5KVGL

Zika specific antibody, zv-67, bound to zika envelope diii
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
DIVMTQSQKFMSTSVGDRVSITCKASQNVGTAVAWYQQKPGQSPKLLIYSASNRYTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQFSSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZIKA Envelope DIII
publication title Structural Basis of Zika Virus-Specific Antibody Protection.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kvgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kvgL01
4IM8A 3QDJA 3DBXA 2V5MA 3S8WA 5EPMA 4XP4L 3HE7D 3HG1A 3I2CL 4JY5L 3WUZA 2XWJA 4YXHL 2ED9A 3GMOB 2K1MA 4M1GH 3X11B 1HWGB 3ARRA 2BOBA 5I16B 1MCBA 4BJLA 1PD6A 4KZDL 1FNEA 2CK0H 1INQB 2QJDA 2EE2A 5GZOC 2CLZB 1AO7D 3NFNA 4JO1H 5K9KA 2QKIA 2GEEA 3PGFH 1T0PB 5B8CA 1JF1A 2M2DA 2YK1L 1WAAF 4LRNL 4HWBH 4ZPVB 2QSTA 3O81A 4AENA 1UXSB 1FRGH 2XYCA 4WDIA 2E7LA 1MFEH 2RFXA 4U3HA 5ESAB 5T3XE 1I3RB 1U8JA 4KY1H 2O5XH 3S4SB 4DCQA 4R90H 5ACLA 2O93L 4KHTL 4N9GB 2X4TB 4QRRB 1CU4L 4U0RB 1MCQA 1R3LB 4HWBA 4LKXB 2VDQH 3IDGA 2CIKB 3ILPA 5FKAA 1ZLVH 1JPTL 3KDMB 1UEYA 3HC3H 3HNTH 4LU5L 2OQJA 1OOAA 5AZEL 1VGEL 5IB1B 1FORL 2R1XB 4HLJA 4F7PB 1FLRL 1EPFA 1OP9A 3LS5H 5SWQA 4Y16A 5GGVL 4Z7NF 2R0ZH 5I71C 2WBJB 5E4IA 1MWAH 3G5YB 4F7CA 5JW4N 3U9PH 4IOFC 4JFQB 1BFOB 1RVFH 4RAVB 5BZWA 2A74B 2DMKA 2L7UA 3GMPA 2OMNA 4U6HA 4JCMA 4TTDC 4AM0B 4BZYA 1LO3H 2MTPA 2DQDH 4R2GC 1DVFD 2NXZB 1MWAA 1ZT1A 5FUOH 2ATPB 3BE1L 1LQSR 3T09A 4N0YH 3OF6A 4JFEB 1KB9J 1N6VA 5EWIL 5CEXB 1RJYA 1QPXA 4FQXA 3RZCC 4HULB 1IKNC 5JIPA 4KFZC 4X5WB 4PJXA 1WVZA 5BRZD 3JWNC 3F7VA 3QAZB 5DMGC 3TO2A 4K3HA 5DEZA 1OWWA 1WF5A 3TPKA 4TTGA 4YGVB 1NBZB 3CFKA 4G80A 3W9EB 1ZANH 4PJ7E 1C1EL 1J05B 1N2RA 1A7RH 1P4BH 4S1RL 5C08A 1RMFL 1QRNB 4CU7A 1F4YH 1RK0B 3HB3C 5C8JB 3VFMA 4NP4L 3PHQA 1D7FA 5I1DA 3QEGH 2MKLC 2O5ZL 5AYUH 2R4SH 3NFPA 5DZLA 5F1NA 2GUOA 3MLXH 1T21A 4JANB 1FFRA 1UVQA 1A6VL 1FO0H 3EZJB 1YEKL 2OTWA 3NFSL 4U6XB 3VD3A 4L8BA 4HF5L 4HWZA 5CEZL 2X4OA 1U8MB 2B0SH 4U1KA 1ZSDA 3MJ7B 3WFCL 1U2CA 4OCRL 3SDAD 3QR2A 1Y0LB 1B0RB 5FYJH 4JPIA 2NZ9C 3MX0A 3VGAB 4PJBF 1PX3A 4G6AD 1M7IB 3QEUB 1LO5A 5IB2B 3ZO0A 2VOTA 4M7KL 4WCYH 3OJVC 1QSFD 4UOW0 3H9SE 1NBVL 1E6OH 4ZXBA 1I75A 3X3FL 4M48L 1QTYT 5I1CL 4EI5A 4HV8A 4NOBA 4GAYB 4W4NA 1F3DJ 3SDCB 1MQKL 4PJHF 1IGFL 1FLTX 4FQLH 3DMMA 1CVRA 2HG5B 3I3EA 3MLYH 4MQ7A 5CJQL 5D96B 4ODSH 4ZTOH 2F5BL 1V7NH 2YPKB 3IVKB 4K7FB 3W0WB 4YXKL 4WHCA 5CGTA 1MFAH 1IZJA 4S1SH 3FOMA 2GJ6A 4W6WB 3MNVB 1ZGLM 2BJMH 3IJHA 1FVEB 5EA0H 4WFGE 5HVHC 2FB4L 1NC4B 3RNKA 2F54B 4RGND 2YD2A 1C16B 1ZT4B 2DLGA 4Z7UF 4WWKB 5CD5D 1BJMA 2F8XC 5IEHB 4WO4B 4WUUE 1MCIA 2FLBT 4MB3A 4JPKL 4PLOB 5D2LE 1F8TH 3ECBA 4NO2A 3RBSA 5K9QG 2VDRH 2HTKD 1DCLA 4JQVA 2CPCA 4M1DH 1N64L 3O2WH 1B4RA 2EDBA 1SQ2N 2R1WB 3IFPA 1YNTA 5FOBA 1S3KH 2DF3A 3F12A 4M4RA 4TSBL 4Y2DD 1NEZA 4M7ZB 3EOAB 4L4VD 3X3GH 4MD4A 1Q1JH 1RURH 4H8WC 3VG0L 5MERB 3HRZA 3WL9A 1CFVL 3MGOA 4GRWE 5C0BB 4P48A 4X7SL 2XXMB 1JVKA 4LGPB 4H25B 5GS1B 5EDXA 3SJVD 3P11H 3MV01 4YE4H 1U3HC 4Y4HB 1ZMYA 3L3OB 2HA1A 3N85H 3IF1A 1FFPB 4LLDA 4MJ5A 1OB1B 1PZ5A 4KKBC 5DEGB 4U3CA 4PJ5D 3EDEA 4OCYL 5FV1L 1F6AA 5E2TH 2AEWA 1WBXB 3NCEB 3DGCR 4HKBA 2X7LB 2ITCA 3FONA 1HYSC 5ICZB 1UZ6F 4P2OC 3BVNB 5C6PB 3PP3H 3LKQA 4LGRB 1KCUL 4Q0XL 3QNXA 3V6FA 2D9QB 4X4ZA 3RPIA 2Z91B 4XAWL 2VLME 1VFOA 2Z31C 5A3IC 1RIHH 2IFGA 1YQ2A 1TTUA 2J6EL 3PQYD 4QRPD 5F7LB 1UCTA 1QZ1A 3S5LG 3TN0D 4UBDD 5T1LA 3GMOA 5I16A 3X11A 4RZCB 4NRYB 4GAGL 4QLRA 2VDMH 1MAMH 4PJ8D 4R0LB 1INQA 1KC5L 1BREA 2BXYA 2CLZA 3MCG1 2EH8H 1X4ZA 2SEBB 4FRWA 5ANMB 3OG4B 4XMKL 4GRLD 4XT1C 4CL7A 5IFHL 3GSXB 4FNLL 4BK5A 5J11C 4ZPVA 4APQC 1TQBB 1FC1A 1UXSA 4PFEA 4XHJD 1CDYA 4OQTH 3OGCB 4NKOB 5ESAA 2AJVL 1I3RA 5F21B 3S4SA 5JQHC 4L3ED 4HS8H 3KPPB 4KRLB 4M6OH 3IDYC 3EJYC 1FPTL 4NQVB 3GJEB 2YUWA 4N9GA 3O6ML 2X4TA 5IVZB 3D2UD 1JZ2A 1WEJH 3ARVA 2GY5A 1D9KC 3LQZB 3HI6H 1MCPL 4PBVC 3UJIH 4LKXA 1XAUA 2CIKA 3BAEL 4OQTA 4TUJB 4PP2B 4LVNC 3MRMA 3VRIB 4OLYL 1CFBA 2AGJH 1YEJL 1TNNA 2L7JA 2WK2A 5IB1A 2R1XA 3GBLA 4YIQB 4F7PA 1YEEH 3NGBB 3OB0K 3BKJL 2JLLA 2XACC 1C08B 2WBJA 4FFYH 3G5YA 1KEGL 2VNCA 1BIIB 4JFQA 2BNRB 4WY7L 4KKAD 1BFOA 3QA3B 4RAVA 2VUYA 1EXUB 3ZE0E 5HYJE 4LSQL 2A74A 3O8XB 2W9DL 3RVUC 1NFKA 4AM0A 3CZJA 2XICA 5HVGB 3QCUH 2QADC 4XBGA 1OM3H 2B8OT 3UC0H 3DETD 1DQML 2ATPA 5BOPA 4A6YL 3LEXB 4JFEA 1GAFL 2IPTH 5CEXA 1QSFE 3BHBB 3X12B 5E00B 4ZD3L 5DVNA 3K8LA 2M8XA 4X5WA 4J3WA 1T0MB 4L9LC 3BD3A 3KG5A 1JWUB 5IEKB 4TOYH 4YGVA 1NBZA 3W9EA 3RVWC 1YJDL 1HHKB 1P7QB 1J05A 2D7QA 1OAXL 3QXTA 3TWCH 1IGYA 3HAEG 5C8JA 4LPCA 2DM3A 3BPLB 1Z9SA 1I1YB 5J06A 4OCSH 2RR3A 3CDFA 1CYGA 4KKNA 4I18C 2DQHL 4G7YL 2CUMA 3LN4B 4R4FH 4JANA 4NWTH 2XQYK 5GRJL 3FQNB 4UAOB 4K9EL 5DQ9B 5CINH 3T0BA 4FABL 1SM3H 5J8OA 3O0RL 4KUCF 4U6XA 1T22B 2HJFB 2IBBA 1P9MA 5JHDB 1QFPA 1QKZL 1W2KT 1RFDL 4JG1L 4OFDA 5E5MB 4LK4A 3O6LL 1U8MA 4RISH 3EO0B 1CE6B 2AJUL 4X4XB 3AM8C 3MJ7A 4Y4FD 5INCB 4S1DC 1SY6H 1Y0LA 1B0RA 1WBYB 3MJGX 5FYLH 3GI8H 1QBAA 1WLHA 3VFVB 2DQUH 2V5RA 5DGQA 2UY7A 1M7IA 3UDWC 4MB5A 3QEUA 3QIBD 5CBEB 4FFVC 3ZKMD 2DQTL 1DBBL 3I3DA 4B53A 2X4UB 1SY6A 7FABH 3MFFB 1EJOH 4GG6F 2HWZH 2UZYB 4DVBB 1KCLA 4LCWA 4RRPG 3SDCA 1FHGA 1U8LB 2HG5A 2LE9A 2D7MA 3SJVE 1G7LB 1VFAB 2AABH 3EO1B 1IARB 3IVKA 2YPKA 1UA6L 4OGAD 4K7FA 3W0WA 2BSED 5ISZB 1Z2KA 1Q9LB 2X89D 3E6FB 4ODTL 3LKOA 2XA8L 25C8L 1NCNA 3KHQA 1OAZL 4U6VL 2GT9B 3MNVA 3MJ9L 5MHSD 1FVEA 5I1KL 2Y6SD 4HQQL 1NC4A 2F54A 4JRYD 3SBWA 2ICEB 1C16A 4WWKA 1C5DB 1HH9B 3QIWC 2LABA 1FDLH 2EDYA 4NFBA 5IEHA 3HI5H 4YC2B 2ZG2A 3NIFE 4G6FD 1T89C 1TJGL 3QUML 2MCPL 1INDL 1LGVA 1UC6A 3WFHB 1W0WB 3EGSB 2QHRH 4YDLC 1S9XB 3EOAA 5E4EC 1J0ZA 4JKKA 3WLBB 5MERA 2JK5B 1S5HB 5C0BA 2DI7A 3RAJL 4OLUH 3BW9B 4H25A 5GS1A 1IQDB 1B4JH 3G6JB 4G5ZL 5F8RC 3OZ9H 2DS4A 3W39B 2HRLA 4Y4HA 1N5AB 1C5CL 4MXVE 4OM1L 5TQ0H 2AJXL 5I1JH 2ZOLB 1FFPA 3PWLB 1OB1A 5DEGA 5KOMC 2J2ZA 4TNWF 3QWRD 3UX9B 5ICYB 1XGUB 4TVPE 1KSRA 5FYKD 1XFPA 2NXYD 1WBXA 3QFJB 5DJYB 4ESKA 5HVFB 2X7LA 4ZS6C 5ICZA 1MPAL 4HJ0D 4G42B 4NCC1 3BVNA 3FB8A 4UV7L 2HH0H 2DKMA 2AI0H 3ARBC 5I0ZA 1JNNH 4UILL 2VDLH 2Z91A 1IM3B 4FP8L 3L5JA 3QUXC 2V17H 1K6QL 4RWHA 1D5BB 1G0XA 1MJJB 3U46A 3UROR 3S36X 3NMEA 5KSAB 4ZSOE 1MJ7L 1WISA 3K3QA 1G9ML 4EN3B 1AKJB 3VXOB 1ZKAA 1CLOH 1FBIH 4RZCA 4NRYA 1LP9B 1BD2D 5DZOA 5AD0B 5TDNB 2FX7H 4R0LA 4POYA 3I84A 1Z9LA 3RUGE 2VIRA 1I8IA 3V0WL 4KI1A 5ANMA 3MODH 3GSXA 2G60L 2J1KA 3HE7B 3OGCA 1Q0YH 4NKOA 3PXJA 4XP5L 2CDGB 4X98B 3MLPA 5E7BA 3KPPA 2VAAB 3BOVA 5HHVL 1BAFH 2XXCB 4NQVA 3GJEA 4PD4J 5IVZA 1ZLUK 2MCG1 4KXZH 1GVIA 3QRFM 1YN6A 3LQZA 1AO7B 2IANE 4PRHA 4PRDA 4MAUH 3MLUL 4K07A 3RL2B 3P77B 4TUJA 5DRWA 4PP2A 1FGNH 3VRIA 2NY2C 4JHAL 3A6CH 3LRGA 2OR9L 3ULVF 4YIQA 2IAMD 1N3NB 1IQWH 3SGDH 1P7KB 4F9PA 3U0PB 1C08A 4OIIL 1BIIA 3R8QA 2R0LL 5D2NB 3ULUC 4FQCL 2BNRA 1V3KA 3QA3A 4MCZA 1EXUA 2YRZA 1MRCH 2DB8A 1T2XA 3O8XA 5ID1A 1E0OB 2FX9L 1G1CA 1UGNA 3ZZ1A 2P43B 4K8RH 4QKXB 2AK1L 3WJJA 2X10A 1XGTB 3I75B 2Z8WC 3BO8A 4J4PA 4QO1A 1FAIL 2N1KA 3LEXA 1JP5A 3JWOC 1A1MB 1WV7T 2AEPH 3BHBA 3X12A 5C2UB 5GISL 1J8KA 4XWOC 3U9UB 1R3IL 1E6JL 5LVEA 1T0MA 2H6PB 1CGUA 1JWUA 5IEKA 3TH3T 3TO4C 4GXVH 4X99B 2BERA 4WI4A 4XI5C 5T3XH 3BZFB 3K0WA 1HHKA 1P7QA 3MSPA 1T04B 1X5GA 1Q9KB 5IGXL 1F90H 2DQGH 1JHKH 1DVFB 4DUWA 3GSVB 1FSKC 1A3QA 2R15A 2NQCA 2DWDB 4PRAB 1MRDH 1I1YA 3EYVB 3KVQA 1TTFA 4WHTB 2IPKB 1N4XH 1CGSH 1KPUB 5BRZB 2ZG1A 4IDLA 3LN4A 5AWNH 4IBLT 4UTAL 5HI5C 3FQNA 2JB5L 5J12B 1LEGB 5ETUA 3FN9A 3P30H 4EXPX 4HUKB 5CIPH 5KN5B 3MRQB 2HJFA 3G6DH 4HT1L 2NY0C 5E5MA 3SN6N 3S3PA 3EO0A 4X4XA 5INCA 3QULB 1WTLA 5HI4D 2JCCF 4MNQD 5DF0A 4X9FA 1MCEA 4NKMB 4LP5A 3RHWK 5GS0D 3VFVA 4JVUA 4XNUH 1LO4H 5CIPA 5F9AC 4XNZC 3TA3D 2CDFA 5KJRH 4O4YL 4IRZL 4N8CH 5CBEA 3M45A 3ZMRA 1XGRB 5JQ6L 5I1IL 4M03A 3MCLH 4OD3H 3MFFA 4NQEE 2QEJA 3SCMC 4MQTB 3SDAB 1IAII 1F58L 4DVBA 3ARZA 2Q20A 1A6WL 2NMSA 3TBWB 5CJXC 3QEQD 2W07A 1U8LA 3QDGD 2EYSB 1AXTH 1YYML 1X5AA 4OLWL 1G7LA 4NN5C 4OGXL 1VFAA 3EO1A 4XTRC 2VXQH 4M5YL 1J0YA 5ISZA 1Q9LA 1QSFB 3E6FA 4MX7B 2FCBA 4Y1AD 3MGAA 4LCYB 4G8FB 3QNZB 1KIQB 2JTDA 3H6JA 5TQ2H 1DN2A 4OGYL 1EAPB 2GT9A 1TJIL 4JJHA 5HTSA 5LXGH 2Y07L 1BWWA 4ODUB 4TULH 1MJ8H 4HC1H 2P44B 1BZ9A 1JWSB 3R0NA 2ICEA 4MJID 1EZVY 1C5DA 2FO1A 1HH9A 4OB5H 2Z8VC 5C71A 4LASH 1IILE 2BSTB 1GZPB 1J8HE 3LKRB 3ULVL 1NGWB 2XN9E 1ZVSB 5EUKB 1T7YA 4P2RD 4PJDB 4FOMA 3IXTB 4L3CB 3VXMD 2NX5D 4HC1A 2OK0L 1YUHB 1UZ8B 3FL7A 2YOCA 3WFHA 4KKLC 4RX4A 3CVHL 3FOLB 4XVUD 1HKLH 2BHZA 3EGSA 4RGNB 5D93B 4UZGA 1S9XA 2DM2A 3GBML 2Q8BH 3WLBA 1ZWIB 5C07D 2JK5A 1S5HA 3T4YB 3BW9A 4MQXC 3C6LD 5E24E 4XPTH 5FHAH 3G6JA 4IRSD 3O4OB 2BX5A 3W39A 1N5AA 1CFSB 4OLVL 2EXWC 4Y2DB 5CLTA 1KELH 2ZOLA 3UJJL 3PWLA 5A2FA 4L4VB 1A7OL 5ICYA 1XGUA 2DRUA 5D1QD 1W0YT 3PWVB 2APXA 3QFJA 5DJYA 4H5SB 4W4OC 2V7HB 5GJTL 3ESVF 4G42A 3D3VD 4KU1A 3SJVB 1R0AH 1JZ3A 4QHUB 1A4KB 4MDIB 1TJHH 5KTEL 1IM3A 5HGDB 1K85A 3RIAF 2O5YL 2A83B 4PJ5B 5EUOE 4PPTA 1OSPL 3MJ8B 1MJJA 5K59F 5GZOD 1H0DB 5KSAA 4V1DD 5ICXB 4EN3A 1AKJA 3VXOA 2CUHA 1TCMA 4Z7VB 5IJKC 4HGMA 3TYGH 1WZ1H 5LG1A 1JHLH 1LP9A 4GMSL 4MA1C 5AD0A 5TDNA 5T33H 4FQJL 3WKML 3QP3A 4GS7C 3VXTB 1CF8L 1ZVHA 2WUCH 5TE4L 3BPNB 5MI0B 3WO3B 3ZSTA 4TUKH 3IRPX 4LLVB 3ARGC 3PQYB 4MA3B 4QRPB 4Q6IB 2YD5A 3HE7A 2XKNB 4JR9H 3TN0B 2FHFA 1M7DB 2CDGA 1QYGH 5T1MA 1A1NB 4X98A 3CZFB 5JMOC 2VAAA 2YRLA 1WGOA 4PJ8B 5I9QC 3P4OB 1LILA 2YUZA 1YY9C 3RKPA 4XB7A 4X6CF 1CR9L 1CCZA 1NMBH 1AO7A 2WWMC 5F9WC 5C0AD 4GRLB 4BM7A 1FE8L 4NFCA 3P77A 1BOYA 3AFLA 4IOFD 4I3GA 1YNKH 3ALWA 5SX5H 1XCTB 3VGEA 4GXUM 4HDIB 3DYOA 1CVSC 1IL1B 3MACL 1ZLWH 3SQOH 5L7XL 4L3EB 1N3NA 3PWUA 5KVDL 2YUVA 3U0PA 5B39B 1KJMB 3D2UB 1FVDB 4R2GD 2CKBB 3FQUB 5D2NA 5ACZB 1A7QL 1UADC 1R5IB 1I85C 3R4DA 4NQSA 3RRQA 3JZ7A 3RZCD 2DQCH 3GEWB 35C8H 2YPLD 3O45B 2AKRB 3MOAL 3THMH 5DMGD 2Q76A 1J1PL 1I8MA 1XGTA 3I75A 4EBQL 1RZKL 2UZXB 4HCRH 1WAAE 2X42A 4UTBL 1A1MA 2V2XB 3LN9A 5DI8B 4PY8J 2VSCA 3RU8H 3HB3D 2PTVA 1UH3A 4HS6B 3U9UA 5EU7E 1N26A 4ZSOB 5FKPA 2HYMA 2H6PA 3SO3B 5J89A 1TETH 3BZFA 5C0DB 3QEQE 1T04A 3QDGE 1Q9KA 4HCRA 3BPCB 1DVFA 5F9OL 3GSVA 4BA8A 1S8DB 5KAQG 2DWDA 4PRAA 4WHTA 2IPKA 4YFLF 5C92A 1KPUA 3HMXL 5BRZA 4WW2C 2XV6B 1RZFH 3Q2CA 2DTSA 4LDOB 1OTTC 4Z7NE 4CN1A 3B3IB 1EO8H 2C3XA 1HILB 1LEGA 1QFUH 4HJJH 2NZ9D 3PP3K 4YH6A 3G5VB 2DTML 3HAEB 5H35B 2R29L 4U1NB 5MENE 4MXQC 2W9EL 5HGAB 1IGIH 1DANU 3QULA 5CUSH 4BZ1L 1G7QB 2J7LA 4NKMA 5IBTH 3REVB 5I2IB 3AREC 3TBTB 3K1DA 5FGCB 4KZEL 4LVEA 5B38B 1XGRA 1EV2E 1IBGH 2DLFL 2YPVH 4GJTB 3WSQL 3WFEL 3AS1A 3FZUC 4Y4FB 1MCSA 3MUHL 3SDAA 5HYJA 5KS9B 1T4KB 1XF5B 5FAAA 3TBWA 4HBCH 1RULH 3V7AE 4N1EA 2EYSA 5DQJB 5IMMB 3IFNH 3QIBB 4J3TA 4WU7B 1QSFA 4KJYB 4MX7A 4ONHB 3OXSB 4LCYA 3QNZA 1GH7A 1OT2A 2A9NH 4XWGH 1EAPA 4U1MB 5FHBL 1EFQA 2F8VA 4B7LA 5DHYB 5DR5L 1I9IH 3T3MF 4ODUA 5ALBL 3UBXB 2IH3B 3BSZH 5EO0B 1DL7L 5KW9L 1JWSA 3F58H 1N6QH 4M62L 1IEAB 2VRAA 1YEGH 1LD9B 2BSTA 4PJBE 1GZPA 3LKRA 1NGWA 1ZVSA 1MHEB 4PJDA 3IXTA 1QUNA 2RJMA 2XZAH 1MFDH 4K71B 4AYFA 1YUHA 1UZ8A 5BV7B 1ODAA 3FOLA 2Y36L 1OAKL 1DZBA 4I0KA 4FXGB 4JRYB 4TVSa 1U3HD 4RQQB 3QXDB 4KTYA 1XF3B 3GK8H 4HWUA 4OFPA 5KVGH 3B5HA 4Y2OA 1ZOXA 1ZWIA 3T4YA 4KKBD 2K9UA 4DGVL 5KSBF 1C5BH 4G6FB 2DN7A 2DAVA 2H2SC 5GGTH 3FO0L 3W9DA 1CLYL 1A22B 4KRPC 1RZ7H 1HYSD 1L7TH 1CFSA 3BP7B 2EDWA 4XCFH 4Y2DA 2B4CH 2LU3A 4L4VA 3MV9D 1JGUL 2UWEF 3V4VH 2VQ1B 3PWVA 3KJ4B 2VWEE 2Z31D 5B21A 5A3ID 3KLHC 1KJ2B 2BHUA 2CMRL 5GGTA 1Z0MA 4RDQF 2V7HA 4AIZB 4Z7UE 3SJVA 3NCBB 1XCQB 4QHUA 1A4KA 3Q3GB 4MDIA 5I6XB 4JRXD 2OJZL 5HGDA 2I07B 1U42A 5C6TL 3V6OE 4PJ5A 1E4KA 3MJ8A 5FCUH 2CGRH 4HZLB 2VR4A 1GZQB 2WUBH 5CAYB 1DE4B 2NXYB 5ICXA 2ZP0T 4QHMB 1B88A 2VXVH 3L1OH 1AFVH 1VSCA 4Z7VA 4G6JH 3OGOE 4AG4L 4NUGH 2UV3A 4APQD 4MZ2A 2YPLE 1N7MH 2ZPKH 1FYHB 1OQXA 3STZB 3VXTA 1ZXQA 3DO3A 4R8WH 3EJYD 4AEEA 2XTJC 5I74B 5JW4R 4LLVA 2E6QA 4GG8B 4I77L 3PQYA 4MA3A 4QRPA 1D9KD 3GRWL 5CZVL 4JB9H 2XKNA 4YBLC 3TN0A 1M7DA 4OBSA 1NEUA 3L9RB 3RWHB 1A1NA 3CZFA 1YJDC 4LSPH 5HYQB 4HUNB 1BD2B 4JO4L 3RHWF 4LSVH 4PJ8A 3P4OA 2DJSA 1WIPA 3RY4A 4LVHC 5CCKH 1UZ6E 2CKBH 2I27N 4GRLA 4OUOA 4EVNB 1UG9A 4TVPH 2ZNWA 5GRWA 3UTPD 3RX7A 2EDDA 3U7AA 1XCTA 4HDIA 1IL1A 2PYFB 4PS4H 5HY9B 2WLZA 2B2XH 1GGCL 4L3EA 1KEMH 2MPAL 3RVUD 3SDDC 2LAGB 3WUWG 2PW1B 1DBAL 4ZFGH 1JYVA 2QADD 4I2XE 1KJMA 3D2UA 5B39A 2CKBA 3NA9L 4PGEB 3FQUA 1I9EA 5ACZA 2R69H 1R5IA 2FEDC 2YHGA 5TE7H 3BFOA 5E2UL 1OAUH 2AKRA 4V2CB 4MQSB 5CP7B 5T5NF 1LO0L 2IAMB 1MCWW 4C56E 5T1DH 1IZKA 3RVWD 4N0FB 1NUDA 2EC9T 1SEQL 2CKNA 2V2XA 1BQUA 5DI8A 4HS6A 5E99H 2DI9A 4ZSOA 4NKIL 4WI8A 1YEHL 4FQ1H 2J8UE 1MLBB 5F6IC 1GOFA 3LMJH 3RZWA 3LV3B 3O9WC 2JJVA 5C0DA 3R0MA 3MGTB 3NACL 4ZFOL 1J12A 3BPCA 1HINH 4PJXF 1G6RB 3E2HC 3MFGB 4YDJB 1DSFH 3LIZH 1NGXA 4LAQH 5HPMB 3CDGB 5AAWA 3EYSH 4P49A 3WJLC 1J5OL 2MOVA 2X70B 5FYJU 1X4YA 2NZIA 4S1DD 1WWAX 3B3IA 1HILA 1ZT7B 5FUCC 3OR6A 3HR6A 5J0BA 3G5VA 3E6HB 4Z8FH 2VUOA 5H35A 2QSQA 4G8GD 4U1NA 2IQAB 4FFVD 4LMQI 5HGAA 4G9FE 5MEQA 4HLZG 3DX7B 2C26A 1B2WH 1Z3GL 1QSZA 1B0GB 4QWWC 1G7QA 4KMLB 1EEZB 1J0HA 3REVA 5IQ9B 2G75B 4OCXH 3JV4B 5E08H 1B6DA 1JRHI 4UB0L 1MAJA 1IMHC 5B38A 1BBJB 4IHOB 2W65B 1EGJL 3FQXA 3ZHKA 3UZVB 4Y4FA 1QLFB 2FEEI 5T3ZL 5KS9A 5IBUB 1T4KA 4MNQB 3LEYL 4NGHH 1XF5A 3NAAL 4YLQT 4S2SB 5DQJA 3TA3B 2GAZB 5IMMA 1F4WL 3BP5B 3QIBA 2I60L 1ZTXH 2EDQA 5F9JA 4WU7A 1NFDB 3VGFA 5JXAH 3DUHA 4Z0BL 2V5SA 4KJYA 3AMLA 3U7WH 4LBEB 3TVMC 3IS1X 1JF6A 1FNFA 2HP4A 5FK9B 1NCAL 1PW3A 4KQ3H 1GGIH 4ONHA 3OXSA 3VFPB 3WN5C 3QIWD 4K7PL 4JFOB 4U1MA 3RWGB 4EXKA 4YFDB 3WKNA 3F5WB 5F96H 1CXFA 4OFIA 3QEQB 3UPAA 4CBPA 2IGFH 3QDGB 4M1GL 3UBXA 4NN6B 3ARQA 1JPSH 5EO0A 1NDMB 1P84K 1RUPL 2CK0L 3CSGA 5E1HB 4HKXB 2X89A 1DBJH 1IEAA 3SE4A 4KJWC 1LD9A 4Y1AB 1QRKA 5IIEB 2V5YA 4JPWH 3IAPA 2YN5A 4YO0B 1G9MC 3RFZC 4NHCH 1MFEL 4X8JA 3SGJC 1KPRB 5F7FA 3VI4F 3NCYP 4MLIA 1OQOA 4KY1L 4KK5D 2O5XL 5DDHB 2GYSA 3DX8B 4R90L 4GG6E 3WIFB 4FXGA 3CSPA 4JRYA 4RQQA 4ELKB 3QXDA 2AP2A 1XF3A 4MJIB 5ITBH 1BM3H 4JGJA 2IMMA 1IM9D 4P2RB 3HC3L 3HNTL 3ARWA 3VXMB 2NX5B 1KJ2H 2OI9B 4F9LA 4ZS6D 1LK3H 3BP7A 2R0ZL 5TDPB 1QBLH 3ARBD 2XY2A 1T2JA 3U9PL 1V3JA 4QGYA 2R56H 2VQ1A 5C07B 3MRJA 1JGDA 5I1GL 1RVFL 5CZXC 3QUXD 4Y5XA 1KJ2A 3UTPE 3C6LB 5FYKH 4AIZA 3ZYZA 2I26N 1FGVH 3VXRD 4M9OA 1LO3L 1XCQA 1PKQE 3P0YH 4IRSB 4C57C 1QFHA 1KGCE 3Q3GA 5FUOL 4PG2C 4FQPA 1AD0A 2I07A 4D8PB 1GGBH 3L3GB 3QWRA 5D1QB 2A9MH 3HC4H 4AQOA 4LCCB 1GZQA 1DE4A 2KZWA 4OF7A 1NCDH 3D3VB 2DQIH 2VLRE 1P4BL 1A7RL 5IB5B 5GS3A 1F4YL 2RQ8A 3STZA 1JGVH 5BCAA 3SGKC 3GHBH 5AYUL 1ED3B 1AGCA 4GG8A 1QA9B 5EU5A 4R97C 2VYRE 4V1DB 1BVKB 3MLXL 4MB4A 1MIMH 3RWHA 1FO0L 1TDQA 5HYQA 1J18A 1BD2A 2NY2D 4I0PC 3NCJH 3S3JA 1JWMA 3HZVB 2A1WL 5L6YH 4P5TC 4RA0C 5C3LD 1XR8B 1NBQA 5C2BL 1L9MA 1EEUA 1UXWB 4G43B 3ULUD 5FYJL 3CXDH 2PYFA 3DVFA 5HY9A 4OZGB 4X4ME 2PR4H 5DQDH 4UI2A 4WCYL 4J6RL 3RBGA 4X6BB 5D4QA 1E6OL 2VSDA 4PGEA 3ZKQD 1KN2H 3GDBA 5I71B 4YBQC 5F1IA 5C0AB 2FEEL 1A8JH 2IPUK 5E2JA 4XWOD 5DEFB 4AEHH 4DAGH 5IROC 4H88H 2B1HL 4FQLL 1S7VA 3DHMA 5CP7A 1RQ5A 3MLYL 3TO4D 4ODSL 4ZTOL 3GSNB 1D5ZB 1CFTB 4XI5D 2EYRA 1V7NL 4N0FA 5E6ID 1NCCH 3G5XB 2GIYA 4KRMB 3FB7B 1G6RH 4R26H 3HNVL 4R2GB 1DQTA 4IMKC 5M95B 1MFAL 1T7ZA 4S1SL 4JREC 1BQHB 4HSQA 2VLJD 2BVTA 1KIPA 3RZCB 1MLBA 4L4JA 2BJML 2R8SH 2YPLB 5M94B 3LV3A 1PSKH 4OM0H 3MGTA 5EA0L 4KRNA 1G6RA 4O9HH 3DECA 4Y0GA 3VE0B 3M8OL 4YDJA 3T0EC 1ZA3B 4EUPB 2NY0D 3SGEH 2I5YH 5HPMA 3ULVE 1F8TL 2X70A 2VDRL 4NC1C 1MY5A 4M1DL 3O2WL 4YDIH 1AE6H 3MOQA 1FIEA 4QYOB 1S3KL 2XRAH 3E6HA 1EIBA 4B50A 3S3SA 1QNZH 1U6AH 2J8HA 3X3GL 2IQAA 5JTWA 3DX7A 3RGVC 3S35H 3IGAB 1XZ0B 1B0GA 2KUTA 4ODHH 2HKFH 1TZGH 2P5WD 1AGFB 1EEZA 1VA9A 1X6LA 1VGKB 2G75A 3SCMD 3JV4A 3OJDA 4NM8H 1AJ7H 1EA9C 3P11L 5DZNA 5BQ7B 3QJHB 5J13C 5MEOA 4LLYB 2R2EA 1BBJA 4IHOA 2W65A 3N85L 5FGRA 5TE6H 4XTRD 1H8SA 3BH9B 3GSUB 4Q9QH 5E2TL 3QQ4B 2RHEA 4MNQA 1II4E 2W91A 3U48A 1K5NB 4ORGB 2ZOKA 1EFXA 1KBGL 5HHOE 1ZVYA 4S2SA 3TA3A 2GAZA 1Q72H 3BWAB 3MRNB 2CRYA 3BP5A 3TBYA 2FL5B 3TH4T 1FYTE 2CUIA 1NFDA 3BYYA 3OAUH 3BZDA 4TPRH 4LBEA 4LLWA 2GTZB 5FK9A 1RIHL 2Z4QA 2LU7A 3DX6B 2Y72A 3VFPA 1KULA 5LQBL 3MXVH 2V2TB 2J8UB 4JFOA 2FSEB 3RWGA 5IESL 3F5WA 3QEQA 4K3JH 3RY6C 3QDGA 3UJTH 5C70A 5IM7B 3QUZC 2VDML 3T77B 1NDMA 1EERB 1M7XA 4X6DB 3TJEH 4KKLD 1OGAE 2IBGA 3ABZA 4HKXA 2EH8L 5HVHB 5IIEA 5EZJB 4HXBL 4YO0A 4OQTL 3WNNA 1KPRA 3S7GA 4M6NL 5DDHA 1KF9B 4MQXD 5J4MA 2W38A 3DX8A 1A14L 4ONGH 3BMWA 1VFUA 4ELKA 3F62A 1B9ZA 1IAOA 3VMNA 2EXWD 5F72S 2NY4D 3UJIL 2QLVB 4P2RA 4P9HH 3BT2H 1RUMH 5IVNA 1UYWL 3VXMA 2NX5A 2AGJL 3O3DB 3IRZA 1YEEL 2YD1A 3B2UC 4KVCH 2VO5A 1G7IB 5ACMA 5TDPA 4DQOH 1U3HB 1ZV5A 4FFYL 4D0BB 1KIUA 3TV3H 4CMMB 2EE6A 1P4IH 4BUHA 5C07A 1CGVA 1JZ6A 3C6LA 3IDUA 4GMTH 3F8UB 4ETQA 1DLHB 2MJWA 3QCUL 4DW2H 1S78C 4WJ5B 4IRSA 4LIQH 2E9IA 3CFCL 4D3CH 1OM3L 4XBEH 3UC0L 1L6ZA 4WFFE 3V4UH 4Z77B 3QFDA 4Q2ZB 1D6EB 4E5XB 4D8PA 1PLGH 1QSED 4YEEA 1YECL 1A0QH 2IPTL 3L3GA 3MV9B 4DN4H 4QRUB 3D39E 1FFQA 4XP1H 3LQAC 5D1QA 5C7XH 4LCCA 5H94B 2Z31B 4TOYL 2J88H 1QFWH 3ARGD 3D3VA 3IETB 4MD5B 5IB5A 2DYPD 1UH4A 4JRXB 1RZKC 4OCSL 1ED3A 2XKUA 3ET9F 5E6YA 3QSKB 1YY9D 4M43L 1F00I 1QA9A 3MOBH 2AEIT 4V1DA 1BVKA 2BY0A 2WWMD 4NWTL 3BP4A 1Z9OA 5CINL 5DJXB 2NTFB 4M9PA 3PV6A 3HZYA 5J11B 4APQB 5GRXG 1SM3L 4P5KB 4QHLB 2XNAB 2BFVL 2BVEA 3M1BB 5HGBB 2Q86B 1XR8A 3IDYB 4RISL 1BJ8A 2GTWB 1RJLA 5CEZD 1SY6L 4NNYB 3BDBA 5J1AB 4P59H 1D9KB 1UXWA 3ZYOA 4ALAH 2NPLX 1R5WB 5D7IB 5FYLL 3GI8L 3R1GL 4XVSL 4LVNB 4OZGA 5EB9A 3HRPA 1KUMA 5K59E 4YHYB 3GSNH 5HHNB 4JFHE 4YHMH 7FABL 4HXAH 1ONQB 5C0AA 2ARJQ 2HWZL 2FATH 3LH2H 2X4PB 1TZHB 5DEFA 2P5WE 2OZ4H 2X1XR 4TN9A 4F58L 2AABL 3GSNA 1D5ZA 1CFTA 4TUOA 5LGKA 1NBYB 4LHUD 3G5XA 5GIRA 2QADB 3V6OA 3WUWB 3FB7A 4MS8C 3OB8A 2CJUL 3DROB 3U0WH 3KAAA 4X7EC 1WWBX 1BQHA 1V3LA 4EUPH 1SVZA 4G7VH 2OZ4A 4WHDA 5IOPA 3RZCA 1IKNA 4YHLL 2YPLA 1PBYA 4L9LB 5F44A 5HYFA 1KCKA 4MNHB 3MLSH 3H3PL 4J8RA 1X3DA 3VE0A 1EHNA 4U49A 1ZA3A 1FDLL 4EUPA 3LOWA 2X09A 1W72B 2LVEA 4XX1G 4MXQD 2HT3C 1HIMH 4IDJH 4I18B 4GKSB 1FZMB 3CLFH 4QYOA 1AY1H 4ENEC 3ARED 2XZCL 2EYTB 5IUSA 4PRPE 5JW4M 4UT9H 3VXQA 2V2WB 5GSRB 1XZ0A 3V8CA 5J7CC 1AGFA 4LPYA 4OLUL 1VGKA 5EU3B 3FZUD 3PABB 2AV1B 4GXUN 2NW2B 4P2CG 5BQ7A 5DRXB 3KYNB 4NRZB 4LLYA 3VXUD 4CAGA 5I17B 3QB7C 3N50A 4G8GB 3BH9A 4OT1H 3V0AC 3MV7D 1MCOH 3QQ4A 4HJGB 5JUEH 4U4BA 4LLMB 4GQ9H 4JGUA 2QQQA 4MA8H 4OZHB 2YEZA 3V7AG 2FH8A 1NCBH 3CH1B 2HH0L 1SYVB 3BWAA 1U8KB 2YXFA 1JNNL 2FL5A 3GSRB 4KI5F 1DUYB 2VDLL 4YUEH 4U7MA 1L6XA 2GTZA 1MCCA 3DSNA 3FJTA 3DX6A 4QF1A 4Z0XB 1Q94B 2V2TA 1GOGA 3MBXH 2J8UA 5CWSB 3ES6B 1CLOL 4BK4A 3O2DH 4P3WA 4F7MB 3BZEB 1KCRH 1OVZA 5IM7A 3MNZB 1F42A 3NZ8B 2FX7L 4DFIA 2H9GB 2NYYC 2EDEA 1D5MA 1BFTA 2D9CA 4OLXH 5L2JB 2MFNA 4FXLA 1V8HA 5IMKB 2UYLA 3MODL 5EZJA 4NZTH 2R23B 3QIWB 1A6PA 2P45B 5EZOH 4J3SA 1Q0YL 4OGZA 2PW2B 4H8WH 5CSZB 3EFDH 2IG2H 2D3VA 2H45A 2ERJC 1I3UA 1BAFL 4HEPG 3NBNA 3WD5H 1A6UH 1BX2B 2H2SD 3AVEA 3GNMH 4KRPD 4G9FA 3UO1H 2E7CA 4XC1H 1WFTA 4YDLB 1RZIB 3UTSD 5E4EB 5JDSB 3UTZB 4OCLC 1FGNL 4ZNEA 3A6CL 4UNVA 3KLHD 1CLZL 3O3DA 4GOSA 1PG7X 3IAGC 3KYOB 1IQWL 2APBA 4PYHA 1A7PH 1G7IA 3KYAA 4D0BA 2DLHA 2XPGB 2PTTA 3U4EB 4BQCA 4PBWD 1AP2B 3G6JF 1MY7A 2P8PB 3T3ME 1BJ1H 4FQQB 1IM9B 1MRCL 4YWGH 3T1FB 4Q9BA 2PO6C 2XWBB 2AVGA 1BF8A 4WJ5A 2BY3A 4K8RL 3SKOA 2ADIA 1IAKB 1U3YA 2AXGA 4Q2ZA 1D6EA 4E5XA 1GJIA 3U79A 3ARBB 2AEPL 3OPZH 1NUNB 4NJ9H 3MV9A 4ONFH 4QRUA 5H94A 2XTJD 1S7TB 2Z31A 3QUXB 2KQMA 1U36A 3V95A 4GXVL 1CD8A 4MA7H 5T3XL 3IETA 3VXRB 4MD5A 3B2VH 1LHZA 1D5XB 2DQGL 1JHKL 2B1AL 2JJWA 2A2QT 5JXEC 5I19H 3VXSE 4NQTA 5KSBE 1MRDL 2AXJA 1CGTA 1UKSA 1SBSL 4L8CB 1N4XL 1CGSL 1IKFH 1CIUA 5E8DH 1LP9F 1D5IH 4XPBH 5IF0B 4HWNA 1KYOJ 2E27L 5AWNL 1NC2D 1CICC 5GQBA 5DJXA 3VXPB 3DXAD 2NTFA 4APQA 2DQJH 3N9GH 3OJ2C 3P30L 3UYOD 2DDQL 4QHLA 1L0XA 2WSKA 2UWEE 4HHAB 3G6DL 4LARH 2NY6D 2XNAA 3M1BA 4NBYB 4LVOC 3Q1SH 5HGBA 4KDTC 5ID0B 2GTWA 1ZEAH 3SDDD 4RAHA 2EKSB 1SJXA 4NNYA 2V9TA 5J1AA 2L0DA 2VDNH 1D9KA 4BSJA 4JLRB 4JDVB 4JDTH 5D7IA 1E4XI 1MELA 4M7JL 4LSSH 1LO4L 2FEDD 1RZJC 5F88B 3IDXH 5KJRL 1XF2B 3P73B 4ZO6A 2NY2B 4OIAA 1A6TB 4QOKD 1XF1A 5HHNA 5SWSD 3QHFH 3MCLL 5D71H 5FXCH 4OD3L 3LEVH 2AAVA 5DT1H 2C9AA 5D7LE 1XF4B 3AB0B 3QDJE 4WVRA 4JN1L 1AXTL 3HG1E 5GSVB 1BGXH 1MLCB 5F7DA 3RA7H 4RGOH 2VXQL 1NBYA 3MUY1 3O9WD 2CO7B 3VXUE 5AZ2H 4L4TE 3DROA 4DKEH 1A7BA 5C0JA 4P57B 1GC1C 5TQ2L 1FH5H 1W72H 4DZ8A 5D8JL 1FNAA 4J12A 3GJFB 5FO7B 2VLRA 4L9LA 4TULL 1MJ8L 1W8OA 4HC1L 3TO4B 4MNHA 3HTLX 4JZNB 4XAKD 3MRRB 1S7UB 5E6IB 5J3HC 1A64A 1X9QA 4OB5L 2FR4B 1C7TA 1FSKB 4LASL 2G5RA 1W72A 1JUFB 4HH8A 1JPGB 3MRPB 2BNUB 5TH2B 2VLJB 1WSST 4I18A 3NVQA 3BISA 4GKSA 4QWWD 2C1PB 1FZMA 5I8EB 4QCIB 3CX5K 2EIBA 1G7JB 2DQFB 1HKLL 2EYTA 5IHZB 4X0KB 3ZTJG 1NL0L 4NWUH 4X7DC 4CN4A 1IFHH 4KPHL 4WTWA 2Q8BL 1MCRA 2NY0B 2V2WA 5GSRA 3V5HB 1KTDA 2ICWJ 4DK6A 3P3YA 2HT2C 1IT9H 1F4HA 3AM8A 5EU3A 3PABA 4FZEH 2YD8A 2AV1A 4XPTL 2NW2A 5A43C 5FHAL 4XPHH 1KJ3H 5DRXA 3KYNA 4NRZA 3CFIC 3WFDL 3LPGA 4XNZB 5I17A 1KELL 3UDWA 4O2EA 4G8GA 4PJGB 4CVXB 3ZDZF 2VLKD 4P9MH 1YYLH 4Q97A 4HIJB 4JY6B 3I6LD 3MA7B 4HJGA 3TVMD 2P5WB 4XCEB 3G6AB 3IKKA 4LLMA 4DEPC 4PJIB 4LLQB 4PJXE 4OZHA 3SCMB 4Z18A 1OT1A 1UWGH 3TT3H 3QHZH 3CH1A 5DWUH 1F02I 2F74B 1U8KA 4OSUH 3C5ZC 3GSRA 4J3UA 1TJHL 1A2YB 1Q38A 1DUYA 2NTSP 4NN5B 5F7EH 3VH8B 3RVTC 1I7UB 3JSSA 5ELIA 3RVXC 4RBPH 4PLNC 1CFQB 4O58H 2W92A 4Z0XA 1A1OB 1Q94A 2ZSWA 4NUJB 3PHOA 4KJWD 5CWSA 3ES6A 4WU5B 1U92A 1J1OL 4F7MA 1J1XH 1WZ1L 3BZEA 1JHLL 1S9YB 5EIQA 2D03H 3NZ8A 5T33L 4GW4B 2H9GA 4HS3B 1O0VA 2HRPL 3D0VB 1V5JA 4L1HA 3TNMB 1TMCB 4W70A 5JPMA 2F53E 5L2JA 2N4IA 2EXYC 3CCHB 3IXAB 4C54A 4CVZB 3BIAX 5IMKA 1AH1A 3LKSB 1AI1H 3EDKA 2R23A 1MI5D 3QIWA 4ODBD 1W8NA 4WFED 4JR9L 3WNPA 1LNUB 5JOFB 4D9RD 5CD3B 1AGBB 1QYGL 2PW2A 5CSZA 1T89A 2XWTB 1BX2A 3CD4A 4PJDF 2CQVA 1KXTB 5EZLB 1MSPA 3RX8A 1ORQB 3GI9H 2OTUB 1RZIA 3SKJH 3WFZA 4JO2H 5GGQH 4H26B 1YNKL 5JDSA 2HAZA 3UTZA 4HIIA 5CZXD 3TLRA 1KENH 1XIWC 3SQOL 1RUAH 2FJFB 1YZZA 2IEPA 3KYOA 4XNQB 2B39A 3MA9H 5AYQA 5FB8B 4J2XA 1QRND 2VXSH 4CRPA 2XPGA 4YPJA 2AJ3B 3U4EA 5A2IH 2NY4B 2P8PA 3S37H 1IM9A 3SE8H 4H1LH 2EEAA 3T1FA 1M6OB 2F5AH 2DQCL 2XWBA 35C8L 3THML 1XGPB 3MRKB 1FNHA 3DMMC 4EOWH 2X9XA 4PR5B 1RAMA 3B9DA 1IAKA 4YHZH 2E9JA 4XHQA 4HCRL 1KJVB 2WAHA 2BNQD 3ARBA 4XC3H 5DK0B 1HSBB 3RU8L 3CXHJ 4GH7B 4H1LA 1RJCA 3VI4E 1AXSA 1S7TA 3QUXA 4R96B 3BEWB 2W0PA 1TETL 3LRSB 1T83C 4WFHD 3UYPA 3VXRA 1BMGA 5HGHA 1UACH 3RWDB 3GZKA 5JIHA 1OGAA 1BEYL 3T3PF 4OKDA 4HKZB 5DD1H 1A4JB 2LFGA 3DI3B 4MA1B 1QSEB 5E2WH 4I0PD 4PLKC 4RNRB 2MSPA 5EH1A 4Z7VF 5GHWH 5C3TA 4P5TD 4GS7B 4P2YA 3VG9C 3BESR 5IF0A 4YK4C 1RZFL 1PZUB 3VXPA 2WIMA 3ARGB 4NKDB 4H20H 1QFUL 1CGXA 4HJJL 1QBML 4HHAA 4Z95L 3AUVA 2DYPB 4OAWB 3S96B 4XAKE 4F15C 3O3EB 1IGIL 1H3TA 1NAMH 2EKSA 5I9QB 4FMFA 1B0WA 5CUSL 3V4PH 3HA0A 4W6XB 4JLRA 4JDVA 5K9JH 4KVNH 5F9WB 4YBQD 5HDLA 4D9QE 4P3CH 4JEGB 2CH8A 4JZJC 3ULUH 5F88A 3TP4A 4XPGH 1XF2A 4C83B 3P73A 3ORJA 5JNYB 3N1QC 1A6TA 1IBGL 4OZFG 1FZKB 1T2QH 2YPVL 3OKLB 3BZ4B 5GRVL 4JFZH 6CGTA 1I9JH 4LSUH 4G8IB 5E8NB 3MRBB 3HLAB 1XF4A 4GBXC 4HBCL 1RULL 2C4FU 5JA9A 4L8SC 1UJTA 3GJFH 4NO5B 3CLEH 4RAUB 2DIBA 1MLCA 3IFNL 3LDBC 1PEWA 3OB0H 2WV3A 3RIFK 1B90A 1JBJA 5EU6D 3ARFC 4O5LH 2H1PL 1G7HA 1NAKH 3T0ED 1AR2A 2A9NL 4XWGL 4ZOCA 7CGTA 4HUVB 3GJFA 5FUZH 5FO7A 4BFBD 1I3GH 4KUZL 3TO4A 3BSZL 3CSYB 4JZNA 1BWMA 4TYUA 3MRRA 2PCPB 1S7UA 4LHUB 1N6QL 5E6IA 2FR4A 5EULV 4PUBH 4D94A 4QRRE 3NCFB 1JPGA 4RGMC 3MRPA 4NNXB 3QDHA 1URLA 2BNUA 5TH2A 2VLJA 3RGVD 3MBEC 3F7RA 2XZAL 1MFDL 4YHKH 1ZLSH 4WW2B 1BPVA 4XGZA 5I8EA 2UWEB 3G04B 3ARDC 4QCIA 3WIHL 4FXKB 1G7JA 2DQFA 5IHZA 3QUKB 4X0KA 2BC4B 3C2AL 3GK8L 4YNYB 2ID5A 5DS8B 5FF6A 5C9KA 2XI9A 4ZUWB 3HNSH 3V5HA 4GAJL 3QISA 3VGGA 1VFBB 5CSBA 3GIVB 5GGTL 4D9RE 3RTQC 1RZ7L 1L7TL 3PGDB 3AREB 1P4LB 3D48R 2B4CL 3ZLQC 1KCSH 3OJMB 4PJGA 5DJDB 3KPLB 4PTTB 4CVXA 5LCVH 4OCWH 1DQLH 3V4VL 4HIJA 4JFEE 4JY6A 4M93C 3MA7A 3AGVA 1FAKT 2P5WA 3G6AA 2C3WA 1EBAA 1MH5B 4LLQA 4PJIA 3SCMA 1AC6A 5IB3B 5CJXA 1NSNH 1M1SA 2V6HA 3VXUB 5KS9F 1YMHB 1A2YA 2ESVD 5AUMA 1QRNE 3QUZD 3VH8A 1I7UA 3C60C 5I1AB 4WV1C 5FCUL 3WIIH 4QGTA 1CFQA 3MV7B 3WNMA 1R24B 2WM0A 1A1OA 2WUBL 4NUJA 4OKVB 2BY1A 2A73B 2F19H 3BUYB 5HHXH 4EEEA 4LEOB 1AFVL 5GRUH 3J8F7 4WU5A 4QTIH 1T7XA 4G6JL 3S34L 4NUGL 3VMPA 1P7HL 1P69B 2ZPKL 1S9YA 5DYOB 4GW4A 4HS3A 3VA6A 3D0VA 5D7SH 3TNMA 1GGUA 1BECA 3TNNB 3HFMH 3OXRA 3SKNB 3OKEB 4GLRI 4R8WL 3G5ZB 3CCHA 3FRPG 3IXAA 3ROLB 3RDTC 4CVZA 1KN4H 3LKSA 4K7PY 3QH3B 2HLFC 4JB9L 1LNUA 3E3QE 5JOFA 5CD3A 1AGBA 3EOTL 4LSPL 4E0RA 4WFHE 2AQ3A 4LRNH 2XWTA 4LSVL 1A5FH 4KROC 3KNBB 1U3ZA 3GGWB 5EZLA 5CCKL 4H0IA 2M26A 1ORQA 2OTUA 2CKBL 4QXUL 4TVPL 4H26A 4ZOAA 3B43A 5E8PB 5JW4Q 1CU4H 3FMGL 3PHSA 3I3BA 4PS4L 4DZBB 5EBWB 2B2XL 4XNQA 4Q9RH 1N5YL 5DO2C 1KEML 4RMUA 4ZFGL 1S78D 4WTZG 3MRDA 4KRPB 2D0HA 2AJ3A 1FORH 4UDTB 3W0WE 3UTSB 3GSQB 5TE7L 1OAUL 1M6OA 4N8VB 1CI5A 4MXWL 3B9EA 4W4OA 3KR3H 3MRKA 4I3SH 1X5JA 5T1DL 2H2PC 3FTGB 3K74B 5DVMA 4PR5A 1CTOA 1ITCA 1KJVA 2R2CA 5DK0A 2F54E 1HSBA 5D1ZA 2VJXA 5BMFH 5E99L 2VZVA 4RIRB 5BJTB 5I1HH 1CXHA 4R96A 4CNIB 4FQ1L 2FBJH 3BEWA 4JO3H 2Q3AA 5F7UA 5EWIH 3DHJA 3LMJL 3LRSA 1J9CT 1RZGB 1QLEL 4NQUA 4BFEA 3RWDA 4PGDB 4I1NB 1HINL 5IJKA 4HKZA 1A4JA 2OSLB 1QSEA 4ZAKC 4RNRA 4JM4H 1AR1C 1DSFL 5DVKA 4M8VA 3BDXA 2ZZUT 1UWEH 4LAQL 3JV0A 5F9DC 4X9BA 2XTJB 3EYSL 2ENSA 1BJ1J 5C0BE 2RCSH 4NKDA 2FX8H 2ENYA 4IIQC 5E70A 5D6CB 4YBLB 3EHBD 4NO3B 1CQKA 2DYPA 4OAWA 1A21A 3EYUH 1A6VH 2OCFD 4R4BB 5F3HB 3O3EA 1YEKH 1YQVH 2YD4A 3JUZA 5H2BB 2VN4A 4LCUB 5EO1B 1B2WL 2QTEA 1HXYA 1NUGA 4LVHB 3KPRD 1UB6B 1I9RH 2YMXH 3SQBA 1G9NH 5JOPD 5HDBF 4OCXL 1MVUB 1NC2B 3CAFA 5E08L 3DXAB 5JW5B 3BRGC 3ZYIA 4C83A 3O3UN 1T1WB 3TPUB 3VD7A 5JNYA 4N5EC 5D7KE 2NY6B 1CDIA 1ZLUH 1JGLL 1MIEH 1EK3A 1FZKA 3NIDF 2CSPA 3W11C 4Z5RB 3OKLA 1I1AC 2QSCL 5C09D 3SDDB 4P46A 4WHYH 2A6DB 4YJZL 4G8IA 5E8NA 3T0WA 3MRBA 5BXFA 3HLAA 1CXIA 2PKDA 5FV2A 3NCYS 3U1SH 3JWDL 4NO5A 1YEIH 3QIUC 4RAUA 5I1CH 3R8BB 3M17B 5I8KL 3Q6FB 5HI3C 1Z5LB 3VWJC 5IT2H 4NDMA 1MQKH 1TQCC 4QOKB 5SWSB 5SX4H 3U7WL 3X17A 3MXWH 2ICWI 4KQ3L 15C8H 5EG6C 2Y06H 3FFCD 4HFWB 5DJAB 3TBVB 5ANME 3P9MA 5DFVC 2IALB 3ZL4H 4YXKH 4HUVA 2ZUVA 1N8ZB 2HT3D 4LHQB 1CTNA 3I02B 1NANI 2YS4A 5EOTB 3E8UL 1JPSL 5GJSH 5F6IB 2JELH 3CSYA 4JQIH 4CU6A 3MTRA 3VXSA 2PCPA 5K33A 3O9WB 3H7BB 4LHUA 4PBXA 4XNXH 5KSBA 1YEDB 2ESVE 1PFCA 1DBJL 1BF2A 4M1CC 4ENED 3E2HB 3G9VA 1SJHB 4JPWL 4ODWA 4Z7WF 4NNXA 1CLCA 4L8DB 4XNMB 3STLB 1KB5B 4NHCL 2DI8A 3QJFB 4MNGB 3QI9C 2D4FA 4FQIL 4WW2A 1F11A 5LGHL 4QY8B 3F7QA 2UWEA 3G04A 3D85D 2EC9U 4FXKA 4GFTB 2ZUWA 3QUKA 2AS5M 4JN2B 4BQ9A 1HHHB 4R3SB 5DS8A 5D5MB 5ITBL 3TBSA 1R3KA 1BM3L 4N1CA 3JXAA 5D9SA 4UOW1 4ZUWA 3S36H 3DUSB 2ZJSL 2BNRE 4M00A 1E4WH 3H2WA 1VFBA 1KPVB 1AQDB 1KJ2L 1C7SA 2B5IB 4OI8A 3QUMB 2ADGB 1LK3L 4PY7B 4X7SH 1BQSA 1CD9B 2NW3B 3PGDA 4XPFL 5I8CB 3AREA 1P4LA 2CLRB 1QBLL 5DJDA 3KPLA 4PTTA 4F9PC 1UQSB 5DSCB 4NYLB 3P4LA 5LKNA 4OFYD 3R06B 2WINA 4XZUB 4BFIB 1MAKA 3O6FD 3WLWC 1MH5A 1H3VA 4Z7OF 2OR7A 4V2BA 4JHBA 3P0YL 1AGEB 5E7FA 2D31B 3VXUA 5KZCD 3L5XH 1FG9C 1YMHA 1GOHA 4L4TA 2V7NB 3OQ3B 1GGBL 4J4PC 2VLKB 1ZHLB 3MV7A 4UU9B 2A9ML 3HC4L 1R24A 5BVPH 4U1SB 4OKVA 3TVMB 4Z78B 3KJ6H 3N1MC 2A73A 3BUYA 4LEOA 1NFDF 4HUXB 4QHNB 3PGCB 3WN5B 3QO1B 3HE6C 1CL7H 4MGXA 5SV4A 2ZUYA 2HJLB 2J5LC 3TNNA 3SKNA 1JGVL 1F5WA 3UTOA 3GHBL 5JHDE 3KYMA 3ROLA 4NZJA 4GAGH 1YY8B 5DMJB 5HD8C 2V9RA 3ZDYE 4HUUB 3QH3A 4Q58C 1ADQH 2X5PA 2XZQH 2J6EA 1MIML 3MRFB 4HPOL 2FGWL 4P4KC 2DMBA 5E6ZA 4UAOC 1IEHA 1JMZA 1PX4A 1KFAL 3IDMB 3NCJL 1PDKA 3KNBA 4YXLH 5L6YL 5IR1B 2GJZB 5DD6B 4D9LH 1GIGL 3SDYL 3RL1B 4B0MM 1HSAB 1ADQA 1DN0B 1MI5B 3EYOA 5E8PA 2HFTA 3CDYA 3CXDL 3WBDA 4KI5E 1UH2A 1K8DA 3MPCA 5JZ7C 3OKYA 4DZBA 1HHIB 3L7EB 2PR4L 4XCNB 4ZG1A 2PO6D 3W81A 5DQDL 1YNLH 1I8LC 3KXFD 1XEDA 2VISB 2R9HC 2ZCLL 4PRBB 5EN2A 4UDTA 3RIFF 5ISZE 1MFNA 2YA1A 2R2BB 4LOUD 3UTSA 3DOSA 3FQTA 2APFA 4DAGL 3FT2A 4H88L 4N8VA 3FCTB 1JJUA 3VFNB 1A3LH 3FTGA 2QV2A 5HHQB 2OR8A 3IAQA 1NCCL 4IMLA 4LGSB 5DJ0B 2RAMA 4HK0B 1G6RL 4R26L 2FZ3B 5JXED 2AJSH 3OAYK 3ZKNC 1MFCH 5LGJB 4RIRA 5DXWA 2F15A 5BJTA 4ZQKB 4XMLL 3H42H 2VR9A 5KVEL 3S37X 3MREB 4OD1H 2AJZB 1PSKL 4OM0L 4PGZA 5SWZD 5ESVB 2HLAB 2RIKA 3C8KB 1CICD 4PGDA 1OGTB 4ZFZB 2VQUA 1J0JA 4O9HL 5ALCL 2F53A 2OSLA 3I50H 2BNQB 4PJ9D 5A1AA 5CZKA 5IWLC 3JTSB 1GGYA 5EBLB 3FT4B 4YC2C 5JHLL 2D7PA 2DL9A 4NZRH 1LK2B 3A6BH 4R97B 4YDIL 5CILH 5D6CA 3D69B 4G7YH 1QOKA 4NO3A 3G6JE 2XRAL 1QEWA 1S7XB 1T0NB 1T7VA 1G84A 4F80A 4PJFF 3VFWB 1JNLL 4JRWA 2VAJA 4R4BA 5F3HA 4TRPH 4CJ0A 4I0PB 5H2BA 4ODVL 4LCUA 5EO1A 3T2OA 3S35L 1MRFH 4P5TB 4RBPK 4RDQG 4ODHL 4WI3A 2HKFL 1TZGL 4O2FA 1UB6A 4RFNC 3D18B 5EFIB 1MVUA 1NC2A 3QFJE 3FHAA 4NM8L 3WS6C 1AJ7L 4OD2B 2H32B 3DXAA 1IRAY 3G9AB 2NY5H 1T1WA 1ZA6A 3TPUA 1ZE3C 3HHRB 1KCVH 1XH3A 5TE6L 2D7OA 2GFBB 4Z5RA 3KGRA 3SDDA 2A6DA 4Q9QL 2NCMA 4OZGF 3O4LD 5IMLB 2V5TA 1DBBH 5HYIA 5T3ZD 1K4DB 1RHHA 3VFRB 1NGQH 1Q72L 1WQVT 3V6ZB 3Q6FA 1Z5LA 1FN4B 1LP9E 3OAUL 4HIHB 5GRYA 1QBBA 2FO4B 4QOKA 5SWSA 4TPRL 4WI9A 4U7SA 3DWTA 4DTGL 3FQRB 5EZIH 4LRIC 2HN7A 4HFWA 4Z76B 3GBNL 4C55A 3TBVA 3FN0H 1U8IB 3MXVL 3V5DB 2IALA 1H3PH 2BRQA 3PP4H 2J4WL 4OCNC 4JREB 4QXGH 1N8ZA 2OL3B 3I02A 1MCWM 4K3JL 3UJTL 1KB5H 4FFWC 2XA8H 5EOTA 2YD7A 3BRDA 3TJEL 1OAZH 2JKXA 4U6VH 3H7BA 1NLBL 4N0RA 4P2QD 1JK8B 1VPOH 1YEDA 2H8PB 5EU6B 3MJ9H 1Y6KR 1FZJB 3B6SB 1SJHA 3T0EB 2X4RB 1AO7E 2VZUA 1XGYH 2ILLA 4XH2B 4Y88A 2Y5TB 4XNMA 2X1WL 4L8DA 3STLA 1KB5A 5DUBB 3QJFA 1WFOA 4MNGA 4M4PA 1FNSH 2NNAB 5HYEA 4QY8A 3WJLA 2HT2D 3P9LB 3MV8D 4ONGL 1IGTB 2MCPH 3MJ9A 4H0GA 1YA5A 3NH7H 1HHHA 1INDH 4N90D 4WENB 1KV3A 3DUSA 5D2NE 2PETA 4P9HL 1OY3B 2K7PA 1OF2B 3ARPA 1RUML 3BT2L 3RGVB 5T5NG 1BLNB 1KPVA 1AQDA 4BQ8A 4OLEA 2ADGA 4PY7A 2NW3A 3MCKB 5I8CA 5E5RB 3CVHB 3I9GH 1I7TA 4LL9A 3C5ZD 3HZMA 3TV3L 5DSCA 4NYLA 4KAQH 3R06A 4XZUA 3RVTD 3B9KC 3P0GB 3RVXD 2XG4A 4GMTL 2EE9A 2G5BB 1F2QA 3E0GA 4L29B 4DW2L 5EU4B 1AGEA 4D3CL 2D31A 4XVTH 4HPYL 4N0UB 2Q8AH 2XZZA 3V4UL 3FRUB 5DA0B 2V7NA 1A0QL 2VLKA 1ZHLA 4DN4L 3D9AL 4UU9A 5C7XL 2IF7A 4U1SA 2EXYD 3TVMA 4Z78A 3V0VB 1MCDA 5GPRA 1OD9A 2J88L 1QFWL 4HUXA 3D0LB 4QHNA 3PGCA 3WN5A 5BRZE 5A2LH 1K6QH 2R4RL 3MRCB 1CD0A 1IGJB 2MKWA 5GGSY 3U6RB 2HJLA 2ESVB 2J8UF 2EEDA 3QUZB 4XBPB 4QRRA 3C5SB 1YY8A 5CS7A 4HUUA 1H15B 1R3LA 3MOBL 3ILQC 1FIGH 4X6DF 3KDMA 2MQ0A 5L88L 3MRFA 2WNGA 3DYMA 3SKUD 3ZDZE 3QYCA 3GJFK 1K3ZA 5J12C 4L1DA 3IDMA 3SGJA 1XIWD 5IR1A 2GJZA 3HPJB 5DD6A 2YSSB 5EIIB 3RL1A 4ZS7L 1FFOB 5C0EB 1K2DB 5HHVH 1HSAA 1IC7L 1MI5A 1MNUH 4P59L 4ALAL 1LDPH 5IB4B 4F57H 1QR4A 5CSGA 3TM6A 1I3VA 3LHPL 4O2CB 3PWPD 4R4NC 5FYJD 1HHIA 1XR9B 3L7EA 4KMTL 1J0IA 2ARJB 4GUPB 1MEXL 1KIRB 4X5XB 3GSNL 3N1PC 3DMMD 1TENA 2VISA 4YHML 4PRBA 1AQKL 4RMRA 2Y7QB 5C0CD 2R2BA 2FATL 3LH2L 4I48B 5EOQH 1T6VN 4OIIH 2NY3C 3INUL 3HUJB 2VDPH 2OZ4L 3FCTA 3VFNA 1ORSB 3GMMB 5HHQA 2GJ6D 1QRNA 5DJ0A 3GMNB 1DR9A 1RK0A 4HK0A 5IHUH 3U0WL 4PG2A 1TCRB 4Y19D 5LGJA 1IJ9A 3CJJA 4PLKD 3MYJB 3O4LE 4G7VL 1CDHA 3MREA 4PJDE 2AJZA 4DOHB 4E41D 2XQBH 5ESVA 3C8KA 5HHMD 3IU4H 1E6JH 1OGTA 4ZFZA 1T1ZB 4JHWH 4FTVD 3NTCH 2BNQA 2FDBP 2ED7A 1RIVL 4RGNE 1M05B 3L7FB 4NJAL 3JTSA 5FFLA 5TDOB 1NEZG 5EBLA 3ETBF 1UCBH 3FT4A 1HIML 4IDJL 1LK2A 1P1ZB 5KG9B 4BH8B 2H32H 3D69A 3CLFL 1AY1L 1S7XA 1T0NA 4JFYB 1BQLH 5IB2A 2JB5H 1JZ7A 1DLFH 2MHAB 4POZC 4I0PA 4JVPA 4P5TA 1CDJA 4L4VE 3QXWA 4HT1H 3LPWA 3BKYH 5EFIA 1T5WB 4GAYA 2H32A 4J3VA 3WV0A 4YBHA 5I18L 1SYSB 4GBXD 4PIRF 2P7TB 5ILTL 1GL4B 2C3VB 3OKDB 3MV8E 1E28B 5D7IF 4ZO9A 4OT1L 4FFZH 1OAQL 4N0CD 4N90E 1KG0B 1MCOL 3EDDA 4PJ5E 3ARFD 5IMLA 3KPRB 4MMXC 5JUEL 3HC0B 4YZFF 3CU1A 3GSWB 4GQ9L 4MA8L 3T3PE 1K4DA 5J6GB 3L3HB 3H9ZA 3HR5B 1NCBL 1I4FB 3VFRA 4LQFH 2OL3H 4Z7VE 5IROA 4LFHG 2KQNA 2X1OA 1FN4A 1A6WH 1G7PB 2FO4A 5T1LD 4YUEL 3NCCB 1ZT4A 1H5BC 3PDGA 5AG8A 3AU1B 4I13B 3FQRA 4OLWH 2N56A 2X40A 4TNVK 3LAFA 4OGXH 5C09B 3PIQB 1FNGB 1E4KC 1U8IA 1ROWA 4WO4A 6FABH 4IMKA 3MBXL 3PV7A 2P4AB 1UEMA 3PQYE 1CXEA 4QRPE 1DBKH 3AS3A 2OL3A 1GPOH 2FECI 3O2DL 4LLUB 4OTXH 1KCRL 3MBED 3Q48A 2DICA 4BSWB 1SEBB 5E56A 4HMDA 1L0YA 4OGYH 2R1WA 3CU7A 1K9TA 3PF2A 4RMWA 1JI2A 1JK8A 3DARA 5F7WC 4LPUA 1OW0C 2MQCA 3ARDD 3S4SG 2QBWA 4QRQB 1FZJA 3B6SA 3FFDB 1HCFX 5MI0C 3FFCB 4NZTL 3T0EA 2X4RA 4XH2A 2Y5TA 4Q74A 1SMAA 5EZOL 5I76B 1WWWX 3P0VH 2NNAA 2IG2L 3EFDL 1U8HB 2JJTC 1OTSC 3EIFA 3IKCB 5EBMB 3TN0C 5ITFB 3VW3L 3P9LA 1A6UL 3C08L 1IGTA 1CDBA 2YZ8A 4QEGA 5JO5B 4L3EE 5LWYH 3RTQD 1QFWM 4PJ8C 4L9DA 3L3OA 5CEYB 4XC1L 1KACB 3CVHH 1N0XH 1JN6B 1PQZB 1OF2A 2FWOB 3RGVA 4NZUH 1P5UA 1BLNA 3GBMH 2BDNH 2UVEA 5D72H 2DM4A 3VGBA 1Q9OB 1A7PL 1OAYH 1XGQB 2GK0B 3D85B 3MCKA 5F71A 3CVHA 4O00A 1NGZB 2EICA 1NMAH 2AK4D 4L3AA 4TQEH 1EEQA 3C60D 4YWGL 1EHXA 2DQEL 2G5BA 4IOIB 4L29A 3KPSD 1RIUH 1YPZE 5EU4A 4CVUA 3PWPE 4N0UA 3FRUA 5GJTH 1CD1B 3OPZL 1U8NB 4ONFL 4OZHF 5IP4A 3IU3B 5L2KD 4Y5YC 2SEBA 4JFDD 1QQDB 4U3XA 1ITBB 3O6FB 3RDTD 5L9DH 5ERWB 3MRHB 2K3TA 2O5YH 3D0LA 4MA7L 4X8XA 4O51B 1OSPH 2HLFD 4HG4J 1IGJA 5IFJB 5KZCB 3JVGC 3RY6A 1CGWA 2ESVA 3NIGF 3QUZA 4KROD 2CD0A 4XBPA 3VDCA 1FQ9C 5C0RH 3C5SA 5BS0D 1IKFL 1H15A 2ARWA 1RHFA 1D5IL 3T1WA 4XPBL 4Y19E 5JPNB 5TE4H 4L5FH 1T20B 4K3DH 1ZGLP 3N9GL 3LCYA 1F3DH 5FGCE 4LARL 3EBAA 3Q1SL 2ERJB 5DO2D 3HPJA 2YSSA 4FTVE 5EIIA 1AXIB 2KL6A 1FFOA 5C0EA 1K2DA 4U0QB 4GSDL 4CW1B 3RPKA 3K81A 4ERSH 2VDNL 5IB4A 1JFQH 4JDTL 4KKCC 5KS9E 4LSSL 2DD8H 4O2CA 2UZIH 3IDXL 4NN7C 1XR9A 3HCVB 5FYLD 2IH1B 2JB6B 3GB7B 4GUPA 4LCIL 1KIRA 3UAJC 4GT7A 4X5XA 2X4SB 4K23H 3MACH 3K2UL 2H2PD 4BZ2L 5D71L 2DLTA 2G2RB 3LEVL 3BUTA 5DT1L 2Y7QA 3AY4C 5E00A 3CFDB 2WP3T 2ZUSA 4I48A 2QQLL 4YHOH 5FO9B 3PL6C 3LQAH 1A7QH 4WI5A 1BGXL 1IAIH 1ORSA 3GMMA 2PO6B 3GMNA 5AZ2L 3KXFB 1S7QB 3MOAH 3ZKMC 4JM2C 4K94L 4MJ2A 1U8QB 4DKEL 1TCRA 3LN5B 4ZAKD 3MYJA 1FH5L 1AR1D 1UWXK 1W72L 3NZHL 2PYED 5I30H 4UTBH 2IBZY 2FECL 1DBMH 5DQ9A 4EQ2A 3JWDC 3CDCA 1G6VK 1BFVL 4FZ8H 4FQ2L 5MHSE 4JAMB 1RUKH 1T22A 2W0LA 1WT5C 2BRRL 4HUMB 5JHDA 4U2YA 2BY2A 4JRYE 1M05A 2YC1B 1CE6A 1H3WM 4I8DA 5TDOA 2BVQB 5L8JB 2QL1A 3L95B 1SHMA 1WBYA 1HQ4B 3V52L 2KPNA 5SWZB 4X9HA 5KG9A 3HMXH 4MDJB 2WP3O 1CICB 3HS0B 4JFYA 2GKIA 2YN3A 2Y6SC 4JPVH 3REWB 4NWUL 2MHAA 4ZFOB 1IFHL 1ERNA 2X4UA 4N5ED 4PJ9B 2VZ3A 3W11D 1I1AD 1IT9L 5D7JC 5TFSL 8FABB 4FZEL 3CX2A 1DP0A 2ZCHH 3HMXA 2EEBA 4XPHL 1KJ3L 2AV7B 1IGCL 1SYSA 4RFOL 2P7TA 1CK0L 2C3VA 3OKDA 3S97C 1E28A 3QIUD 4PG9B 1MCKA 4F9LC 4OZIB 5HI3D 2OBGA 4P9ML 1SMOA 1KG0A 3VWJD 1YYLL 3HC0A 5JW3L 5DJ2B 2DLFH 3GSWA 5FYKE 3NPZB 8CGTA 4Y5XC 5J6GA 5IW1B 3L3HA 1EEYB 1UWGL 1KOAA 3HR5A 1I4FA 3QHZL 5DFVD 5DWUL 3TT3L 3WFEH 4OSUL 1T5XB 1KNOB 1PY4A 4MSWB 3O3AB 1G7PA 5I6XC 3ULUF 5C09A 2AK4E 3PIQA 4O58L 5FOJA 3VCLB 1FNGA 4LNRB 3O4LB 4G3YH 3P40A 1S7RB 4XCYB 1QSVA 3LVEA 4LLUA 1J1XL 2DBLH 4BSWA 1CDCA 1SEBA 2D03L 3QI9D 3OG6B 1W0WA 1BD2E 5HDBE 4QRQA 3FFDA 5IVXB 3MQIA 3L3KB 3FFCA 1AI1L 1FNEB 1X5FA 4N5UA 5A16B 3T65B 5I76A 3RKDC 2AEQH 3F6IA 5E2VH 4PRHD 3ZT5A 5EBMA 4NKQB 1U8HA 3IKCA 3SO5A 2QKIB 3NIDE 4MHHI 5K9KB 1IQDA 5ITFA 5H37H 4HH9B 4AENB 3RVVC 5MEPB 3TEUA 5JO5A 4PP1C 3TZVC 4P2QB 4DGYH 5B4MC 2E7BA 5CEYA 1U8JB 1OSZB 1JN6A 1PQZA 3X13B 5GGQL 3D25B 1X5XA 2FWOA 1JZ8A 4M5ZH 43C9B 1KENL 3WLWD 3SDXB 2IQ9L 3MZGB 5E8EB 1RUAL 5FKAB 3MA9L 1XGQA 2GK0A 3D85A 3MV8B 2VXSL 3NPSB 1NGZA 4KK6C 1JTPA 4MZ3A 5MP6H 3GHEL 1G0DA 3SOBL 4BFGA 1D5BA 4WNQB 3SE8L 3TESA 3BQUC 4J4PD 3OAZK 2F5AL 4IOIA 1JGUH 4PJGF 4HIXH 1WICA 4DEPB 5DD3H 2GSGB 4EOWL 4YHZL 5BZWB 3HE6D 4Z7WE 2WANA 5IQ7L 1TZIB 3I6KB 4XC3L 4PJIF 2JJSA 3C5ZB 1TTGA 5CBAB 1U8NA 3IU3A 2DJUA 1F97A 4OFYA 1NPUA 1QQDA 3O6FA 2BVUA 2VMFA 5ERWA 5HD8D 3MRHA 5C6TH 3WXVH 4YEFA 4O51A 3D87B 4FG6C 3S5LB 2C4FT 1UACL 3TO2B 5IFJA 4P4KD 1RI8A 3DVGB 1DQDL 5DD1L 4PJCB 5E2WL 2AJYL 5GHWL 1R5VB 2NR6C 1X6NA 5CJ8A 3RL2A 2VXUH 5JPNA 4NBXB 4UQ2B 1JZ5A 1T20A 2A77L 3CSBA 5HJ3B 3CFBB 5CZVH 2E6JA 5JZ7D 1T21B 4X6EB 1P7KA 4TTDD 3IFLL 3U36B 4C4KT 3LPFA 5GZNC 2OTWB 3GMQB 1NAML 2EIZB 4Z7OE 4CW1A 2D0FA 1AHWC 3C5JB 2VTFA 4L8BB 2R9HD 2E9WA 2APTA 3AMKA 5K9JL 4KVNL 2R0KL 1P6AB 4P3CL 2X4OB 4MNQE 5K9OB 3ULUL 4XPGL 3GRWA 3GFUA 2Z35B 2IH1A 2JB6A 3GB7A 4YFLI 1FO0B 2W60B 1XIWB 2X4SA 5I66B 1T2QL 2G2RA 3L3DB 1GGCH 1NFDE 5TF1H 4I0CC 4JFZL 1I9JL 2MPAH 4LSUL 3QEHB 1RY7B 4HMEA 3ZKND 5FO9A 1YPZB 4X99A 4YX2H 5KANG 3VA2C 3CLEL 3PWPB 3T4AB 4HV8B 2Y23A 1U93B 2APVA 2EO1A 3DV6B 5EOCH 4ELMF 3KPTA 1S7QA 3DMMB 5FA3B 3EYVA 1CDUA 1U8QA 3LN5A 5C0CB 1NAKL 4ZNCD 5DLMH 1SEQH 4Y1AE 1WJ3A 4UT7H 4Y4KC 3VDBA 4C4KO 3MMEB 4JE4B 1OWRM 1I3GL 4P4RB 3ZHLA 1ZHKB 1VDGA 2ZCKL 3VFSB 4JAMA 5KN5A 2GJ6B 3MLRL 3MRQA 1JPST 2Y25A 5DURD 1ZHNB 4NPYB 5JXEA 2YC1A 4PUBL 4MJIE 1U0QA 1DFBH 3AS2A 4XP9H 2BVQA 2FD6H 4Y19B 4K55A 2E3VA 3L95A 3VI3F 2D0GA 2IPUG 4YHKL 4DN3H 4P2RE 1ZLSL 3QO0B 4E41B 1HQ4A 5SWZA 3LS4H 4YK4B 4MDJA 5HHMB 3VXME 1YMMD 1CICA 2NX5E 4Y5VC 3HS0A 1X5IA 2CO6B 4XPAL 1QG3A 4FTVB 5T5FL 1RZJH 5I1LB 1TPXC 4ZFOA 4NM4L 5TGBB 4PJ9A 2YD6A 5TPWL 1XT5A 5AG9A 4KDTA 5FOBB 5I8OH 3QCVH 1DUZB 3H9SD 5C07E 8FABA 2NY7H 2VN7A 4LDEB 5D1XC 2AV7A 3C09C 3HRZB 4XMPH 3FN3A 4JZJB 2PTUA 4XVUC 4PG9A 4S0SD 3U7YL 3CIQA 4OZIA 3QPQC 2MNUA 1FP5A 2ZUXA 5LCVL 1FJ1B 4OCWL 1DQLL 1YC7A 5JR1H 4M6AA 1WIOA 4P9HC 4G8FA 3IF1B 1KIQA 4X80L 5DJ2A 1DTUA 1JV5B 3BWUC 5I1EL 5IW1A 3VU2A 4GBXB 4IEFB 4LIQE 1GC1H 5DK3A 1A7NH 1NSNL 1T5XA 3LEYH 3D3VE 1KNOA 4MSWA 4L8SB 1UJ3B 3TJHC 3O3AA 4FFWD 3FONB 1OP3H 4LSRH 3LDBB 4M02A 4OI7A 3NAAH 3WIIL 5BZDB 4LNRA 3O4LA 3O6KH 3ARFB 1AD9B 1S7RA 5EUKA 2F19L 4LCCC 4XCYA 1MCNA 5HHXL 1RU9H 3ARYA 4L3CA 4PJFE 4V1DE 4WUUD 1BZQK 5GXBB 4K7PH 4YPGB 1LE9B 5D7SL 3HFML 4RWYL 5T1LB 4NC0B 2DIAA 1H8NA 4OLZL 1KN4L 5IVXA 4OV5B 3L3KA 5DJ8B 2FRGP 3LB6C 1RUPH 5A16A 5L0QC 4JDZB 3T65A 1OD7A 4LPXA 1WUNT 1VESA 4RGMB 1UB5B 3MBEB 4HH9A 5F7MC 1A5FL 5MEPA 4OZGE 3RP1A 43CAB 4P2OD 4P2QA 3ARDB 1OSZA 1HXMB 4WW2F 3CNKA 4P3DB 3X13A 4D0CB 3D25A 4HD9A 5DC9B 5C0AE 4H5SA 3QG7H 43C9A 2GSIB 2YZ1A 3BEVB 4TSAL 2QQKH 3B9KD 3SDXA 5E8EA 4Q9RL 3MV8A 3MRMB 3OL2A 3RTQB 2Y1VA 3MUGB 4HFUH 2MQ3A 4U6YB 2A83A 3WFBH 4ISVB 5DGRA 3U4AA 4WNQA 4K3EH 1H0DA 2VWEC 2VLMD 3WMSA 1LEKB 4M93B 5I73C 3C8DA 4NQDD 4RMSA 3B9AA 2AXFB 3KR3L 5I1GH 3ZE1F 4I3SL 2GSGA 2ZUQC 4HW6A 1O7SA 1WZKA 5EORH 3GKWH 1TZIA 3I6KA 3C5ZA 3RWFB 5CBAA 1JZ4A 1IAMA 2AK4B 3V6OC 5BMFL 3DSFH 4XBGB 4GQPH 4TNWK 3OR7B 1F4XL 4OV6F 5I1HL 3C60B 4WV1B 1LWRA 2FBJL 4JO3L 4Q6IA 3ILQD 3S5LA 3DTXB 1KXVC 3KPSB 1CL7I 4KDVA 4FQHB 2EDLA 1A3RL 3DVGA 3UTQB 4PJCA 4C59B 4JM4L 5L2KB 2EC8A 1R5VA 1UWEL 1IGYB 1PG7W 4OI9A 5ECJE 4JFDB 4NNPH 1NMCC 5ADPL 5FDYA 2F8OA 5GS2D 4S0TD 3RDTB 4KQ4L 4UQ2A 2RCSL 4RMQA 2FX8L 3I85A 2HFFB 4U1HB 4K9EC 5HJ3A 3CFBA 3WO4B 4R4ND 4X6EA 4AH2B 4ZUUB 3MROB 3EYUL 3U36A 5FM5O 1YQVL 1FVDA 2EIZA 3GMQA 4KROB 5BS0B 3C5JA 5D70L 3KPOB 2A1WH 1I9RL 2YMXL 4Q7DA 1G9NL 5K9OA 1CIDA 5KVFH 2IFFL 2Z35A 3O45A 5HYJD 3CGTA 2NY3D 4UT6H 5C2BH 4ZUTB 3I6GB 1FO0A 1YMME 2W60A 1XIWA 4CVWA 4ZO8A 4JKPH 5I66A 1MIEL 2WBKA 5GGVY 3L3DA 1JRHH 4WUKH 3QEHA 3P2TA 4J6RH 1U91B 2Z0BA 4YDKH 1YPZA 3U1SL 1YEIL 3PWPA 3T4AA 4LCWB 4KJPC 4Z7WB 3QRGH 1U93A 5IT2L 1MFBH 3A0OA 3DV6A 1J0KA 2B1HH 2WIIB 4X6DE 1P84J 1S8DA 5FA3A 1CBVH 5FEBA 3HAEH 3MXWL 5KBNC 15C8L 4N1HB 1MHPH 2Y06L 5C0CA 3ZL4L 1KB9K 3MMEA 3HNVH 1J87A 5FDWB 3LKOB 4J23A 3TT1H 4OF6A 4P4RA 3BGFB 1ZHKA 2FIKB 5GJSL 2JELL 4JQIL 3VFSA 3B83A 1T83A 4XNXL 1YEFH 1KT2B 3HAEA 1ZHNA 4YHPB 4NPYA 5CP3H 4UMGA 1RD6A 4E9LA 5E95B 4Y19A 4POZD 4ZAKB 4HWEH 5F7HA 3M8OH 3T2NH 2PYEB 3BH8B 2ICES 3QO0A 5I2IA 4E41A 2X41A 1NCWH 5LBSH 4ZNEE 4FN0A 2PUQT 3TBTA 4HZAA 5CP3A 1L7IH 3GM8A 4IIQB 4PB9H 3AS0A 4FTVA 5I1LA 4WW1B 5TGBA 4AJ0A 5IFAH 3S36L 5C86A 1DUZA 2YA2A 4OBRA 5TJWK 1E4WL 5CGYC 4HK3N 4NQCD 1U58B 5T1KD 4CGTA 5IG7B 1KLGB 4F33B 3CFEB 3VXNB 4JZJA 4G6ML 4XXDB 4JG0L 3RWIB 1T3FB 1CZ8H 4P0DA 1T03L 3MNWB 3IB4A 2OJEB 4PJAB 1FJ1A 3PG2A 2KDGA 3SE3C 3MV9E 2J12B 1IC4H 1I1AB 4U1IB 4NCDA 3AXLB 1JV5A 1B6UA 3FAXA 3GUTB 5DHYA 4RRPA 4GBXA 4UINH 2IH3A 2W0FB 3BIKB 3IDJB 3L5XL 4L8SA 1UJ3A 5BV7H 3QIUB 1KBGH 1V7MH 3FB8B 3OKMB 4JRXE 1VERA 5SV3A 3VWJB 5BZDA 1TQCB 4JO1L 5BVPL 3ARFA 3PGFL 3KJ6L 1AD9A 1MHEA 3K4ZA 2CDEB 4HWBL 1FRGL 1PG7H 1X7QB 3U46B 3NOIA 4NQDE 5LQBH 1CL7L 4CU8A 4YPGA 1LE9A 3LZFH 1OTSD 5IESH 5GGSB 1LVEA 4ZUVB 1EMTH 3F7PC 2XIDA 4OV5A 5DJ8A 2O61B 3MLVH 2VDQL 4EKXA 4JDZA 1ADQL 4MVBC 1X5LA 2XZQL 2VIRB 1I8IB 1I7RB 2XA3A 1BFSA 4BQ6A 5D7IE 1HK6A 1IC5H 1UB5A 2R39A 3MBEA 4HXBH 1X4XA 3QI9B 4YXLL 4JQXC 43CAA 3LS5L 3GO1H 1EUTA 3W5MA 5HGGS 4D9LL 3ARDA 3ZE2F 4YZFE 4M6NH 4EI6B 1MWAL 1HXMA 1A14H 4P3DA 4D0CA 1WZLA 3QXAB 5E94B 5B39G 2IADB 1YN6B 2GSIA 4TVPD 1PAMA 3BEVA 4PRHB 5TF0A 5D5MF 4PRDB 2UVFA 1U95B 3CMOH 5DRWB 4I5BB 3GMLB 5BW7C 1EVTC 1YNLL 2DQDL 1TNMA 1UYWH 3RTQA 4F7EB 5DUMH 3MUGA 5HBBA 4YHYC 2ITDB 4N0YL 3U30C 4U6YA 5FM8A 3U83A 4ISVA 1NKRA 4WEBH 4HZLA 2EDTA 2ATKB 2NLJB