5ZA 5KSBB 3WUZA 3SHSA 1CTNA 1G6RL 2HFTA 3MLVH 1DQJB 3INUL 4G43A 3MRQA 3NA4A 4PJXE 3C60A 2AEQH 2JE8A 4QOKA 4GRMB 4LHUB 2CO6B 2GK0B 4RGMB 3W0WB 4ZPVA 1C12B 3AB0B 5HHQA 1S9YA 5E24E 4ZQKB 4X6DB 3GSNA 1YNTB 1JZ3A 2H3NA 4DVBB 3EJZC 3LMJH 2AS5M 1QTYT 1CD9B 2GSIA 1I7RA 1DBJH 5CJ5A 3DGGB 1AHWB 4JHAH 2FO4B 4LLMA 3ULUD 2WM0A 3QT2A 3HUJB 4Q74A 3WXWH 1I9JH 2XQYG 4FQQB 1VFMA 5D5MA 4LASL 4YE4H 1JWSB 3EOAB 2W0PA 1U95A 4GSDL 1U58A 4CMHC 1F11B 3GDBA 3WLBA 3D1MC 1IGCH 4JO1H 2OQJA 2ADIB 1UWXH 4IHOB 2OK0H 1TVDA 4TOYL 2A38A 1LO4H 2DLGA 5I1JH 1NMCB 4X6BA 2YWZA 3MBXH 4G8FB 3JSSA 3DXAB 2FO4A 4LLMB 4LVHB 4XC1L 1WBYA 4PBVC 2X89D 5CD3B 1F8TH 5K9QG 4F7PB 3BKYH 1IAII 1JGDA 2A73B 4XNQB 3MV7A 3TT3H 3HE7B 4QXUH 2HJKA 4TULH 1ZA6B 3DYPA 5INDA 4AT6B 2V7HB 3N06B 5KSAB 1FJ1B 5CZKA 2PR4H 4ZMAT 1KIPA 3MMEB 4QHUB 5JW5A 1DBAH 7FABH 3OG4B 2CIKB 1JRHH 3HLAB 5GS2H 3VFRA 1I8IB 4KDTA 1U8JA 4G42B 3KR3L 3NABL 4RMWA 4JFEA 5IUSA 3ZE0F 1Z5LB 3TIEB 2VZOA 1HHGB 4NPYB 2O5ZH 4NJ9H 1Z9MA 2J8UA 3VFTB 1ZLSH 2F5BL 5C0ND 3KPNB 4C56D 1W72B 4P2RB 1AI1L 1RUPL 2YUXA 1DP0A 3GSQA 2VZ3A 4PJHE 3PQYD 2HFGH 2ESVD 3AUVA 2X05A 4ELKA 3ARZA 4Q6IA 1G7HA 4XBPB 3VXMD 4ONGL 2VJXA 5GGRA 4NCC1 2Z0BA 5LXGL 3UTZB 4XMPH 1WCBB 5C08B 1TQCB 1IGYA 5J6GA 3C6SA 3L6FB 1K2DB 4CMMB 3DX7B 2HJFB 1AGCA 3DXAE 3E3QE 2Z91A 4BJLA 1CYGA 2G5BB 4PGBB 2CIKA 3MLYL 4CVZB 2D7QA 3B9VA 4PJHF 5MEOA 4DK6A 5J12C 3QEUA 1XR8B 3QIUA 4EXPX 3VFMA 4FFVC 1J1OL 1T7YA 3QIWD 1U92B 3QUYB 3JUZA 5J8OA 3O6FC 3QEHA 2B5IB 2BVTA 5DMKA 4Q2ZB 2AABH 4EQ2A 3DO3A 2VE6A 4WENB 2WWKO 3T0WA 4Q0XH 1VEPA 4QRQB 6CGTA 3TO4C 1YEJH 3KPLB 1I75A 5EO1B 4MD5B 4TUJB 1H15B 3BN3B 4OFIA 4X6DF 3P11H 1MRDL 3HNSH 3NCYP 4ODUB 3ZTJG 1RZGB 5E94B 2I9TB 3EFDL 2GTWA 3NCJH 5HHVH 4TUOB 1YN7A 3LHPL 1N4XL 4GBXB 3W39B 1ZT4A 4FFYH 4ZO9A 4EXKA 1GOGA 4QHNA 4ZAKB 1SYSA 1P7KB 2D31A 4F15B 4Y4KC 4NO2A 3QUZB 2AXGB 5F44A 2PYEB 4I2XB 2NY7L 1KTKE 3ES6B 4HUMB 3RY4A 4Z0BL 4U6HA 1CIUA 2LE9A 4P5KB 3G6JB 4MAYC 3VJ6B 3B3IB 2VN7A 43CAA 1BIHA 5ESVA 3LEYL 5HGAA 5C0EA 1MCJA 1Y0LA 4NM4H 4AIZB 3D0LB 1OW0C 5DD0H 4YC2C 1KEMH 4ONFL 2Y07L 1E28A 4FFZH 4DOHE 4UMGA 2AEWA 3C09C 4NWUL 4XNMB 1EEYA 2MPAH 5DJXB 3TH3T 5D6DA 5AD0A 1Q9LA 1OGAD 3CC5A 4RDQG 5IMKA 4U0RB 4JLRB 1Q0YH 3E6HB 2K7PA 4WFFE 4HWNA 2WINA 4LLQA 5C0BA 2IBZX 3QEGH 4NQSA 2QSQA 1XZ0A 1EGJA 1CLCA 1RUKH 2FX7H 2LTQC 4ZFGH 2DQHL 5MI0C 3HR5A 4I4WB 4GRMA 4LHUA 2AJ3B 2CXKA 3PV6B 4YZFE 1CK0H 3B6SA 4X4XA 5BZWB 5TE4L 3RTQA 3FJTA 1UH4A 4ENED 1DUZB 3CCHB 1BF8A 1CGSH 1LNUB 1S7UB 4G8GD 2YD9A 5ICZB 2QQQA 4HF5H 4HS8H 2QLVB 4KZDL 1CQKA 4JCMA 2NW3B 4ALAL 5ALBL 1ZTXL 3QWRA 1EFXA 3GMNA 4U6VH 3I75B 3NN8A 1KIRB 4NO5B 4FS0A 1JMZA 5F1NA 4GRWF 3OKLB 3RVWC 5I66B 1TFHA 3IDMB 1EJOL 1N0XH 3ULSB 1U2CA 3T0EB 2IPTH 5ICZA 4OCWL 5DVMA 3T3PE 4P57B 3ZKNC 1UCTA 1KFAH 3WS3A 5T3XL 5IBUG 3I2CL 2CXGA 1AO7E 3AMLA 1NLBL 3IFLH 1HZHH 3E8UL 3OAUH 4O58H 5JORB 4JJ5A 5KN5B 1SJHB 4TNVF 3G5VB 5C0AD 4KDTC 4XAKD 5IMOB 2ATKA 1FNEB 5HXMA 3DURB 5HYJB 3ZHDA 2VZTA 2A77H 4WIQA 4XC3H 1RURL 3GRWA 5DFVC 1PSKH 2AK4D 1QUNA 1IC7H 4RAUB 3QG7L 2QR0A 1RZJC 1RK0A 4G6MH 4K8RL 3VGHA 3SPVA 4NP4L 4M5ZH 3FQXA 2OBGA 3NOIA 3EFFB 4FQ2H 4P3CH 4GRWH 4ZO8A 2OTPA 3RVUD 2DQFB 3ZMRA 3QDHA 3QA3B 5C0AB 2D4DA 5HI3C 3S88L 1F02I 3KWWA 3VD5A 2K1MA 4LEOA 1Y18B 2MNUA 3MLTA 4PJ8A 1PAMA 1V3LA 3T3PF 3LN4B 5SX5H 3WUWB 5M7QA 5FYKH 1B0GA 2NY5C 4LVOB 5JHDD 3CSPA 3NIFF 2F54D 3T77B 4IIQC 3V6OC 1JWUB 2OCFD 3MJ6A 5IFAL 4EVNB 3HMXL 4Z7OF 2J8OA 3RGVA 3UTTE 2O93L 4Y7MA 3VGAC 3QXDB 1QBBA 1MLCB 4K7PX 1JHLH 2VDNL 4HMEA 1MJ7H 2DLEA 4HFWA 4PV8A 1MF2H 4JHBA 4JPKH 3L7EB 1SY6L 3H9SB 4ELMA 3S35X 2YMXH 1UJ3C 3K80A 2YPKA 4KWUA 3CU7A 3AXLB 3PNWA 3D3VD 3ET9F 3W0WA 1XMWA 4ONGH 2BC4B 5JIHA 4OKVA 4MXWL 3WFEL 3D69B 3QUZD 2IGFH 4P2CG 3GJEA 3BT2H 5KVGH 3SO5A 3UZQA 4KTEL 4G9DB 5F72S 1VADA 1IC5H 1HQ4B 3PWUA 5SX4I 2EYSA 1LO3H 1NKRA 3WDHA 1EEZB 3GKWL 2A6KA 2R0KL 1ZKAA 1NBZB 2EECA 3QJHA 3E3QC 1D5XB 1S3KH 3LKPB 1REIA 4XCFH 3PWPD 1NCUA 1P7QB 4NWUH 2A1WL 4OAWA 4KC3B 4PJHA 4IRJC 3NIFE 2OJEA 4HX1B 2PNDA 1SYVB 5GZNC 1DQQB 1GZQB 1RD6A 1A1OA 4ZTOL 1XGQA 3VWKB 5I1HH 4Y8DC 4UDUB 3FQTA 1P9MC 3TNMB 3ILPB 4XRCB 4HGWB 4E41D 4UV7L 5CEYA 1JV5A 5GGUA 3VI4F 1XGPA 3RUGA 1U8JB 4G42A 5T1KB 2ZUWA 4X6FB 4X99B 3NA9L 3N50A 1RFDH 3OB0H 5FK9B 5ALBH 1K4CB 2VSDA 1P7QD 4CVUA 4LDLB 4UDTA 1YEHH 5HHMB 4U1NA 4HKZB 3G08A 2J8UF 3LEVH 5E2WH 4DZBA 3QRFM 3BN9D 4LSUL 4XVTL 3WIFA 4PRNA 4UOW0 3I9GL 5LGJB 5DWUL 4OLYL 32C2B 1CF8H 4DK3A 5HSFA 3IFOA 3T1FB 3HCVB 2V17H 4EEEA 3HA0A 5HYSB 4HUKB 3WHXB 5E8NA 1KTRL 3MYJB 4NOFA 5FCSH 4PJDA 2XRAH 2ED7A 1WFTA 1KN2L 1G7IB 3K4ZA 5CGYD 5E5MB 5T1KA 5GSVA 5ABDE 2B4CH 4K3GA 1ZLUH 2FEDD 2ERJB 1NH6A 1BM3L 4K71C 2DTMH 4NJAL 4F33A 2C1OB 1EA9C 4NRZB 4PJCF 4Z7WA 12E8H 3MXVL 4K2UL 4KI5E 5JW3L 2H32A 1JGEA 1UWGL 2P5WB 2WIMA 3BP5B 4PTTA 4XCEB 3RDTC 4J4PA 2VISB 2IBBA 3HZKB 3WHE1 5K59E 5ISZB 4NKIH 4A6YB 1JWSA 4HH9B 1KXVC 3AS3A 4PJGF 5CSZA 4K3EL 5E1AB 2GTZA 3RNQB 4J6RL 1GL4B 4MJ6A 4XXCC 4KAQH 3AREA 5IW1A 4I77L 4WI3A 4PIRF 3TT1H 4MDIB 4JANB 1HHKB 1VERA 2DOCA 3V6FA 2G60H 3BHBB 3O9WC 3LS4L 2PO6B 4OCLC 4ODUA 5BO1L 5JA9A 4PBWD 1QFUL 3PDOB 2BNQA 4S11A 4UOW1 1E0OB 1WSST 4U7SA 4UUJB 1NQBA 4HC1L 4KJYB 1W0WB 3GJFK 3TA3D 1FIGL 1PDKA 1RPQA 4X7TA 2DIBA 2ZSVA 3EFDH 5HHVL 1VFAA 1HILA 4DGIL 4G8IA 4NZRL 3N85H 4LNRB 5KVEL 4JY6A 4MB4A 5EZLB 4EI5B 4XNXH 2ATKB 2FH6A 4YWGL 3GSWA 1OARH 2APVA 4KROC 4U33A 1ZHLA 3ARBD 3MFFB 4TNWF 5DTFB 1WIUA 3KHQA 5EO9A 5D93C 1D6EB 3K3QA 1EH9A 5H37H 4XPBH 2EDDA 1IEBA 1YEGL 1BD2B 4L4TE 3VXOB 4M93B 1ZANL 4M43H 3IXAB 4LEXL 2W9EH 4OTXH 1AXTH 2DQGL 1XT5A 4P23D 3ZHKA 3TM6A 5SWSB 1S7WA 3ZYOA 4PRID 1Y18A 4FRWA 2IH1A 3CPLB 2OZ4L 3V4VH 1N7ML 4MNQB 1PEZA 3IETB 5F1KC 4M1DL 4OAWB 1JPST 2I9LB 4LLVB 2ADGB 4QCIB 1HH6B 1FFNB 2CRZA 1NBZA 5CAYB 4TRPL 4N8VA 1JJUA 1FZKB 5C71A 4ZUUA 3FFCE 3RWGA 2R23A 5MHSD 1KUMA 1RZKL 3W81A 1NDMA 4KHXL 4Z7UA 2GSGB 4Z7WE 5DZLA 1Z6JT 4X6DE 1M7IB 5SV3A 4RWYL 1NANH 1LO3L 4XTRC 2AQ3A 1A6TA 2G9HA 3RWCA 2Z92B 5C09D 5TE7H 3SDAA 1BVKA 5KOMC 2HT3C 1XZ0B 2X44D 1J0JA 5HPOA 1DQML 5DDHB 4DVRL 3MRHB 4IOFD 1NAMB 4POUB 4IEFB 4BFGA 3KLHD 5IEKB 5FYJD 1MCLA 5K9OA 1H3GA 4R9HA 5EU7C 1HOCA 4Z7VF 2P8LA 4LKCA 3SKOB 4JFZL 1FE8L 4X6CE 3PWPE 3QRGH 1YEIH 5IIEB 5INDB 1Q38A 3MNZA 4KTDH 1ZLWH 4N8VG 3QG6B 4H88L 4HJGB 5D1ZC 2B2XL 1MCWM 5D70L 5CINL 3NAAH 3WV0A 4K8RD 1UC6A 4QHMB 1RZ7L 2YN5A 4ZSOA 5HYSG 4X6BB 4MXVF 3I6LD 3HE7C 3JWDL 3T04D 2XG4A 4RIRB 3LV3A 4BZ1H 1F42A 1ORQA 4JPIB 1T6VN 5HHMD 5GGRY 4P4RA 5C0CA 1UG9A 1UM6L 3U9UA 2Q76B 4I13B 2XWJB 3LN5A 1QQDB 1BZ7A 5EOCL 3DETC 5BV7H 3V4PH 4MAYD 2CKBB 5DQ9A 2J12B 2H3NB 5D7LA 4LIQE 3SQOL 3V9FA 4XMLL 4ZUWA 3ZE0E 1ROWA 4HUVB 1R3JB 5EN2A 3Q48A 3QPXL 4BK5A 1N2RA 1S9WB 1VACA 4GXVH 3D39B 1LK2B 2CLZB 2Y25A 3C60B 1R24A 2Z31A 1DBJL 3VXMB 2YEZB 4M5YL 4MD0A 2ED8A 5C0FA 4RGOH 4XP6L 1OB1A 4TUKL 3ARTA 5KJRL 5E2TL 5CJBA 3BRGC 1HDMA 3SDAB 1CG9A 1UACH 3D3VB 1K5NB 4QOKB 2VLJE 3MPCA 1ZLSL 3HS0B 2XT1B 4RAVB 1FLRL 4KRPD 4UT7H 3TYFB 1MHEA 3SKJH 2ORBL 5DHVB 1OTSD 1OWWA 2DKUA 1OTTD 4AH2B 4MA3A 1CLOH 1T7VA 3WIHA 4OF7A 2PUQT 5TFSH 3UTZA 4JRYD 3N1QC 5ESAA 1FG2A 1D6VH 3BKYL 1AXIB 5I2IA 2R1XB 3DVNA 3NIGE 3VXRE 2XN9A 1P7KA 3JV5A 2Z8VC 4IDLA 3W2DL 3ZYIA 2GK2A 2G5RA 3HI1B 1DN0A 3S4SA 1S7WB 1V3MA 5E9DA 3KJ6L 2PTUA 4E42B 1JNHB 1BFVL 5FGBC 1KN2H 3SDCC 2EEBA 4PRAB 4I48B 2RHEA 4IIQA 5ALCL 2MTPA 4KKAC 2R2EA 5FKPA 2ZUSA 3PXHA 3LDBC 4NHCL 2OL3A 1CS6A 1HOCB 4N68A 1QFWL 5MEQA 1IAIL 2J4WL 3ETBF 1JPSH 3U1SH 4PS4H 2VLKE 4LPXA 3SE3C 4MB5A 4F7TB 5I8OH 5DRNB 1GAFH 2JELL 5GHWL 2HRPH 2GT9A 4XP5L 4Z78B 5IQ7H 1HYSC 3REVB 2M26A 1PW3A 3HMXA 4DFHA 1HH9B 1C5CL 1K8DB 3PQYB 1RU9L 4JFXB 4M6OL 5FA4B 1FLTX 4U1SA 3HI1A 2OMNA 1FAKT 4MNQD 1FL3B 4N9OB 2OL3B 1EEQA 3SE8H 1J11A 3UBXG 3RUGB 5TPWL 5TE6L 3BH8A 4O4YH 1S5IL 4QRPE 3QDGB 4PJ7E 2B0SL 4PRIE 3RVWD 1NFDE 3CLFL 3QZWB 3NA9H 1FP5A 2EDJA 4LHUG 1GOFA 2V2TB 1HKLH 3N1GC 1DQQA 4KKLD 1TJGL 4PGZA 5JHLH 3MGOB 1KC5H 5JHDE 5JIPA 1A6PA 5DSCA 2VLJA 1MCPH 4OZGA 4L3EE 1WT5A 4HZAA 4Q9BA 4YDLC 3N9GL 2EH7H 1ODAA 4HV8A 3L9RB 5C0DA 2UY7A 1VPOH 1MAKA 3VFVA 5FHAH 5IWLC 3ZYZA 3MRFA 4XMKL 4LSVL 1RI8A 1ZHBA 1J8KA 2EYTA 1XF2B 1HCVA 2C3WA 2XACC 2MQ3A 4G9FD 4YDJA 1C1EH 4APQB 1FNAA 3P11L 3BXNA 5DHXB 1YNLH 5GISH 5GIRB 3VG0H 4XP1H 5FYJE 3RAJH 3TV3L 1RMFH 4QTHA 4M1GH 2JLLA 1W0VA 3MLWH 1Z9SA 4XNUL 2DMKA 3WO4B 4OLVH 3EYFB 4JFDE 2YPLA 4P2OB 4HIXL 3PWJB 3GMOA 5DJCA 4JFQB 4PR5B 4OZIA 1UM6H 2VQ1B 5D7JA 1R3HA 1SEQH 1N2RB 1S9WA 2IC2A 3FMGL 1KIUA 4JKLA 5BJTB 4TULL 3RA7H 3P9MA 4L3CB 5JXEA 1UXWA 4EBQH 2R0ZL 5DK3A 3WDIA 3TBVB 1UYWL 1XGPB 1J0ZA 4MJ5B 4RFNC 1RUAH 4PJ9A 3UO1H 3I6LE 4TSAH 1FVCB 4XI5D 3EKCA 5CEZH 4XH2A 1F2QA 1AGEB 5CSZB 4AEIL 1U41A 3AB0C 3RWDA 3QWOB 4R26H 4N0UA 3QG6A 4HH9A 2HFEB 5KVEH 5IESL 3KWWB 3NABH 1J05B 4BZ2H 5KAQF 25C8L 4I0PD 4WO4D 3UPRA 3IGAA 4MNHA 3FQUB 4X4YB 4OM0L 1QA9B 3O2DL 4PRDB 5D1ZB 2Z4QB 2CLVA 4CGTA 5HGHA 1S9YB 4HGKC 1OAXL 4PJIB 1F3JA 4BUGA 5D2LE 1MFEH 1UZ6F 3IDYC 5KVDL 4XVUD 5F1IA 4LAQH 3T0DA 5F9OH 4U0QB 4G3YL 3O9WD 2IAMB 1ZS8A 4X5WB 2J7LA 3WKML 4R96B 1OGAE 4LLDA 2JIXA 3VXME 1T03H 5D72H 2FB4H 3I85A 5DI8B 3MV7B 1PX3A 3QDJD 2KBGA 2Y06H 4HFWB 4ZOBA 2YRPA 2Q6WB 3EO1A 5LCVL 3OGOE 3TF7C 3WFDH 5C0JA 1N0XL 3GNML 1FORH 4JRXB 2XQYK 3IDJA 4F7MB 5ADPL 2H6PA 5ALCH 1DFBH 1KT2B 5CIPB 1G7QA 4BA8A 5B4MD 1QBML 1QLRA 3BZDA 4HLZH 4P9HH 2EXWC 4YX2H 3F62A 1KB5L 1P5UA 2IH1B 4KI5F 1G7JB 1OGTB 2D7OA 4Y0GA 5DEZA 3N1MC 1Q94B 3SE3A 1SEBB 5T33H 1WWAX 2BXYA 3D2UD 1HIMH 2ZUYA 4I0PA 1A9EA 2NY2B 2EE3A 3K81A 3PWPB 3WNKA 1IAMA 1YMME 4QHKJ 9CGTA 4KKBD 3OKEB 3WSQH 4OV5A 2DKSA 1A7RH 4P2QB 4S2SB 3UYRL 4DEPC 2XTJC 1W2KT 4LCUB 3X3GL 5BZWA 4PV9B 2MOVA 1PEWA 3IDUA 2A2QT 3DARA 1MWAH 8CGTA 1NANI 2HLAA 4JPWL 4RMSA 1I3VA 1WVZA 5HHNA 2GUOB 4U1HB 1FO0B 2W59A 2E6JA 2FGZA 3K2UH 3KPSB 3NPSB 5EIIB 4WFED 1U42A 4CU6A 2WINB 4LLQB 4FA8A 5DJ2B 5MENB 3NFPA 1GGBH 3MRFB 1I4FB 4K23H 4PJDE 3V6FB 1MCOH 3CD4A 3O41B 5IB1A 3RBGA 4Q58C 3SOBH 3NCBB 3U46A 1JTOA 2AXFA 3ULUE 1XH3A 1NBYA 1HINL 3MX0A 1AKJD 3WEXB 5DQ9B 3RWIB 4JM2D 2AJYL 1GGTA 1IAOA 1S7RB 2VQTA 5KSUA 4PS4L 4YHYC 2O5XL 1X4ZA 4MA1C 3VD9A 3BMWA 4Y16A 5I75B 2GY5A 5IWLA 1TZGL 1IL1B 4PJGA 3OQ3B 1T2QL 2BSRA 5HDLA 4LLWB 1UJ3B 4R6UA 2ZG2A 4TUKH 4FXLA 4MXWH 1DR9A 4OF5A 4JQIH 1NCAH 5FUOL 4JREC 1H9VA 1BEYH 2OZ4A 1TJHL 4PJCA 1UH3A 2GJZB 1I3GL 1LNUA 1S7UA 4OFYA 1WZ1H 1YEEH 4UBDC 5KS9B 1OQXA 1RVFL 5FM8A 2Q6WA 2FD6L 4LOUC 2A6DB 3IDIA 4LLYB 3SJVD 4ZOCA 4C4KO 2FJFA 4YXLL 1X5LA 3DURA 3MA7A 4HK3N 3UZEA 3P4MB 3UTTD 2BFVL 5DJYB 1KENH 2XA8L 4B5EA 3G04A 3HNTL 3U0WH 1A4JA 3QUYD 5E7FA 5CSBA 4JJHA 3C2AH 3SDYH 1PQZA 3BQUC 4U7MA 2Q3AA 5HYFA 2X4RA 3MJ9H 3PUCA 2XI9A 1I1FB 3NH7L 2NPLX 4OM1H 3KPRB 2GSGA 5F88B 4JRXD 4ZYKB 1XGYL 5FB8B 4R4ND 4YHIA 2WUBL 5KVDH 4JDTH 2BX5A 4BH7A 4HIEB 4NO0A 4Y4HA 1V5JA 4LSSL 1QBLH 1LDPL 5EB9A 5F9OL 3ZTNH 2FYYB 1Z0NA 1YA5A 4L8BA 4ELKB 3TZVC 1CFSA 4NQVB 5HHOE 5J56B 5AYUH 2W9DH 1D5MA 4OLUL 1W0YT 4WTXA 5JDSA 4XX1G 4GOSA 4OBRA 3VI4E 3QAZC 1U8KB 5TPWH 1C5BH 5JW4M 2HWZL 5DFWH 1NC2B 3IAPA 3T8XB 1H3PL 4L3AA 1AXSA 3QXTA 3MA9H 4X0KA 3O8XC 4PJFF 5T1DH 5IB2B 1DL7H 5GS1C 2ZP0T 5H2BA 4PJIE 3L5XH 3Q5YA 5C0BE 1YMMB 3EYFA 5DMJB 4Q9QL 4MVBD 2DM4A 5T3ZD 2VAAB 3MACL 4M93C 1BVLA 3BQUB 3DROB 2FWOB 4X7SL 4XPHH 3UBXI 2V5MA 1XF5B 2A74B 1DQDL 2DQEL 5GGVL 5DTFA 4YHMH 4Y19E 1T0NA 5E4EB 3ZDYF 2FSEB 5E99H 3MXWH 4XGZA 1CXEA 3SO3B 1JWUA 2XTLA 2PXYD 2ZUVA 2EIBA 2XKSA 1UCBH 3VFVB 1NGZA 2ZUTA 1AJ7H 4KI1A 4ODTL 2BHZA 1PKQA 2JTDA 1MLCA 3VG0L 1YDPA 5ACMA 1Q9KA 2D7PA 5FA3A 3IDGA 5GS3A 1MFEL 5AG8A 2DQIH 4K3JH 5DJZB 3AS2A 3HAEA 3QFJB 4PJFB 5LBSH 1RV6X 2PYFA 5JPNA 4YHOH 5JXAH 3K8KA 3HTLX 5JUEH 1GYAA 4DN4L 5IFJB 1BQHB 3QPQC 4MHHI 5F6IC 4ZTPH 3IJHB 4OF0A 2D7TL 3T0AA 5K9OB 1H3UA 5C0CD 3O45A 2HMIC 2FIKB 5INCA 4TQEL 5B39B 1WFNA 5JZ7D 3EDEA 3IRZA 3SDCD 1CFNB 3CMOL 1UYWH 5DGRA 4N8CL 1DBMH 4LCYA 2AJZB 3VXRA 1DEDA 2AK1L 4KVCH 5DURB 5CJXA 1RIVH 4KH2A 1N59A 1T1YB 3MBEB 5DR5L 3VXQA 1NPUA 1P69B 5DC4B 3LEXB 3FT3B 3RUGF 1MQKH 4KRMB 2GT9B 4WRLA 1NFIB 2BP3A 3RWGB 2HT3D 3MNVB 2R1YA 1OAXH 2DQTH 1JNHA 3L3JA 3LQAL 3FN0H 4IOFC 1N64L 5LKNA 3KLHC 4N90E 1IBGL 2WBJC 4KMTL 4DGYL 4U2ZA 3RWEB 3H8NA 4HUUA 3JTSA 2Z91B 2YPVH 1JPTH 1MCNA 3IF1B 3NIDE 3L3DA 2VDQH 1ES0B 3MLXL 3ULVF 5I8EA 2Q7YB 4X98B 1VENA 1WTLA 3QULB 1WTGT 3QPQD 4KJPC 4OLYH 1WZ1L 2EDRA 4XWGH 3T09A 1BAFL 2B39A 1EJ6A 3RX8A 1R3KA 3OZ9L 1S7TB 4HS3A 3SQBA 4WUKH 3ARGB 5LCVH 1QSED 3T4AA 1CF8L 4JZJC 5ESAB 3LQZB 3S7GA 4LFHD 1WWBX 2N4IA 5I1EH 2VLKB 3VW3L 2VH5L 4HJJL 4AL8H 3DRQA 1TETH 5D2NB 1RZKC 4CJ1A 2YXFA 1WZKA 3MNVA 3CFEB 3CK0H 1ZLUK 3SGEI 1I7TA 3HAEH 4FN0A 4G9FE 4PTUB 2YBRA 4FQIH 2NY3B 3C8HA 4M7LT 4Z7NE 4PJAE 1UWGH 5EZLA 3M8OL 4XNZC 4QRRA 2CRIA 2X4QB 1MJ8L 1MUJB 3UMTA 4ZXBB 3O3EA 3FO0L 3QCTH 1MHPH 3BZ4A 4LCWA 2ORBH 1PLGH 4QO1A 2MHAB 2W38A 4D9QE 4ODSH 1B2WH 3QCVH 3KYMB 3ORJA 5F3HA 5HHXL 1T5XA 3MOAH 4H8WH 5D1QB 4GKOA 2P43B 3MROB 4G7VH 1ZVSA 2VDNH 3MSPA 1CBVL 3T0XA 1CL7H 1G9MC 3TZVA 3D6GA 2DQCL 5LGKA 2DL9A 3CFKA 5GS0H 2H2PC 1FNLA 3GBNL 1NFDA 2G2RA 1UA6L 2WP3T 5T5NG 5I0DA 1AE6H 5IB3B 1L6XA 4Y4HD 1AIFA 1I9IH 3NPSC 2EE2A 3QDAA 4NGHL 4DWHA 3HB3D 4FNLH 5DT1L 5I15H 1ORQB 4JPIA 5J1TC 2DD8H 2OSLB 5GS1A 4U1HA 4EJ1C 2JJTC 3NGBC 2MCPH 4MJIA 2PYEA 4RISL 3ARDA 5HD8C 1M6OA 4IRJD 5DA0B 4OZGE 5BZDA 2VXSH 4FQHA 1UB6A 4M62H 4AIXA 5IG7B 3D39D 3CFCL 3GBLA 4RNRA 4DQOH 1PZ5B 5DMGD 3VWJD 1B90A 4GKNA 1G0DA 4IMKA 1BWWA 4F2MA 4YHLH 2R8SH 1N6QH 3ILQC 4ZOAA 4F9PC 4I0PC 1M1SA 3UTTA 5TF1L 3QIWA 3RU8H 4QY8B 1IT9L 4HKXA 3SKJL 1IFHH 2VDML 3PWVA 1FZJB 2BERA 5GJTL 5FUOH 1SBBA 4Y8AA 2BNRE 4HS6A 2Z35B 1U3ZA 5E2JA 4GG8A 1T83C 3QDJB 1QO3B 2IALB 2EDNA 2F58H 4YQXL 1HKFA 2Y07H 2DN7A 1ZGLP 4FABL 1TTUA 3KYOA 1BQHG 2FIKA 4H5SB 1KT2A 4ESKA 5I1KH 4UAOC 1TZIA 1P4BL 1M7IA 1Q1JH 3GI9L 3CSGA 3ESVF 1A8JH 4MB3A 3WNLA 1KC5L 2AV7A 2YUWA 4WTZG 1YEFH 2ARJA 4PB9H 2VLRA 5FECA 2HT2D 2AK1H 4KVCL 3MRKB 5CMAA 4UTAH 3WFBL 3HAEB 4OSUL 5DZOA 3WS6A 5F9WC 1BLNB 3QJHB 4HWBA 3WFZA 1C8PA 2JJSA 2NW2A 4FG6C 2J88L 1NUDA 1NJ9B 2DYPD 1FNSL 4MX7A 4PY7A 5MEND 3BUYA 1L7IL 4OD3L 1IQDB 4Z95L 5E2UL 2V7NA 1PKQB 5AAMA 4N0FA 2HJLB 3MRPA 1CDJA 3RVVD 3VI3E 3QUMA 1DQTA 4GG6E 4PRDA 5D5MF 5D70H 1JZ6A 1TVHA 4C83A 4MCZA 3VXOA 1TNMA 2M1KA 1CI5A 4X4XB 1OB1B 3P4MA 2F53B 4NRYA 3DMMD 3STLB 1VEOA 1OPGH 3UEZA 4V1DB 2KPNA 4WTWA 3RX5A 2OR9H 3UTQB 4QRRD 5DO2C 5C7XL 1N8ZB 1AIFB 1E6OH 3PJSA 3QO1A 2EIDA 4ZS6C 4MWFA 2ADIA 2ILLA 1JGDB 4M1CD 2VTFA 4KI5D 1ND0B 3E0GA 2Q76A 5GGVH 5D6CB 4MJ6B 3C8KB 1X4XA 4NO3A 4LU5L 5DZNA 1AGDA 1K6QH 5T1LB 3MGOA 3A67H 4UB0L 4LRNH 3Q6FA 3MODH 5DHYA 3L1OH 1UQSA 5KSUB 3S37X 3FO0H 3ECBA 1WLHA 4X9HA 5EOCJ 1KSRA 3MJ7B 5D1XD 1QPPA 1HSAB 4R4NC 4NQED 1PLGL 1YPZB 2NQCA 1FL5B 4WW2F 3MV7D 5TH2A 1B0RA 4L9LA 5A2FA 4XP4H 3D9AH 1QOKA 1JFQH 2VLJD 2AXFB 5C07D 4OZFB 1KYOJ 1HXYB 3Q6GL 5DJAA 1N4XH 4I1NB 4OLEA 1TNNA 1YMMA 5D7IE 1DDHB 5TDNB 2OJZH 2A6IA 4OUOA 1KNOA 3EO9H 3VDBA 4GAFB 2NY7H 2UVFA 1K8IA 1MPAH 5FECB 2X41A 3MFGB 2B4CL 5J11B 3QDMD 1D5ZB 1HHHB 4JDVB 4QRPD 4XTRD 3TBSA 3H3PL 5ISZE 4HK0B 1JV5B 4IIQB 3MUGB 4X80L 3MNWB 4NQCA 4IOIB 1T21B 3VH8B 4HPOL 2PO6D 2R8SL 2AVGA 1L7TL 5FB8A 1EO8H 1N6QL 1RAMA 1JGVH 5I8OL 3KPRA 3S3JA 3UTSD 4M7LH 5F7LB 1A0QL 2AI0H 3OMZA 1I3RB 1UM4L 4B7IA 4PJ9D 5TF1H 5GJTH 1DQMH 2H8PB 4M8VA 4XVJL 3QCUH 1N64H 1N0LA 4KK5C 4WJ5A 4LAQL 4UZGA 1FCCA 1BGXH 1KCLA 4LVNC 4RMVA 4XCNA 1W72A 4P2RA 3VD3A 3BKCL 4FQXB 4YPGB 1MQKL 5BVPH 4BFBD 2H9GA 3CSYB 3ALXA 5J1AB 4JDVA 1KXTB 1HSBA 3B8SA 3QG7H 2OI9C 1WGOA 1E4WL 4H1LG 1RJZB 3NACL 3TPUB 2EC9T 4JB9H 1MFDH 1CICC 4GKZA 4E42A 2ICEA 5CZVL 2VNCA 3RJQB 1Z0MA 5JDJA 1XGUB 1A6WH 3NFNB 4HWEH 1UA6H 1E6JL 2IANA 4XZUA 1LK3L 4N1EA 2FECI 4JO3H 3RL1B 4CADA 4S0TD 1ETZA 3MRCB 4H25A 1ITBB 5CJXC 3DIFA 5KSBE 5KSAA 4Y16B 3MGAA 3O3AB 3OTTA 4G8GA 1KFAL 5EOTB 3KXFB 1H8OA 4P5TA 1JHLL 1BZ7B 3RGHA 4KK9C 1PZ5A 1XFPA 2ZG3A 4PJCE 3L3IA 3K8LA 3QP3A 4NNYA 2PXYC 4OQ1A 3FOMB 3MRLB 4LHQB 5D6DC 1RUQL 1HHJA 3BH9B 3B4NA 5EUOA 1UGNA 3DYOA 3L3HA 3LEVL 5ESQA 2C3XA 2HFFA 1NGWB 3RX7A 3RZCA 4DAGH 4XNUH 4ZXBA 2BCKA 4PRBA 1ED3A 5IKCB 2BNUB 1T66D 1GPOH 1FVCA 1QLRB 2C26A 4OI8A 3AS1A 3D2UB 2A9ML 2OR9L 5F9JA 3FMGH 1G7PA 1MHHA 2L0DA 4FQQA 5CP7B 2AXHA 3UTPD 3F65A 5I8KH 2NYYD 4U2YA 3MV9B 1OM3L 4OGZA 1I1AD 3MJGX 3MOQA 5EUKB 5K59F 5D7LB 3CDFA 2VE6B 5HGDB 1IGFL 2CIIB 5FF6B 1A9EB 2NTFA 2R9HD 3UBXA 5IMOA 3B83A 3RKDD 5E56A 3V8CA 3UPAA 1IQDA 3STBA 4ZUSB 1UKTA 1ZS8B 4FZEL 4X5WA 5F6HJ 3AMKA 3ZKND 1T3FA 3L95B 3NCCB 4DJMA 4K94L 2F53E 3DSFL 3C6LA 3K1KC 2VRAA 3CUPB 5JO5A 2H2SD 2EYTB 4YFLI 1BFOB 5AWNH 5A40E 1G6VK 2JIXD 1MIEL 1C08B 4OZFH 4UU9B 1JF5A 1YMHB 1OTTC 2NY0C 4BH7B 2ZOKA 3Q6GH 5IJVA 4EZMA 4OKDA 3EUUA 4H0GA 1PKQE 3BQUD 4XRCA 1LEIA 1FAIL 3TT1L 1EUUA 3CMGA 1Q0XL 3TBYA 3LEXA 3VXUE 3GSXB 3E8UH 4KUCF 3AY4A 3BPNC 3EO0B 5F7DA 2BNRB 3OKKB 4PRPD 1GGBL 1FFRA 5CGTA 1FGNL 2QADD 1SJEB 2AKRA 1YN6A 1H5BB 4K8RC 4TPRL 1CDBA 5FCUL 5D7IF 4QWWD 4OF8A 3OF6A 1U93B 3H9HA 1OAZH 3HZVA 2IEPA 4W6YB 4OUUB 4OT1H 1YEJL 1KLUA 3HR5B 2WZPD 4WUUA 5SWSD 3RPIA 3UTTB 4D9LL 4JFQA 4OJFH 3F7QA 4NDMA 4JFFA 4NZTH 5KG9A 2IWGA 4XPFH 5JOEA 1T0PB 3ZKXC 4Y2DC 5JPNB 3BPCB 4F9PA 3ALWA 3CCHA 2E7LA 5BRZD 4JVWA 4LRNL 4LEXH 1SVZA 4V2BA 3UDWC 5DLML 1H0DA 3BWAB 3CJJA 4YDIL 1CTOA 2HAZA 2FH8A 4PP1C 1JHTB 3QDMA 4QF1A 4X6CA 2E8ZA 3RGVB 1F58H 3MUJA 3MNWA 5C2BL 4XCCL 2JB5L 4G6JL 5ESVB 3C08L 3S98A 2ICWI 4JO4H 5IFJA 5FIEA 2VERN 3MLUH 1YJDL 1GVIA 1CFQA 5FM5O 3HFMH 1MY7A 2H32H 1PKOA 1UEYA 1SJVA 2VLLB 1E28B 3FT2A 4YGVA 5C6WH 2C4FU 5JIKA 1X7QB 1BHGA 1FQ9C 4ZUVA 2DI7A 3WFHA 4D0BB 4NKQB 5HPMA 2W0LA 3O6KH 4L5FH 4MSWB 3DBXA 5A2KH 3ARFA 3LQAC 4QTIH 1ZT4B 1HE7A 2MQCA 3CIQA 1S7VB 2R0WL 1IC4H 4N1CA 3QZWA 3RUGE 1CLZH 2GUOA 3FB7A 4K23L 4HXBH 3X13B 2MHAA 2AXGA 2BOCA 3HG1D 3SO3C 2HJLA 3GSNB 4K7FB 3L3KA 2A9NL 5CJOL 3VGDA 3MYZA 2X10A 3N1FC 1ZLVK 3QEQD 2EO9A 1CT8B 3P77B 4OLUH 3IFOB 1JZ5A 4AEIH 5IVZB 3V6BR 3Q6FB 5D7SL 4HF5L 3H9SD 4TVPE 4QRUB 3OJVC 5KG9B 3K46A 4P5TC 5C0BD 3RGVD 3WIFB 2Y1VA 1NCCL 4YEFA 4XP4L 1C7TA 2VWEC 2Y72A 3U2SB 1J1OH 3DVFA 2EKSB 4OIIL 5F7EH 3QUYA 1EBPA 1VEMA 5ADOH 4ZAKD 3ZZ1A 4W4OC 4XBGA 2YK1H 2APTA 3L3OB 3BGFC 5MI0B 3ULSA 5D96B 5K9QI 5A1AA 2FHCA 3T65B 3MLSL 2GFBB 5IW6A 1PG7H 3ARVA 3W9DA 4TVPH 4DZ8A 1CXHA 2EYRB 1MCQA 5F8QC 1YEEL 2HA1A 3CNKA 3LIZH 2P4AB 2Y6SC 3LZFL 1D5XA 3S5LA 1K3ZA 2D9QB 4JFEB 2IFFL 3G6AB 4ODWA 1BJ1H 4YR6B 1OAQH 2EYSB 3FQNB 4D3CL 1F90H 4FZ8L 5F88A 5DJAB 4M8QA 3FFDB 4QYOB 5FM4A 3B9KC 4LSPH 3U4AA 1INQA 5IM7B 5TFSL 2IAMC 2WBWB 3D69A 1BQLH 5AUMB 3TIEA 4LLWA 1CFBA 5FXCH 4URTB 2BRRL 1RHFA 4MYWB 3FQUA 4FTVD 4X4YA 5FYLH 2P5EA 1ZA6A 5EU6E 3F8UB 1V3JA 4G5ZH 4HUWB 5L88H 1N26A 4Z5RA 1FSKC 5TQ0H 2PYEE 2ESVB 3S96B 5K33A 4HCRA 3NCFB 5A43C 1BOYA 1J0IA 3PP4H 3WXVL 1RJLA 1CDHA 1TZHB 1LO2H 2OI9B 4YAQB 2LTQB 4NZDA 2PYFB 4JAMB 3PGCB 3S4SG 3CK0L 5HGAB 3UJJH 1UXWB 3S37L 1D5IH 1BFTA 4ZS6D 1A3QA 3LKNB 2FATL 4XP5H 5JPMA 4Y19B 2W60A 1Q9KB 3K2UL 3KLAA 4NRYB 3STLA 2P42B 4RA3A 1NMBH 1T7ZA 5DLMH 4U3CA 4S1SL 5I8CB 2IAMD 1JGUL 5FHBL 1W0VB 4I9WE 4N1HB 4WFFD 2YHGA 1X6NA 3V8OA 2Z8WC 3L7EA 2Y7QA 4QXTB 4J3XA 2I9TA 4ZOEA 1F58L 5GS2D 1KCSL 1HXMB 1U2HA 3U6RA 1LDSA 5EZJB 4MQTB 4Y4FC 5HD8D 5L6YH 5EO1A 5F9DC 3MLZL 2X4NB 1MLBA 1U36A 3HZVB 4ZUTB 5DRWA 3RIFK 1DLFL 4MLSA 5I1DB 2UYLA 4PJEA 1DBBL 1RZJL 4Z7WF 5CINH 5ANMA 1I4FA 1DE4B 4HWBH 4L8SC 3TN0A 2W0FB 4YUEH 1DBKH 2JB6A 5EC1B 5FEBA 2ZUQB 1V7NL 1EZVX 5IB2A 4YIQA 3AFLA 2QSVA 1NDGA 3EGSB 1BFSA 4N90D 3HE6A 2HVKA 4M1CC 4KRNA 4RDQF 3REWB 1AD0B 1TQBB 1S9XA 1QZ1A 2W60B 4XVUC 4QXGH 2JJVA 1HEZA 5F7DB 4HH8A 3BN9C 1INEH 3CXDH 3MROA 1VB9A 5C9KA 3KPRD 1MCSA 3HUJE 1T1WB 1A6AA 3P0VL 4HKBA 4P5TB 4APQD 1YECH 4TQEH 2MKWA 1UACL 5DJ8A 4M3JA 2J8HA 4R2GC 4YAQA 4JG0H 5DURD 3U4EB 1Q72L 1FH5H 4KHTL 5GGSY 5DR5H 3ZT6A 2D0HA 3VRLF 4NN6C 2BVOB 2PO6C 3D25B 1U3HA 2PKDA 3OGCB 3V95A 5TE7L 3EJZD 3SDXB 1ZVYA 2O5YH 1AR1D 3UTSE 1ORSB 3QCVL 1T3FB 2HRPL 3L95A 3HNTH 3NZHL 5KS9E 4LP4A 1D9KD 2Z8RA 4XVTH 1HIML 3T0ED 5B4MC 2F8OA 5IROA 1UZ8B 4Y5VC 1SY6H 2ZCLL 4F2MB 3WN5B 4JY5L 5CILH 5KSBF 1J8HA 4MA8H 1A22B 3P4OA 4G6KH 1L0XA 4JHWL 1F4XH 2B1HH 4Q7DA 2AV1A 3HN3A 3E1F1 2DM2A 1SEQL 2NMSA 3KJ6H 2YK1L 2WBJA 3THML 4HULB 4L9DA 5DUPH 5IFAH 1CGXA 3S5LB 3S3PA 3GB7A 4R26L 4XVSH 2NTSP 4UQ3A 5TDNA 3LH2H 2VXSL 3TWCL 3TESA 3HE7A 4G8IB 4U1NB 1TVBB 4KV5F 2GJJA 1NKOA 4L4VA 1AQKL 5FA3B 1QKZH 1F3JB 3WJLA 4XPAH 1CD8A 4GMTH 4JN2A 3FRPG 3MQIA 2J6EA 1P2CB 3L5XL 1TJIL 1HSAA 2AW2A 1F6FB 3BIKB 1X4YA 5C0RL 1T1WA 1KPVA 5KZCD 5KTEL 1UQSB 3G6JA 1RMFL 5FO9A 3TZVD 3C60C 3HRZB 1D5ZA 3R0MA 3O11A 3BJLA 4H20H 1NUGA 2OJEB 1PSKL 1J1PL 5H8DA 4N9GB 3RWHA 1A7QL 4ODSL 1CDCA 3B9KA 4XCFL 2ZKHL 1JGEB 1QFHA 1OSZA 2DYPA 1CBVH 5IHLB 1KJ2L 1M71B 5F8RC 5HYEA 4UNVA 5E6ID 1HILB 1YQVH 3CVHB 1N8ZA 1KACB 5D96C 3BX7C 3HNVH 3SKMA 2DM7A 4NCDA 1JMXA 5DJ6A 2PCPA 3VWJA 5IFHL 1HXMA 3HPJB 5IQ9A 1TPXC 1QR1B 4ODVH 3P4NB 2I60L 2CGRL 2EH8H 3MRQB 4G43B 4OLXH 5MENE 5KANG 2NZ9C 3CFJA 3C2AL 3SDYL 4JREB 1K3IA 3DBXB 1O0VA 1A1MA 4UBDD 3SDAD 5D4QA 3U0PA 3DMMA 4HKZA 2Q7YA 4O2EB 3F5WA 3GRWL 3OXSB 5F6HI 1OGTA 1QLEL 1SY6A 1KJMB 2VDKL 4LCIL 1RIHL 1LWRA 3IJSB 4MWFB 1Z2KA 4OLVL 2JJWA 4QRTA 1IRAY 4HEPG 4JM2A 3VGGA 3CFCH 1LE5B 3TNMA 4WU5A 4TUJA 1AC0A 2UWEF 2QSCH 3MRRA 3MRKA 1T7XA 3QH3B 2YD1A 3LKRA 4PPTA 1IGJB 2E27L 3QFDA 2YPLE 2AV1B 2CK2A 5F71A 5D7SH 3Q2CA 4U1MA 2R29H 5E8NB 1S78C 4NHUA 3IS0X 1A6VL 1TVHB 3B2UC 1MWAB 3GB7B 2XKNB 2XZCL 3LPGA 3B2VH 2YN3A 5ENWB 2QL1A 4JFFB 1J1XL 3QIUB 1XR8A 4I3RL 3CH8A 3SE4A 1LD9A 5DMIH 4BSVA 5C3LD 2B1AL 4PJBB 1DQDH 2DQEH 1ERNA 1KTDA 4JRWA 4OGYH 3SDXA 4EN3B 3BP7B 3ZE2E 5BS0D 1J8HB 2R2BA 5DK2B 5E1HB 5IVXA 5EU6B 3O2VH 3WD5L 2NXZB 4R7NB 1MNUH 3UJIL 3FQTB 1IGIH 1A47A 1EMTL 4DUWA 3BAEH 1AKJB 4UV4L 4HLJA 3QQ3A 4YHPA 1NCBL 4QRPB 1ITCA 5D2LB 1UH2A 5L7XH 3JVGA 5BXFA 3D0VB 4ZG1A 5FKPB 1P84K 2J8UB 1OAYL 1U3HC 4HHAA 1QSFB 1MRFH 3X3GH 1Z3GH 4MJIB 4Q9CA 1IQWH 3B43A 4XBGB 4J4PD 1KJMA 2FZ3A 2C3VA 1A9BA 1OP9A 4FQXD 2MCG1 4XPBL 1IEBB 4QXUL 4X83A 4R3SA 1QFWI 2WP3O 4MJ5A 4CKVX 1I7ZB 3HMWL 1EO7A 1KJ2B 3VRIA 3Q5TA 1ONQB 1UXSA 3REWA 5FGCE 3RWFB 1R3JA 2LU3A 3CDYA 4UNUA 3GSNH 1INDL 2VXVL 4LNRA 3OKEA 2NXZC 4P9HL 4OV5B 3QEQA 1I7RB 1KENL 2J2ZA 1QLFB 2ZWLT 2UWEA 4BM7A 2XY1A 4NQCE 3T2QA 2I5YH 4PJEE 5H35B 1MI5B 1J9CT 3EYUH 1GIGH 1B0RB 4L9LB 2FX7L 2J8UE 3MRMB 3HKFA 1Y6MR 2BCKB 5HYJE 3QUXA 4HMDA 3VXTA 4GH7B 1URLA 4PD4J 2DB8A 1UZ6E 3D3VA 5DD3L 4PLKC 3FB6A 1LP9A 4S1DC 4NN5C 3IU3A 3U48A 1CLYH 3DPBA 1RZ7H 1UEMA 1ZHBB 5JZ7C 4EKXA 3ILQD 3LS4H 4NNPL 4DKDC 4R97C 1WBXA 2G75A 3QAZB 3WEXA 2Q3ZA 1QRNE 1RZ8B 1QSFA 2R2CA 1EVTC 3C8DA 1T5WB 4Y1AB 4RSVA 5IV2A 1NEZB 1NAKL 3SDDD 4MA7H 3ZT5A 5KW9H 2HLFD 4ONHB 3WO3B 2CUMA 2JF1A 1IC1A 4LBEA 4DVBA 4JFFE 4OGXL 5SWZE 3TIDA 1AD9B 2AJSH 2H45A 3FN3A 2AK4E 2J3SA 3RWCB 4ZNCD 1U6AH 4PGDB 1NGYA 3H6JA 2Z8SA 4X4MA 4ZXBD 1EBAA 3D39E 4TN9A 3LHPH 3OXRB 32C2A 5KSBA 4Y5XA 2LAAA 4I0PB 3ZKQD 2MQ0A 4NDMB 3QDGE 1AXTL 3LD8B 3KPQA 3ZSTA 5E6IA 4E9LA 3IVKB 2VKWA 4M7JH 3CU1A 5BVJB 5J3HC 5C0IA 1XF3B 4Y4FA 5E03A 2C7UA 3T3ME 3BZFB 5GQBA 4WW2B 2XA3A 2E9WA 1FCGA 5L2JB 1XF1A 1GGCL 2ZJSL 4JY4A 2ARJB 4G6KL 4F3FA 4PJ9B 2C1PA 3KPMA 4Y5VB 1LO0H 1B4JH 4UIMB 5LXGH 2QEJA 1RZ8A 5HI5C 1FZKA 3CFIC 3MLRH 1E6JH 4TNWK 3UAJD 3D3VE 3DRTB 3QUKA 4JG1L 5I15L 2NY5L 5C0EB 2B1HL 5LQBL 2IF7A 4PJAA 5EU4B 3TN0B 1XCTA 1P1ZA 3BOVA 3C5JB 3HPJA 1J0YA 3B9KD 1MLBB 4UV4H 3WYRA 1WIPA 4XPGL 1QBLL 3BISA 2OLDA 5E8DH 5GGSB 3MXVH 2XWBB 3W0WD 4MAYB 5E94A 1CT8A 1WAAA 1KCUH 4ZODA 3GEWB 3CVIL 1XGYH 2MJWA 4MDIA 1S7SB 1T0MA 5IOPB 4P2QD 5TE6H 3R06A 1SMOA 1T0NB 3GJFB 3UXFA 5DYOB 2DI8A 4Z76B 2VLJB 1ONQA 4NUJA 1U8PA 5IHUL 3HC0B 2CH8A 3AU1A 1ZHLB 4KAQL 3NCMA 2OM5A 4F80A 3GMRB 4NQDD 2PXYA 3BGMB 3D2UA 1DCLA 4KUZL 5IVOA 3K7UA 1G9NC 2F15A 4X4ME 4P4RB 4DGVL 43CAB 3BSZL 5E0QA 1FNGB 4HQQL 1OAZL 2V2WB 4PRBB 1OP5K 4YHOL 4NSKA 4AL8L 1TENA 4JFED 3IS1X 4JRYE 5EBWB 2X4UA 4CL7A 4JDZA 1P2CA 3OKOA 3QYCA 4X6CB 2LVCA 2VXTL 1T89A 5L9DH 4QHMA 3IAGC 2NY0B 5GRJH 5B8CC 1TTGA 3IKKA 3EO9L 3DHMA 5EBLA 2FYYA 1A6ZB 3TVMD 1X5XA 1R6VA 4OZHE 2ARWA 5FDWA 1KG0B 4ODTH 3CMOH 3S96A 2E7CA 4GAJH 4NP4H 3HC0A 1EEUA 4TTDC 1RFDL 2P5WA 4YFEA 2J6EL 5DHVH 2ENSA 3FFDA 4JKWA 4LCYB 4LVHC 5EORL 3DV6B 2FDBP 1ZGLM 3DX9A 4X6FA 1ACZA 3QUXC 1ZVHA 3WDJA 2SEBB 1ULVA 3EYSL 3SGEH 4U1IA 2VZUA 3AGVA 2XG5A 5D8JL 2HKFL 4POZC 2CKBH 4IRJA 5IBLD 4FFZL 5DSCB 1QR4A 1G6RH 1WC7B 3CVHH 4GQ9L 2EZ0C 2EDLA 2BVYA 5ICYA 4Z7UB 2WBKA 5K9JL 4HCRH 3BPLB 2AV7B 4GS7B 2YWYA 1OOAA 4WI7A 3D85B 5H94B 2GCYA 4HX1A 1AFVH 4LK4A 1P9MA 1BLNA 5ERWB 2W65A 4R8WH 1SM3H 4KKBC 3WJJA 2KZ1B 1IAIH 2J4WH 4ZTPL 4NHCH 2ICWB 1JCKA 3DMMC 4I5BA 4JPVH 1A6VH 5CBAB 3WKNA 1MJ7L 1RUMH 3F5WB 3GMPB 2EEAA 2GFBA 3DNKA 1BD2E 2EXYD 1CVSC 1JWMA 3VH8A 4HGMA 3PDGA 1L0YA 4JDZB 1AR1C 5GGVY 3OL2A 1UADC 1N5AB 3KLDA 4PFEA 5ANME 2VZVA 3PHOA 3ARBC 1B3JA 4K3HA 4ZNEE 4JPKL 4Q0XL 6FABH 1MVUB 1VHPA 4J8RA 4O5LH 3Q1SL 4Z7QF 5D5MB 3EDKA 4CNIB 5C6PB 2J5LC 1A4KA 2VC2L 3OKNB 3NZ8B 4YDJB 2X2YA 3G5YB 2NY6D 1U8OA 4KZEH 3ARPA 1I85C 4XBEL 1Y6KR 5F9AC 3WLWD 2V2XB 5GS0L 4F7EB 5CCKH 3VXNA 1YZZA 4AEHH 3LKQB 1KULA 3S34H 4G6ML 5JR1L 2VMFA 4GW4A 3W82A 4JKKA 4D0BA 2YRZA 3QNXB 5HPMB 5LQBH 1VGEH 2GJ6D 5JOPD 3LB6D 4IRSB 2AJSL 2YPKB 4JQXA 4JCLA 4OSUH 3ESUF 4FQ2L 4P2QA 2BDNL 4D3CH 2P5WE 5F9WB 5C9JB 1VFBA 1X5AA 4XWOD 4UOJA 1IAOB 4L3EA 1DEEA 4M02A 5KS9F 2FR4B 3MRJA 2PXYB 4MNGB 4HIEA 4KKNA 1DVFA 3D87B 4Y4HB 4ETQB 4HT1H 4E41B 1UM5H 3C60D 3QNZA 3RVTC 3A0OA 4CW1B 4QHNB 5DYOA 2FHFA 2AJVH 1CLZL 1YPZE 3W9EB 1ZT1B 2EH7L 5C09E 1X9QA 4NFCA 3H42L 3GJFH 3RKPA 1UM4H 3TBTB 3NBNA 2C1PB 3KYMA 5F3HB 2VISA 1T66C 2GSIB 3NFPB 2A9NH 5CJOH 3KXFA 5DJDB 4MD5A 3MRHA 4GAYA 4NBZB 2FSEA 1I8MA 1BGXL 4ZQKA 5JTWA 1IGMH 1LP9B 1W8OA 1XF4B 5B38B 1WJ3A 4P23C 5T5FH 4D0CB 2PR4L 4YUEL 1A6TB 2DLIA 2G9HB 2WW8A 4GW5B 4GMSL 4YHZH 2CSPA 2OL3H 5DRZA 4BQ8A 3IDIB 3FL7A 4F7EA 3ARGA 4P4KD 2ICWJ 2CKNA 5D93B 4KZDH 5IVNA 1OAUH 4X5XB 5HYSA 2XZAL 3A67L 5EFIB 1RJZA 4V1DE 4RFNB 2ZSWA 4LU5H 3TJEH 1CR9H 1MAMH 4HFUL 4N0YH 3H0TB 2YKLH 4U1LB 1S7TA 4WWKB 4OQTL 4JO1L 3SJVA 2V5TA 3KYNB 1XIWB 5DK0B 1AY1H 1CCZA 1JIBA 1S7QA 4MAUH 4J3OC 2C3GA 1R3LA 4PJ5D 1G0XA 4F9LA 1ORSA 2R39A 5HHME 2NY4B 3KG5A 3RZWA 2X70A 4NZRH 1X3DA 3D0VA 3ELAT 2X4SB 4QRPA 3I02A 2X42A 5TQ2H 1X5FA 3IVKA 2AJ3A 3SBWA 1WEJL 1AKJA 4IOIA 3RWDB 2R0KH 3TC9A 4ZPTA 4I77H 3ULVD 2EE9A 1HDMB 4B50A 1S7XB 5GRUH 1XIWA 5DK0A 3LEYH 4XAWH 4KTEH 1JPFB 3DSNA 3HZYA 1FO0A 1EEZA 5SX4H 1X5GA 1DSFL 1TCRB 2FJHA 3SE9H 4KQ3H 1EFXB 3ISWA 2DQGH 4NNXA 1OW0A 4I3GA 1CFNA 5HGBA 2GJZA 1AO7B 1VESA 4GXVL 4RMTA 1KCKA 2HJKB 3EJYD 5SV4A 4P2OA 4WEBH 3QEQB 4YBLB 1KELH 3MRNA 1I8KB 2ADFL 5BRZE 2QQLL 3OKMA 4K9EL 4RGND 1FFPB 5E6IC 3IJHA 3TGXA 4PB9L 4YX2L 1XCQA 3MRGB 4PYHA 2LU4A 4U6HB 1PX4A 2JK5B 3U0TB 4X7CC 3NH7H 1BECA 1X7QA 4TSBH 4OF6A 3ZDZE 1DFBL 5A2JH 1MIEH 3QHTC 1KB5H 2HMID 2ZUQC 4TRPH 3VXRD 3VMNA 2NXYB 4NQUA 1A6ZA 5I76B 3ZE1F 1ND0A 2FLBT 2FBOJ 4XPTL 5SX5K 5JW4R 1JZ4A 5AZEH 2PW1B 4FQXC 5DJXA 1ADQL 3VCLB 3AROA 5FHBH 4L8CB 2BOBA 4LSUH 3FFCA 1QSZA 2BVEA 2BY3A 1XGRA 3UTQA 3KS0J 4GO6B 4KZEL 5D7JB 3FTGB 1BBDH 4IMKC 4ETQA 4OGAD 1NGZB 3KDMA 2NX5E 3LPWA 1OF2B 4ODVL 2FLRT 1FFPA 5MERA 3VFSB 2NXZD 5HI4D 2W9LA 1G84A 3O3DB 3BDYL 2HLAB 4NQEB 4WV1A 1CDUA 1UENA 2VOTA 4HZLB 4L4VE 3SKNA 3HC3H 1UM5L 3OWEA 1U8KA 1I9RL 3P3YA 2KL6A 1NDMB 4GG6A 4DKAA 2MMXA 5L8LB 1M71A 2YD8A 1Q94A 1C16A 3MTRA 2X89A 3GI9H 1J5OL 5C0DB 1QA9A 3LN9A 5F7WC 3SGJA 1C5DB 4FHBD 1E27B 1KOAA 2Z93A 3WIHL 3VXSE 1IAIM 5I9QB 4KPHH 5DUBB 2NW2B 2CR3A 3R8BB 5EU3A 4P5MA 6FABL 4UINL 3RWJA 3KPNA 2XPGA 2FJGB 4G9FB 4OGAC 2IFGA 1A14L 4P9MH 2NX5B 3SDCA 2XNAB 3BP6B 3QULA 3C09B 1I1AB 2JJSC 1G7LB 2UZIL 5J6HA 1S9KC 5D2NE 3BKCH 1S7QB 1N5YL 4UIMA 3JWNC 2X6MA 3O9WB 3O6ML 2FECL 4XP9L 1MFCH 4CMMA 4P23A 5DFVD 2FJFB 5FV1L 1K8IB 3GSUB 4I0CC 5JMRA 3C6LB 3MBXL 3TO4A 2VH5H 4HJJH 4GQPH 3TJEL 2Y36L 2NY4C 5F7FA 4H5SA 1CDYA 3D18B 3BRFA 1V7ML 5JQ6L 4ISVA 1TMCB 4BH8B 2DMBA 2WBJB 1CK0L 2F8XC 2DJSA 5DF0A 4D8PB 5I71C 3VDCA 4IJ3B 4X9IA 4XMKH 2R2HB 4D9RD 5GIRA 1YYML 4JFDD 1FZMA 1L0QA 5ITBL 3SY0B 1W0WA 3FCTA 3V6OA 5C09B 4X80H 1K85A 2VDOH 4KVNL 4JEGB 3QNYB 3SKMB 5L7XL 3DJ9A 1LEKB 1YMMD 4UQ2A 3PGDB 5A16B 4K55A 4MAYA 3MUZ1 2YPVL 4X9FA 4M9OA 3JWOC 4M1GL 1FSKB 3MLXH 1X5ZA 1EX0A 3VE0B 3WNNA 4MD0B 4M4PA 1F11A 4CJ0A 2W9DL 4GKSA 3WUWA 4C57C 1JVKA 3DI2B 4XB8A 4O2CB 4XCYB 1SBSH 1J0HA 4KK6D 4A6YA 3TZVB 4G6FD 4J6RH 4GLRH 3QHFL 1HHIA 3CFJB 1RZFH 4POZD 4XAWL 4AH2A 3SBWC 4RRPA 5CLTA 5F1OB 2EZ0D 1T4KB 1NFDF 1QFUH 3H3KA 4KJWC 3I2CH 4P5TD 4UT9H 3TYGL 1RIVL 3QDGA 1SYSB 2D31B 4LSQL 4XNYH 2RFXA 1V7NH 5CKAA 1T5XB 4K9EC 5D1QA 2W1NA 5I1EL 1C5CH 1JPGB 1RZGA 2QQKH 1F13A 4QHLA 4WY7L 5FAAA 4OCYL 4D0DB 1KTLB 1ZT7B 5FM5M 1MRCH 2K7QA 5KN5A 5IF0B 1JHKL 1KLGB 2IH3B 5ANMB 1R3IH 3KAAA 1T1XB 1KLUB 3Q3GA 1IKFH 3SGDI 1I9JL 1OL0A 1QSVA 2RR3A 3IB4A 2FL5A 3GRWH 4M5ZL 4N0RA 4OD1L 3V5KA 3P0GB 4U1JB 4TSCH 4OFPA 4PJ9C 1FYTA 3U7WL 5CEYB 4O2FA 3KJ4B 3GFUA 5IQ7L 2BSSA 3V0WL 1KEGL 4XMLH 5KSAD 2VO5A 1U8MB 4Z77B 3PWNA 5EU5B 2NY6C 2A83A 5KVFL 2RCSL 1TDQA 2XN9B 1MFBH 2WIIA 4P23B 4EOWL 2DQFA 2R69L 3GSXA 3MV01 3IF1A 1K2DA 3GMPA 4AK1A 4ELME 2EDWA 3A6OA 1R3KB 3KGRA 5GZOD 4JN1H 1OAUL 1RUKL 3ME0A 5FYKL 4JG1H 1YY8A 4TPRH 3IDJB 3DOSA 2XTJB 4KMQA 2YD3A 5J7CC 3EO0A 2B1AH 4R4BB 5TE4H 1XR9A 5B39G 4LSTH 1NAML 4G9DA 2AERT 5DC0A 1I1FA 3DVIA 1H3XA 5HHOB 1HI6A 3KYKL 2EDXA 3MV8E 4H8WC 4MAUL 2BC4A 5F1IB 3WN5A 1OP3H 1NAMA 1A4JB 4WGWB 4M6NL 1EIBA 4X7FC 2OXGA 1QBAA 2P5EB 4YJZL 4KI5C 4NUGH 3FHQA 4JQVC 5C0GA 2R0LL 4O02H 1Z5LA 2DQJH 4WWKA 4M6MH 4FQJL 5EU6A 2ZOLB 2R4RH 1QSEB 1IM9B 1T1YA 3MBEA 4MNHB 1R24B 2Z31B 4MCYA 5SWZD 1FVEA 2BVOA 3MV8B 4HJ0D 3UJTH 4R4BA 1CE6A 3Q3GB 3MLSH 4ZUUB 3HNSL 2WNGA 2F19H 3CLFH 3T0EA 5GZOC 2XKNA 1JTPA 4FXKA 3JVGC 1ZLWK 3RY6A 4NHUB 4G8EA 4Y4FD 2P5ED 3GHEL 3LV3B 5DD1H 2XKUA 1ZHNA 4BZ1L 3KS0H 1ZWIA 2X4UB 3IDGB 5GGTA 3ES6A 2HFFB 4OT1L 2AJUL 4DCQA 1OSPH 5CP7A 1JYXA 1I1RA 4FMKA 2VXTH 3HC4H 1GCFA 2XN9E 2Q7NA 3HE6B 5JQ6H 4LF3A 3QFJA 4PJFA 3WUWG 1LE5A 3MRIA 4GLRI 2Q1EA 4YC2B 1NEZA 3VFWA 1NGPL 1FBIH 5EWIH 3WFBH 4PG9A 4HDIA 1ZT1A 4N8PA 3ZLQC 4Z76A 1LP9F 4ODHH 4CN1A 1U58B 3IDXH 1B88A 3IU4H 1EVUA 2NY2C 3RVTD 4XNZB 3GMOB 4YHPB 3U0TA 2FR4A 2HYMA 5IR1A 3GSWB 1YC7A 3R06B 4JQIL 5I9QC 5DMKB 4YXKH 3CX2A 2OTUB 5L0QC 4HPYH 1RHHA 2NXYC 3I3EA 1NCCH 3OX8B 4Z7UE 1P1ZB 3MZTA 3OF6D 4XXDB 3GM8A 2N56A 4MA7L 5C09A 4R2GB 4OUUA 3LKNA 3LQZA 5K9JH 3A6CH 3LPFA 4RWYH 1M7DB 2AJXL 4PJDB 3RDTB 2QADC 4DTGH 5BOPA 4GRWB 4WI9A 1CGUA 2EEDA 3HCVA 1YY8B 3N0PB 1T04A 3ARRA 4XWOC 2RQ8A 3KPSE 3SDAC 3W0WE 4BELD 3WNMA 3OKLA 3CFBA 4QWWC 4WDIB 4ETYA 5T3XE 2VN4A 4ODXA 4JZOB 1XEDA 1AI1H 1RUPH 4PJXB 1IGJA 4PGJA 3FQRA 3GSQB 5D7KE 3BP5A 4P2QE 4XCEA 3I02B 1DTUA 2VZSA 5EU5A 3V4VL 2XZQH 4OLZH 1EJOH 3QH3A 1YYMH 1OP3K 5ITBH 3QB7C 4AG4H 2X70B 1U0QA 2EE6A 3DYMA 4JGMA 4YFLF 4EDXB 5ITFB 3P9LB 1TCMA 1NC4A 5EU7E 1JPSL 3U1SL 4M7ZB 4MJ2A 4NN5B 1N3NA 5C7XH 4KDWA 1BFOA 4EDWL 4F7CA 3ULVH 5HDQL 1CGSL 3CFDA 2E7BA 1EGJH 5DDHA 4LLYA 3WIIH 3RHWK 1FRGH 4UQ3B 2VAJA 4L1HA 4KDVA 2BXZA 3LKPA 3S36L 1NC2D 1HINH 1KG0A 3E2HB 2WWKT 5I73B 3H7LA 5D1ZD 1ZTXH 5EG6C 3RL2B 1IM9D 3FOLB 4AQ1B 4JY6B 3MRBB 1NCWH 4IRSC 3UBXB 3N85L 1MCCA 3O4LA 3LKOA 4GKNB 3LDBB 1M7DA 4RCAA 4CVWA 5CFHA 4JRYA 3SKNB 3PHQB 1FIGH 2A6IB 4NQDE 1JI1A 4Y4HC 4X4ZA 2CUIA 1BIIA 1YN6B 5B38A 2ZUUA 4XNXL 5J9PB 1ZSDB 1KCRH 2Z31C 1S5HA 3MR9A 2XZZA 5E9DB 3H9SA 1WFUA 3HFML 1A1OB 2HVJB 2NYYC 3BP4A 3UPCA 4DFIA 3KYKH 2EC9U 3T0VA 3KPTA 4IJ3C 4JR9H 1BQLL 1Q9OB 4KKCC 4WUUD 5SWSA 4NO3B 3CFBB 4WDIA 5I1HL 1U3YA 3FZUD 1JZ7A 4PTTB 4I18A 4QHKI 4JGJA 3W39A 3CVIH 1MI5E 3EHBD 3GGWA 5CWSA 3WN5C 2EDBA 3E6FB 4BKLB 4NZUH 5TDPA 2VWEE 2IQ9L 5IP4A 3OXSA 4TSCL 5L6YL 4WNQA 3BD4A 5ETUB 5DMYA 5KSVB 1LO4L 1GGIL 1FC1A 4M03A 1G7IA 5E5MA 3MBEC 4WFGE 4XAKE 4L4VB 1P7HL 3TCLA 1QLFA 5ADPH 1A5FL 2H26B 3AXLA 3QUMH 3RPKA 4KUZH 3BJ91 2V7HA 2X09A 4YDLB 1EHLH 4GRLD 5DJ2A 4GW1B 2F54B 3F7RA 4LHJB 4Y16D 2XZAH 1BM3H 5E4EC 2AJUH 2WK2A 4X0KB 4A6YH 3OR7A 3MRPB 4FZEH 1K4DA 1T1ZB 2VXUH 5TGBA 3FONA 1PJ9A 1XF2A 4O51B 1CQYA 3G5YA 5IEHA 3GIVB 4CU8A 1UXSB 1HSBB 2P8MA 1I7UA 1KXQE 2BVPA 1LQSR 4ZSOB 5C70A 3Q1SH 4G7YH 3RJDA 5I8CA 4YFDB 3WLBB 1CLOL 3B5HA 1HNGA 4H26B 5ICXB 3CDGA 8FABA 5FO8A 4X98A 3O11B 2EIZA 4QNPE 5HHOA 2P49B 1MCIA 4OM0H 2HFGL 4HWEL 1C5DA 4PJBE 1F4XL 1FZOB 4JAMA 5CIPA 1MJUL 5F7NC 3DGCR 5EOTA 4LARL 2GHWB 4MGXA 4RGNB 4M61A 3BDBA 1RJLB 3JWDC 5C1MB 3TFKC 1AO7A 3G6DL 4OLWH 4CVXA 3BPOC 4RX4D 1BPVA 2IAMA 4GG8B 5IVXB 3P30H 2GCYB 4I3SH 5DQJB 4LCCB 2VR4A 5D8JH 5HJ3A 5ACZA 1YNKL 5DI8A 5EZOH 3PNWB 2CDGA 2NZIA 1JNJA 1QHPA 4EUPG 4M5YH 1SJHA 2QQNH 43C9A 4ACPA 2I07A 1MCRA 4PGEA 4N0YL 5D1ZA 4U6XA 5EBMA 4EOWH 1J0KA 3BZFA 2E9JA 3GIZH 3RBSA 4OZIF 2D4FA 1V3KA 1XAUA 3RRQA 1XR9B 1U91B 3U0WL 5IB5A 2ZG1A 1II4E 1UZ8A 1DBAL 5E99L 5AZ2H 2GJ6A 4RWHA 1G7PB 1MHHB 4N8VB 2B20A 4MDJB 4O5LL 4H26A 2EDYA 2B0SH 1PYWA 5I76A 2OL3L 1DN0B 1J86A 2I9LA 4LLVA 2FGWL