5KVEH

Zika specific antibody, zv-48, bound to zika envelope diii
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
115
structure length
115
Chain Sequence
QVQLQQPGAELLKPGASVKLSCKASGYSFSNYWMHWVKQRPGQGPEWIGMIHPNSGNTKYNEKFKNKATLTVDKSSSMVYMQLSSLTSEDSAVFYCARLGNDMDYWGQGTSVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZIKA Envelope DIII
publication title Structural Basis of Zika Virus-Specific Antibody Protection.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 23
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2016-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kveH00
1RUML 1RHFA 4NWTH 3QFJB 2ICEA 2W9EH 3CSYA 4IOFC 3MV8A 2VIRA 2X4TA 2X4OB 3RFZC 1FFNA 4J3WA 3V4VH 5AYUH 1QFWI 1PZUB 2XY1A 4O02H 5AAMA 1CF8H 1R3JB 1FYTD 4PYHA 4ZUSA 5IJKA 4X4YA 1B9ZA 3S5LG 1UB5B 2BSSA 3VXQB 4FQXD 3B9KB 5I1LA 4LIQH 1A9BB 1RJYB 4P2RB 3V5HB 5CWSB 5FOBB 2XN9A 4A2LA 3EYFB 3WD5L 4MQ7B 3ABZA 4Z7WF 1EEZB 3QQ4A 3SJVA 4J2XA 3S96B 4NZDA 1OP5H 1C5DB 3LRSB 1F02I 1JHKH 4ZNEE 3WFZA 3I50H 2HFEB 1FNGA 3O3DA 4HFWA 4Z7OE 4HD9A 4K8RD 1DQML 1NCAL 5IM7B 3PWPA 4FHBD 4JFOA 4LF3B 1T1WA 3E0GA 5DJXA 4KGLA 1W0VA 4YDJB 1N6QL 4IMKA 4CMHC 2XPGB 3A6BL 5CSGA 5GXBB 5I17A 3IFNH 5C0BB 3C2AH 4OI9A 3RA7H 5HHVL 3H9ZA 1BZQK 5GZND 1LDPL 4XRCA 1KJVA 3E3QE 4QRRB 3GHBH 3HMXL 1NCTA 2F54E 5B4MD 4JHWH 4YX2H 3WIIH 2Z4QB 3KVQA 3OJMB 2XWTA 3QUZB 4JFHE 3VGHA 2BFVH 4OD1L 1YYLH 5IESH 4P4KA 2AJ3A 3RUGB 3MRJB 5LGHH 1ZWIA 4QXUL 3CFKB 5HJ3B 1KIQA 1VEOA 4ODBD 2YSSA 4M93C 2X1OA 4X6FA 3OMZA 2FIKB 1HE7A 4NUJA 3IGAB 3HMWH 2DIJA 3KPRD 3PQYA 4R0LB 1KXTB 5FO8A 4QF1A 1G6RA 5E4EC 1MFEL 1G9MC 4F9LC 3L3OA 1U41A 1KCSL 1I9IL 1Q0YH 3IU4L 3IXTB 3BJLA 2VABA 5ID1A 2E7HA 5INDB 1S5IL 1YY9C 4KI5F 5HHME 3OJDB 4HX1B 3CLEL 5CEYB 3CMOH 2QSCL 4XTRD 3GB7A 3FFCE 4ZFGH 1WCBB 3UX9B 5T1MA 4U1NB 3QIUA 1UVQA 1FHGA 4P49A 4L9LC 5HHQB 1MJ7L 5J11B 5JA9A 1W8NA 1IC5H 3VGEA 2BNQA 2B4CC 3ARBA 5FGBC 1RZ7H 4BKLA 4KKBD 1EHLL 1Y0LA 2PF6A 1EHXA 3TPKA 3U36A 3JTSA 1NFDE 4DKEL 1KTDB 3NGBC 3CC5B 2F8OA 1ZV5A 1CLYL 1WSST 3BIKA 3IFOA 4X6CF 5AEAA 3CK0H 2GSIB 2IPKA 5A2FA 4XNQB 4ZFZB 1CLCA 3MBED 4PLOB 4FQ2L 5SWQA 5C0CD 2CK0H 5D7LB 1A6UH 4M7JH 4Z6AT 3S97C 4HG4J 2X4RA 2RFXA 4U1LA 4X8JA 3JWDL 4BELD 4OV5B 1ZLUK 1YMMA 2ADIB 2V7HB 1N6UA 3NFPA 4BSVB 4ENEC 3QUKB 5I1EH 1IKFL 1AJ7L 4LCYB 4D0DA 3LS5H 3OAYH 3TA3B 1SEBA 2FGWH 1JPST 3WLWD 3SPVA 3NN8A 3QXTA 1OGAD 4XP4H 4B0MM 4XNMB 1FN4A 3UC0L 5CILH 4OLVL 2FECL 1EERB 2XKSA 5C0EA 1F42A 2YOCA 4JM4H 1S8DA 1D9KB 1TQBC 1YEKH 4GG8B 3U79A 1WITA 2ADGA 1OAXL 4HKXA 4M4PA 3QO1A 5DI8A 4R3SB 3IXAB 3VFMB 3MLYL 5IVXB 4JQVC 1W0YT 4W81A 2QHRL 3G04A 4Z8FH 5K9KB 3H9HB 4GW4B 2VXUL 1H8OA 2AK4A 1BM3H 4TSBH 4ONHB 1AR1D 5IB4B 3L5XL 5C0JB 3IU3B 5KN5A 5LKNA 1ETZB 3EDJA 4PRHA 1J8KA 1IQWH 4TVSa 1T21A 2V2TB 5EC2B 4P48A 1AC0A 2P4AB 3FT4B 1ZT7B 5KANG 4JPKH 5C6TH 4Y4FD 1LK3L 1RUMH 1KLUB 3SDDD 5J6GA 5D5ME 1KTLB 3QFDB 4O4YL 4XBGA 3MCKA 4FFYH 4X99A 3DMMA 5KBNC 4LBEA 3CJJA 1DVFD 3QH3B 5GIRA 3WNNA 5LXGL 3P73B 3N85L 4HJ0D 3FN0L 4OIBA 5K9QG 3K8MA 3O2WL 4GUPB 4PRIE 2C1PB 2X89A 5HGGS 1JN6A 1QFUL 4JFEA 1I7TB 2UWEA 3LN4B 4ZFOB 5I8EA 1JL8A 3RDTB 1FZJA 1KIPA 1IM3A 3WD5H 1UKTA 4JCLA 2ITCA 1UWXK 4G5ZH 4GRWE 5BZWA 3BPLC 3MNZA 4JY4B 2FO1A 2WIMA 5KSAC 5E8OB 2K7QA 1H3XA 1AXSA 5F88A 3EKCA 1KT2B 5JHDD 2PYEA 3WHXB 1RUKH 3MV01 1IGJB 3BQUC 1NCAH 3UTOA 5KSVA 4OZGE 5FCUH 5C0ND 4YDVA 4IRSB 3O6FD 5IGXL 1N6QH 4BM7A 5TE7L 3Q0HA 4V2BA 1KULA 3C09B 3A6BH 4GRMB 1F3RB 2YD6A 1MEXH 5C08A 1BPVA 4OFDA 5CHNB 4PRPE 4P23C 3BRDA 1XR8B 2PXYC 5HHVH 2P5WE 2VZTA 2XTLA 1LDPH 2ESVA 1X5KA 2IBZX 3HMXH 4X0KB 2ENYA 3STZB 2VRAA 4Q0XL 2VDMH 4U4BA 5DEZA 5EO1B 2NPLX 5FF6A 4NBZB 2IBZY 1FLRL 2ATKB 1DQJA 1ZLSL 3U30B 4OD1H 4Z7VB 3RX5A 1EFXB 4QXUH 3VXOA 5I1DB 3OB0H 5DJZB 4R6UA 2CIIB 2ID5A 2X4OA 1JPFB 3T65B 4BQ6A 4R8WH 4AZ8A 2OK0H 1S5HB 4JM2C 4TUOB 3QEHA 2AV7B 4WW1B 4PGBB 3DXAE 5F6HJ 1BVKB 1UB5A 1KCSH 1I9IH 4KMQA 1U6AL 2E9JA 3VXQA 2P48B 4P46A 3IU4H 1S9XB 4KZDH 4V1DD 4L8DB 1RJYA 3RGVB 3GMLB 5CBAB 5CWSA 4ZS6C 1L6XA 3QWQB 4HW6A 4F15B 3CLEH 4R2GB 2QSCH 3FQRB 4RISH 1EEZA 4NO0A 1JMZA 2P1YA 3S96A 3VXSE 1QFWL 3SDYL 1K4CB 1IM9A 1UENA 4QXWA 4XP1L 1FL6A 4LQFH 1AFVL 3TN0C 5DTFA 2HFEA 1MJ7H 2X70B 2YPKB 5IP4A 4KDVA 4M3JA 4J8RB 1NC2D 3FTGB 4LF3A 4DKEH 4G80A 4QHKI 2FO4B 4YDJA 3RZCD 4L4TE 3Q5YA 2XPGA 2ZUQB 5HYIA 3DX6B 3KXFD 5C0BA 3RWFB 3HHRB 4XPAL 1WT5C 3EJZD 1PBYA 1DUYB 4FQ2H 4GSDL 1MLCA 2CJUL 3BZFB 3J7HA 3OKYA 1LILA 5KANI 4PJFE 3IFPA 4WTZG 4LLMB 4PRNB 1D5IL 1LO3L 1Z9SA 2PW2A 3JWDH 4FA8A 3R1GL 1YY8B 3QUZA 3DARA 1DE4B 5D7IA 3GSQB 5MERB 3V2AR 2VXSL 5K9QI 3RUGA 3K2UL 3MYZA 1IKFH 1AJ7H 3BPNC 5DT1H 3KPLB 5HJ3A 5E2UL 5ICXB 2GY7B 4CVWA 4QTHB 5JA8B 2DBLL 3PXJA 3BGMB 1IAOB 1OAQL 4Q6IC 2J6EH 3UC0H 4OLVH 4G8IB 2YN3A 4LCWE 3LB6D 4JCMA 1GGBL 4XP9L 3VI3E 1OAXH 3LKSB 3VFPB 4ZOAA 3MLYH 3IXTA 2WINA 4HAGA 2QHRH 5INDA 3OG6B 1SY6L 4RMVA 4NPYB 3OJDA 5CEYA 2HTKD 1T2JA 4NQTA 3QUML 3VMNA 1WCBA 1FL5B 1KPUB 4U1NA 1B3JA 3FQUB 3WXVL 1RI8A 3FZUC 3KHQA 4OM0L 1H3GA 5L2KB 1LK3H 2R56L 5DO2D 5IFJB 4G7YL 3K4DA 1KGCD 2C3XA 4O4YH 3UTQA 4PV9A 1P4BL 3WNMA 4LVOB 5LXGH 3IAQA 4IDJL 2NY5L 3QEQD 4MQXD 2BOBB 3O2WH 2R2BB 4KKAD 3VD3A 5D2LB 3MRCB 4ZFZA 5HYJB 4X9HA 3MC0A 3OL2A 3UMTA 5D7LA 1UQSA 2FYYB 4M62H 3DVNB 4YFLF 1WFUA 4IRJA 4QRUB 1Q9KB 1I4FB 5J6HA 5E8PA 1N3NB 4UT7L 2YD4A 4OV5A 2V7HA 2ADIA 3SDXB 4F7PB 1LK2A 4BSVA 2NZ9C 2VSDA 5HDQH 3MJ7B 4YO0A 2XV6B 3JVGC 1X44A 4LCYA 4Z7WE 2X1WL 4LNRB 5ACMA 2QSQA 4HEPG 4LSVL 4ELMB 3F5WB 4QHLB 2WM0A 4JFQB 4U3HA 4AYFA 3H7LA 4KH2A 5LQBL 2G5BA 2DL9A 4W6WB 3KWWA 4UOJA 4ZSOB 5BO1L 2DJUA 5IGXH 4YGVB 4JO4L 5TE7H 1D9KA 4GG8A 1UH3A 3BP5B 4YNYB 3BSZL 1D7FA 1EBPA 1DR9A 4CL7A 5IVXA 4K3HA 2VDQL 2Q6WB 5ICYB 1MCKA 4PV8B 2XZAL 1FVCA 4DWHA 5BXFB 4LCCB 3VXMB 4LLWB 5HGAA 5C0JA 5IB5B 4DJMA 2AW2A 3WN5C 1NKOA 4M5ZL 4G9FE 1ZLSH 4X8XA 1NPUA 1JUFB 4EOWL 1Z3GL 4PJ9D 2QEJA 1ZT7A 5DJ8B 1V05A 3X11B 1KLUA 3FO2B 3U7WL 4ELKB 2C5DC 4OLEA 5JOPD 3QH3A 5FUCC 4F3FB 4GUPA 2C1PA 4ZOBA 1DFBH 2QADD 1FJ1B 5CAYB 1U6AH 3DRQB 5FA3A 4XAWL 3IJSB 1I7TA 1W2KT 4O2EA 4YHIA 4ZFOA 5FKPB 5DUML 2KBGA 5FO9B 1MQ8A 2NW3B 1XZ0A 2EE3A 1DJSA 4M7LL 1HI6A 3OKMB 3LHPL 1QFWH 5E8OA 3SDYH 4XP1H 1AIFB 1WBXB 1AFVH 1C16B 3FO1A 3W0WB 5K59F 4KI5E 5D2NC 1CWVA 5CZVL 5IOPB 2R4RL 4I0KA 3WHXA 3MUGA 3JUYA 1IGJA 4QEGA 1MFBL 3OPZL 4IM8A 5DJ6B 1CXHA 4IRSA 5MI0C 4ODUA 5ACZA 4K94C 2OL3B 5T3XD 3NH7L 2EIEA 4WTXA 2AJSL 4WHCA 4GRMA 1YEHL 4N0UA 2IALB 3WLBB 3U0PB 4HKZB 1NCCH 5CHNA 4YBQC 1XR8A 1I7UB 2UZYB 4O58H 1E6JL 2XA8L 4GSDH 4AT6B 2CJUH 1VA9A 4PBWD 5DEFB 3ARVA 4GBXB 1D5IH 1LO3H 5JO5A 4X0KA 3C5ZA 1S7RB 2VWEE 1R3HB 5EO1A 3R1GH 5EDXA 4MD4B 4BK4A 5F44A 3HAEH 4XI5C 1ONQB 2LV4A 4LMQI 5CCKL 2ATKA 4KDWA 4WO4B 5T5NF 2IQAB 4LASL 3JBG7 4Z7VA 3BDYL 3K2UH 3G08B 5E2UH 25C8L 2DBLH 1FG9C 2CIIA 5FGCE 1FIEA 4AEIL 1OAQH 2J8UF 5F7DB 4PJ5E 1JPFA 3HFMH 3ZO0A 1MQKL 1PY4A 1GGBH 4XP9H 1S5HA 4TUOA 2AV7A 3Q6GH 4PGBA 1BVKA 2D4FA 1JCKA 1EHAA 1S9XA 5DD0L 1SY6H 4L8DA 3RGVA 5CBAA 1ZHBB 3ARFA 2GSGB 5E95B 4UDUB 2P45B 3VA2C 1NMCC 5C3LD 3FQRA 5SX4H 3MJ9L 2P5EB 1CE6B 1K4CA 1VADA 3WXVH 3ARED 3PGDB 5FM5M 4D2NA 3D3VD 2X70A 4OM0H 2YPKA 4I48B 4KDTA 3CFEB 1DN2A 3VFGL 2R56H 3MMEB 3VG9B 2EICA 2AJZB 4J8RA 3MNVB 4LRIA 5FYLE 1IT9L 3FTGA 4OD3L 1FYTB 1MNUL 3OX8B 1SJXA 3QDGB 5GRYA 4R97C 4IDJH 2NY5H 4K3JL 4KTYA 2GTZA 2E7BA 1TLKA 3NIDE 3RWFA 3L5WA 2CR3A 2VERN 4BZ2L 1DUZA 1E27B 3S3SA 5JDJA 2R0ZH 4LLMA 4PRNA 3WUZA 1JK8B 3VGAB 3NFNB 1JRHI 4JHAH 4ZDHB 3TYGL 1DE4A 5MEND 3GSQA 5HYSG 5MERA 1NL0L 5CGMA 3MO1B 1HOCB 1A7QL 3RVXC 3T0EC 3K81A 4LSVH 3X13B 1CFSB 1DBJL 1EAPA 3BGMA 3L9RA 5LQBH 2OTUA 3OKOB 2M2DA 3KPNA 5BO1H 3ARGC 4JO4H 1OTSD 5EOCJ 4F9PA 4X9GA 3FOLA 1ZKAA 4Y4KA 2WBJA 1IZJA 1ZHKB 4YAQB 2FH8A 3BSZH 4BQ9A 4HK0A 3L3DA 4ZS7L 3SCMD 3VFPA 3JV6A 1EVTC 2W9DL 4GXVL 4Y5XB 4I1NB 1K5NA 4F7MA 3ULUD 1J0KA 4J3VA 3EYVB 3QDJD 1YNLH 4M03A 4P2QE 5I30H 1S3KL 2XZAH 5F7WC 4CVUA 2Z8WC 1GCFA 5DJ0B 4IOFD 3FHQA 4G3YL 4PP2B 3UP1A 4M5ZH 3F7YB 3MFFA 5DRXB 3UTTB 4JO2L 2VAAA 5JPNB 1CQYA 5FYKL 4EOWH 1Z3GH 2H9GB 4M1DL 4HWZB 4MMXC 5L2KA 1BOYA 1VFAB 5IFJA 3KPRB 4ZMAT 2JJWA 3AM8C 4Y5YB 4PUBL 2W0FA 5ENWB 1A47A 2WMPA 1D5XA 1GC1H 5HXMA 1ZVSB 2BOBA 3OAZK 4N8PA 5D2LA 3MRCA 4DGYL 4XAWH 1BX2B 3PHOB 3NIFF 1IGCL 2UWEF 3HPLB 1UJ3C 4KUCF 5DUMH 5EFIA 1TPXB 3LDBC 3S98A 2FYYA 1S7XA 1U36A 2HRPH 2PUQT 3DVNA 3NCYP 4U49A 1KELL 3VFOB 4M7LH 4PJ8B 1N3NA 4RMUA 1MHHA 2MFNA 2X9YA 2HMID 2HJFB 1Q8MA 3LHPH 4XCEB 3SDXA 4F7PA 2DN7A 1NSNL 3LEYH 1XIWA 5IMKB 1D6EA 5EBWB 5CZVH 2R4RH 5T3ZL 4PJCB 4LNRA 4NFCA 1MI5B 5CJXA 3TESA 4KQ3L 1MFBH 4QHLA 5HI4C 4ZTPH 4I9WE 1CK0L 1UXWB 4Y5VC 5F8QC 3MTRA 5CINL 3QWOA 4JFFA 3NH7H 2EYRB 1OAZL 2AJSH 2E7CA 1YEHH 3MBEB 4YNYA 4HZLA 1T1ZB 4JVPA 2CKNA 3MJGX 1XGPB 1E6JH 4D94A 2XA8H 3NIGE 5IJVB 4E0RB 1RUPL 3DX7A 1MIML 3VH8B 2W92A 5DQ9B 3T04D 2RB8A 4ZFFA 5BXFA 1TJIL 3VXMA 1B2WL 1CT8B 4IHOA 4U0RC 2MKLC 2CRIA 2OJZH 2Y23A 5CCKH 2ZG3A 4LASH 1S7VB 1OGAB 2WQRA 3BDYH 5DJ8A 2DLTA 1R5IB 25C8H 3JWDC 3X11A 1T6WA 3ULSB 4ELKA 3I84A 1CFQA 4L3CB 4MJID 2VQ1B 3X14B 3BKYL 2OZ4A 1I8MA 2CMRL 3EOAB 3MA9L 3QHFL 3ZTJG 3G9AB 4BFGA 3IJSA 1VGKA 1F11A 4M48L 4KTDL 1ZAGA 4IJ3C 2NW3A 3MREB 3GMOB 5KG9B 4YFLI 3RY6C 5IFAL 3OKMA 3QIBC 5IEHB 3MJ9H 4K7FB 4K9EH 4RFOH 1L4IA 4L4VD 1AIFA 4HUMB 5I71B 4Y4FB 4MCZA 3W0WA 1JFQL 2VE6B 3SDDB 5IOPA 1G7IB 1Q1JL 3EOBB 1G7MB 4TSAL 4HSQA 1DVFB 1RK1B 1GIGL 4XMKL 5LWYL 3EYSL 3UYPA 1IT9H 4HULB 4OD3H 1MNUH 2AJUH 4CKVX 4JFDE 2R69L 4ZAKD 5CD3B 5F9AC 2VLLA 3WLBA 3U0PA 4YHLL 3O4LA 3BRGC 4LLYB 1I7UA 1QSVA 3ROLB 1N2RB 2W0PA 4ENED 4AT6A 5D96B 3BVNB 5DEFA 1CDCA 5L2JA 1BFOB 3MRMB 4XAKD 4JFPB 2VZOA 1R3HA 5C86A 5CIPH 2ED8A 5JHDB 1JPSL 4MD4A 3TYGH 2AJXL 1F4WL 2JJTA 3I85A 3PL6C 4WO4A 3S4SG 2IQAA 1DEEA 1NL0H 2R0LH 5D7IF 4FQJL 1A7QH 4ZTOL 3G08A 1T0PB 4EDXB 2PYFB 3C08L 1P4IL 4EXPX 1AGDA 3DI2B 5F7DA 4AIOA 2B5IC 2VSCA 3JZ7A 5AZ2L 3T08A 2R9HC 1A2YA 2VQUA 5GRJL 3SDCB 4TTDC 5CLWA 4ZS7H 2EDYA 5GRVL 4JZJB 3IDGB 5IEKA 2W9DH 4GXVH 4UTBL 2IAND 3MLWL 4NC2B 3ZT6A 1PDKA 4ZYKA 1JZ2A 1S3KH 2GSGA 3NA9L 1T5WB 4UDUA 2VQTA 3O4OB 5EZLB 8CGTA 1HYSC 2NTFB 2IH3B 2P5EA 1CE6A 5JXEA 4G3YH 3AS2A 4ZXBD 1CR9L 4JO2H 5GGRB 4LLAA 5FYKH 4B50A 3NABL 4M1DH 4QTIL 1QTYT 3ARDC 1U8HB 1Q9OB 1TZGL 3MNVA 1QLFB 3MBXL 4PUBH 4W4NA 4DQOL 5JMOC 3RI5F 3E6HB 4P3CL 2EDXA 3HG1A 4J4PC 1X5XA 3MSPA 3QDGA 4TPRL 2P42B 3E6FB 1HQ4B 3BKJL 3SE9L 1YMHA 4U1SB 5IF0A 4V1DB 5KSAD 1UM4L 4IOSD 4DGYH 2AV1B 4KRPD 2VDRH 3MV8E 3X12A 1QSFA 4EN3C 1IGCH 2AXHA 3PP4L 5DQJA 2HT2C 4G43B 1JK8A 5BVJB 3BQUD 4MSWB 3BI9X 1DDHB 2BXZA 4LAQL 1RZIB 1M7XA 1NSNH 2XN9E 4YDKL 1HOCA 5T3ZH 1NC2B 4C57C 4DUXA 3NFSL 5ERWB 2BSTB 2UV3A 3X13A 3MJ8A 4MWFA 3BD3A 3LV3B 5DWUL 3RZCB 3SJVE 1CK0H 3IDJA 3LPGA 5CINH 5K59E 3KXFB 4NWUH 5D1QD 1OAZH 2HVKB 4U1GB 4M7ZB 3CFCL 3BFOA 4NN5B 3MCLL 1OTTC 1RD6A 3MV9E 3BH8B 3PWPE 1NBVL 5IVXF 2DQJL 5IW1B 1VKXB 4E41D 4JRYD 1AGBB 1RUPH 1MIMH 2F53D 3GIZL 4FRWA 1L7IL 2CLRB 5IMLB 3Q48A 3ZE0F 1B2WH 4L8SC 4N90E 5DJ0A 3I02A 3ZYJA 4JB9L 4O2FB 2EDJA 4JG0L 4KUZL 4HC1A 4PP2A 3F7YA 5LBSL 3UTTA 5I15L 2O61B 1SJHB 2DQDL 2HVJA 4WFGD 2ZKHH 5GS1B 4KMTL 4KROD 4PTUB 4F57L 5KS9E 1T03L 3KPRA 4Y5YA 2GUOA 2HLFC 1JV5B 3SGEH 1CZ8L 4PJ7A 5D7SL 3HI1A 4U7SA 2FEEI 3VXNB 2CMRH 1CDYA 3QHFH 3MA9H 5IK3B 2NY4D 3U4EA 4JZOA 5BW7C 5FYJE 1G7PB 3ZT5A 3RJDA 1BX2A 3PHOA 2PTVA 3HPLA 4M48H 3TN0D 4HKJB 3PQYE 4KTDH 4ZO6A 4ODVL 4X83A 2ICWJ 2XG5A 4X9BA 4PJ8A 1UACL 2QBWA 4NO2B 4X6BB 2E6QA 3BAEL 3ZDYF 3GGWB 5CZXC 3RX8A 1DEDA 2GKIA 1RZGA 1PEZA 1JFQH 3UJJL 1C08B 1Q1JH 4PJCA 4NCC2 3PNWB 1MI5A 4TSAH 4XMKH 1GIGH 5LWYH 3EYSH 3DSFH 3QEQB 1ZTXL 4YPGA 2FX7L 3BOVA 2A77H 4PJHA 3VD5A 5CD5C 4GW5A 4F8TA 1EPFA 2BNQE 5B21A 1RK0A 2VUOA 4X7TA 1OP3H 4NYLA 3WNOA 3ZKXC 3ETBF 1GGCL 5C0AD 3BP4B 2Z31C 1CE1H 3QQ9D 5SWZD 5T5FL 5IJVA 5HDLA 3KYNA 3Q3GA 2OL3L 3VH8A 2P8PB 2NY5C 3WFDL 5C09A 1CT8A 3H3KA 1JPSH 1DP0A 3NCBB 5EBGA 4Z7UA 2AJXH 4FQJH 4D8PB 1OL0A 4Z7VF 4ZTOH 3U46B 2EDWA 5HTSA 4K7PL 1A1OA 1R5IA 3C08H 2H8PB 5IG7B 3ULSA 4LPVA 1P4IH 2BCKB 4TSCH 4G8EB 1W72B 2BHUA 5AG8A 4I8DA 5KTEL 2DM4A 3X14A 1X7QB 5AZ2H 4KK5C 3QWRA 3F7PC 3SDAC 5GRJH 2CUMA 5JXED 2EO1A 4R4NC 4WI7A 2NY2C 1JGEA 3ORJA 4OF6A 3MLWH 5A43C 1A3QA 4OZFB 3NA9H 3GMOA 4DK3A 2KL6A 2KPNA 3MZGB 3HZYB 3WJJA 3LKOB 4K7FA 1KXQE 4Y4FA 4AEHL 5D93C 1NQBA 1ZGLM 4G6KL 4NJ9L 3SDDA 3RPIB 3NABH 1G7IA 4QTIH 2AK4E 3VFRA 5C0GB 1V3KA 4WI3A 4M1CD 3HPJB 3VGFA 4WWID 1TZGH 1SVZA 4PRHE 3MBXH 4QNPE 5A2JH 3QXDA 4P3CH 1D5BA 4HEME 5I66A 2VAJA 2QADB 4HIHB 5CD3A 1S7SA 1PFCA 4Z0XA 5GGUB 3BKJH 4XPHL 3O9WB 1FZKB 4MNQE 1UM4H 3GIVB 1S9VB 3MUJA 4PJXA 1ZVHA 2YMXH 4LLYA 3T0AA 3DYMA 1UYWL 3BVNA 1KCVL 1MSPA 2NZ9D 5E6IC 4XPGL 3P0VL 1BFOA 3MRMA 5JUEL 5CJ8A 2GJ6A 1YEDB 1Q9WB 2IFGA 1JYXA 5ELIA 3NIFE 4JFEE 2UWEE 3K4ZA 5GGSY 1NMBL 1H5BA 2QHLA 5B3JF 5DZNA 3LSOB 1NEZA 2D0FA 3NFSH 1J5OL 4EDXA 2Q8BL 3WO3B 3H7BA 4XX1G 3TBWB 3GMNB 1WBZB 3OTTA 4ZO7A 4K8RL 5BMFL 1NBQA 1YJDL 5F1SA 7FABL 3CFCH 3WIHA 3MCLH 3SDCA 2JELL 5BZDB 2J7LA 5SV3A 4JZJA 5JOFB 3SN6N 3IDGA 4ONGL 1NBVH 2DQJH 5F1NB 1LEKB 1JPTH 2APWA 3GIZH 1L7IH 5EU6D 2I26N 1T5WA 1KIUA 2DOCA 5C08E 2PETA 4JB9H 5IB2A 4JG0H 1ITCA 4KUZH 1GPOL 3D87B 4PRBB 5LBSH 2GK0B 2X4SB 4H1LA 4NBYB 5J1SC 2DQDH 2ESVE 2ZNXA 4BFBD 3ZSTA 3HNSH 1MJ8L 4G9DA 4KMTH 4F57H 1U8HA 1T03H 1OD9A 1RIUL 4WHTB 2ITDA 4WFFD 4QRSB 3H9SE 1QQDB 3E6FA 2HP4A 1HQ4A 1UB6B 3VGDA 4WW2B 4DK6A 4LPWA 4N0YL 5HVHB 1KENL 5ISZD 4LL9A 1CXKA 2AV1A 1WFNA 1P84K 1RJZA 2BVOB 2EDQA 2HT4C 2A6JB 4S1DD 5D2LF 1D5ZB 2VXVL 3BW9B 4GAJL 3BDXA 4GKNB 4ODVH 2XNAB 5CBEA 2ZWLT 3QCTL 1E4JA 5GRWA 4MDJA 3AREB 4MSWA 5F3BA 1EEUA 3W11C 3D3VB 4I0PB 1ZOXA 3LD8C 1UKQA 3SDXF 1RZIA 3UJJH 3B3IB 4R0LC 4RRPA 2V9QA 5KSBB 1ADQA 3TIDB 4O51A 5ERWA 5KVMC 3IKCA 3LV3A 2XKNB 4YBQD 3D6GA 4HF5L 3ZE2E 1ZTXH 4GRLC 4PLJC 35C8H 4D9QE 2JCCB 3C6SA 2DQTL 5B39A 1LGVA 1GGCH 4YQXL 4XI5D 4UIMA 4ODTL 3BH8A 5IW1A 1VKXA 5T5FH 4PRDA 2OL3H 1AH1A 5IMLA 3WFDH 3OKDA 3HZKB 3QT2A 4ZPTB 4KHXH 5C0BE 4OCSL 4O2FA 3DUHA 1U8IB 2BVEA 4L4JA 1N5AA 1SJHA 4CU7A 3MOQA 1NH6A 1G6RL 5EO9A 5IVOA 5GS1A 3L7FA 1BJ1J 3BP7B 5C7XL 1N0LA 4YWGL 3RIAK 2ICWA 5J3HC 4RFNB 2EXYC 5D7IE 1MCDA 2XG4A 3I2CL 5KTEH 3SCMB 3V7MA 4JRWA 4P5KA 3UCRA 3RUGE 5DK0A 3VXNA 2BVUA 4Q9BA 3QDJB 4UU9B 3EJYC 1RIVL 3R0NA 32C2B 4LVEA 1WWCA 2YKLL 3TA3C 2ZUUA 4EVNB 2FD6L 2B1AL 3LEXB 4MJ6A 2FEEL 4AEHH 4G6KH 4NJ9H 5DRWB 1IMHC 1I1YB 5DD3L 3BEWA 1BIIA 3PNWA 3KPOB 1MCIA 4Z5RA 3HC0A 3C8KB 3TO4C 3QEUB 3L1OH 1SM3L 1MF2H 2G9HB 4CU8A 4ZUVA 5DD6B 1PSKL 2QTEA 4UOW1 2M26A 1MOEA 43CAA 3ULVF 3O6LL 2LTQC 5C0RL 1MPAL 4XPHH 4XB8A 4F7TB 1GSMA 3RNKB 5E5UB 1UYWH 5HDBE 1KCVH 1N59B 1GZPA 4Y16D 4XPGH 3DSNA 3P0VH 4PRAB 5JUEH 1EH9A 2CLZB 3LOWA 1XGUB 3VDAA 1AHWB 5L88L 1BVLA 5JW3L 2EE2A 3O6ML 5D1XD 1NMBH 1O5DT 1NCWL 5D7LE 2D31B 2V6HA 3U46A 2WZPD 3P77B 4WCYL 1J5OH 5IG7A 1U92B 1QR1A 3DIFB 1T0NB 5IBTL 4G8EA 4QGYA 1WBYB 4K8RH 1YJDH 1WF5A 2EYSB 3QI9C 7FABH 3RIFK 4UILL 2JELH 4S0SD 4ERSL 1MFAH 4ONGH 4CBPA 4B41A 3PJSB 5E9DD 3ARRA 5DFVD 5A2LH 5HGDB 4OZFA 1IGFL 3QXUA 3EGSB 2BRQA 4UAOB 4X5XA 5IR1B 4YHPB 1ES0B 3W9EB 5FM8A 4M5YL 5IVXE 1GPOH 5MEOB 5E4EB 4NGHL 2JJUA 5FYKE 4HWBA 2GIYA 3ZE0E 5IMMB 5C0GA 1MJ8H 3IB4A 4QGTA 2SEBA 1YN7A 1N0XL 3HPJA 4JKKA 5E99L 4MJIB 1RIUH 2DQUL 4HIIB 1E4XI 1P7QA 2VZVA 2VR4A 4JFXB 2HJLB 3NZ8B 3ELAT 4Z77A 1P1ZB 3GRWA 4HIHA 5TE6H 1F6AA 3E1F1 3CSGA 1FO0A 1XGTB 4N0YH 3O9WA 1FZKA 1KENH 5H35B 1XF1A 4L9LB 6FABL 3QXVA 3JWNC 1E6OL 1CDGA 2BRRL 3BHBB 2ORBH 4GAJH 4YUEH 1M6OB 5DHVA 1A5FL 3QCTH 3MGTA 4L4VB 3VFWB 5ANMB 4NUGL 2HLAB 5HI4D 4UB0L 4UTAL 2DQGL 5ALBL 3S3PA 4FTVA 1JZ5A 4N8VB 4ODSL 2CGRL 2OXGA 3UAJC 5F6HI 4HUVB 3WL9A 5HD8D 3ZDYE 4HJGA 1KJ2B 4KPHL 1FFOA 3TBWA 3GMNA 3TNMB 3MXWL 1EXUA 4NT6B 5DEGB 3HUJA 2A9ML 4HV8B 3V5KB 3B9AA 4JRXA 4AJ0A 3CH1A 1KEGL 5JORB 1JNLH 1VACB 5BZDA 2KQNA 2DQTH 2GQHA 3C87A 4I77L 2HT3D 4ODXB 1MH5B 4I4WA 3GSRB 2XY2A 4RBPH 4ODTH 5FB8B 5CGTA 1LEKA 1PG7W 3VXTA 3ZTJH 1P84J 5DDHB 5A1AA 3T0BA 3GBNH 3C5JB 4GJTB 1HXMA 5TDPB 4N0UE 3ECBB 3RWIB 4OCSH 2PR4H 1VEPA 1HSBA 1TQBB 4PJGB 3SKNB 3VWKC 3BYYA 3UDWA 4PRBA 2NY0C 2GK0A 3OV6A 5DMGC 1O7VA 3WEXB 2PW1B 4HPOL 4XNUH 3MRIA 1A7OL 4MHHG 2ZUQC 3EJJX 1FNEA 4CRPA 4N8VG 5C7XH 3GI9H 4YWGH 4AM0B 4QXGH 3L7EB 4OLUL 4LLVB 1ORSA 4QRSA 3I2CH 4LPTA 4DAGL 1AR2A 4Z7VE 4PJ7F 5IBLC 2HJKB 4QRPA 5IHZA 1Y6MR 5F7HA 3WIFB 3QIBD 4QRQB 3H42L 2G60L 4EQ3A 5E6ZA 1D5ZA 1RIVH 4LCUB 1IGTB 2XNAA 3G5VA 4OCYL 2YKLH 5DMIL 3U82B 3UTSB 4ZXBB 3BZ4B 5EU7E 2FD6H 1F4AA 3REVB 2B1AH 4ORGA 1F2QA 4I0PA 3T2NL 4XPTL 3RVVC 5FFLA 4Y19B 1NDGB 1V7ML 3B3IA 4R4BB 3OGCB 3QRFM 5F7EL 5HI3D 4PJCF 4WWKA 3WUWB 4XCFL 4JVUA 4OGXL 1OP5K 3QDAA 1U8JA 1T20B 1SM3H 1IE5A 1DBKL 1PSKH 1NC4D 1CN4A 3D9AH 4RQQB 2Y6SD 3PIQB 3BPLB 5KSAB 3F62A 4J1UB 1NGPL 4PJHF 5IQ9B 5D1ZC 4KRPB 3GNML 5C0RH 1X5LA 4X7FC 1HCFX 1MPAH 3VU2A 4HXBL 2IPTL 3ALPA 4ZD3L 5CSZA 4FQLL 2P24B 4N9GA 3DYPA 4YH6A 3BQUB 1DQLL 1I85A 2DMKA 4MNGB 4ZPTA 4ZNEA 5L88H 5IV2B 2V5TA 3O6MH 3DX8B 1JNHB 1NCWH 4Z7UF 5ILTL 5HPOA 4RMSA 3EYQC 5CJOH 4WCYH 4DZ8A 3BP7A 1XMWA 5D1QB 4XVUC 2P8LB 3BIBX 3K8KA 3I6GA 1FGNL 1AC6A 2HKHL 5B3JE 2X1QA 2YEZB 2PO6D 3DHMA 1I9JL 3SCMA 3WUWG 8FABB 1EO7A 3QRGL 2A1WH 3ARZA 1DLFL 2V5SA 4FQHB 1C5CL 2IG2L 2VDPL 5EULV 2F53B 1HYSD 4UU9A 1OCWL 1T83A 2OCFD 1W0WB 5L8LB 1A6WL 1W72L 4HMDA 3TM6A 5C2BL 32C2A 1IGFH 1F00I 5KVEH 5JIHA 4EVNA 3FQTB 2NXYC 4HBCL 4M5YH 2GJZA 5HI5C 3LEXA 1TVDA 4JM2B 3MACL 1U8OB 4X9FA 3K1KC 1CDJA 1YECH 2H32B 1N0XH 5E99H 1T22B 1FG2A 4AEEA 43C9B 3G9VA 4HGKC 1A6ZB 4S2SB 3BISA 3ZLQC 3MYJB 1U8KB 2DS4A 2WK2A 3CH8A 2XTJC 4LCCC 2MPAL 3KHOA 5L2KE 4IRZL 4GAGL 3TN0B 6FABH 5DSCB 1RJCA 3RNKA 1UXSA 1FAIL 1E6OH 4PJXF 1INEL 1IGYA 4HFUL 1D6VL 1HSAB 1N59A 4MHHI 1NGWA 5F1IA 4MLIA 2P8MB 5LJYH 5D6DC 2WWKO 1WEJL 3EYOB 4PRAA 4URTB 1XGUA 4KHTL 3T2PA 3U4BH 4UB0H 4PG2C 4Y2OA 4UTAH 5D2LE 1NJ9A 5ALBH 3IRZA 2UZXB 5F1OB 2CGRH 1I9RL 3VWJA 1T7VA 1Y6KR 4R4FL 3F6LA 1XT5A 2F54D 1X9QA 4OIAA 3P77A 2A0LC 4XXDB 2Y07L 1U92A 2HN7A 1EJ6A 3DIFA 1T0NA 4JFHD 3SDXE 2YWYA 3QUXC 3CX2A 4NQDD 5ABDE 1WBYA 2Q8AH 2I9TB 3OAYK 2A9MH 2YXFA 2EYSA 3GMQA 2X1XR 3A67H 5C0AB 2Z0BA 3G5YB 1KEGH 5SX5H 5SWZB 1LO2L 2DB8A 4I77H 3IF1B 3H9YA 3BPNB 1HHGB 1GOGA 5D7JC 4UMGA 4ZSOE 4JFFE 1EHNA 1XF2B 5HGDA 5IR1A 3UYRL 5L9DL 3BUTA 4G8GD 1ES0A 4Q6IB 4P3DA 3REWB 3W9EA 3HE7D 1TZHB 3L3GB 3D0LA 5MEOA 4H5SB 4WV1A 2D3VA 1FCGA 1WZ1L 4OGAD 4RAVB 4OGYL 4F9LA 1G9NL 4HPOH 5HHMD 5IMMA 1A7OH 1BF2A 5FK9B 3VXME 5EUKB 3HNVL 3FFCD 4LEOB 1C12B 1R3KA 2AXGB 4TVPL 4HIIA 1HKFA 1BBDL 5EOQL 4JFXA 3DUSB 2HJLA 2WBKA 5M94B 5EG6C 4GKSA 5D7KE 4U1KB 4L8CA 3PDOB 4OQTA 1XGTA 2OP4H 1TTUA 5H35A 4PBVC 3FFDB 1X4ZA 3H42H 2G60H 3VRIB 5CZXD 3BEVA 5FGBA 1EX0A 4JEGB 3BHBA 4L29B 4NQSB 2VUYA 1M6OA 4PY7B 4OCYH 1E4XL 2EDKA 5DMIH 3VFWA 5ANMA 1CDUA 2HLAA 4JN1L 5EZIL 1U3HD 4BFIA 1E28A 1M05B 2V2XB 1WFOA 4XPTH 4Y2DD 2PCPB 1V7MH 4F33B 2GW5A 1S78D 3KNBB 3NCEB 1WAAE 4RCAA 4WDIB 5F7EH 3T2OA 4OCRL 3MLXL 4XCFH 3RRQA 2NLJA 2BERA 2ZCKH 3V7AE 3W0WE 1T04B 1NGPH 4WUUD 5C0FA 2XQYG 3T3ME 4XNXH 2DWEA 1F3JB 4OKVB 4Q6YA 5HY9B 1O0VA 4HXBH 2IPTH 1MH5A 3GSRA 3B2VL 5EWIL 4ZD3H 4FQLH 2E6JA 4NQXB 1DQLH 5DDHA 3MRNA 1FNLA 3EDDA 1KNOB 2RQ8A 2HG5B 2OLDA 3O4LE 4JFZL 3RHWK 4PJGA 3RWCA 3SKNA 2Z35B 4XHQA 1S9YB 5BV7B 5ILTH 4UI2A 2PW1A 1L0XA 4JPWL 4KK5D 4ISVB 1T7WA 4JQVA 2Z91B 4FQXC 3GSOB 4OFIA 4S1RL 2DIBA 4R4ND 2KDGA 3TYFB 2NY2D 1QOKA 3DRTB 1FGNH 2Z92A 5ESAB 2HKHH 4LLVA 1CGVA 2FCBA 1I9JH 4N8CL 1N6VA 3QRGH 2APVA 2DYPD 3OB0K 3WN5B 2IG2H 2VDPH 3CVHA 3VGAC 3HLAB 2ZJSL 1OCWH 5EU6B 4XC3L 3MRRB 2FLBT 1W72H 2E9BA 1DQQA 4K8RC 1EAJA 2F9BT 5C2BH 4N0FA 1YJDC 1OQXA 1IGTA 3VJ6B 4R96B 4PRID 5E94A 3UTSA 3ULUL 3TVMD 3BZ4A 3AXLA 2X09A 4M61A 3T0XA 2VDLL 4Y19A 3MACH 1BD2A 2AABL 5CP3A 3C60D 4R4BA 1PG7L 3QISA 4DCQA 1NCNA 3VXPA 5HHXH 1TXKA 5GZNC 1CLZL 1S7TB 1AE6L 4Q9RL 2Y06H 4FP8L 4LHUA 1CI5A 4Y5XC 2P5EE 1CXLA 4LKXB 1EO5A 4ODHH 3QA3A 5B4MC 2P7TA 3O11A 5KSAA 4J1UA 5FHAH 5GZOC 5E1HB 3MV7D 2FHCA 1JNNH 4F2MA 4IRZH 4GAGH 4S1QH 1MIEL 1UM5L 2MCG1 3DVGA 1Q72L 5D2NB 5KSUB 1FAIH 3BXNA 1OPGL 1BECA 1DCLA 1Z0NA 3RWJA 1CICC 1A6AB 1FYTE 2P24A 3PWVA 3QDGE 4HFUH 1D6VH 1UG9A 3CCHB 1WEJH 1IAIM 4X5WB 4BUHA 1U58B 3CUPA 5JZ7C 4KHTH 5MI0B 1A9EA 4PRPD 5IV2A 3NPSC 3DX8A 1JNHA 4MA1B 1PAMA 3FB8A 1LD9B 3BDBA 1I9RH 4R4FH 1FIGL 4P23A 1VHPA 2PXYA 3STBA 4LLDB 4M02A 1SBSL 4FOMA 5A3IC 4JG1L 2Y07H 1KPVA 1X3DA 1E4KA 3TZVD 2P8LA 2E6PA 5J12B 4XNYL 2YEZA 2D0HA 3PWJB 4HIJB 1XF3B 4P0DA 1LO2H 1EV2E 1AY1L 3OF6D 4PJFA 5T3XH 3WFBL 3M45A 4PJAB 2MQCA 5JNYA 1FC2D 4UDTB 3KYOB 3UYRH 5L9DH 4K7PX 3TCLB 2ZOLB 3DXAD 3GMPB 3HI6L 5BRZD 3BN3B 4P99A 4JO1H 3FQTA 3GBMH 1SVCP 2H2PC 4JM2A 4K7PY 1JJUA 4Y8AA 1G9NH 1ACYL 2JE8A 2Q76A 3P4LA 2YHGA 4NQEA 3L6FB 4Q9CA 3HE6D 5JW4M 3HNVH 2IQ9H 3VXSD 4TVPH 3ZL4L 4NCDA 3FRUB 4PJIF 1NMCB 5EOQH 2FH6A 1A6ZA 2VR9A 1ZLWH 4S2SA 3UTTE 1FV1A 5IIEB 1U8KA 4N9OB 3AC0A 5T1KD 1YUHB 4OIIL 3VI4F 4BK5A 2ZSVB 3W11D 3KPRE 1WQVT 4H1LG 1NDMB 1HKLL 1DBAL 1ZHLA 4HWUA 4KJYA 5IHUH 2P8MA 3BD5A 5E2JA 1E4XH 2K9UA 3BKCH 5JLZB 4JANB 4JN1H 4R97B 1FBIL 5E5RB 5JTWA 2OI9B 2R0WL 2WWKT 3NZHL 2ADJB 4AENB 4GRLD 4PLJD 2C7UB 3S3JA 1WT5A 4OCRH 3MLXH 3K46A 3FRPG 4LCIH 3RL1A 1F4HA 3RAJL 5I1HL 4MDIB 3HUJF 3MRLB 4PJCE 1AGFB 1MI5E 1FRGL 4EI5D 3IF1A 2C4FT 4Y16B 3B2VH 1VB9A 5EWIH 3T0EB 1A1MB 4LCWD 4PJHE 1HHKB 2V9RA 2XOTA 4PY8J 3I75A 3V52L 1CGSL 5LCVL 2BJML 3REWA 3W39B 5HPMA 3ARGB 3VW3H 1HEZB 2VOTA 3PWUB 1BZ7B 4XZUB 5J3HD 1TZHA 3C6LD 1OT1A 3GMRB 3MOAL 4RAVA 3LKPB 4JDZA 4CN4A 5B39G 2QKIB 1A3RL 4L3ED 5DMYA 5FK9A 4YHNB 5EUKA 3NOIA 5F70A 4S1RH 4UUJA 1C12A 2AXGA 4EQ2A 1T1YB 5LGJA 4WU5B 3HTLX 3Q2CA 5DR5L 5TGBB 4Z7UE 3SGDI 2EDRA 3DUSA 4V2CB 3CDGB 1MHPH 4N8CH 1ACZA 5EO0B 3RBSA 2BNRD 3IDMB 3MRPB 4WU7B 1QBML 3VFSB 4U1KA 4BZYA 4NOBA 2I07B 5EU5A 4MB5A 1CFTA 4KU1A 3FFDA 4XC3H 1EK3A 3VRIA 1HYRC 2ILLA 2HFTA 3L3JB 5ITBL 2XKUA 1ZA3B 5FDYA 2A74B 3L5HA 4PY7A 4U2YA 4QHNA 5C0NC 3ULUH 3O6FC 3RWHB 1M05A 2V2XA 3FB5A 2R39A 4HKBA 5F3HB 1KEML 1A3LL 2VDLH 4OAWB 4ORZC 1IC4L 1XGQB 5DJCB 3ULVL 2AABH 4F33A 1DBML 4WDIA 4X6DB 1PG7H 4Y4HD 1AD9B 1UJ3B 1CLZH 4Q9RH 1AE6H 3CX5K 4H0HB 4HPYL 5I16B 3ZDZF 1J0IA 2WV3A 4OF3A 5EBMB 4AQ1B 5I1AB 5HVFB 2EYTB 2PTTB 3CSBA 4NC1C 3I6LD 2GYSA 5DK2B 1FH5L 4GW1A 5CKAA 1PEWA 5FGSA 5HDOA 4M8QB 4EDWH 2ZG1A 3O4OC 5FA4B 5HY9A 4AL8L 1S9KC 3LS4L 1UM5H 1F4YL 1CCZA 1Q72H 1KJ3L 1EBAA 4H0GA 1NANI 1KNOA 4EIGB 3OJ2C 5FUZL 1IQDB 1OVZA 1UT9A 4G6FD 4U7MA 1IILE 2B20A 1A6VH 4RGMC 2Z35A 4JVWA 1UEMA 2AEQL 3FQNB 2OMNA 4Z7OF 1LWRA 1FIGH 4P5TD 1IC7L 3P4MB 3QI9D 2Z91A 3GSOA 1IAIH 5DJAB 4MAUL 3ROOA 5TDOA 4WEUD 1L9MA 3DRTA 4Z0BL 3R06B 4G9FD 5I6XC 3M8OL 4XNYH 4U0RB 3PE9A 4FFWC 3KPSD 3UO1L 4U6XA 3RTQA 2KZWA 4KAQL 3GSXB 1NGYA 2OJEA 5KVFL 3HLAA 5DHYB 1UEYA 1AY1H 3KJ4B 3MRRA 3QJHA 4LGSB 3WFBH 3L5JA 4HH9B 4XWOD 2EEDA 5FOJA 5TPWL 2VXTL 3V8CA 4AK1A 1R3LB 2FX8L 3B83A 4HLZG 3VJ6A 1OSPH 4DVRL 1MAML 1T66C 3HI6H 4DEPC 3C8HA 4HIEA 3RZCC 3EFFB 4WI4A 3VXRA 4X4ZA 4M3KB 1NFKA 2Z93A 1ACYH 1BQHA 4M7ZC 1TQCB 4NN5C 2EDLA 1KPRB 4OQ1A 2L4OA 2QSTA 1S7TA 3ZL4H 4BUGA 4C56B 4IJ3B 5T1LD 4RX4D 2E7LC 4KI5D 5GSRB 3U9UA 3QIBB 4TNWK 2J3SA 1WWAX 4JO3L 1J05A 3F12B 3VFNB 3LRGA 1VGEL 4P46C 4XXCA 5KSUA 1MFCH 1A7RL 1DBAH 1X6NA 3O8XA 4YDLC 1A6AA 4R7DB 4OLYH 2BY3A 3VRJB 3RWEA 3L95B 1ZLVH 2ZNWA 1U58A 4K3DL 3Q6FB 1AP2A 2Y25A 5FV1L 3VD7A 1LD9A 1NAML 3NZHH 3KLHC 2V2WA 4P57B 3M1BA 4P59L 5E1AA 2FJHB 1NC4B 1JF6A 2VDOL 4JQIL 5ECJE 2IBBA 4Z7QF 3FO9B 1E4WH 4NSKB 3T0DA 3O45B 2HTKC 2YK1H 3D5OF 3FB6B 3RAJH 2ICWI 3PWJA 3DHJA 2XACC 3DYOA 4HIJA 1XF3A 5IW6B 2DMCA 1FRGH 5EZOH 3DV6A 3OXRA 3GJEB 4KK6D 1KJ2H 5E8EB 1NLBL 2WNGA 4HC1L 2G75A 4PJ5D 5EN2A 5J56B 2NY0D 5DMGD 4HIXL 4UDTA 5DO2C 2Y7QB 2DWDB 3V52H 1CGSH 1BBJB 5LCVH 3CDFA 1YYML 1INDH 1M71B 2BJMH 2BP3A 3TCLA 3GMPA 4MMZC 4ALAL 4MX7B 2B5IB 3TT1H 3GZKA 3U0WL 1LEIB 3QSKB 5C07A 4UINL 4PJEB 4MQXC 4KV5F 4NN6C 4KKAC 1A22B 1A3RH 4CMMB 2IAMD 3L6FA 3P0GB 1G6VK 3GUTA 5DR5H 3UPCA 3FRUA 5DJ2A 4U3CA 4OZ4A 5IIEA 1ZHNA 3T1WA 3HZMB 2R15A 4KRNA 1L7TL 5FYLD 1L6ZA 3MX0A 4P2QA 4JN2A 3ARDB 3UBXA 3B43A 4HK3N 4PJBB 1S9WB 4Q7DA 5FDWB 4NQVB 1TDQA 4CADB 3BP6B 5F7NC 3BWAB 4HMCA 4JANA 2QQLL 1IGIL 2RBLA 3AROA 1A3LH 1IC4H 4U1IB 3VCLB 2ADJA 4AENA 3LKRB 4MA8L 3QUYD 1MCJA 2EDBA 5D5MF 4EN3B 1J9CT 3T4YB 1ZANH 3DTXB 5GGRY 4HPYH 1BP3B 5DLMH 3IKKA 2NY1D 1JP5A 1KGCE 3BO8A 2R0KL 5I2IB 4MDIA 1FH5H 3MRLA 4EBQL 1X5JA 4AL8H 3GJFB 3LS4H 4J12A 1F4YH 1UZ8A 2M8XA 4LLQA 1ORQB 4GQPH 3T0EA 4PJ9C 1KJ3H 5C6WH 1A1MA 3AY4C 3CGTA 3CPLB 1YNKL 2C3VB 2EKJA 4GRWF 4IRJC 5IROC 4GMSL 2F15A 1M7IB 3QDMA 2NMSA 5FUZH 3W39A 3QG6B 1HDMA 2ARJB 4XB7A 3ARGA 1R5VB 4LSPL 1HEZA 1JPGA 2HRLA 4XZUA 5GGSB 5DMJB 5I8CB 1RMFL 1P7KB 2AEQH 3GMRA 1H8NA 2HFGL 1OSZB 1IC7H 3D2UD 4P4RB 2QKIA 5H2BB 3NAAL 3RBGA 2IF7A 5JW5A 3OB8A 4NQDB 1JYVA 4M7LT 1T1YA 1YQ2A 2X44D 4E9LA 3CX5J 3M8OH 4M9OA 5BV7L 3UO1H 2F58L 3ZHKA 4OBSA 3IDMA 4QHUB 5BS0D 3MRPA 4KAQH 1CS6A 3O3EA 5E7BA 3BMVA 1I1RA 3VA6A 3P9LA 2DQEL 3T77B 4RFEB 3HMXA 4G8GB 1LNUB 2NY7L 3L3JA 5TPWH 3HE7B 4X7CC 4UZGA 2FX8H 4I3SL 3AM8A 1OF2B 5I8KL 4DVRH 1MAMH 3NTCH 4HUXA 4U31A 4JR9L 1QSEA 1FNSL 3RIAF 1X6LA 5HHMB 2EEBA 4M7KL 5DJCA 2EZ0C 1IAKB 3FFCB 4OUUB 4CW1B 2XTJD 3OKLA 1AD9A 2ZSWB 4NN7C 2IBGA 5I16A 1J1OL 3FOMB 4LSRL 5H8DA 2EYTA 3L3IB 1G9NC 4MD5A 3CLFL 4O00A 1QNZH 4JO3H 3V0AC 4JPIB 2H32H 5DUBA 5HYFA 4HUWB 1VGEH 1SJEB 5HGBB 1A6TB 1ND0B 1A7RH 1NGXB 2FSEB 3QUMB 2D2OA 1U3HB 4LAJH 3OKKB 3VI4E 5I76B 4QWWD 2D7OA 1OT2A 4Y2DB 4Y5VA 2A0LD 1AQDB 4K3DH 1A7PL 2ZCHH 3BZEB 5HHOD 1CGYA 3QUXD 3BN9C 3V6FB 1NAMH 3D18B 3JTTB 3U83A 3ZKXB 4OLZL 4NZJA 4P3WA 1JBJA 2GI7A 3P4MA 3WIHL 3IS0X 3SQBA 2VDOH 5E0QA 3V9FA 5DJAA 1JIBA 4JQIH 4JFDA 4WUUB 4FTVE 4HMEA 3R06A 1EVUA 5D7JD 3S34L 2EIZB 1AGCB 4YHZL 4DOHB 3U7AA 4DW2L 3SKMB 3V6OC 3CFBA 1QO3A 4X80L 4JLRB 5T3XE 1DBBL 4DTGL 4PJFF 1EGJH 3IDNB 4HIXH 5FEBA 3HUJE 2J8HA 3V0VB 2YR3A 4ALAH 4RAUB 5EC1B 2XWBB 3U0WH 2VJXA 1MFDL 5DJDA 3WFEH 5A40E 1P4LB 3KLAA 4UINH 4NNYB 4JM2F 4UT9L 3RIFF 2NY2B 2Q1EA 2J6EA 1KPRA 1QLRA 4YC2C 1KN2L 4C56A 4PP1C 4WJ5B 3F8UB 4AH2B 4NFDA 5TF1L 2RJMA 3DROB 5L6YL 3ZKSD 3QIBA 2JIXA 3KPPB 1OY3B 1CGTA 4D9RE 1FVEB 3VFNA 5CLTA 4PRIB 3KYAA 4OTXL 4R7DA 4RA0C 3VRJA 3G6JB 3UPRB 1ADQL 4QRPE 1G1CA 1KTRL 1VENA 4PLKD 2F8VA 4M6NL 5B3NA 1MHEA 3RU8L 2CKBB 1DSFL 1LP9A 4QHMB 3OAUL 2YPVL 2FEDD 4MA8H 3C9NA 4FZEL 3JV4A 1HILA 4KKCC 3ULUC 4JFYB 4HS8H 5E6IB 3ARUA 4DVBB 3FO9A 3MV7B 1QRND 4HDIB 1A02N 3O45A 3P4NB 1BOGB 2DDQL 3FB6A 4OZGB 3VE0B 4NM8L 3VFTB 2R0KH 4E5XB 4JKMA 3NA4A 5C9JA 5IUSA 1KCKA 5IW6A 3PL6A 3HC3H 3ZDZE 4PGCB 1FSKC 2VZ3A 3TJEL 3H3PL 2W60B 4PRPB 4BH8A 2Y7QA 1YNKH 3HN3A 4PB0H 2RR3A 4LSPH 1LEIA 3MRBB 3WBDA 1B0RA 1RMFH 3H0TB 1UM6L 4X6EB 1G7JB 1I1FB 2HFGH 2C9AA 3PABA 1N4XL 5EU4A 2VMFA 5CGYC 4PREB 4DZBB 3NCFB 4WNQB 1KBGL 2HWZH 2AQ3A 1JZ3A 3QPXL 2R1XA 1HNGA 2VLJA 5BV7H 1FAKT 5DS8B 2F58H 3LIZL 4Y4KC 1HH9B 2WBJC 4LP4A 2HMIC 3MV9A 3N06B 3HZMA 4MAYD 3S37L 1N8ZB 1F4XH 3FT2A 5DGQA 2IWGA 1JZ7A 1ED3B 1YEIL 1AHWC 4IEFB 4IS6B 2DQEH 5D6CA 1CIUA 3ARDA 4F7EB 5BRZB 2NY7H 4K55A 2N4IA 4NKMB 4PJBA 1F3DH 1S9WA 5FDWA 3CNKA 5I8KH 1PGRB 4J4PA 1G9EA 3BP6A 2MHAB 3BWAA 2BSRB 4JDVB 4JR9H 1FNSH 2OYPA 1H9VA 2A83A 3MV8D 3B6SB 5LG1A 3HE6B 1SJVA 1ZA6B 2AP2A 5GQBA 4U1IA 5KS9A 4HUNB 3LKRA 3D85B 3VXSB 5GZOD 4JY6B 3GKWL 4M6ML 2EC9T 2RHEA 4D9LL 4EN3A 4EZMA 1BQUA 1YNTB 4DGIH 4MJ5B 1LMKA 5T1KB 4Z9KB 1J1OH 4XMLL 3CDYA 2NQCA 1CICD 3HS0A 3MRFB 4B7LA 1T1XA 3LKNA 3CLFH 3FQXB 4UIKL 1I8KA 5I2IA 3O41A 4UAOC 3RNQB 5JZ7D 5KJRL 3LD8B 4NIKB 2WUBH 2MMXA 1KB5B 3SJVD 1CD1B 1IL1B 1AXTL 3SEPA 1NBZA 1ORQA 2VKWA 4M43H 2X10A 1S7UB 4QYOB 1TZIA 4XVJL 1KLGA 5IB3B 4LHUG 5AUMB 5A3ID 1OP3K 4OFYA 4ZUUB 2VDNL 3QG6A 4LGPB 3AMKA 1A7PH 3O3UN 3PWPD 4GRLB 4XWGL 1UJTA 1WFTA 3HCVB 5GGSA 5I8CA 1P7KA 1MREL 1K8IB 3RWGB 1KOAA 4P4RA 5H2BA 1BWWA 2EKSB 5F6IB 1EMTH 3IJYB 4KXZI 4K94H 4QOKB 4KQ4L 3PGCB 3GSWB 4L8SA 3S34H 1WZKA 3STLB 5I73B 4YHZH 1CXIA 2CO7B 4PS4L 4QHUA 3QIWA 2EH8L 1A7NH 1M7DB 1TCRB 2W65B 4DW2H 2CDEB 1ZEAL 5JDSB 4PGEA 4X80H 2CRZA 4Z7QE 1DBBH 1I3VA 2YPLD 4DTGH 3T77A 5CEZE 1S7WA 2H2PD 2YUXA 1DANU 2ADFH 4EUPB 4NO5B 1U8MA 2NCMA 3OR6A 1JWUB 4P4KD 1QA9B 4HWBL 5CIPB 2VLKB 2R2EB 3I9GL 3HAEA 5GRVK 1YPZB 3D25B 2LQRA 3GMMA 2A6IB 2QQQA 5FYJD 4ZAKC 1MFDH 2FJGB 2X1PA 3B9VA 3X3GH 4L3EB 1NFIB 1Z6JT 4W4OC 3WNKA 3QNXB 3PQYD 1IAKA 4UT9H 4OUUA 1B90A 1X5FA 1B6DA 4CW1A 5BW7A 1G7QA 2ZSWA 2IADA 1KN2H 1I7RA 2BNRB 5KAQG 4KV5E 3FOMA 3P9WB 2OBGA 3L3IA 5TF1H 5L6YH 2F5AL 4S10A 2HKFL 4JPIA 1SY6A 4G6ML 1B0WA 1SJEA 4MJIE 4MCYB 5HGBA 1A6TA 3QPQD 3QIUD 3SBWC 2FSEA 4OTXH 1OAUL 3TO4B 2P46B 3G5XB 4FN0A 2FBOJ 1PG7X 2BNQD 5EBLB 2ICCA 3ARBD 3O3BB 4OZIB 1F45A 2V17H 1AQDA 2NW2B 3HC4L 4M6NH 5EB9A 4NDMA 3BZEA 4EUPG 5FO7B 2LTQB 3RU8H 1DSFH 2APFA 4WI6A 3D18A 2R23A 2BVPA 2YPVH 3EUUA 5JXAL 4GT7A 5GGTL 2Z31A 4FZEH 5JIKA 5ANME 3QZWG 4L5FL 2HFFA 3QXWA 4WUUA 4Z7WB 4D0CA 1PQZB 3ULVC 1KFAL 4NZTL 2X9WA 4MNQA 4NM8H 3NIDF 3V79C 5DGRA 4ZXBC 3SKMA 1YMMD 3GSVB 4XCYB 3GM8A 4DFHA 1A4KA 2DLFL 5FKAB 3TJEH 3LQMA 4OD2A 3QR2A 1BJMA 1JGVL 1SQ2N 5ESQA 3V0VA 4ZPVA 3MZTA 4I5BA 5EC1A 1T5XA 2XWBA 3D0VA 4LP5A 1KJMA 3QI9B 1P4LA 3SDAA 2JJTC 5J89A 4XAKE 5ICZA 3KJ6L 1UM6H 4NNYA 4PIRF 3BIAX 4W68A 1MHCB 1T89C 2GY5A 1N4XH 4P9ML 2B2XL 5DVLA 4KRPC 4FFZL 3KPQB 3SGKC 4G9FB 4WUKL 1KBGH 1IRAY 3PUCA 3KPSB 4WJ5A 3TPUA 5C8JB 4AH2A 3GBLA 4PJGE 4H26A 1DQMH 3ILPA 4XPBL 4N1EA 3LIZH 2AK4D 5GRUL 4AG4L 1DANT 1R24B 2GT9B 2XWJB 5C0IA 3S37H 1GOHA 4BH7A 1FVEA 3S5LA 2X41A 1YEIH 4PRHD 3WSQL 2X4NA 5KVGL 3KGRA 2YA2A 4LOUC 3JWOL 1J0ZA 3UPRA 4TUKL 4NRYA 4NZRL 1R5WB 5D1QC 2WBWB 2YD8A 3MR9B 3DMMD 1XF5A 4G6JL 4J3TA 2AXJA 4OJFL 2BC4B 3GKZA 4OZHA 3GKWH 3FONB 5T1LB 4M6MH 4D9LH 3UTSE 3CXHK 2C3GA 3H9SA 3GSUA 4JFYA 3VD4A 3O3AB 4HCRL 5E6IA 4JFED 3P30L 4KUCD 2WSKA 1ZSDA 2FNBA 4Y19E 3P4NA 1BOGA 1MCFA 4YEFA 1BD2E 2MWCA 3VE0A 3QFJA 3VFTA 4JREC 5KJRH 3N0PB 2WIIB 4KC3B 3QQ3B 5C6PB 4XGZB 4D0BB 1R3JA 1OM3L 2W60A 1MFEH 4KROC 2PYED 1QFWM 1RZJL 4XVJH 1FQ9C 3QULB 2DKUA 3B9KA 2CDGB 2VDNH 5EZJB 4X6CB 5DC9B 1A9BA 3G5ZB 1S5IH 4HLZH 4P2RA 5FOBA 3T0VA 3MRBA 3KYKL 2DQFB 3V5HA 3EYFA 4XWGH 4CNIB 4MQ7A 4CAGA 2X4PB 3H0TA 4FFWD 1G7JA 1I1FA 4JQXA 2NY4C 3L3KB 1C5DA 3LRSA 2HA1A 4PREA 4DZBA 1INQB 4NKOB 3ARWA 4KQ4H 2X42A 3WO4B 1CGWA 4WGVB 1VSCA 2ESVD 4PS4H 5IM7A 1EHLH 1HH9A 2EH8H 1PYWB 3VWKB 4PJ5B 1T66D 2FWOB 1ZEAH 1N8ZA 3C5SB 3RHWF 2NY0B 3R8BB 4HT1L 1CLYH 3NIGF 4LVNB 2NXZD 4WVRA 3UTPE 3IJHB 4ODWB 1CLOL 1T6VN 3TO2B 2CR6A 3I9GH 5AD0B 5CJBA 2HAZA 3CU7A 3O2DL 2MHAA 2BSRA 3DNKA 3MLUL 4JDVA 4KJWD 4PGJA 4TNVK 1MWAL 4QRRA 5E2VL 5F7FA 4MB4A 5DA4A 3B6SA 2IAMB 5F9WC 5HHPB 3SY0B 1ZA6A 1MVUB 4KJPC 3HZVB 3D85A 5GS2H 2Z4QA 1MJJB 1UZ6E 3QYCA 4YEEA 2GFBB 5IVZB 1JZ6A 1YNTA 1SMAA 3QQ9C 1II4E 3TT3L 4P46D 4FMKA 4LPYA 4WFGE 3MRJA 1TVBB 3CFKA 4W70A 4RZCB 3LRHA 2EC8A 2F5AH 3FQXA 4NQEE 1AO7B 1IEAB 2FIKA 2HKFH 1J88A 3RNQA 3TBYB 4O2CB 2DM2A 3IGAA 4NO0D 1IZKA 4R0LA 1IM9D 1BQHG 1S7UA 1J8HD 1OAUH 2IC2A 3BH9B 3KLHD 3VGGA 1J0HA 1T2XA 3CAFA 3MQIA 3MJ9A 5IB3A 4YR6B 1OW0C 3N1QC 3HC4H 4RGOL 3NCYS 2VXUH 5D1ZB 1NKRA 2CLVB 4HX1A 4NKDB 2BX5A 4X7SL 6CGTA 3NBNA 3BESR 3K4AA 1J86A 5JXAH 3L5XH 1K8IA 1U95B 5GGTH 3DWTA 3ESUF 3I6KB 3IJYA 1CGUA 3IETB 4XNZC 4L5FH 5C2UB 5HHQA 4QOKA 4L8BB 1YEFL 3GSWA 1B0GB 1KFAH 1QKZL 3STLA 3PWLB 3SO3C 4Y8DC 1CGXA 1P53A 5INCB 4R7NB 2CDEA 5T33L 1TNMA 1KTDA 1PX4A 5JDSA 3CC5A 4HWEL 3QUZD 4GFTB 3N85H 3KPMB 2DLFH 3RGHA 3FN0H 2GSIA 2GEEA 4M1CC 4XNQA 1QA9A 1UC6A 5CIPA 2VLKA 5CMAB 1QFUH 1YPZA 3D25A 3VD9A 2A6IA 1WZMA 5SWZE 2Y72A 1X5GA 1NFIA 4FFVC 2VLMD 4MD0B 1RVFL 3KJ6H 3QNXA 5ALCL 4P9MH 2B2XH 1NLDL 4FFZH 4OQTL 4WHYH 1MVFA 3QUKA 1MY7A 3UJIL 4XPFL 1K6QL 5EPMB 1D3CA 2OSLB 5BS0B 2LAGB 2JF1A 5DQDL 3TA3A 1Q38A 4XPBH 2FLRT 2NXYB 4MXWL 4R90L 1NBYB 1C8PA 5I9QC 4XNMA 5H37G 3LQAL 4G42B 1I75A 3FMGL 2EH7L 3HNTL 5FYJU 1J11A 3WSQH 3D69B 5JW4Q 4OLWL 4ZQKB 5KVGH 2R4SL 3JWOH 2CQVA 5BV7C 5ITFB 3TO4A 4R3SA 3IXAA 3VFMA 5EBLA 4TUKH 4NZRH 4OZIA 2NW2A 1F90L 5K9KA 1PKOA 3H9HA 4GW4A 1OQOA 3MRKB 2XTJB 2BSED 4ONHA 4OJFH 2AEIT 5IB4A 2RAMA 4Q0XH 1LP9F 3IU3A 3U0TB 3QAZC 1ETZA 1FLRH 5SWSB 2V2TA 3UBXG 4HCRH 4YDIL 5EC2A 5A16B 4QRTB 4FXKB 3FT4A 2R29L 1PQZA 2CKBL 5D7LD 5CJQL 1G0DA 3QDHA 4IRJD 1KTLA 3QFDA 3ILQD 4MA3B 3OKEB 2DQIL 4PR5B 3GSVA 5MEPB 3P73A 3ZKND 2CUIA 5FKAA 1OM3H 1U42A 1BIHA 2NX5B 3TEUA 4YHML 5HHOB 3QUXB 3LN4A 5EIIB 4CUCA 4JDTL 5EIQA 4LIQE 4RBPK 1U8NB 3GJFH 3RDTA 3W5MA 3KYKH 1DQTA 4RDQF 4LFHD 1MY5A 4LSUL 4JY4A 1D9KD 1MHCA 3FN3A 4APQC 4AIZB 5D7JB 4S1DC 1KT2A 3HRZB 3CXHJ 3U7YL 4F7CB 3BYTA 4PTTB 3KS0J 1FZMB 1R24A 2KH2B 2XWJA 4HT1H 4HK3J 2EZ0D 4MA1C 1TVHB 3N1FC 4XPAH 1RHHB 1GL4B 4KKLD 2BVQB 3O2DH 1Q94B 3MLUH 2X4UB 5AAWA 1MWAH 3T1FB 3V6ZB 3FT3B 5EU6E 2MNUA 3ISWA 3P9MB 1HHIB 5B22A 5J12C 2BC4A 3STZA 1OD7A 2ED9A 3VXUB 5KS9F 2EXWD 4OBRA 4Y0GA 4TVPD 4J3OC 5FUCE 3TT3H 2CD0A 2YN5A 2VXSH 4N1HB 3VXRE 1EFXA 4NQUA 2ZPKL 5I1DA 4TYUA 2OTPA 5DJZA 2NY3D 4NRZB 1AI1L 4BSWB 3MROB 3MXVL 3T65A 1WIUA 3T8XB 3QQ3A 3BN9D 4WW1A 1KG0B 4WTZA 3V4PL 1QVOB 2E7MA 1FL3B 2JK5B 2F74B 5F97E 4WGWB 4ZUWB 2FL5B 1KB5L 4RGOH 4P2CG 3GMLA 5D2NE 4M00A 3U1SL 1TJHL 1YDPB 1I8LC 5HYSB 3OQ3B 4GS7C 4X7SH 4U1HB 3QUMH 2FZ3B 1QRNB 2OR8A 5L0QC 5J06A 2O5YL 1ZGLB 1JNJA 1QPPA 4NHUB 3EO0B 1I1AC 1QKZH 5BQ7B 2X4QB 3M17B 1FFPB 4G7YH 4YBLC 3B9EA 5E8DL 1EZVX 1PYWA 3VWKA 3C5ZD 1P4BH 5T33H 2FO4A 5GHWL 4HWEH 5B38G 4FQXB 1EZVY 2OI9C 5ETUB 1QEWB 2X7LB 3IJHA 3DX6A 5FUOL 2Y4SA 3VDCA 4KXZH 2VO5A 5AD0A 3UBXI 1DUYA 3BZFA 4PP1D 1VPOL 5EOTB 4A6YL 1I8IB 2A6KB 5JW4N 1J87A 2VL4A 1MVUA 4UT7H 3HZVA 5ALCH 1YY8A 1UFUA 2H1PL 1U93B 1MCQA 5IVZA 4XPFH 2OR9L 3AVEA 4Y16C 5C07E 1OB1B 4PY8I 3KPLA 3GSNL 2BNUB 5ICXA 4QTHA 3ARFD 5IBUG 5ID0B 4MXWH 4RZCA 4R90H 2VZUA 1AO7A 1IEAA 1S7QB 1IAOA 5D1XC 3FMGH 1BZ9B 2EH7H 4YHYC 4G8IA 2XIDA 4OLWH 2R4SH 3LKSA 4NQCD 2JJSA 3BH9A 5F9DC 2ICEB 1UWEL 3CSYB 1YC8A 3MV8B 4YR6A 2VIRB 4LARL 2VDQH 4KKCD 1IJ9A 1F90H 4NPYA 5D1ZA 2CLVA 4XP6L 4Y89A 2KQMA 4ZUSB 4X4YB 4TNWF 1MCPL 1H3UA 2BSSB 1UCTA 1FL5A 1KPUA 2ERJC 5I1LB 4QNPF 1C5BL 3FQUA 1CICB 5DFVC 4YDIH 4OF7A 3X3FL 4TTGA 1GOFA 2CKBH 1TFHA 4GRWH 5CJQH 3QQ4B 3PWLA 3SJVB 3U7WH 3NPSB 3MCG1 5KOVC 5DFTA 1PZ5B 3BPOB 3BKML 1FNGB 3O3DB 3B9DA 2R2BA 1FLTX 1T4KB 3PWPB 5SX5K 4JFOB 1CD9B 5HYJA 1A6PA 4YHMH 5CGYD 5DJXB 1W0VB 3KR3L 3T0EE 2B1HL 3SGJC 1EUTA 4IOIB 5I17B 4QRUA 1Q9KA 4MD0A 1I4FA 1CL7I 4LSUH 4YK4C 2IEPA 4Y4KD 2WBJD 3QDME 2QV2A 5F7LB 4XRCB 1KJVB 1CFVL 2ZCLL 5F96L 3MJ7A 1AQKL 3U7YH 2OSLA 3IDIB 3V4UL 4ELMA 3F5WA 3CU1A 4JFQA 1NBYA 2XWTB 2YPLB 3OPZH 4NKIL 4G42A 4ZSOA 4YGVA 1T3FB 3D69A 3TBTB 1T0MB 1IVLA 3BP5A 2A9NL 5C0CB 4NWTL 2YRZA 4X6FB 5HD8C 2J8UB 5ITFA 4NUJB 5L2KD 3S9DB 1UADC 2VN4A 2Q6WA 5ICYA 4UV4L 3SE3A 3V4VL 2BZDA 5FO8B 4QF1B 5D70L 4PV8A 5EORL 1G6RB 4LCCA 4LLWA 1RJLB 3L3OB 2MSPA 2FB4L 4OZHF 2HT3C 5IB5A 2YUZA 5SWSA 1QSEE 5A16A 1JUFA 4QRTA 3KJ4C 2R1YB 5D6DA 1MLBB 2E3VA 2J4WL 2ZPKH 5J8OA 5CP7B 1EFQA 2VC2L 3FO2A 4PG2A 4PBXA 4X6DE 4AEIH 4J3SA 1AI1H 3TLRA 1KIRB 3W2DL 4MA3A 3I50L 1MQKH 3CIQA 1J1PL 3ARBB 4FQCL 3ZDXF 5T5NG 5HVWA 4I18C 1XIWD 4EIZC 4F3FA 4BKLB 2ZZUT 3V4PH 1Y0LB 2FIRT 2NX5A 1FJ1A 1PW3A 3DRQA 1JTTA 1TQCC 5FO9A 2NYYD 5DD0H 2Y36L 5FKPA 5C92A 2E5EA 1KB5H 3BIKB 3IFOB 2N7BA 1JHTB 1WAAA 1HCVA 1TJHH 4N0RA 2YUVA 3S4SB 4JFFD 3C2AL 4G7VL 1N26A 1WBXA 5D7JA 4AY0A 1C16A 4PB9L 3S6CA 3ZE2F 5GPRA 2O5YH 3GHBL 3HRZA 4RIRB 2V5MA 3UTZB 2FECI 3VFGH 4U1LB 4X8JB 1XFPA 4JHWL 3IDYB 5BCAA 1YMMB 5E8DH 3VXMD 1DQDL 1FZMA 2XI9A 5DJ6A 3NFPB 1EIBA 1K85A 3I3DA 5FCSH 2OL3A 5GHWH 3P3YA 5LGHL 4K3JH 4D0DB 1SEBB 4NJAL 5HI3C 1F13A 2AERT 3SPVB 2IALA 1TVHA 3NN8B 2BOCB 4HKZA 5D7KD 3F6IA 1JZ8A 4BZ2H 1RHHA 2XA3A 4OSUL 1Q94A 2Y6SC 2V5YA 5C0EB 4U05A 2OR7A 1VPOH 1KXVC 4A6YH 2ADGB 3P9MA 1ODAA 4GBXA 4HKXB 2GAZB 4EUPH 5DI8B 3VXUA 1S7RA 1Q0YL 2DJSA 1ONQA 2H1PH 3S37X 3G04B 3DX9B 4QXTB 2OR9H 2ZUTA 1ZS8B 1G0XA 5J13C 3HAEG 4RGNC 3RUGF 3GSNH 1DBJH 3O6FB 5KN5B 4PRHB 2APTA 1Q9LB 1OAYL 3MROA 4BSWA 1T21B 2RCSL 4C56E 2EDHA 1IC5L 3W0WD 4F37K 1KG0A 5J6GB 1QVOA 4XBGB 1UWEH 1FL3A 5FYLL 3MCKB 4K07A 3DMMB 4LARH 4I13B 4LBEB 3RVWC 5GIRB 2PO6C 1ZHBA 4Z7NE 3CK0L 3ARYA 4XP6H 5HYSA 3ULVD 3DO7B 3JWOC 1NMAL 1MCPH 3WDHA 1JN6B 4JFEB 2UWEB 2ATPB 1QRNA 3WJLC 5B8CC 1C5BH 4GLRI 1JF5A 3O4LD 2CK0L 4UQ2B 1FZJB 3PGDA 1KIPB 1IM3B 1GGIL 1KYOK 4HS6B 1ZGLA 2ITCB 4I48A 4NHUA 3CFEA 5BZWB 1VDGA 5GGQL 3MNZB 4AQOA 5BQ7A 2DKSA 1LP9E 3MMEA 1FFPA 2AJZA 4Z95L 3OKNB 4RGMB 1AXSB 4DFIA 5F88B 1MCBA 3DVFA 1FYTA 3OX8A 5HDBF 3BKMH 5E5MB 2PYEB 3LS5L 2YUWA 4FQXA 4WO4D 2OQJB 1QEWA 4JJHA 3HA0A 5E4IA 4YDVB 1E27A 5CILL 5I6XB 1YPZF 4YHKL 5HHNB 3DV4B 3TJHD 2H3NB 3KR3H 1KELH 2GJJA 2MJWA 2A6KA 2K3TA 1RZJC 3NFNA 2Q7NA 1MCOL 4ZDHA 1U93A 1CFVH 2ZCLH 4YZFF 5JMRA 3MO1A 1AQKH 1NUNB 4PJEE 3V4UH 4LOUD 3WFCL 4MXVF 4DEPB 1OOAA 4KQ3H 1CFSA 5FF6B 5AYQA 2W9LA 1S7QA 4NKIH 3OKOA 1DQJB 2FGZA 3E3QC 5EH1A 4EI6B 4CGTA 3ARQA 2P5ED 4JPKL 5C6TL 3VXOB 1JRHL 1ZHKA 2Z8SA 4YAQA 2A9NH 5CUSL 3K74B 2VLJE 4R26L 3EOYG 3MV11 1BWMA 1EUUA 3DVIA 4HZAA 4FFYL 4Y5XA 3W5NA 2WLZA 4UV4H 3EYVA 4OZIF 4NFBA 4QKXB 5D70H 2W0KA 5EORH 3HG1D 1YZZA 1TJIH 3QEHB 3QDGD 1IKNC 3AS3A 4PJBE 3UJTL 1N7ML 2FB4H 4P46B 4K71C 4OCNC 4YDLB 3BZDA 1CICA 5DRXA 5JPNA 1RIHL 1BGXL 1QSFD 3LY6A 3QCUL 1FPTL 2H9GA 2J4WH 4HWZA 4G5ZL 1WC7B 5C71A 1TJGL 1VFAA 2VC2H 4NO0B 2UUDH 3HE7C 4K3EL 1MELA 1IM9B 1FL6B 4XHJC 5ENWA 3K3QA 3W2DH 1PZ5A 1J8HB 1MCEA 1NGZB 1V3MA 4OGAC 5DTFB 4YXLL 3BKYH 1RUKL 4N1CA 3B2UC 5CJ5A 4XT1C 1J1PH 1G1YA 4FQCH 1GHFL 1ZVSA 5D4QA 4ONOA 1T4KA 1ZVYA 2LVCA 5FCUL 1WV7T 4G80B 1K8DB 4NP4L 2Y36H 4KTEL 3J8F7 2P49B 2YD3A 4IOIA 1MEXL 3VFOA 2DLHA 3VWJC 4LLUB 1WJ3A 5IFAH 4G7VH 2HJFA 4XCEA 4KI1A 1MLCB 4PB9H 4UBDC 3IFPB 4XCCL 2EIDA 5IMKA 5EBWA 4JJ5B 4BA8A 1JVKA 2PW2B 3IDIA 3B4NA 3UROR 2VDML 3WV0A 1U3HC 4ZG1A 2YPLA 1DQDH 2YD7A 1UXWA 4KK9D 5D7IB 4Y2DC 4PYGA 4NQDE 4NN6B 4WTWA 5LGKA 1CL7L 2R69H 2EYRA 2LU4A 1T3FA 3TBTA 1S78C 4MZ3A 1T0MA 4NJAH 3MBEA 3UTTD 3RJQB 4YHLH 5C0CA 4KJPD 1T1ZA 2J8UA 3U4AA 4OSUH 1XGPA 1FVDB 4R8WL 5SX4I 5JW4R 1P2CB 4E0RA 2OK0L 5DQ9A 4PLNC 2WLYA 4WV1C 4G8GE 1KUMA 1RJLA 2X2YA 2WINB 2XQBL 1QYGL 4KZDL 2CRYA 1F4WH 4P9HL 1YEEL 1S7VA 1SYSB 1OGAA 3JV0A 2R1YA 5IWLC 1MLBA 4RISL 5CP7A 3P0YL 1ZGLP 1QHPA 4OF0A 4Q97A 4PJ8D 4LQFL 4L3CA 1OAYH 1KIRA 4KGJA 2RCSH 4NKQB 2VQ1A 3ZKMD 5T1DL 4JHZA 5AWNL 3EOAA 3UTQB 5FYLH 4PV9B 1OARL 4UTBH 1MI5D 3LQAC 2P44B 2LAAA 1JHTA 2G2RB 3MREA 2ZUYA 5KG9A 3S4SA 1NMAH 3WHE1 4ZOCA 5IEHA 1J1XL 2D7TL 3LQZB 3MA7B 4PJ9B 2VISB 2D03L 1CR9H 2DTSA 1TENA 1UQSB 4N5ED 1GGIH 5ADPL 2VE6A 4IRJB 4RIRA 3RPKA 3MLRL 3UTZA 5J6HB 5E8PB 5GGQH 3EOBA 1G7MA 2WWMC 4LRNL 3TVMC 1DVFA 1RK1A 4Z95H 2X5PA 4OCWL 5C09D 4HXAL 4DQOH 1LK2B 3FB7B 4TPRH 4YO0B 5H37H 4WUUE 5DT1L 3C60C 4FFVD 2Q7YB 1X5AA 3SE9H 2VLRD 4LK4A 2BOCA 4DOHE 2G5BB 4EKXA 2FBJL 2J6EL 3KWWB 3ROLA 1N2RA 4YHKH 3PP4H 2AQ1A 1Z2KA 2GAZA 5K33A 4JFPA 5DUPL 3TH2T 3QWRD 5JHDA 1MCOH 4YBHA 1OWWA 3LN5B 4LAQH 3DX9A 1FVCB 4QXTA 5F8RC 3AS1A 3H2WA 1R6VA 1ZS8A 2ZUWA 3OJVC 4YDKH 5HGAB 2IJ0C 3WFCH 2DKMA 1KYOJ 4OCXL 1Z5LB 3O6FA 2PYFA 5IB1B 5DWUH 2D9QB 5HYQB 2X9XA 1Q9LA 2WW8A 5I75C 2OXHA 3BPCB 5ESVB 1A7BA 1JRHH 3GFUA 5CUSH 4R26H 4YPJA 3MGOB 2Y5TB 4RMQA 4NN7B 2YRLA 3TZVC 4GKOA 4IMLB 4N68A 3A6CL 3D39D 3RVTD 3DO7A 5I1KL 4LFHG 1ZLVK 3G6JE 1N7MH 3K0WA 5EZLA 5FA3B 3UJTH 1K4DB 2NTFA 1KB9K 5IKCB 2IH3A 2ATPA 4O2EB 4YHIB 3C2SA 1G0YR 1KCUL 4UQ2A 1OTUD 2BK8A 4M62L 5I15H 1TTGA 2NY3B 1XZ0B 5GGRA 1RIHH 4HS6A 1BGXH 3QCUH 1FPTH 4LSQL 4BFEA 4LPXA 1HI6B 1TJGH 3X17A 5MHSE 4GG6B 4K3EH 1Q9OA 3ARPA 4OZHE 1VCAA 4AMKL 1QLFA 4XVSL 3OKNA 3GDBA 3E6HA 2GJ6D 3FO1B 1CZ8H 4YXLH 5D7SH 5E5MA 1H8SA 5GS0D 5HDQL 3MUGB 3MV7E 1JWMB 2EECA 2OQJA 1VESA 1GHFH 3HE6C 2AQ2A 4U1SA 4V1DA 3GO1L 3QFJE 1VFUA 2Q3ZA 4APQD 2VITB 1P9MC 4NP4H 4ODUB 5ACZB 5HHNA 3DV4A 4KTEH 3AU1B 2H3NA 1BFVL 5DRNB 3ZDXE 4N0UB 2AJVL 5TQ2L 1UACH 4G43A 5BVJA 4FQQB 1XH3B 1DDHA 3BAEH 1H15B 3SDCD 4FQ1L 4YXHL 1JYNA 1E4KC 4XCCH 4P2RE 5JO5B 1HH6B 1NC2A 1U91B 3C5ZB 3FAWA 2BSTA 3VG0L 4ELMF 4MS8C 3RZCA 1TTFA 3PDDA 3ZYZA 2FX7H 4EI6A 3KXFA 1CL7H 3QP3A 2HVKA 1OP9A 3QNYB 4AEFA 5F93C 4LPCA 4WFEE 4YC2B 3D1MC 1QZ1A 1D5MB 5F6IC 2E7LA 1AGBA 2CLRA 3IAPA 1VERA 5DFWH 5BRZE 1FNHA 1DFBL 5MENB 5I73C 4HGWB 2X40A 5FYJL 4EI5C 3BT2L 2XQBH 1QYGH 4P9HH 2XYCA 1YEEH 3ARFB 3S88L 2O61A 4QRRE 4H0IA 4K7PH 1WC7A 4PTUA 3P0YH 4C4KO 2H6PB 1VADB 4GAYB 3C6LC 1JV5A 3NCCB 1J8HA 1NGZA 4NQCB 2F8XC 1YEJL 5BOPA 5T1DH 2VDKL 3GM0A 5AWNH 4UV7L 5IK3A 1OARH 1G7PA 1K8DA 2GHWB 4Y1AD 4HKJA 2WANA 3LH2L 3OSKA 4Y88A 2GTZB 1WAAF 1I1AD 3DUUB 1NCCL 4LLUA 3L5WB 4NO2A 1JI1A 4X6BA 1DUZB 4O58L 1FSKB 4POYA 1J1XH 2D7TH 5TH2B 1I7ZB 2D03H 3GGWA 3GEWB 3WE6B 1OWRM 5ADPH 1C08A 2ARJQ 4JJ5A 3MLRH 3F65A 3T3MF 4LRNH 3DI3B 3V95A 4GOSA 4OCWH 4HXAH 3QEQA 3A6OA 4QOKE 4NC0B 1LO5B 1EAPB 3CFDB 4Y4HC 4KZEL 1RULL 1CU4L 3EHBD 3L9RB 2OTUB 2FBJH 3BP4A 3KPNB 4F8QA 3HFML 1FVDA 1P2CA 3FOLB 3WS6C 3MRDB 2P8PA 4Y4KB 2WBJB 3BX7C 1KV3A 3QO0B 1VFBB 3L3DB 4HK0B 3U2SB 3Q6GL 5DUPH 3JV6B 2VLKE 1ZT1B 4KWUA 1K5NB 4F7MB 5I19L 1YPZE 1IFHL 4D8PA 1SYSA 3ZHDA 3WMSA 4L3EE 3BJ91 4OCXH 3DURB 2Q8BH 2H8PA 1B6UA 2BCKA 2E9WA