5KVEH

Zika specific antibody, zv-48, bound to zika envelope diii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
b'QVQLQQPGAELLKPGASVKLSCKASGYSFSNYWMHWVKQRPGQGPEWIGMIHPNSGNTKYNEKFKNKATLTVDKSSSMVYMQLSSLTSEDSAVFYCARLGNDMDYWGQGTSVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZIKA Envelope DIII
publication title Structural Basis of Zika Virus-Specific Antibody Protection.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2016-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kveH00
4GKNB 4PJBA 4R2GB 2IBGA 1RUKH 5LJYH 3KS0J 4OD3H 5FO9A 4P2OB 5KVFH 4CJ1A 1ORSB 1AGDB 3QI9B 5ID1B 5D2LE 1CFSB 1DL7H 1I9JH 5DI8A 5DJ8B 3UJIL 4G5ZL 5C0DB 1T66C 1LK3H 5IESL 4XMPH 4GXVH 3U0TB 3QDGA 5I1EH 2HLFC 2I9LA 2DQEH 1UJ3C 1GGUA 4XPTH 2R0KL 1KENL 2YD4A 3MLZH 3GSUA 1I9IL 1S9XA 5SWSA 4ZPVA 3P4MA 1JE6A 4WI9A 1NC4A 4JFDD 5F89B 1OSPH 2Q1EA 4BZ2L 4KQ3H 5FO8A 3GBNL 4K8RC 2UZIH 1SBBA 3OR7A 4NUGH 1INEL 3HRZB 4OT1L 5K9KB 3H2WA 3GMOA 1IKNC 3ZDYF 5HVWA 4L9LB 4K2UL 1SM3L 1FIEA 4X4ZA 2V9TA 3D2UD 1E6OL 4QOKD 4KZDL 3ZE0E 4PUBH 1OTSD 3IDGB 1CXFA 2BVPB 1FBIH 1XF2B 4R7DA 3FB6A 2YPVH 4RFNB 1EVUA 1UB5A 3LSOB 4QT5A 4TUOB 4HUWB 4XP9L 3L3HB 4HKXA 5JPNA 1A64A 3DPBA 4S0SD 3ZZ1A 3WFCH 1ZTXH 2A83A 1CF8H 2VDNL 4HZLA 3D3VA 2VIRA 2BDNL 1O7VA 2G9HB 5KN5B 1NLBL 2ZJSH 4S10A 4X6BB 5F21B 5TPWH 1L7IL 4AIXA 5JIPA 2N1KA 1BJ1J 2I07A 1FNHA 5HPOA 1N4XH 1D5BA 3QDMD 4L3AA 5L88H 2HH0L 2OZ4L 3ULVC 1FJ1A 4NO2B 4NWTL 4GG8A 2GJ6A 4Y2OA 3KXFA 1JHKH 1PKQE 3MOAH 5E9DB 3GSQA 3SGJC 4WFFE 5IROC 4PJCE 3GNMH 1Q1JH 5EBGA 1NAML 4P2QE 5K9QI 1ZHBB 1N5AB 5EOCH 3MYJB 2IGFH 5IIEA 3TBWB 2DLFH 5ITFB 4DVRH 2ZOLB 1OW0C 1YJDC 5DVNA 2ORBL 1HIML 5TDNA 1CDGA 4LQ1A 1FAIH 4Q58C 2Z93B 1C1EL 4MQSB 3U7AA 3WKMH 3KPNB 1FO0A 4U6HA 4D94A 5I1GL 3D9AH 4R0LB 2R4RL 4GS7C 4KKBC 1IGML 3NACL 2DLEA 5EZJA 4IDJL 3ROOA 1OHQA 3TJEH 2E9IA 3BESR 5HTSA 5DLML 4PRIA 2Y6SC 4DFHA 3TGXA 1A14H 4JFHD 3LRSB 5GSVB 1ODAA 2F19L 2LQRA 1J8HD 2HRPL 1OGAA 1XR8B 3BP7B 2XTJB 5E0QA 1P7QA 4LPYA 2D7TL 4AL8L 4Y2DA 4NP4L 1GGTA 4N1CA 5FM4A 3G5YA 3KR3L 1A8JH 5C0GB 1EBPA 1NGZB 5HI4C 3FQXA 1A7OL 1GPOH 3EOYG 4RDQG 1CLZH 5ANMA 3VWJB 1QPXA 4RFOL 1A4KA 4L8DB 3MO1A 2BSED 1R5VA 1P53A 3MGAA 2AEQH 3GMRB 4NKMA 3QIWA 1CD1B 4F57H 1I85C 2J8OA 2VDLL 43CAA 3IDUA 3W0WA 4EI5A 1OGTB 2IPTL 3C6SA 1HH6B 1K4CB 3FT4A 1RMFL 1BZ9B 3KJ4B 2NX5A 2XG4A 1OAXL 2B1AH 5DHYB 3KLHC 1NBYA 3H9YA 2C3VA 4YWGL 4U1JA 1CFVH 1LNUA 3BP5B 4OF8A 1DBBL 2HKHH 3QDGD 4OZ4B 4GOSA 3LHPH 4PLJC 2P42B 4WCYH 1T1WA 2Y1VA 1T1XA 3BKYH 2AK4B 3WIFB 5MP6L 5SWSD 2F8OA 3MLUL 1NC4D 3U7WL 2JJVA 3IXAA 4KI5F 4FFWD 3EYQD 4FTVB 4UILL 3GSWA 1A0QH 1BX2A 1PKOA 1AGEA 4NQXB 1ZLSH 3QAZB 1ORQA 5IV2A 5HDQH 4NM8L 2HJKA 3D48R 4J4PD 3QFJE 1ZLVH 1M7IB 3QR2A 3NCMA 4F3FB 4GKSA 1EXUB 3BO8B 2X40A 4YHYB 5KSVB 1CDCA 2CRIA 4H26A 1FE8L 1EVTC 3LEYL 1AXIB 3QULB 4K9EL 3VI3F 3G6JA 4NT6A 2VISB 3AU1B 3BXNA 3QRGL 3FB8B 3HN3A 3D3VD 5F9JB 3ULUE 3Q5TA 3AY4C 2HT2D 3C5SA 3RX8A 2CKBB 4N0FB 5I16B 2R0WL 5A16A 2LABA 5HYJE 3FOLB 3OKEA 4MX7A 4AENB 4QTIH 3MRDB 3A67H 3MYZA 4OZGE 1UKQA 2C4FT 2GJ6D 3VI4E 4P57B 1KNOA 2MMXA 3KXFD 1KPVA 4KJPD 2QQQA 3MRCB 1NCCH 3LIZL 4OJFH 5DJ2B 4LLWA 5IWLA 7FABH 5ID0B 2V2WA 2DIBA 2HT3C 1UZ8B 5BO1L 1RUML 4XP6L 2NNAB 4XPBL 3NIFF 4HIIB 5D2NB 5IVXE 2JELL 3D2UB 1HYRC 3L5JA 1SMAA 5IVOA 2DN7A 4I1NB 3HNSL 2FR4B 1Z2KA 4KVCL 2MPAH 1A6VH 4ZOAA 1N0XL 1JN6A 1NEZB 1C12A 4QYOA 1S7RA 1B9ZA 4U1MA 3SDAC 2JJTA 2ICEB 2P5WA 1ZANL 1IEAA 2E8YA 4K7PL 4LSTL 1HHHB 1ACYL 4JZJC 2FIKB 1KJ2L 5DD1H 1B4JH 4ELMB 5FM8A 5L2KA 1P7QD 1RJLB 5HDBE 1MI5B 2AV1A 3HR5A 3T08A 1HDMB 4XMKL 1PY4A 1KTLA 4JN2A 4Y2DD 1L4IA 4MWFA 1KC5L 3FT2A 5DYOB 3ESVF 4PJ7B 5JW4R 4L29B 4NOBA 5D93C 2GK0B 3DOSA 1J87A 4YHPB 3WN5B 3QQ4B 4TPRL 3S4SA 1IGCH 4Q6IC 3ZT5A 1T83C 1N3NB 4WHTB 5ITBL 2YK1L 1IC4L 3AFLA 3RL1A 1U8PA 1P4LA 1YNLL 5C9JB 1A6TA 3MLRL 1BQHG 5I9QC 1UQSB 5L7XL 4PJEA 3VXNA 3W0WD 1T7VA 4EI5D 5K59F 1DLFL 2QSTA 5DRXB 1QLRB 1WBXA 1R5IA 1J0YA 3GI8L 3H9HB 4ONHB 2HMIC 2NXYD 1LE9B 2BVOB 5EC2B 2R23A 3OR6B 3ULVE 2VLJA 1VB9A 3PWUA 4HUUA 1WAAE 2XNAB 3MLTB 3PP4L 4L4TE 4ZTOH 1J8HB 5I74C 4DW2L 5F6HI 4NNXA 5A3ID 5T3ZE 2ED8A 4ZOEA 4NPYA 2C3WA 1JJUA 1G7PA 3RKPA 3CPLB 2Q20A 4YHNB 1N6QH 4ODTH 4J3WA 4K71C 4DGVH 2VC2L 2W59A 4MQTB 1YN7A 1A1MB 1H8OA 1I75A 1XEDA 3CXDL 3T4YA 5CSBA 3KPPB 2VITB 4IS6A 4WUKL 4LHQB 4XCYB 4CN1A 2PO6A 25C8L 4Z77B 1RZKH 4FRWA 1NSNH 1P4BL 2P7TB 4G43A 1U58B 4FP8H 4L3EE 4GG6B 2XN9A 1GYAA 3QUZA 5EC1A 4ESKA 5M95B 1VKXA 4WEBL 2QKIA 4M1DH 5GS2D 3ILPA 4PJBB 4XX1E 1T03H 2BVUA 1TENA 5SX4I 4Y4KC 2P47B 5DD0L 5FO9B 2FYYB 4XC3H 1U8QA 1X5FA 5FAAA 2CLRA 3KPTA 5TDOA 2ITDA 2HYMA 2CLVA 1OAKL 2OR8A 4DVBA 5ESAA 1BEYH 4QLRA 4P4RA 2EECA 1OWWA 2ZUQC 1KF9B 2R29L 3CFKA 3QDGB 5HHOE 1X9QA 2I9LB 4YUEL 4Z7OF 4WWKC 2QBWA 4HBQA 4POZC 1XIWC 3GSUB 2NY4D 1S9XB 5SV4A 4NQDA 5SWSB 4ZPVB 3P4MB 3GI9L 2MHAA 3FTGA 4OKVA 1NC4B 2B8OT 4WEMB 3HZMA 2CLZA 5FO8B 3TC9A 2A77H 3JV0A 1U3HC 1BZQK 1CD8A 3OR7B 4XWGL 5C0AD 2VDQH 3GMOB 2EDTA 2X05A 1A3RH 4DUXA 1BREA 1TVDA 1Q0XH 4JHAH 1U3YA 1MCWW 2ENYA 4Y5XC 4UBDD 5HY9A 5E7FA 1A1NA 5CGYC 3GHEL 2A6IA 1WIUA 1BD2E 1L0QA 4R7DB 1GCFA 3FB6B 1BIHA 3CFCH 5F7DA 1UB5B 3D39E 3O41A 3OQ3B 3NFSH 1A9EA 1L0YA 4QT5B 4DKDC 5TH2A 4HKXB 5JPNB 1XGUA 4ETYA 2P5WD 2A83B 5KTEL 4HZLB 1ZLUK 3D3VB 2VIRB 4YZFE 1SEQH 4F9LC 5DD6A 5CKGA 4U33A 5D8JL 3RVWD 3FONA 2R4SH 4XZUA 3OV6A 2I07B 1Y0LA 1XAUA 3CDYA 1D5BB 5F3HA 1FJ1B 4GG8B 2GJ6B 3KXFB 1TJHH 3GSQB 1N64H 4R96A 2EC8A 4EOWH 1U8NB 4LHUD 5EFIA 1MCHA 1FH5H 3DMMB 2EXYD 5F9WB 5DZLA 3BWUC 5IIEB 3G6AA 3MRGA 3BT2H 2FDBP 3D18B 4TULL 3DJ9A 1Q9OA 3WL9B 2ADFL 5TDNB 4KJQC 3K2MC 1EZVX 1K5NA 3NCCB 2OR7A 2NXZC 4M6OL 1FO0B 4DK6A 4U6HB 1BJ1H 3IDXL 2VH5H 3T0WA 1WQVT 4JRWA 3RZWA 4NKOA 4NQEE 5ALCH 5EZJB 3ROOB 1OY3B 1NDGB 4EI6A 2PXYA 5EBWA 1G0YR 2IG2H 3U0WH 4PRIB 1EGJL 1FLTX 2VLJD 2IFFL 4XVTH 2VAAA 2VNCA 4G3YH 5DTFA 4QHLA 1OGAB 3WXVL 1ZGLP 4QHKJ 3PL6C 4TUKL 2LFGA 1OARH 1EO8H 1P7QB 1PKQA 2OI9C 3FRPA 4Y4HA 2CJUH 4XPFH 3BMVA 4Y2DB 6FABL 4I3RL 5F72S 3MRNA 3G5YB 4P2QA 1RZKC 4FFVC 4OM1H 4ZAKC 4NGHL 1FG2A 5H37H 3ARDC 3FQXB 3GBMH 5ANMB 2PO6D 2J3SA 1A4KB 3QHFL 3MO1B 4WHYH 1R5VB 1MFAL 2XN9D 3MA9L 4YH6A 1N5YL 3QUZD 1OP5H 4BUGA 2IAMA 4NKMB 2XRAL 5JORA 1H3PH 3QIWB 1R3IL 1KCVH 43CAB 4WEUD 2DQHL 2ED9A 1S9WA 3W0WB 5DD5L 4EI5B 3CXHJ 3PHOA 2D03H 1U8KA 5E8OA 3B2VH 2X09A 3IFLH 4KKCC 4TUJA 3FT4B 3BN9D 3RPIA 2NX5B 5EU7C 5CIPA 3BVNA 2XKSA 2BVTA 1NBYB 2C3VB 4U1JB 1WT5C 3ES6A 4R4FL 4JJHA 4YC2C 1LNUB 4N9GA 3UYOD 5MHSD 3I6LD 1T1WB 1T1XB 1I8MA 4NQDD 3Q48A 4W6YB 1UZ6E 2CR6A 5F7WC 3IXAB 1RUPL 3QQNA 4PJGA 3GSWB 1BX2B 3JZ7A 1AGEB 3VXRD 2O61A 5C3LD 5B21A 4HBCL 1ORQB 2R0LH 4JHWH 4PJFE 5IV2B 2HJKB 1D5XA 1IKFH 1HSBA 2XT1B 3KLDA 2NY3D 4OLZL 3QT2A 1DVFA 3KJ6L 4GKSB 4GBXA 3DV4A 3CSBA 4IJ3B 3WD5H 1CE1H 1EEZA 4LEOA 1JNLH 3WUZA 4KUZH 1CFQA 3TWCL 2JJSA 4H26B 4HX1A 4UOW0 5HDOA 4FQXA 3BPCA 5KVFL 1QSEE 3G6JB 4PTTA 4NT6B 1IBGH 3BXNB 1XF5A 5FDWA 1MJJA 2IPUG 4XVUD 4XNXH 1I9JL 1MHPH 3D69A 1TCMA 1LK3L 4Y16A 3C5SB 3QEGH 4JQXC 1A7RL 4XMPL 5IMOA 5I1EL 1KJ3H 1MVUA 3TFKD 5A16B 2DQEL 3MNVB 4QWWC 4PJ9D 4XPTL 3OKEB 4MX7B 3MLZL 3V5KA 5ISZA 2YKLH 2QQLL 2NY4B 4OZHE 4OBSA 1KNOB 4BM7A 2YPLE 1KPVB 2ZKHH 4ONGL 4MVBD 5GZOC 3QFJA 3DYPA 1U42A 4KQ3L 3TJHC 3MUY1 3OBAA 4LLWB 4NUGL 1DCLA 3TP4A 2V2WB 3LH2L 2ICWA 4XNYL 4S1DC 5A40E 4DKEH 4XTRD 1X5ZA 3AB0B 5GS1C 4M7JH 4JDTL 1FBIL 1A6UH 4H0GA 5BOZG 5FO7A 4JREC 2W65A 1JN6B 1C12B 4QYOB 1S7RB 1QHOA 4LCIH 2AABL 2PXYD 4U1MB 3DARA 3RY6A 1NBQA 1ZTXL 1QACA 2P5WB 1IEAB 3T2OA 1U3JA 3V95A 1OTTD 2VXQH 4E0RA 1KPUA 1J0KA 4FQIH 1DBAL 1DANU 4P5MA 1VGKA 2D4DA 3IF1A 5L2KB 1N4XL 1ZT4A 1FPTH 2AV1B 1LP9A 3HR5B 3R06A 4GH7B 5JXEA 4PJHE 1KTLB 4JN2B 3PXJA 4MWFB 5H8DA 4DGYH 4YGVA 3FT2B 4P2QD 1HXYA 1JHKL 3CSGA 3MOAL 3HZYA 4JGUA 5I0DA 2ZSVA 3LPWA 4WGWB 1OD9A 5D7IE 3S4SB 1C7SA 3HC4L 2IGFL 3JV6A 3VJ6A 1IGJA 2DLFL 3QEQA 2ZCLH 1M05A 5CJQH 5IW6B 3BDBA 4G7YL 5AUMA 3RL1B 1U8PB 4Z76A 1P4LB 2IAMD 1FAIL 3SDYH 4P23C 1A6TB 1CL7L 3KHOA 4PJEB 4LPWA 3VXNB 3QJHA 4WTZG 2K9UA 3D9AL 5F70A 1Z5LA 4NZRH 4FQLL 2YD8A 4J3VA 2JE8A 4NQVA 1WBXB 1R5IB 3T65A 3TO4C 3CNKA 3HFML 2R23B 3GSNL 4K7PX 1YEDA 2VLJB 1U8OA 3PWUB 4HUUB 4OLXL 5IVZA 4WFHE 1JI2A 4H1LH 1KN4H 2EKJA 1HQRA 1Y18A 3CJJA 3CX5K 2NY6C 4NNXB 1MCQA 2HFFA 3K8MA 2YUWA 3UPCA 4NPYB 4L1DA 1G7PB 1H15A 4QHUA 3SDXA 4M4RA 3TESA 4R4ND 1UENA 3MV01 3N9GH 1GPOL 4I0CC 1YN7B 5CS7A 1PSKL 4LSVH 1NMAH 5B4MC 3VGDA 3T4YB 1YN6A 3RPKA 4IS6B 4YXLL 2XWJA 2PO6B 2DKSA 3LKQB 2UWEA 1DVFD 4G43B 1AD9A 3QUXC 4GBXD 5LCVH 2XN9B 5D7SH 3QUZB 3O3EA 1AGBA 5EC1B 1IEBA 3U6RA 1E27A 4MYWB 3UZEA 4F57L 4LPCA 1WSST 2WUBH 2ZUTA 1VKXB 2QKIB 3MXWL 5DJ0A 3ILPB 4UV4H 3CVHH 2JF1A 5C71A 1T22A 4FXGA 4HUMB 1U8QB 1JCKA 1RSFA 2CLRB 5TDOB 5IBLD 4HK0A 2DBLH 4XP1H 2ITDB 1WWAX 2YD2A 2B1AL 2X4RA 4KC3B 4TN9A 4P46C 5JW3H 4LSQH 2CLVB 4M6AA 4DVBB 5J56B 5ESAB 4JRXD 4P4RB 1KXTB 4KV5F 1RIUH 4O5LH 1MWAH 1KFAH 2P44B 5I6XC 5JW5A 3CFKB 4DGIH 5D6DC 1OW0A 2VLRE 3FO9A 4WCYL 3TV3H 1NUGA 4RFEA 4G7VL 4RWYH 5IP4A 3BKYL 4KDTC 4KMLB 1LVEA 2EDYA 2M2DA 4U6YA 5C0ND 3WSQH 5ISZD 2AP2A 2DF3A 3ARGC 3K4ZA 4QGTA 3MRLA 4NQDB 2MHAB 3TCLB 3FTGB 3QFJD 4OKVB 3BPNC 3HZMB 3ZDYE 4N90E 1ZLSL 2CLZB 4F8TA 1AJ7H 5HDQL 4L3EA 3C9NA 4H1LG 1MHEA 3MCLH 4TNVK 2XIDA 2NY3B 4YBLC 1S8DA 3QUMH 5HY9B 1A1NB 2NYYD 5EU7E 3LKPA 4C55A 2A6IB 5E4EB 1OB1A 1HHKA 3QCTL 3QZWG 2IANA 5CEZE 4JN1H 5AYUH 4HIEA 5F7DB 3RVXD 3O41B 1T5XA 2ZUYA 1DE4A 1A9EB 4OKDA 4Z7VA 4JQVC 5TH2B 1WUNT 3MRRA 1XGUB 3BDXA 3SE4A 5EIIA 5HHOA 2VZSA 1EAJA 5DD6B 4PJIF 3S35H 3IDYB 4G6JL 1LQSR 3FONB 5CZXD 4XZUB 3OF6D 2DM2A 1V7MH 2BNRE 1CGXA 3L3OA 3VXUA 4JKKA 1Y0LB 3S5LA 3EUUA 5JXED 1H3VA 5F3HB 4UDUA 3KLAA 3PJSB 3RVUC 1WLHA 4AY0A 1RURH 1HHGA 3QXAA 2P43B 4R96B 5FKAA 5EFIB 3WHE0 2AJSH 3SHSA 1MH5A 5JLZA 3QEQD 3UCRA 3G6AB 3MRGB 4Y19E 1DBKH 2P1YA 1BD2A 1FFNA 2IC2A 1P4IL 1U8MA 5DC9B 5FYJD 1T5WA 1HEZA 1K5NB 3O6KH 5FCUL 1A6VL 3T0BA 4FNLH 5TQ2H 4RAVA 1YYML 2VLKE 4NKOB 1NFDA 1AH1A 1WWCA 1OM3H 4EI6B 2PXYB 4OLYH 2PYFA 5D7LE 5EBWB 1F8TL 3MGOA 1GGBH 4APQD 3QXVA 3V6OC 3ORJA 2VAAB 2DBJA 3RNKA 5DTFB 4OB5L 5DD1L 2VTFA 1B4JL 4QHLB 1JI1A 3N85H 3DXAE 2MSPA 3FN9A 3UTOA 1PKQB 2BRRL 4R26L 4WW2A 4Y4HB 5JOPE 2GY7B 4FFZH 5HD8C 3MUHL 4P2QB 1EHNA 2X89D 5HGAA 1DDHA 1FG2B 5EULV 5GRVK 3BQUC 2DLHA 2JTDA 1IGCL 5C07E 5JW4M 2AJUH 3P9MA 2RAMA 4PJ5E 3AREC 5FV1L 4R97C 3DSFH 4NM4L 4JM2C 3DYOA 2BHUA 3H3PH 2B4CC 2Y5EA 3E3QC 5KS9A 2IAMB 2EO1A 2BRQA 5JORB 3UDWC 2PKDA 5CEXA 2Z8WC 1GC1H 2LAAA 1S9WB 1RVFH 3PHOB 1NGYA 1U8KB 2WSKA 5E8OB 5D7KE 4TUJB 3TYGH 4ZSOA 5IBUB 5T1DH 4UUJA 3RPIB 3C6LD 3PHSA 1MY7A 4PBXA 5CIPB 3BVNB 5T5FH 4M8QA 4X4ME 1IC5H 4HLJA 3DNKA 1CTNA 3LQZB 3QXWA 1E6JH 2FSEA 4FS0A 1I8MB 2KZWA 1BFTA 5I75C 2E7HA 3D25A 4ODTL 4DGVL 1RZJC 3O2DL 3M8OL 1NEUA 3VFPA 3FJTA 4PJGB 3W5NA 4RRPG 4HAGA 1IGIH 1KCLA 2KBGA 4HUNB 2O61B 3SDAA 1D5XB 4Y1AD 1HSBB 1NSNL 1QBMH 4WUUE 4XVJL 2XKNA 4G9DA 5EZLA 4FP8L 4L3CA 1DVFB 4U49A 3DV4B 2Q86A 4JZJA 4YDIH 3VI3E 4Q9RH 2RIKA 1EEZB 2CUIA 5IJKC 4LEOB 2IAND 4N0CD 1T03L 1CFQB 2VSCA 4HX1B 4F9PA 4FQXB 1CGSL 4YXKL 1SVCP 4PTTB 3EDEA 3MRBA 4FABH 1XF5B 5FDWB 1MJJB 5F7YC 4PRAA 1FFOA 3F58L 4LGSB 5BV7B 3D69B 2GSGA 5F1KC 4Y16B 1ZT1A 5DFVD 4MHHG 5IMOB 5K9JH 3VXUD 1MVUB 3QIUC 3BRDA 1RZIA 1WZ1H 1EFQA 4HJGA 5EA0H 3C2AH 4NFCA 1G7JA 3V5KB 2P49B 5GJSH 5ISZB 1AO7E 4J12A 5GISH 3ZKSD 1QFUH 3QFJB 5E24E 3QA3A 2A77L 2GIYA 3NIFE 3OX8A 1LMKA 4G9FE 2VDQL 1A3RL 1Z6JT 1Q0XL 4QF1A 1X5LA 5DQDL 2NY2D 4XCEB 3U46A 2BVEA 3CFJA 2QR0A 1PEWA 1QSEA 5DVMA 2F9BT 5FO7B 2W65B 3CFCL 3JWOH 4XPHH 4URTB 3NFSL 2R9HD 3MUJA 1MIEH 4X4XA 3ZDXF 3AGVA 3MBEC 3B6SA 1MCDA 4QRPA 5GGTH 5KSUA 4O02H 3SE3A 4XMLH 1IGYA 1SEQL 4N8CL 1JFQL 5I0ZA 4E0RB 1KPUB 1JPSL 4P5MB 3QNZA 1VGKB 4M8VA 3IF1B 4OZHA 5IM7A 1ZT4B 4TSBH 3O0RL 4YFLI 2NTSP 4MCZA 3R06B 1LP9B 3S97C 4HMDA 3ZHKA 2CDEA 2WBKA 5D1XA 2WBJC 2EZ0C 4YGVB 3LPFA 1HXYB 5EWIH 3RGVA 4V1DA 3HZYB 4IHOA 5KVMC 2VZTA 4EOWL 2ZSVB 1DSFL 1D5ZA 1FH5L 1P84J 4IIQC 2H8PA 4P3CH 2HVKA 4N8VG 3JV6B 5T3XD 5IVXB 3VJ6B 1JF6A 1IGJB 3BT2L 2JK5B 3QEQB 1M05B 4BH8A 4X6CF 4PPTA 5AUMB 4X9HA 2I60L 4Z76B 3ZO0A 5K59E 2OL3A 1I8KA 5BS0E 1TCRA 4GAYA 1S5IL 2R39A 5CHNA 5BXFA 2EO9A 4FQJH 4NC2B 1P1ZA 3GK8L 3QJHB 2VH5L 2BK8A 1UACH 1Z5LB 3LV3A 3TA3A 5I73B 4PYGA 4H8WH 2GEEA 4NQVB 1VEPA 5GPRA 3T65B 2OXGA 3SJVE 1I7RA 4Z0BH 3WUWG 1OAQH 4I18C 2V17H 1WWBX 1YEDB 4YDKH 5B8CC 1U8OB 5IVZB 4G3YL 1U3HA 1M1SA 2CQVA 4LHJB 1G6RH 4J3SA 1HQRB 1TZGH 1XT5A 1A6PA 4LVOC 4MNHA 1OARL 1Y18B 1EO8L 4HIHA 1J05A 5TDPA 4QRQB 2HFFB 4Y5XA 2AXFA 4LCCA 2P8PA 1H15B 4LOUD 4Q0XH 3IXTA 4QHUB 3SDXB 5JW4Q 4OM1L 4I0KA 4DEPB 4QTHA 2W91A 2ZUWA 4NJ9H 5L8LB 5MEQA 3NZHL 5DT1L 4QXGL 2C1PA 4KQ4H 4ACPA 4MAYC 1GGIL 2HG5A 4HC1A 2BJMH 1I9EA 5DO2C 5EU6D 3KPOA 4CDGC 2XWJB 4KK9C 3FB5A 4YGAB 2GTWA 2UWEB 4YHMH 3REVA 4U0RC 4UTBH 1AD9B 1IQWH 1TXKA 2F74B 3HI6H 2JIXA 3O3EB 1AGBB 4PGBA 4TNVF 1IEBB 2B5IC 3U6RB 1CS6A 1E27B 1BPVA 1KCVL 1GVIA 4Y5VC 3V6OE 5DJ0B 1QLEL 3EHBD 3KVQA 4NJAH 5ADPH 2D03L 3I6GA 5CD3A 3B2VL 3IFLL 4FXGB 2HFEA 4EQ3A 4HK0B 1X5KA 3QEUA 2X4RB 3O3DA 4Q7DA 3BGAA 2LV4A 2FL5A 4Z7OE 2X6MA 3JWDH 4IMLA 1KACB 5AG8A 3REWB 1IC7H 4QXUL 4C56A 1S7WA 2A74A 5JW5B 3BKML 1GOGA 3FO9B 3MV7E 2XOTA 4RFEB 1KB5A 4U6YB 1QRNE 3WFBL 3MRLB 1SHMA 5E8NA 2NY1C 3FFCA 3E3QE 2F58L 3HMXA 4KDVA 3NTCH 3H3KA 4GS7B 5HHQA 2IBZX 4WI8A 3T2NH 3OTTA 4L3EB 4LGRB 3C9NB 4KJYA 4XWOD 2ID5A 1MHEB 3HS0B 1S8DB 5T33H 1A7QH 3GRWA 2FGWH 3CGTA 5TE4H 2WWMC 4S2SA 3ISWA 3MLXH 1CE1L 3KPSA 4YXHH 3LKPB 1JNLL 2JJWA 3MJ8A 1OB1B 1HHKB 2IANB 3GKWH 1ZEAH 5GIRA 3MJ6A 4HIEB 3CDFA 4X5XA 3W11D 1T5XB 1AKJA 1XH3A 1DE4B 1Q72L 1IBGL 4Z7VB 2D7NA 3MRRB 1V05A 4QRPD 4H88H 2Y4SA 3IB4A 5LG1A 5EIIB 5JHDD 5GRVL 4BUHA 5B3JF 3QNXA 2FX7L 5HHOB 2F54E 3WFDH 5I8CA 5I1KL 1YPZF 1KJ3L 1UWEH 3GHBH 3L3OB 1X7QA 2X4PA 3S5LB 1A47A 5D1XD 2YKLL 2E9BA 4UDUB 1Z3GH 3RGVD 3VDCA 4V1DD 3VWKA 1HHGB 4KK5D 3QXAB 3LD8C 2J8UE 4L4VA 4XHJC 3B43A 5FKAB 3VRIA 5D72H 3K1DA 3SKJH 3EKCA 5DRWA 1MH5B 5JLZB 4JE4B 2VXVH 2Y23A 5KVGH 3P30L 1GSMA 2VXUH 1X5HA 4HJ0D 1TPXB 4M4PA 2WLYA 3WNMA 1BD2B 4DKEL 2A73A 1FFNB 2NY2B 4M7JL 4QHNA 3UROR 1WT5A 1FGVH 1U8MB 3ARRA 1T5WB 1HEZB 2PETA 4JKMA 4P4KC 4RAVB 3TA3D 1CXLA 4P9MH 1TLKA 1INDL 4OGAC 3OKLA 4PFEA 4U1KA 1NFDB 4I9WD 4PD4J 3VH8G 4AEIH 1FFQA 3EJZC 1GGYA 5GGUA 3MGOB 3MACH 4WI2A 4OLWH 2VXQL 1ZLWK 2DWDA 3RNKB 5INCA 1S5HA 5E2TH 4MA7L 1J0JA 4LSRH 4HD9A 3B9VA 4JFQA 1FPTL 3NIDF 2H2PC 3IRPX 3O4LE 2APXA 3ARBA 4WW2B 4P2RE 1U36A 3SQOL 3MZTA 2H26A 5HGAB 5E2UH 1DQLH 1U0QA 1DDHB 3RZCC 1R3JA 1A7NL 4GFTB 3P9MB 5JTWA 3I50H 2OZ4A 5CJQL 4LNVA 4FQQA 3AAZA 1E4WH 3B2UD 5KSAC 4J6RH 4W4OA 2JIXD 5D6CA 5KS9B 3G08A 2VRAA 5E5UB 5CEXB 1NAMA 3U30C 2Q7NA 4WY7H 3MUGA 4NZRL 1ZWIA 4X83A 3U83A 1NGYB 1C08A 2F53A 4ZSOB 4WFHD 4UUJB 1R3LA 1A3LH 1XGYL 4PTUA 4ORGA 4WI5A 4EDXA 5HYIA 4M8QB 3IGAA 4PREA 4K07A 4NWUH 2ED7A 4C56D 1KN4L 1D9KA 2FD6H 4PV8A 2WAHA 3O45A 2YC1A 2RHEA 2FSEB 1ZS8A 2VB5A 1O0VA 3D25B 3FFCD 3NN8A 1JGUH 3VFPB 3VFTA 1VFOA 4BFIA 3DX8B 1TJIH 1NMAL 1UXWA 5F93C 1FGNH 1RK0A 2GTZA 1DANT 4YPJA 3SDAB 4CBPA 4OFPA 2XKNB 4G9DB 1NL0L 5EZLB 2COQA 4L3CB 4CAGA 2P8MA 5A2KH 2Q86B 3KPSD 4JZJB 5EUOE 1OSZA 2RCSH 4G6FD 2WUBL 4UV4L 1D6EA 1CIUA 1AKJD 1W8OA 2F8VA 1EBAA 15C8H 2ZUUA 5EH1A 4XP1L 4MXQD 4X4MA 3MRBB 5K33A 3MRMA 3ZTNH 2VDPL 2H1PH 4Z7WF 5JW3L 4PRAB 1FFOB 4LSQL 4OCXH 2CPCA 3HB3D 5DC4B 5D4QA 2GSGB 1NFKA 4QHKI 1ZT1B 1RIUL 3LRGA 3NABH 4Q6IB 1KFAL 4D8PA 1RZIB 3VE0A 1JUFA 3B4NA 4HJGB 1YMME 3WSQL 1G7JB 1LK2A 2E6PA 4JKPH 2XYCA 4Z0XA 5GS0H 2XICA 1FL3A 3VWKD 1A5FL 3VXSE 4L4VD 4L8CA 1AJ7L 1AR1C 2XZAL 3OL2A 3QA3B 3V7AG 5LGHH 4UMGA 4M93C 3OX8B 4PJXF 3MZGB 5E5MA 3MCLL 4GKZB 5SWZE 4QF1B 2FJGA 1J0HA 3INUH 2P8LA 4S1RH 1BF8A 3UYPA 3WIHH 1JRHH 3U46B 3B5TA 3CFJB 2QR0B 1QSEB 2V6HA 4MQXC 5I74B 2CIIA 3EOTH 3V4PH 4JN1L 5AYUL 3BH9A 5KOVC 5TQ0H 1KXVC 1KELH 4BFGA 5GGVY 3BEVA 4EXPX 1UA6H 4X4XB 3CSYA 3B6SB 4P5TA 4K71B 2B2XH 3OB0K 4CDHA 5JQ6H 4PYHA 2JB5L 4OCYH 4QRPB 5F96H 5KSUB 3DGCR 3Q3GA 4ZFFB 1IGYB 3S35L 1EHXA 2DQTL 5I17A 1D5IL 4QRRE 4OZIF 3LB6C 4NO0A 3WS6C 3SGKC 3QNZB 4JANA 4OF3A 1U8IA 1CBVH 4Y0GA 4OZHB 3QUXA 5IM7B 2Y07H 5EUKA 2XWBA 3ARBD 3DI3B 4MCZB 1WISA 5BRZE 2CDEB 2VR4A 3L5HA 4L9LC 1RURL 4V1DB 1PG7L 5HI5C 4IHOB 1B0WA 3P0YL 1D5ZB 1SVZA 2AJSL 5GGRA 2H8PB 3PABA 4KK6D 2PYEA 2HVKB 4JPKL 1MOEA 3ILQC 4I2XA 1YQVL 2HFGH 5L9DH 4P46A 4BH8B 4TNWK 3KHQA 3LEXA 2OL3B 1I8KB 4KRLB 1TCRB 1T3FA 4FNLL 4GAYB 4PJAF 5BXFB 5CHNB 3X13A 1JF1A 1SY6A 1P1ZB 5TGBA 3S8WA 5LXGH 3TA3B 3LV3B 3FMGH 2VZVA 1ZHKA 2XV6B 3PDDA 2F53D 1JZ3A 2OK0H 3MUZ1 3OG4B 4PG2C 1OM3L 4X9FA 4U0QB 1I7RB 3ALXA 2CKNA 1GGBL 2DIAA 2Q8BL 1FNSH 2F5AL 4LK4A 3L3KA 3UTPE 4X7SH 5CGMA 3OKMA 1FLRH 3RKDC 1D9KD 1U3HB 2CKBH 4MXWL 3N85L 4CVWA 4MNHB 4NQCE 1ZK9A 2DQCL 1J05B 4MA8H 4YBQC 5TDPB 1JZ4A 4JFYA 4Y5XB 4FFZL 2AXFB 2P8PB 3IXTB 1JPST 4O2CA 4QTHB 2CK0H 1MRFL 2D7MA 1KJ2A 5MEQB 1G9EA 2FB4H 2C1PB 3MOBH 3THMH 4KU1A 2AJUL 2HG5B 3OG6B 5DDHA 8FABA 3KPOB 1HKLH 3DSFL 3FB5B 2GTWB 4LLYA 3H3PL 3L7EA 3REVB 5M7QA 5BS0A 4IDLA 3RWFA 4KRPD 4OTXH 4NKIL 3U0PA 4N5EC 2H3NA 4JAMA 2JIXB 4PGBB 5D7KD 2EH7H 4JPVH 4P49A 4LU5H 3SJVA 3FB7A 4W4NA 2VDOH 3C5ZD 3I6GB 5CD3B 4I48A 3SBWC 5C8JA 3TYGL 4DUVA 2HFEB 3BP4A 2XTJC 4KV5E 5D5MF 3QEUB 3ARTA 3O3DB 5T5FL 2JCCF 3ZKMD 1E28A 2FL5B 5HYEA 4KI5D 4IMLB 1EZVY 5GS0C 4C56B 1S7WB 1I1AA 2A74B 2CMRL 2FX8L 1E6JL 2Z4QA 5C0BE 1KGCD 1KB5B 5C08E 2ZWLT 1TMCB 4J7RA 2QLVB 5E8NB 2CGRH 2NXZB 3FFCB 5JHLH 2X4NA 4F15C 3OAYK 3Q5OA 3PE9A 3S3SA 1IGIL 4LLAA 5HHQB 4F37K 1C5CH 3BDYH 1NANH 4KJYB 1X6NA 2DOCA 3B83A 2IWGA 4GAJH 3O8XA 4BSWA 4D9LH 1LO2H 3V6OA 1MFEH 4S2SB 5C92A 3KPSB 2DAVA 4M5ZH 4I4WA 3UO1H 4U3CA 1TZHA 3MJ8B 5GRYA 2NY6D 5GIRB 3AS3A 1NC2D 3V79C 5BMFL 5B3NA 2M1KA 2AEPH 4X5XB 1OTUD 5J06A 1AKJB 1XH3B 4P5TD 5BVJA 4PJIE 4ZAKB 4OGXH 5FK9A 3D87B 5C0RH 3QNXB 3BQUA 2ZUSA 4FQCL 5I8CB 2CRYA 3MV7A 1UEYA 1TQBC 1JZ5A 4JVPA 5J3HD 5FYKL 1VFAA 5K9JL 3QUXD 1X7QB 1F2XK 2X4PB 4LGPB 3UTTE 3EIFA 5GISL 3VWKB 4B5EA 5A1AA 1DQDH 2BCKA 4FG6C 4L4VB 2HTKD 2HVJA 3VRIB 1OWRM 4YHYC 4HKJA 2Z31A 1BWMA 2PYED 5DRWB 1NFIA 2WINA 3F7PC 5GRWA 2A73B 4QHNB 3WXWL 4YC2B 1FRGH 4HJJH 3WNLA 3JWOL 4POYA 3EBAA 1CDJA 4GO6B 4K94H 4XPHL 4U1KB 3MOQA 3OKLB 1MIEL 5HYSA 5IT2H 1IARB 4OV5A 2F54A 2APBA 3HI1A 5C3TA 1JYWA 2EH8H 5GGUB 5GGTL 4XMLL 5EIVA 2W07A 5FHAH 1BJMA 4D0BA 4M7ZB 2C3HA 2DWDB 3D6GA 4NN5C 1T7XA 2FO4A 4KRNA 4KHXL 3DVGA 1S5HB 4ZUUA 4JO3H 3QXTA 3T3PE 4TSBL 2X9WA 4JFQB 4HW6A 2YUVA 3ROLA 4PBVC 4RQQA 3ARBB 5EWIL 2R8SL 5IJKA 2I26N 5F71A 2H26B 3EOAA 1SYVA 2YRPA 1Q0YL 4Y19B 1R3JB 3K2UH 4PGJA 1OTSC 1HNGA 1CLOH 1EK3A 2R2EB 4FQQB 4ZTPH 4Q9QL 2VOTA 3AAZB 2EICA 3JUYA 1NUDA 1IT9H 5D6CB 3QDJE 3G08B 2ZPKL 1NAMB 3U36A 3QIUA 1NAKH 1HYSD 3MUGB 4LFHD 1UACL 3H3BC 4JG0H 5DA4A 1BFOA 1ZWIB 4OI7A 4H8WL 1U8HA 1C08B 4HH9A 2F53B 4NNYA 4RGNC 4Z0BL 1OAQL 2V17L 1R3LB 4PTUB 4ORGB 1W72L 4EDXB 1NBVL 4LLDB 2Q8AH 3IGAB 4PREB 1RZ8A 1JF5A 1G6RL 3W5MA 1WZLA 1D9KB 3O4LA 1I1AD 1TZGL 1MLBA 2VDML 4PV8B 1ZA3A 4UT6L 3O45B 3QUYA 2YC1B 4WDIA 3ZKND 3WN5C 1CYGA 1EGJA 1ZS8B 3SGEH 5JNYA 3CIQA 3NN8B 4JREB 4BFIB 2B0SH 3VFTB 1LEIA 5IB1A 2QHLA 2E7LC 1UXWB 2BJML 4B41A 3MODH 2GTZB 2IQ9H 1YEIL 3C5JA 5AZ2H 3ZSSA 4KK8D 2A6DA 3O8XD 1F97A 4FHBD 4M9PA 3SKUD 3HI6L 5FYJU 4KRPB 2P8MB 1A6WH 3A6OA 1J1XL 1OSZB 1A3QA 4G8GA 1D6EB 1FNGA 5ADPL 2NPLX 3T3ME 3JVGC 5D71L 4WTWA 3QEHA 5E9DE 3E0GA 1ZGLM 2WBJA 2V7NA 3N1FC 5BVPH 5I1HH 2ARJQ 3MRMB 4N0UA 1PLGH 1NCWH 3QO0A 3N1MC 5DMGD 1AD0A 4JY5H 1NJ9B 4D8PB 3VE0B 5FYLL 5J4MA 1JUFB 4WTXA 1IAMA 1LK2B 1B0RB 2KH2B 4Z0XB 2FRGP 4K7PY 1FL3B 4ZNEE 1FORH 4B7IA 4L8CB 3F7YA 3DETD 3NTCL 2Z31D 3T2NL 5E5MB 5LGKA 1ND0A 2R69H 3T0VA 2FJGB 5T33L 2X44D 1A7QL 2P8LB 5B8CA 4FXLA 4CVZA 2XTJE 4YXHL 2WNGA 3JUZA 3ZDXE 1DR9A 3CFEA 4TNWF 3GKWL 2CIIB 1ZEAL 1PZ5A 2NY6B 2J6EL 3DV6A 3BH9B 4CRPA 5MI0B 1QRKA 35C8L 5IW3A 3WIIH 3SDDA 3BEVB 4LAJH 1S9YA 1OAYL 3CSYB 1EO5A 3RWEA 4P5TB 4H88L 1V7NL 3Q3GB 3X14A 4HCRA 2FBOJ 3EGSA 5FOBB 1T20A 5I17B 5F8RC 4NO0B 4X0KA 1F6AA 1UWEL 4JM4L 1MHHB 2HTLD 4FFWC 4JANB 3EYQC 1U8IB 3QUXB 1WFTA 5EUKB 2DM3A 5D7JA 1UM5H 2XWBB 2NY5L 4Z7QE 1Z3GL 4J4PC 5I19L 4JFFD 3DVNA 5LQBH 4DN3H 1BGXH 1EAPA 1DN2A 1X44A 4RCAA 5D72L 5SWZA 1XCQA 2BXZA 5GGRB 3PABB 4H25A 4LNRA 5CZVH 4AEHH 2PYEB 4I2XB 4K3DH 2E8ZA 3X3FH 2LTQC 5AZEH 4J1UA 1FYHB 4P46B 5FUCC 3LEXB 5F7EH 3JV5A 5F9DC 1FGVL 1QBLL 3FN0L 1UCBH 3MROA 3QIUD 1T3FB 3STLA 2FWOB 1UKTA 2AK4E 4BSVA 2W0FA 3VA2C 4I13B 1JF1B 2BVYA 5E99H 3X13B 2J88H 5TGBB 4CMHB 5DR5H 1JTOA 3T1WA 1C8PA 4AEIL 2HT2C 1ZHKB 5SWQA 3SN6N 1JRHI 4QRRA 1QBAA 3MACL 1L6XA 3BPNB 1CU4H 1RUAH 4LIQH 3L3KB 3S35X 2W9EH 5IFHL 1KCSH 3OKMB 4TVPH 2YR3A 1NKRA 4UIKH 3BSZL 4ZUWA 5BRZA 4KJPC 3MGTA 2AV7A 3QUYD 5DMYA 1K8IA 4U1IA 3TBTA 3QUKA 5ECJE 4JFYB 5F9WC 1JPTH 2O5YH 1IVLA 4YHOH 3LAFA 4EBQL 2GFBB 1PG7X 1OPGH 3MC0A 2QTEA 4O2CB 4B53A 2PCPA 3HUJF 1DQLL 1HE7A 1KJ2B 3OPZH 1CD0A 3NVQA 2HT4D 5GGSA 5DDHB 8FABB 1XFPA 3LQAL 3R4DA 4UQ2A 1E4WL 1RZFH 4LLYB 3L7EB 5BS0B 1PBYA 4UOJA 5DVLA 3MMEA 4F37F 3RWFB 4J6RL 2FHBA 3U0PB 2H3NB 4DK3A 4JAMB 5TF1H 4G8GD 3O3AA 3LQMA 4WY7L 5E6ZA 1MRCL 3VFNA 3SJVB 3FB7B 3Q6FA 1KEML 2WBJD 4I48B 5C8JB 4JFDE 4YEEA 4L8SA 4XP5H 1BECA 1VGEH 3WBDA 5JPMA 4AK1A 1IJ9A 4P5KA 2OR9L 4BK4A 3HC3H 1E28B 1OAUH 4OIAA 3VGHA 4Y2DC 4NWUL 4S1QH 2IEPA 4ZO6A 2FD6L 5BOPA 3MXVH 1I1AB 4QOKE 2V5TA 2Z4QB 2PNDA 5EB9A 3GSNA 1QBBA 1V8HA 2E3VA 4K23L 4HH8A 1JGUL 2X4NB 4JPWH 4HWEH 4NBZB 4EEEA 2Z8SA 3ARYA 3DECA 5J57B 4EI5C 3O8XB 4BSWB 5HVHC 4ELME 4YNYA 2NXYC 3CFBA 1KOAA 3GGWA 4I4WB 1TZHB 4WGVB 3ZE2F 3BGFC 3QDME 3M1BA 3SDDD 2MOVA 5IJVA 2DLGA 4NQTA 1P6FA 4QRSA 1LP9F 2VZ1A 5C0CA 5BVJB 3T0EA 5CJXC 3EJJX 3ZTNL 1XGQA 1CG9A 4OCXL 3U9PH 1G9NL 2L4OA 5FK9B 5A3IC 3RZCA 3BQUB 3HPLA 2FIRT 3MV7B 3CZJA 2NCMA 4HIXH 1WEJH 4OM0H 5C08A 1VFAB 2E7CA 4R97B 1UFUA 5D7JD 1KJVA 5KSAA 4JB9H 3V5DA 5HDLA 2X41A 5E8DH 1I1YA 3MJGX 1U41A 1DBJH 2BCKB 2V2XA 2HVJB 4IJ3C 4LARL 4HKJB 1KIRA 3R0NA 1IM9D 1NFIB 1YZZA 4JFHE 2WINB 3OGCB 3INUL 1TTGA 2EDHA 3WIHL 3GSVA 1JRHL 3VCLA 4YHLL 1J8HE 3FCTA 3IVKA 4O2EA 1P7KA 4OQTA 3BAEH 3F7VA 3EOTL 4E42A 3QCVH 3VFRA 4G8IA 4AG4H 5JDSA 1NANI 1KELL 1YEFL 1Q94A 5HYSB 1UA6L 1AY1H 4FQ1H 5I75B 2F54B 4OV5B 2B2XL 3B5GA 3HI1B 5F96L 4PRHA 1MCWM 4CUCA 2R56H 4RMSA 3NIDE 4D0BB 2FO4B 3VG0L 5BRZD 4GG6E 1C5BH 3V0VA 3DVGB 4I5BA 4ZUUB 1B2WL 1CBVL 2EEDA 3CC5A 3FO2A 3ROLB 4RQQB 1K2DB 4PJBE 2EDWA 1PG7W 3F12A 4RGOH 2C4FU 4LSUH 5EORL 1ED3A 5DEGA 3EOAB 1JHLH 4KDWA 1SYVB 2DYPA 3PV7A 3F6IA 3AB0C 5CUSH 3AUVA 3BZEA 1YQ2A 3QNYA 3CUPA 2HFGL 3WLWD 5L9DL 2WV3A 1KJMA 1BQHA 1CDBA 1B6UA 4KPHH 3QDGE 2NMSA 2AI0L 3DLQR 2JJTC 3IU4H 5IB2A 3U36B 3QIUB 5LXGL 5SWSE 3FMGL 5DJCA 1TJGH 1BFOB 3R8BB 5EDXA 1U8HB 1DFBL 1MCOL 1DJSA 5MEOA 3RVWC 4HH9B 2E27H 1K3ZA 4NNYB 5KJRH 4Z7UA 1TITA 4F7CA 2OMBA 4FFYH 3P2TA 4HWNA 5I1DA 2N7BA 2CKBL 3ZKXB 1RZ8B 3O4LB 3I9GH 1VEOA 1MLBB 4P2RB 1RPQA 1ZA3B 4MA8L 3QUYB 4WDIB 3NCYP 1YEEH 2EXYC 5HGHA 2PN5A 5JNYB 5FUCE 2CK0L 4PGEA 2FB4L 1WJ3A 3MOBL 3S3PA 1LEIB 3THML 5IB1B 2BC4A 3N0PB 4K7FA 4WI3A 1RIHH 1HKLL 3W9EA 4AT6A 3D3VE 3MBEB 3C5JB 4L5FH 5IB5A 2EDNA 1FV1A 1R5WA 4J2XA 2A6DB 1QNZH 3QDJA 4JO2H 2AEIT 4Z7VF 1EH9A 4OTXL 5J9PA 1GGCH 4U1SA 5JMRA 2H9GA 1WIPA 1AC0A 2W38A 3ZYJA 2Q3AA 3SGKA 4G8GB 1EERB 4LU5L 2WIIA 2GI7A 1FNGB 2GJ6E 2VDOL 2HJFA 5D1QA 4Z7WE 3LOWA 3KXFE 3QEHB 5C0CD 2DIJA 2WBJB 3B9KA 3T0ED 1RFDH 4N0UB 3SY0B 3QO0B 3RZCD 3BUTA 4S1SH 4PJ8D 1AD0B 4OLUL 5C08D 1IGTA 1G7QA 3IETB 4OI8A 4PRNA 3I75A 5LBSL 3GIZL 2CRZA 1AE6H 2PO6C 4YK4C 4NCC2 5F1IA 4MJ2A 2CGRL 5JHLL 4IRZH 3OJMB 3VXPA 2DQGH 3F7YB 1TTFA 1C5CL 1N7ML 3WFZA 4NQUA 4PJDF 1ND0B 1UH3A 4GAJL 3SGEI 4D9LL 3ARFA 1LO2L 3MREA 5B8CB 1FNFA 1TETL 3O2DA 2O26U 4CVZB 3QG7L 4RAUA 2UV3A 3UO1L 1WFOA 1QVOA 3L7FA 3CFEB 1PZ5B 3DV6B 1J5OL 1PYWA 2AEPL 3SDDB 4P9HH 4HULB 1S9YB 3OKYA 4YHZH 5BQ7A 3RWEB 12E8H 1UEMA 1BFSA 5J11B 4PRHD 5CIPH 4OZIE 1NGXA 5C0RL 4LRIC 4Q9BA 2ZCKH 4JZNA 3X14B 3EGSB 3WDHA 1T20B 3TYFA 1JNNH 4X0KB 1F6AB 4YHKL 5D7JB 1X4YA 4BK5A 2UZYB 3MLSH 2X4TA 3W0WE 2B5IB 5KS9F 1CT8A 2NY3C 3DVNB 3LRHA 2DYPD 1DQDL 1UJTA 2EIZA 4GMTL 5SWZB 1I3GL 4M7LH 1XCQB 3SBWA 2DQIH 1NUNB 3HRPA 4MB5A 2B39A 4H25B 4LNRB 5E4EC 1HILA 1CGVA 4J1UB 1E4JA 4PJAE 2HKFH 3BKJL 3L5IA 1N26A 3MROB 3SE8L 1HN1A 5IOPA 1FRGL 3FQNA 4HJJL 3STLB 5ICYA 4BSVB 4LSDA 2W0FB 4CU7A 4K94L 2IBZY 3OAYH 4U1GB 3RIAK 3IDYC 4IEFB 5IT2L 5T1MA 3VG9B 2Z91A 5SWQB 1A7PH 2NZIA 1XF3A 2WANA 2NY1B 3ALWA 1YMHA 2EH8L 4PGCA 3TFKC 4L1HA 4QRRB 5C0JA 4NSKA 4YPGA 5K93A 4PJ9C 5BV7H 5FHAL 5HVFB 1G6VK 3QDHA 4PB9H 4IM8A 1J0ZA 4ZUWB 5BRZB 2AXJA 5FIEA 4MVBC 3MGTB 2EDBA 2AV7B 5IHLB 4F7TA 1K8IB 3P11L 4JFZL 3QUKB 4U1IB 3TBTB 5IKCA 5DMKA 1JZ2A 4X6CA 3EDFA 4QGYA 4IBLT 1BZ7A 4O58H 3CZFA 5ETUA 5C2BL 5JZ7D 4XTRC 3W39A 5GGSB 1CLOL 4I77L 1VSCA 2V5YA 4UQ2B 2X1XR 4HT1H 4JO4L 2E7BA 4FZ8H 1WCQA 3MMEB 4HLZH 3WO4B 4XVSL 1S7TA 3MJ9L 3KYMA 2DDQH 1BMGA 1LGVA 4TQEH 3VFNB 5D1QD 1U93B 3Q6FB 1OTTC 2JCCE 3ULUH 5GS3A 3B9KD 4L8SB 3PGCA 5DRNA 5HI5D 5JPMB 4P5KB 3EYUH 4NQCB 5C0AE 4KXZI 4ZODA 5DFWH 5JR1H 5EU3A 3QB7C 2YEZA 1JPFB 1FZMA 4MS8D 1F4HA 3GSNB 4HF5L 1I1CA 4WO4A 2B0SL 1JHTB 2A9NH 2Y9RT 5AWNH 1QQDA 1QUNA 5KAQG 2UUDK 4DZBA 3MODL 2RR3A 2IQ9L 3HI5H 2P5WE 2FH8A 5AZ2L 3MV9A 3RUGF 2XFXA 5CFHA 3ARFD 3X17A 1AQDA 1VESA 1A6WL 1QOKA 4J3UA 4N0YH 1MFCL 1MFDL 4GRMA 3ARXA 3GGWB 3CFBB 4YNYB 4JFDA 2GITA 1OLLA 3M1BB 4YBQD 3U9UA 1YY9D 1IL1A 1LE5A 1KLFA 1KBGH 5BVPL 4QRSB 1HSAA 5I1HL 5C0CB 1ZA6A 3SE9L 3T0EB 4Z6AT 1NCWL 1CG9B 1XGQB 2FATH 3MRQA 5HSFA 4QOKA 3UC0H 3RZCB 5LVEA 3HPLB 3VXMA 5ALBH 1NCBL 4JY5L 5C08B 3FQRA 3CMGA 1A2YA 3RWIA 4R4NC 2VLLA 5CBEA 1KJVB 5KSAB 1BAFH 1IZKA 2CXKA 2K7QA 3V5DB 4JCMA 1CCZA 2ZZUT 3LEVL 2O5ZH 3CK0L 1I1YB 3DROA 1FORL 1FC2D 4LF3A 5CD5D 3PF2A 1DVFC 2AJZA 3RIFF 1NMCC 4GBXC 1MCNA 2V2XB 1KIRB 3BX7C 2VLJE 4ODHH 5FYKE 2Y06L 2VLMD 4WW1A 4NCC1 4M6NH 3U48A 5MEND 3CDCA 3GSVB 4Q6YA 3QDMA 3VCLB 4YQXH 3FCTB 3IVKB 2ADIA 4O2EB 5IBLC 1P7KB 4S11A 3U4AA 3F7VB 4GQ9H 1AFVH 5EBMA 4E42B 1L9NA 3VFRB 1MSPA 4G8IB 5JDSB 3SCMD 4PJIB 1YPZA 4E9LA 3ULVH 4JFEA 3FL7A 5TFSL 5JOEA 1Q94B 1T89A 1KEGH 4PRHB 4YX2H 1Y6MR 4G6KH 5C0NC 1YEHL 4RBPK 4G8FA 1LO3H 5HHXL 2FHCA 3PWPA 3H6JA 2XN9E 3V0VB 4I5BB 1YJDH 4NHCH 1B90A 3UTTB 3CC5B 3FO2B 1PEZA 3I02A 3F12B 2CDFA 4ZUVA 1UVQA 2ZNWA 1ED3B 4MZ3A 5LQBL 5DEGB 1F2QA 2LAGB 2DYPB 5DEZA 2XQYK 4J8RA 3BZEB 2NYYC 3QNYB 3CUPB 4K3DL 3PWVA 3X3FL 5AZEL 4XAKD 1KJMB 1BQHB 4NRXA 3GMQA 5L0QC 3RVXC 5F7EL 4WTZA 5I30H 5MHSE 2NTFA 1UCBL 4FMKA 3I6LE 4C4KO 3RY6C 5IB2B 4X7CC 3O2WH 5E99L 1Z9OA 2HWZH 4NQDE 4MXVF 1FNEA 5DR5L 5DJCB 1CK0H 3O9WA 4X7EC 5MEOB 1QFHA 4ZS6C 5CZXC 3VXRE 4F7CB 5DUPH 4LIQL 1CU4L 4HV8B 5I1IL 5I1DB 1U2CA 3QPQD 2HAZA 3NCYS 4TVPL 2D9QB 4UIKL 5F7FA 1LDPL 4R4BA 2N7AA 1CI5A 4M7KH 4ENED 1LWRA 1JPTL 3GMNA 1XF4A 1JTPA 3FT3A 3Q0HA 2DI7A 5HGHB 4K3EL 5F44A 3T0XA 4UNVA 2CUHA 4M1GH 4MCYA 4WO4D 2A9MH 5I1LA 3WHE1 1FZJA 4PGEB 3OPZL 5H94A 2BC4B 4K7FB 3HNVL 1QZ1A 3MV9D 3W9EB 4HWUA 1CIDA 4AT6B 5IB5B 5I18H 1FV1B 1RZFL 2FBJH 3OKNA 3QDJB 3OB8A 2BOCA 3QWQB 4XH2A 1T2QL 1H9VA 1DEEA 5I73C 5J9PB 1IILE 2YN3A 3I6KA 3LZFL 3V4UH 4U7KA 4LPTA 4U1SB 1X5XA 2H9GB 3RWCA 5DEFA 5ELIA 2WIIB 3M07A 4APQC 3ARSA 3H8NA 2HJFB 5D1QB 3GSXA 4J4PA 4XP5L 3B9KB 1VGEL 2CRMA 2Q3ZA 1U92A 1AR2A 4XNMB 4NUJA 1BQLH 4XX1G 1OAUL 2DQDL 4S1QL 3RA7H 3VXMD 4LQFH 4QKXB 1CZ8H 4DEPC 1IGTB 1G7QB 3MXVL 4D2NA 4LVEA 3P0VH 5E5RB 3DBXA 4PRNB 3I75B 1EHLH 5EO9A 1D7FA 3K0WA 3TH2T 5F1IB 2AQ1A 2MNUA 4M48H 1T1YA 1B4RA 5C6TH 4H1LA 1RUQH 4JPWL 1XGTA 4X6FA 3BMWA 2CXGA 4HWEL 3VXPB 4M02A 4KMQA 3UP1A 3HNTH 1MAMH 4U1LA 3Q6GH 4RGND 5T3XH 2C9AA 2J12B 1QSFA 3E2HB 5DURD 3ARFB 1NCDL 5E6YA 3MREB 4XB7A 3T1FA 4RAUB 4ALAL 4Z7WA 2A0LD 3C6LC 1GZQA 1QVOB 3L7FB 3DVFA 1F58H 4JFED 1LEGA 1PYWB 1MUJA 3WYRA 4O9HH 2M8XA 3S36H 5DZOA 4XCNA 3E8UL 5BQ7B 4X4YA 1BQSA 1VACA 1J7VR 3AS2A 1NGXB 3RIAF 3U9PL 5AG9A 4MA3A 2V9QA 2XTLA 4JZNB 1G9MC 1FHGA 3PWPD 3A6BH 4K55A 3LS4H 1WEJL 4HIXL 4OM0L 3TYFB 3HKFA 1CICD 5KZCB 4LSSH 4M43H 4F7PA 4PJXA 3U4EA 3WFEL 3GSRA 4JB9L 3OKOA 1P69B 4U7MA 4KKLD 2X4TB 4GUPA 1KV3A 1PX3A 1CT8B 1VEMA 5E00A 3RVVD 4D9QD 4GRLD 2EIZB 2P45B 3FO1A 1U95A 2APFA 4K3GA 1JWUA 1NH6A 4QO1A 5B39G 1HILB 4N0CC 4ZFOL 1I3RB 3G04A 2OTUA 3B5HA 4UI2A 1H3UA 3IFOA 3OAZK 5IOPB 3BAEL 2DM7A 3SE4C 4JRYA 4D3CL 5ICYB 4P3DA 1CFNA 4DJMA 4KHTH 2QL1A 4ZYKA 4OZIA 1JZ7A 2BSSA 2F15A 2DM4A 3O9WD 1GIGH 4PJGE 1AY1L 5T1MB 1MREH 3V2AR 5DFVC 3L1OH 2Z91B 4YJZL 1XF3B 3PP3K 1YMHB 4PGCB 4F15B 5E2WH 3HE6A 1NBZA 2VDRH 4NSKB 4YPGB 2R56L 1RI8A 1OCWH 1J1OH 1F4XH 1UM4L 4IMKA 4LAQH 4F7TB 1UB6B 4PGDA 1VFBA 3LS5H 3P4OA 5DMKB 1JGLH 3EYSH 4RGOL 4LSUL 2AQ2A 4X6CB 2XZCH 4ZS7H 2IPKA 2IF7A 2W9DL 1TPXC 1BZ7B 2AJVH 3CZFB 4X80H 5CUSL 2NY2C 5ETUB 3W39B 1CXEA 1TTUA 4PJAA 4OF6A 4YAQA 3QIBA 4HPOH 1ZXQA 4WNQA 5CJXA 2BHYA 3KYOA 2XACC 4JRXE 1KCUH 5KW9L 3WEXA 5I8EA 2R9HC 5EIQA 1S7TB 1TQBB 3KYMB 1M4KA 4HWZA 1IEHA 2MWCA 1NUFA 2KDGA 4M03A 5ISZE 3MLWL 5DUMH 4M6ML 1TJGL 4GXUM 5EZIL 3HMWH 2BFVH 1AXTL 1RZ7L 2E27L 3C08L 5DXWA 4AM0A 3PGCB 5DRNB 4DQOH 1MCLA 2AK1L 4M3JA 4FQ2H 5FUOH 4DFIA 1JGDB 4WW2C 1YEGH 4GRWF 1WBYA 3O2VH 3LDBB 3I9GL 5EU3B 4OLVL 3SKMA 4OFYA 2YEZB 4RRPA 1FZMB 1FP5A 1YEEL 3MLVL 1RY7B 3K4DA 1MQKL 4KVNL 2DICA 3RRQA 5D2LF 4WO4B 2D2OA 1CDUA 1QQDB 5J6HA 4YIQA 4DZBB 4BFEA 1RIHL 4A6YH 1MJ7H 1P9MA 1KCRL 5TE7H 3MV9B 1QSFD 1QNZL 3QFDA 4JO2L 2XFXB 3W9DA 3ZE2E 3PWLA 1AQDB 2XZQH 1YYLH 2UYLA 2OL3H 5CILH 5IMKA 2VXSH 4NN5B 5D5MA 1CLYH 4H20H 4GRMB 2JCCA 1LP9E 2XXCB 4E41A 4JFDB 2GITB 2YD1A 3U9UB 3GIVA 1N6UA 4OQ1A 1IL1B 3AXLA 1LE5B 4XNQA 1HSAB 4TYUA 3VD4A 1ZA6B 5C0AA 2X9YA 2QQNH 3MRQB 3W82A 3QEQE 4QOKB 3ZE0F 1LO0H 4LOUC 3SO3C 1KYOK 3VXMB 3FQRB 5HI3D 3AROA 1A2YB 3RWIB 2VLLB 3GZKA 5CBEB 3U82B 5FYJE 3PGDA 1H3TA 1I7ZA 4IRZL 4LF3B 2AJZB 1CLCA 4HK3N 4QNPE 3CLFL 2P48B 5IG7A 4RGNB 5J13C 5MEPA 2K3TA 2NZ9D 5E70A 1EEYA 4WW1B 4LMQE 4F9PC 4ZMAT 3EHBC 2FJHA 5DURB 2J4WH 3QDMB 4RISL 5CLTA 4AQ1B 2QQKL 2ADIB 1L6ZA 4Z95L 4JRYD 3V6FA 2OMNA 5EBMB 3IFPA 2X4QA 3MX0A 4PJCF 1YPZB 4X9BA 3SDXE 4YBHA 4LHUA 4JFEB 4P9HL 1OP3H 1NLDH 4YHZL 2ZSWB 3AC0A 3HE6D 2QV2A 2ZCKL 1FVDA 3V8OA 4LKXA 1AXSA 5DJZA 2UWEE 4G8FB 4R90L 3PWPB 1CDHA 3TEUA 3P4NA 5SX5H 2WP3O 1SJEA 4G6ML 2WUCH 1OF2A 4XHQA 3VRLE 3OWEA 5F7MC 1GJIA 2FEEI 1CGTA 3I02B 1SMOA 2CDFB 1S7QA 4PBWD 1EJ6A 1UVQB 1UYWH 4XWOC 4ZUVB 4IRJD 3HMXH 4D0CA 4N8VA 4OIBA 5LGJA 5J1TC 5J6GA 4M7LL 2DQIL 2H32A 1X3DA 4J8RB 3QIBD 5ERWA 4GQPH 1DQMH 1KB9K 2WIMA 4WFED 5HHMD 3F6LA 4NRXB 3GMQB 3V0AC 2NTFB 3W11C 1ROWA 3SE3C 1G1YA 2A38A 2VYRE 1FNEB 3O9WB 3CD4A 4B7LA 1A7PL 4MB4A 4NHUA 4R6UA 2YD5A 3QDAA 3K4AA 5EO1A 5BV7L 1W0VA 4Y1AE 5D1XC 4OIIH 1KN2L 2IALA 3RGVC 5FM5O 4TOYL 4R4BB 3K46A 4KK5C 4OFYD 3L6FA 3GMNB 3ARVA 1XF4B 5GGTA 5JIKA 5C09D 2IANE 3FT3B 3LKSA 1F3DJ 3UJIH 4W6WB 4MCYB 5IESH 4O58L 5I1LB 2JB6A 4HJ0C 5DI8B 1FZJB 4RMRA 4Z7VE 5H94B 4Z8FH 1MCPL 2FEDC 5ESVA 4UZGA 1I9IH 5FA4A 4HT1L 3OKNB 5T1LA 5KAQF 3TA3C 2BOCB 4LRIA 4XH2B 1X4XA 5CEZH 1DEEB 2V5MA 3V4VH 3I6KB 3O6FD 3GBNH 3VXUE 2X1OA 3DUHA 5E94A 2DDQL 4E41D 3RWCB 5DEFB 4OT1H 2D4FA 2FCBA 4LCUA 3KS0H 1YC7A 3VXRA 3ULUL 1SM3H 3F65A 2VE6A 3GSXB 1WC7A 3ET9F 4I8DA 1U92B 5E56A 4NUJB 2Z8VC 5IEKA 4LCCC 2FZ3A 3RI5F 2KZ1B 5JR1L 3AS0A 3ELAT 3ZT7A 5DK0A 4I0PD 2LTQB 3DBXB 1MCEA 2VDNH 5EO9B 2BDNH 2EC9T 1W72A 4TVSa 4HWBL 1T1YB 4P99A 1URLA 3TZVA 1G6RA 1NFDE 4H1LB 4PJDE 1L7IH 1XGTB 2DJUA 4X6FB 3B2UC 1I8IA 1YEJL 3HI5L 4HHAA 4U1HA 4U1LB 1TQCC 2OZ4H 2GKIA 3CU7A 4PRBA 4F80A 1QSFB 1KG0A 4PJ9A 4CN4A 1OQOA 1X5JA 4OZGF 3LPGA 3S88L 3VI4F 3T1FB 4HKZA 1NAMH 4JR9H 4Z7WB 3WFHA 1GZQB 5FUZL 3CMOL 4WENB 4HG4K 1KBGL 5GSRA 1LEGB 3GJFH 4L9DA 1MUJB 2QSCH 2J8HA 4XCNB 3VFUA 4X4YB 1VACB 4XPGL 2FATL 4O4YL 4K8RL 3LCYA 4MA3B 3N1PC 5FGCE 3NH7H 3UC0L 5T3XE 1F45A 5J12B 1G84A 2AKRA 5CMAA 4NKDA 5I1GH 1S78D 2R4RH 1IGMH 4KI1A 1LO5A 3O6MH 2R0ZH 4IDJH 4EIZC 5KS9E 4NOFA 4F7PB 5JIHA 4PJXB 3U4EB 3OZ9H 3BZ4A 1BAFL 2DQFA 3GSRB 3OKOB 3U7YH 3A6CH 3PDOA 2O5ZL 4GUPB 2C1OA 3MBXH 1FSKB 5E00B 2HRPH 1ZLVK 4MQ7A 5FYKD 3CH8A 1RU9H 4ZSOE 5LAXA 4AQOA 3FO1B 1U95B 1BVZA 4NC0B 1JWUB 3QH3A 3NPZB 4OUOA 4NP4H 4M6NL 5HDBF 3PQYA 3G04B 2OTUB 4YQXL 2YZ1A 3IFOB 3GO1H 3NAAH 2YUXA 3O4OC 1A7OH 2H6PA 3GDBA 4MXQC 4GSDL 3VH8A 1JYNA 1AFVL 2D7QA 4JRYB 4ODXA 4P3DB 1ADQL 1CFNB 4HSQA 4ZYKB 3ULVL 4OZIB 2BSSB 1MCCA 3HB3C 1IGFL 5D1ZA 3RY5A 3V52H 1NDMA 1MIML 4YDJA 3LN4A 1KYOJ 4ZFGL 4YX2L 3CLEL 3HE6B 1NBZB 5EU6E 2OJZH 2G60H 5T3ZL 4BKLA 4NKQB 2IPTH 1L7TL 2J6EA 2QSQA 3VWKC 4LCWD 1YJDL 4UT7L 1XF1A 2J2ZA 1E4XH 5HVHB 2OQJA 4PGDB 1VFBB 3P4OB 3C6SB 2HLAA 4LDLB 2I24N 5HHPA 3GEWB 4QXWA 2IPKB 2NXYB 5IGXL 1H8NA 3BGFB 3I3BA 4JO1L 3AMLA 5E6IA 5DMJB 1WAAF 3HC0A 4PJAB 2ARJA 4U2YA 4UV7L 4GAGL 2XKUA 4YAQB 3QIBB 3IAPA 5MP6H 1H3GA 4WNQB 5GRJH 3MLUH 1OOAA 3KYOB 5T1LD 4DWHA 4MD0A 3U7WH 4JHBA 5HHMB 1FZOA 4UILH 4NNPL 3WEXB 1FVCA 1I9RH 1SJVA 3OHXA 5I8EB 32C2A 1Z9LA 5DJYA 4HWZB 2YPKA 4NM8H 5CJ5A 3L5XH 3QWOA 5EN2A 3O2WL 2O93L 1AGCA 4M7ZC 1CK0L 4CMMA 2ADJA 4AM0B 1AI1L 4UDTA 5C1MB 3ARBC 3MV11 4U6VL 3TLRA 1FE8H 1MAJA 1WBYB 3LEYH 3HUJA 2X70A 4U4BA 5FEBA 1RUKL 4QHMA 4OD3L 3SKMB 5H37G 4JDZA 3QRGH 3HAEA 5TJWK 2B20A 4KK6C 5DJ8A 4M1GL 1OP9A 3TZVD 2A9ML 2PW1A 1DL7L 4OZFH 4WHYG 1KB9J 3C87A 2Q6WA 3WV0A 3R0MA 5T5NG 3RUGE 3KPRA 4W4OC 5J6HB 4YIQB 3SDCA 4JRXA 4QRPE 1VHPA 4G80A 1EO7A 4GXVL 1AGFA 1C5DA 1T4KA 5JHDE 3QFDB 3W9DB 3PWLB 2ATKA 2UYLB 5IMKB 3V4UL 3LIZH 1I1RA 5D5MB 1OSPL 1G1CA 1P5VA 2JCCB 1SY6H 3DHJA 4E41B 2EDLA 4XPAH 2UZIL 3ZYIA 3GIVB 1KSRA 3AXLB 4KAQH 4V1DE 3AVEA 1D9KC 4XNQB 3VXOA 2JELH 1S9KC 3NMEA 3AMKA 1ZE3C 5C0AB 2R15A 1HCFX 5A2LH 1HKFA 2A6KA 4PUBL 4BSJA 4N8PA 1ETZA 3B8YA 1R0AH 1CZ8L 3LSOA 3DTXA 2YPVL 3P0VL 2Q7YA 3VMOA 1EHLL 1ZANH 3VGGA 3EJYD 3G5VA 4LSTH 3PGDB 4XCCH 1R3HA 4M48L 3WFCL 1J9CT 1I7ZB 4DAGH 1CF8L 4I9WE 1CE6A 4Y89A 2ZJSL 4KRPC 3MR9A 2IFGA 5FYLD 5TPWL 5JIIA 5IG7B 5MEPB 3OF6A 1KC5H 3MRJA 1VPOH 3PQYD 1EEYB 5L88L 3P73A 1ZHLA 2FJHB 3TVMA 3C5ZC 3EDKA 1JPGA 3HLAA 1JYXA 5CP3A 4X9GA 5CCKH 3V6FB 4OZFG 3GNML 2NY0D 1Q1JL 3IFPB 5ITBH 2X4QB 3ZKMC 5D1ZD 2NQCA 1IC4H 3I85A 4LHUB 5EOCL 4KI5C 3VD7A 1YNLH 2D7OA 4NO3A 4DVRL 3C2SA 1SEBA 4RDQF 5D70H 4KJWC 3MJ7A 5KSBF 5L7XH 4CW1A 4V2CB 2WMPA 1FVDB 4LKXB 1AXSB 5DJZB 3A6BL 2VZOA 2ITCA 3WKML 3LVEA 3P4NB 2DKMA 3GI8H 1SJEB 4OFKA 1OF2B 5I8OH 1TNMA 3TJEL 3QWRA 5GRZA 3PP4H 1S7QB 3T8XA 3CSPA 1T0MA 4D0CB 1A14L 4N8VB 5LGJB 5E6ID 4APQA 5J6GB 4IRSA 2H32B 1F5WA 3WHXA 3RHWK 5ERWB 4X9IA 2OCFD 2V5RA 5MI0C 4HUVA 4C56E 5IMMA 2D0HA 4F58H 4MXVE 3K1KC 1OTUC 4P5TC 3ZE1F 3CXDH 4ZD3H 4WUKH 3TT3H 1MFBH 25C8H 2JJUA 2X89A 4KHTL 1CLZL 3CH1A 3FFCE 4K9EC 3L1OL 3KPLA 4YK4B 4NHUB 2MTPA 5J3HC 4U6TA 5E2WL 4GXUN 2Q87A 4P2CG 3D0LA 5EO1B 4R2GD 1XR9A 2AEQL 1TVHA 2EEAA 1J0IA 1OCWL 1W0VB 1J1OL 4P2OD 4P3WA 1F4XL 2BZDA 5DD0H 2B4CH 3KPSE 2HTKC 3L6FB 1JGLL 1PX4A 3QJFA 1ZGLA 2L0DA 3RWDA 4ZDHA 1OAKH 2XZCL 4ZS7L 3LKSB 1CWVA 3VMNA 3C6LA 1OAZH 3BP5A 3KPRD 2JB6B 3OXRA 4X80L 3KAAA 3SDCD 1VENA 4YUEH 1CFVL 3I2CH 2HKHL 4HPOL 3WMSA 5ESVB 2WWKO 3LHPL 3QHTC 2OP4H 4OCMC 5FA4B 3MV8A 4KUCF 3GI9H 4CMHC 5T1LB 4XI5D 2IH3A 4J3OC 2CH8A 3JTTA 2BNQA 4N5UA 3P4LA 1UZ6F 1U6AH 2KPNA 3EO9H 1A0QL 3UMTA 5DUML 4LCUB 3Q5YA 3VXRB 1QFPA 5CAYB 3HMWL 2VE6B 2CIKA 2YXMA 1WC7B 1RZJH 4L4VE 4Y1AA 1F3DH 1ZT7A 5AYQA 3GHEH 3NGBB 1YEGL 5IEKB 2FZ3B 5F7LB 5IK3A 3QULA 5GRUH 3QXDA 5DK0B 4QRTA 3VD5A 3K7UA 1RJZA 5L8KB 2AXHA 1W72B 1G0XA 2IPUK 5D8JH 2GK2A 3TZVB 4YE4H 1G6RB 1OP5K 1I8IB 2XWTA 4HHAB 4A6YL 4U1HB 5TE7L 4ZS6D 3PHQA 2VL4A 4H0IA 4PRBB 4KKAD 1MCSA 4QTIL 1HYSC 1KG0B 3A67L 2CO7B 4PJ9B 3TVMD 5CILL 2HA1A 4NQSA 2FLRT 4N0RA 3VDBA 1CLYL 3R8QA 3PV6A 4HKZB 3WDIA 3RJQB 3WFHB 1NCCL 4OJFL 2BXYA 2DQUH 7FABL 1EEQA 5CP7A 5D2NA 5GSRB 3UPRA 1I1AC 2QQNL 4ODBD 3DGGA 3TN0A 3VFUB 4Z78A 1Q9OB 4AIOA 4WHCA 1S7UA 3ZKNC 3BH8A 4FA8A 2AKRB 1LO0L 3IDXH 4NKDB 5CMAB 2VABA 2MPAL 1FYTA 1LO5B 1CTOA 5J1SC 3BZ4B 1EGJH 2DQFB 4PJDA 3QWRD 4WHDA 1JTTA 5HYSG 3PDOB 2C1OB 4KK8C 3N06B 3V9FA 3O8XC 4MQ7B 3WXVH 2F53E 4IRSD 4TUKH 5LAXB 2DI9A 3BKCH 2RB8A 4KWUA 1ULVA 3BJ91 3NA4A 1REIA 4CVUA 2ENSA 3QH3B 6FABH 1UWXK 4I3RH 2Z0BA 1X5YA 4Z7UF 2J4WL 2LU3A 3MRKA 6CGTA 4PJHF 3L3JA 5DSCA 3BEWA 3MRNB 4AZ8A 3CU1A 1IRAY 3VH8B 4D9RD 4ODXB 1S7SA 1A02N 3RNQA 2NY0B 5D1ZB 5DMGC 5D7IF 4JCLA 1N5YH 1NDMB 1NLDL 4HMEA 4YDJB 1F4YH 4DKFH 3LN4B 2XRAH 1MPAH 4WIQA 1R3IH 3TH4T 4BKLB 5DD5H 1QLRA 2R1YA 2VQUA 5J89A 3EO1A 2WUCL 1IZJA 1F3RB 2OQJB 3DETC 2Z31C 3ECBA 2HLAB 4ETQA 5GS2H 5HHPB 5AEAA 4IOFD 1UYWL 4R4FH 2VXTH 2BY0A 3JV4A 5E6IB 3MRFA 3ES6B 3HC0B 4NYLA 2ARJB 4ZTOL 2X1WL 1B88A 4N9GB 3BPLC 4W70A 1BFVH 3MV8D 3ZLQC 4KI5E 2VAJA 4MD0B 3OGOE 4DTGH 1SYSA 2QHRH 1JZ6A 1FZOB 2BNQD 1FVCB 1N6QL 4AYFA 3FAWA 32C2B 4HBCH 2YPKB 1FC1A 5EN2B 1RZGA 3QWOB 4LLUA 2F5BH 4AEFA 1KGCE 3WJLA 5BW7A 1AGCB 3HG1A 3VXQA 1UG9A 5EU6A 1RZKL 3O6LH 4GRWE 4CMMB 2ADJB 4HXBH 2HTLC 3EDDA 5B22A 3RQ3A 4UDTB 1NMCB 4GBXB 3TWCH 4HCRH 4HGWA 1FZKA 2ZNXA 3K3QA 4OIIL 2NW2A 3KNBA 2VO5A 4UAOB 4TTGA 2FYYA 1EEUA 3HUJB 4M1DL 2X70B 3KPQA 4QHMB 4EUPA 3BPCB 3GFUA 4XC3L 5SV3A 2ICES 4JDZB 3HAEB 1V3MA 4NZDA 2CD0A 1J12A 1T1ZA 5FGBA 4J3XA 4YFEA 2GYSA 2KL6A 2XXMB 5B38G 2PW1B 2Q6WB 1JVKA 1C7TA 1D6VH 1A7RH 4ZFZA 3PWJA 3CX5J 3KPRB 1JGVH 1GZPA 1BEYL 4Z8FL 2E6QA 1EA9C 3SDCB 3SO5A 5JO5A 4JRXB 1E4XI 4G80B 3SOBH 1AGFB 1C5DB 1T4KB 2QQLH 3WS3A 4ONGH 4MNGE 5CEZL 2ATKB 1RULH 3V4VL 3CDGA 1P5UA 2C4XA 2HN7A 2H2SC 4HDIA 3LH2H 3PNWA 4XNYH 1S9VA 2APWA 3ZKXC 4RSVA 3BRGC 3VXOB 2ICWB 3CAFA 4CKVX 5TE6H 3TN0D 4JHAL 3MJ9A 4JDTH 5IR1A 3QUYC 3A0OA 2A6KB 2PYEE 4ZO9A 4I2XE 1KPRA 1ETZB 4ZUTA 1FYTD 3DTXB 1NCNA 1Q9WA 2AABH 2Q7YB 4HUKB 4OBRA 5L0QB 1G7LA 2HT4C 3RUGA 3ME0A 3G5VB 3RX7A 1GXEA 4C57C 1R3HB 4FOMA 1DBAH 5JHDA 1MI5D 1CE6B 3DX7A 5F6IC 3MR9B 4V2BA 2R4SL 5FCSH 3QCUH 3MRJB 4JG1H 5I1CH 5ICXA 4PP1D 3J7HA 3P73B 1ZHLB 1TIUA 3TVMB 3HLAB 3RHWF 1JPGB 4PLKD 4X7TA 1U8NA 3HCVA 4JR9L 3DMMA 1TJHL 5E95B 4Z18A 2EEBA 1J1PH 1N64L 3HC4H 3L9RA 3VW3H 2D7PA 3D18A 1MJUH 1JK8A 4G7YH 3WL9A 1NGQH 2QSCL 1CL7H 4NO3B 4RAHA 4R8WH 4L4JA 1SEBB 3MJ7B 2MQ3A 3NH7L 4CW1B 1N59A 3UTZA 4HXAH 4YDLC 1UXSA 5BZDA 4FQLH 2ITCB 4G6AD 3O6ML 1H5BA 2R0ZL 1NDGA 1QO3A 4AJ0A 3HFMH 3OZ9L 2FLBT 3GSNH 3WCYA 5ALCL 4ISVA 3U7YL 2YRLA 3A6CL 1IE5A 1N8ZA 4OLXH 3MBXL 2IG2L 3TPKA 4JVUA 3U0WL 3T8XB 1T0MB 1QP1A 1RU9L 4XVTL 4APQB 3N1QC 5E8PA 4IRSB 3OJ2C 3T2PA 3IRZA 3WHXB 3VDAA 4HUVB 3SDDC 5IMMB 3NAAL 3GO1L 2CJUL 4XPFL 2G5RA 2R1XA 3M45A 1PSKH 5J11C 4YXLH 2P24A 4OF7A 1F90H 3HG1D 1DQQA 2LVEA 3GBML 4BFBD 3CH1B 1ZLUH 3V52L 1YN6B 3S36X 2YA1A 4GMSH 3KPLB 4IOSD 3WO3B 2FX9H 4Y8AA 4EKXA 3D0LB 5D7JC 1XR9B 4TTDD 2GT9A 3MXWH 1TVHB 2OJZL 2G60L 1U8LA 1UKSA 1H3PL 4WWID 1IAIH 3QG6A 4G8EA 5ACLA 1E4XL 1HWHB 3ZDZF 1T22B 1H8SA 1AHWC 3QJFB 1ZGLB 2YD7A 3RWDB 4ZDHB 4U3HA 2X7LA 3C6LB 1GRWA 3OXRB 4OCWH 1INQA 5FM5M 4G7VH 3IFNH 3OAUH 1GAFH 2PR4H 5T5NF 5GRJL 4YO0A 1GH7A 3MV8B 4U1GC 5J7CC 3ABZA 2BY2A 5EPMA 1I9RL 2IH3B 3VG9C 3JTTB 2BNQB 1T2XA 4OQTH 3UBXA 3RBSA 1BM3H 3L5XL 2KKQA 2AXGA 1CR9H 4R9HA 2R0LL 4JHWL 1UC6A 1IKFL 3GJEA 2CIKB 4Y1AB 1WITA 3VFOA 1ZT7B 3I84A 3QCTH 1FIGH 3WD5L 1DUYA 4XAWH 5IK3B 4KUZL 3QXDB 4R7NA 1LHZA 4QRTB 1UT9A 2BP3A 1Y6NR 4K3JH 1RJZB 4GW1A 3GSOA 3VFWA 3VXTA 3MCG1 1NCUA 4G6JH 5F8QC 4XNXL 3WLWC 1MHPL 3PIQA 5DJXA 1M71A 3OSKA 1X5IA 3MNVA 3WO4C 1KCKA 3QEGL 2XWTB 1TFHA 5T1KA 3PHQB 4DCQA 4PP2A 3VXUB 5M94B 3HZVA 4NQSB 3KLAB 5IB4A 4L8SC 3DMMD 4KTDH 2ZKHL 3PV6B 5CJ8A 1SY6L 5CINH 2Y36H 4XPAL 1DQTA 3KPMA 4KAQL 5CP7B 4JFFE 4YFLF 3UPRB 1U9KA 1P4IH 5C70A 4UIMA 3DGGB 3TN0B 5D96B 4Z78B 5FCUH 5FV2A 5EZOH 3VGAB 1S7UB 3BH8B 1R0AL 1A6UL 2FEDD 4WFGD 1YYMH 2VABB 1FYTB 3IDJA 4MMZC 4PRID 3S37H 3QP3A 4O2FA 4YDVA 1GOHA 5BZWA 1F8TH 5K9OA 3IU3A 4OAWA 4JQIH 4LCIL 3CXHK 4PJDB 3LKRA 4XCCL 4F8QA 1A9BA 3L3IA 2PYFB 4KFZC 3ETBF 4DAGL 2GUOA 1OGAD 4OB5H 1B3JA 1FCCA 3HZKA 5L2JA 4BZYA 3G6DH 4FQIL 2BRRH 4R26H 4HZAA 4I3GA 1VPOL 4MGXA 5DRZA 1IMHC 4MJIE 3MRKB 4DGYL 3L3JB 5DSCB 5CCKL 2EYTA 2EXWD 3BEWB 3T0EC 5DWUH 3FZUD 1I8LA 3MRPA 5IW6A 1S7SB 1T2JA 4NM4H 3RNQB 1N0LA 2ZUVA 4PJ8C 4WU7A 2ZCLL 5FGCB 3QIWD 5D70L 2BOBA 1MF2H 3SDYL 2NW3A 3WNPA 1FQ9C 2YA0A 5C86A 1CXIA 3BGMA 2R1YB 2NX5D 3EO1B 4WI7A 5I8OL 1NGPH 4U31A 2J7LA 5KVDH 1WTLA 2VQ1A 1BVLA 4G8GE 3ECBB 4ETQB 5F1NA 1T0PB 1PZUB 1NQBA 1MLCA 1QFOA 4OGZA 4R3SA 4HMCA 3JV4B 1A4JA 1OLZA 2IH1A 3MRFB 5JXAH 4N0UE 4UTAH 4NYLB 4LP4A 4Y5YA 3C60A 3KYAA 3RDTA 3TM6A 4HFWA 5C6PB 1X6LA 3O2DH 1K6QH 3M8OH 1SYSB 4F58L 4FN0A 5DMIH 3SO3B 4ZD3L 3TT3L 1MFBL 1RZGB 4LLUB 3N9GL 4QXTA 4Y8DC 3G9AB 3HPJA 4XVJH 3LKQA 4LSVL 4PRPA 3UZVB 1QSZA 3HG1B 4ZFOA 3RGHA 3VXQB 5EU6B 3RVTD 4ZQKA 5J8OA 4RIRA 3ZKQD 5IQ7H 1A21A 5LCVL 2A1WH 5D7SL 1VA9A 4HGWB 1FZKB 2NW2B 3KNBB 1CGSH 4YXKH 4MA1B 2AVGA 5J13B 3KPQB 3CVHL 1KULA 3S9DB 2B4CL 3DUSA 3QRFM 4EUPB 3V0WH 3C5ZA 1BP3B 3F58H 1T1ZB 5DVKA 2DBLL 2DD8H 5E8EA 4TVPD 2Z8RA 1OAZL 5FYKU 5A43C 2HRLA 3M17A 1V3LA 4ZFZB 3IJSA 3F62A 3PWJB 1WGOA 5I1AA 1GZPB 3FFDA 4Q9CA 3I2CL 5JO5B 4O5LL 5T1KD 1MWAL 5H2BA 3CCHA 2OP4L 4DGIL 3ZYZA 4U1NA 5DGRA 2AJYH 3TV3L