5KVGL

Zika specific antibody, zv-67, bound to zika envelope diii
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
214
structure length
214
Chain Sequence
b'DIVMTQSQKFMSTSVGDRVSITCKASQNVGTAVAWYQQKPGQSPKLLIYSASNRYTGVPDRFTGSGSGTDFTLTISNMQSEDLADYFCQQFSSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ZIKA Envelope DIII
publication title Structural Basis of Zika Virus-Specific Antibody Protection.
pubmed doi rcsb
source organism Zika virus
molecule tags Viral protein/immune system
total genus 51
structure length 214
sequence length 214
ec nomenclature
pdb deposition date 2016-07-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kvgL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kvgL01
2OQJB 3LQZB 4ZXBA 1U2HA 3C09C 3KYOB 1J05A 1PKQB 3QZWG 1LQSR 3KYAA 1JHLH 4RGND 1IEAA 4MGXA 3KYNA 4K7FB 1IT9L 3IDIA 3B5GA 3BMWA 4I1NB 1X5AA 4P9ML 2VDOL 3RWIB 2X9WA 4WWID 5AYUL 1YEHH 2E7BA 2HJLA 1HKLH 1KBGL 3PJSA 1XGTB 2JJWA 2R2HA 1PY4A 1DQJB 5GRYA 2X09A 1JWSB 1A3RL 5DRNB 3JVGC 1LK3H 1A14L 1JF1A 3NGBB 1OAYH 4Q9RH 4R4BB 5E9DE 1J9CT 1A3QA 5HVHB 5L7XH 3QSKB 1JGVH 4G8GA 5C0AE 3VRIA 3VXMB 3X3GL 4BFBD 5C7XH 5FYJH 2I25N 5CEZH 1PZ5B 1UEMA 1OARH 4XPFH 3HG1B 3VDBA 3VXOA 3B9VA 1EHAA 1HKFA 5DTFB 4WW2B 1AO7B 3V0VA 4W81A 1C5BH 3U4EA 4H26B 5TDOB 4R7NA 5JHDD 3FRUA 4JPVL 4WFHD 2P7TB 4RGNB 4PJHF 3BPOB 1NBQA 4LLAA 3NAAL 5F3BA 1J87A 4LLDB 5IMMA 1KIPB 2AJYH 5I74B 5J1TC 2W91A 4DGYH 1JPSH 5DZLA 4Z7NF 4P2OD 4XBPA 3U4BL 3VGHA 3L3OA 1IGIH 3EYVB 5IB2A 1GGIL 5SX4H 5I1KL 3KPMB 1BIIA 2KZ1B 2CQVA 2OTUA 2W9EH 3E1F1 3WXVL 4OT1L 3MRHB 4O5LL 5C09B 3T0EA 5HY9B 1SJXA 4YGAB 3BH9B 3MNVB 1IARB 1A2YB 4A6YA 4HJJH 2OR9H 3DLQR 3L95A 1FLRL 1MHEB 1QLEL 1WBXB 1PG7X 2DB8A 3BPCA 4IIQA 3T1FB 4CMMB 4NZDA 4K3EH 1YQVL 2GFBA 3X12B 2ZSVB 1T83A 4DKFL 5E2JA 5KJRH 4IMKA 5JHDB 5D1ZD 4UT7H 3SE4A 2EC9U 3MRPB 1E4WL 2GK0B 3B6SA 4Y19A 4X7SL 1TVBA 3MQIA 3KWWA 5A43C 4L4TE 5LWYH 3VXSD 1H5BA 4DGIH 2FEDD 3K8KA 3D6GA 4L8DB 1R0AL 3BN3B 2V17L 4P2OB 1JNNL 4PRNB 2DMBA 4WGWB 2UYLA 3QIBA 3LPWA 4ELKA 2ED9A 2HFGL 3H9HA 1RUAL 5F97E 1LO0L 3TIEA 4I0PD 3B2VL 1MFEH 2DJSA 4M6OL 3C6LC 4CN4A 1HH9A 4DAGL 2CKBA 2ESVD 5CIPA 2A6IB 3W0WA 1RMFL 3UTTA 1I3UA 4PP2B 1ZHKA 3WLBB 5CJQL 4MXWL 5EO0B 5I1CH 5JA9A 1I85C 3HN3A 4PBXA 2HJKB 2OCFD 2EYRA 5JO5B 1BFVH 3ZKND 4JZJA 3B9AA 2R0KL 2WWMD 3BEVB 1CFNB 3GB7B 3BDYL 4Y5YB 3GEWB 2DQEL 2VDPH 4DCQA 4IRJA 1AC6A 3WXWL 5A2KH 3D69A 5D1ZB 2W07A 4G7YH 1H0DB 3BIBX 4OCYL 4KGLA 4RISH 5CAYB 1T04B 3AROA 1U6AH 5IMKA 3VXSB 1P69B 5J1AB 1U92A 4Q9BA 1Q9OB 1JV5A 4MNQE 3BSZL 1U8JB 5A1AA 1RU9L 4HUUB 5JMOC 12E8H 3H9ZA 1N59A 4GRWF 4HKZA 1RUKH 4QRRA 4GXVH 2PO6B 4TPRH 5HI3C 4AYFA 3U7YH 3FO0L 2J1KA 2EYTA 3MRIA 2ESVB 2V5RA 4F37K 1S9YA 3AS2A 3CH1B 1C16B 2GKIA 3QPQD 4M1GL 1C12B 3PWLB 1FRGH 4HV8B 4S1SL 2VE6A 4JKKA 3WHE1 5I6XC 3T3PE 5C07E 3DUHA 4P9HH 5IJVA 1CN4A 5SWZD 5EO1B 3QEHA 4U6YB 4G9FB 3BZEA 2I9TB 4YHYC 4PRPD 5B8CB 1XF5B 3ZT6A 2EH8H 2BSED 4LLQB 1I9JL 4Q0XL 3DECA 4NM4L 4LAQH 1FJ1A 2I9LB 5B4MC 4PG2A 1UJTA 5E99H 1HOCA 1IGML 2AV7A 3ARZA 5I75C 2IJ0C 2ATKA 1EK3A 4D0CA 4UIKL 4JPKH 1MCDA 2BNUA 1PFCA 2X4OB 2FRGP 2JTDA 2F53A 4JFYA 3V0WL 2W0PA 3K80A 4LPWA 3QUZC 3LS4H 1DP0A 4ORGB 1RK1B 4OLUH 4YDIL 3JV6A 2DQHL 1LVEA 3IDYC 1MIEL 1JTTA 3WS3A 5GS0H 2FX7L 3S7GA 1QG3A 3WSQH 1FSKC 4POYA 4ODUA 5MENA 3NIGE 5GGRA 3ZHKA 3VD9A 1C5CL 5BXFA 4F7MA 3TT3L 3ULSB 5SWZB 3GSRB 4TVPL 2I60H 2L7JA 5EWIL 3EYSL 5D96C 5I30L 4MAUH 3RWCB 2HJFB 4YQXH 4Q6IB 2XTJC 1SHMA 4PJ7E 4H0HB 4IDJH 5I1EL 5DQ9A 1U8KA 1YJDH 4M03A 3AAZA 3H9YA 2DBJA 4U7SA 1QZ1A 1YY9D 1I8KB 4NN7C 4KTDL 1JWUB 1ORSA 5GZNC 4BSVB 3L3JB 1MCKA 5TF1L 4PV9B 5KVEH 1W0VB 1BQHB 5C0IA 3U46B 3QHFH 1OVZA 3WKNA 1CTNA 1B4JH 4NP4L 1CD9B 1XGPA 1DVFD 3X13B 3TBSB 1QA9A 3T09A 1LP9B 3CFJB 4S10A 4X6DB 4N8VG 4UINH 4X4YB 3RP1A 1G7PB 2YUWA 4GBXC 4L4JA 4ZFGH 1BREA 1ZHBA 4GAJH 4PJ9D 4KK8C 1G0XA 4X6EA 3GGWA 1A3LL 1T3FA 3ARFC 4NKMA 3EDFA 4PRAB 2ED8A 2R8SH 4TVPE 2APBA 2A6KB 5HGHB 4JY6A 4Y4KD 1VFAB 1NGZA 3O41B 1EEQA 2R0ZL 1HDMB 4N9OB 4V1DB 2PW2A 1I7TB 3IFPA 3O4LA 1Z9OA 1U58A 3HC4H 4XNZB 3RDTB 3SE3C 2DYPD 1Q0XL 5GIRB 3BKCL 5JW4M 3IDMA 5AZ2H 1FVDA 4JANA 2H26B 1ZGLP 5BV7B 5EIIB 5ALCH 3L1OH 3EHBD 1JPST 1DVFB 2EEDA 1FE8L 4LVNB 4ONHB 4JFFD 3RVXC 2AJSH 1IM3B 4KRPC 4EXPX 1JGLH 1MRFH 4UBDD 4Y0GA 2QTEA 2AEPL 2ZUSA 3W9DA 2DLHA 4NKDB 4I4WA 4YHIA 1T21A 3RWEB 4PJ9B 2UWEE 1YDPB 1VCAA 3ALXA 4XNYH 4K7PX 2YEZB 4C54A 1JYWA 4E5XA 1NGPL 4AM0A 3KLHC 4HH9B 2GJ6E 4OZGA 4Z7QE 4XX1G 2SEBB 5HGDA 3D3VD 3O11B 4Y4KB 5IF0B 3WHXB 3GHEL 2I07A 3PGCA 4O2CA 3FT4B 1AD0A 3SKMA 4HG4K 1X5LA 4XCCL 1W0WB 4R0LA 1TZGH 2C7UA 4EUPA 3QG6B 3OKLB 2CRYA 3MGTB 1IGJA 1MJJB 1P1ZA 2DYPB 1OWRM 3QRFM 4XMLH 3J8F7 3WKMH 4U1LB 3FO9B 3TVMA 5HGAB 5E2WL 4YWGH 4OD2A 5DO2C 4XHJC 4L8CB 5C3TA 2DI8A 4IJ3C 4QRSB 3KJ6L 3KLDA 1KCVH 4QCIA 2RR3A 5DA4A 2V2XA 4NJAH 4JFFB 4XP6H 3P9WB 1OTUD 3GSQB 3OB8A 5M95B 1NGXB 2VXQH 1WCQA 2JB5H 4D9LL 5EU7C 3WD5H 1GPOH 1JGEA 1SMAA 1KB9J 3BGAA 1I8MB 2QSCH 1FV1A 4G8EB 3E3QE 3NABH 4ZTOL 3QEGH 3BN9C 2BVQA 3DXAD 1BGXL 5FDWA 1RAMA 3CVHL 5C0EB 1H8NA 4OCSL 4P23D 4XTRC 4Z7WA 4DEPB 1B4RA 1GAFL 2IG2H 4KK5D 1LO4L 3LQAH 1JHKH 4LOUC 2GIYA 1KB5B 2QQKL 4BSWB 2B39A 3MCLH 2AQ1A 5F1IB 3WIHA 3N9GL 3MRMA 4YHML 5KANI 4LKXA 3SE8L 2VSDA 5I1GL 4CW1B 1JZ5A 4PJAF 3B9KD 4OJFL 3BAEL 3WE6A 4P57A 2B2XL 2IADA 5IP4A 1RZKC 1IKNC 3L3KA 4X80H 3ZE0E 3B2UD 2OL3H 3B43A 4MQXD 1TTFA 1S8DB 3S6CA 1V7ML 1UGNA 3X11B 4JFOA 3ULUH 3PV6B 1NAML 4JAMA 1NCAL 1SY6A 1N64H 3FFDA 5L0QB 4L3CA 4XWOD 3H6JA 3P9LA 3MJ8A 3CXHJ 3ES6B 5FGBC 4EZMA 1A64A 3S36H 1I75A 1WIOA 3P30H 5EZLA 1X4XA 5D1XA 1F4HA 1OW0C 1W8NA 4F58H 4ZPVA 1OSZB 3DXAB 5C9JB 3DVGB 3T65B 4PJFA 4P23B 3TNMA 3U0TA 1KN2L 1OAKL 1EHLH 1S7QA 1ZMYA 4KK9C 1HXYB 3CZJA 5EU6D 4CADA 1U93A 1HN1A 4KFZC 3MBXL 2AJVL 1RZKL 1IEAB 4HJGA 1CXFA 3K8LA 3G9AB 3KYNB 3R8QA 5E08H 3I3DA 4XMPL 4QHUA 4K71C 3V4VL 5K9QI 1D5ZA 3AVEA 3HE7A 2XNAA 1AFVH 3OXRB 3NCJL 2HJLB 1WEJL 5DI8A 3DI2B 2P42B 3PJSB 5EU7E 4PJCE 2WBWB 2R2HB 5HVWA 4QRPE 4N0YL 3VW3L 4P4KD 2DM3A 1A47A 3V6FA 2HRPH 5ESAA 4HC1L 1FNHA 2PXYC 3BRGC 4G8GB 3CX2A 3T0ED 3VRIB 5AUMA 4K3HA 1J0KA 3TZVC 5FEBA 3EOAA 3VXOB 2R4RL 5IVXE 1TZHA 3LEYH 5DJXA 1OP3H 3V0VB 1QHPA 2XKNA 1RURL 3EJYD 3SDYH 4LPTA 5GS2D 1MJ7H 4I0CC 4M5YH 1T1XA 1H3PH 2J7LA 1G6RA 3H0TA 1AIFA 3FRUB 1WGOA 3UC0L 3REVA 2WSKA 4HT1H 5DJZA 4Y19D 5ISZE 1NUFA 5E7BA 9CGTA 5IQ7L 4PJEA 5F3BB 4N1HB 3LRGA 5IMMB 4EDWH 3MLPA 2JJUA 2QV2A 2A77L 4QOKE 1DR9A 1J5OL 1FH5L 3U48A 3IS1X 4G9DA 3L3OB 3SE9H 1GGBL 4U7KA 5IB2B 4KROC 3DMMC 4MJ4A 5D5ME 2NXYD 3VGAC 4P4KB 2HKHL 1BIIB 2WUBL 3F7VA 2A1WL 2NY4C 2OTUB 2XN9E 2G5BA 5J6GB 1ZSDB 3G6DH 1MHCA 5HDOA 2B1AL 2ZCLL 4FHBD 3UTTD 2P46B 1EZVX 2NZIA 3NFPA 3T0EB 3DRQA 1RVFL 5HJ3B 2Z8SA 1XGYL 3RGVA 3OKEA 1VHPA 2OI9B 4PJXF 2PTUA 2J4WL 3L95B 4JPIA 4QY8B 4OCWH 1S5HA 1WFUA 2HWZL 3Q3GA 4RAVB 3BPCB 4IIQB 5IVZA 3GSNL 1JWMA 4IHOA 2GFBB 3PQYA 4LNRA 5D7JA 1PLGH 4MA7L 3DVFA 5TQ0L 1YEFH 1YN7A 4NRYA 4D9RE 3G6JA 4Y88A 3B6SB 4Y19B 4PJBE 1TVBB 1MAKA 1D6EA 5JXEC 3Q0HA 3HZVA 2QQNH 1CZ8L 1Z3GH 5IVOA 4XPGH 1H5BB 5JPNA 3VDAA 4K7PY 2ITDB 1A1OB 4CVUA 2UYLB 3QIBB 1YEHL 4OLXL 4ELKB 1HKLL 3H9HB 3MODH 4R6UA 4GG6F 4KKLC 2CUIA 5C0GB 5CLWA 2NNAB 3TIEB 4EI5A 4FQPA 4LPUA 4QRRD 1QOKA 5E5UB 5DD6A 1HH9B 1LK3L 2CKBB 5CIPB 2NYYC 1OAYL 4Q9RL 1BHGA 3W0WB 3UTTB 4CJ0A 3ZDXE 1IFHH 1OP5H 1ZHKB 4X7DC 1JGVL 4H1LG 5C7XL 3QXWA 5FYJL 3I85A 1OARL 4GOSA 2CGRH 4JCLA 2EYRB 4XPFL 5GPRA 1REIA 4JZJB 3MV01 3OQ3B 4HWNA 3QI9C 1OM3H 3DO7A 1AXTH 3WFDL 2ZNXA 5FF6A 1C5BL 2ICWA 1XFPA 4ZNCD 3D69B 4QEGA 3W82A 2C3GA 1D9KC 5IMKB 1U92B 1T2JA 2AJYL 1JV5B 5E5MA 2D7NA 4DGYL 1JPSL 3NFNA 3G6AA 2FB4L 4TVSa 4MXVF 5SV4A 5J3HC 1N59B 1CFVH 3B83A 4HKZB 5C0BA 5E8DH 4MMXC 4QRRB 4OM0H 3MRIB 3B8SA 3CSPA 1IGYB 3JWDH 2NQCA 4G42A 5F7MC 3BVNA 1CDBA 1YPZF 4IM8A 5CCKH 5MEND 5IB5A 1TJGL 2VE6B 3OG4B 1BEYL 1UWEL 3BGMA 4HJJL 2OR9L 5FYJE 5IJVB 4YLQT 3QB7C 1ES0A 3KYKH 3QEHB 3BZEB 3QUMH 2C4XA 3RIAF 2VZSA 4K3EL 4WNQA 3GI8H 3CC5A 3TC9A 3V0AC 5KJRL 4MA8L 5I1IL 1FJ1B 4UT7L 4YHLH 1HOCB 2AV7B 4KXZI 4PS4L 2HT4C 3EYOA 4HS8H 5AD0B 4XNXH 3LQMA 1BBJA 4D0CB 5LWYL 1A4JA 3NZHH 1M7XA 5E5RB 4JFYB 4MDJA 4FQLH 1U8OB 4U3HA 1TVHA 1MVFA 2H32H 3A6BL 3OKNA 1RZFH 4WIQA 4L4VE 4LVEA 5F9DC 1P5VA 2FHFA 4ZAKA 3F7YA 1VFMA 3DROA 2EDRA 4P46D 1F3RB 5L2KE 3JV6B 1ZK9A 1I1AC 1T2QL 3SDXF 3RGHA 3WS3B 4WEBL 4CN1A 3T1WA 2ZUTA 3T4YA 2YN5A 4NOFA 1YN6A 4N0UA 1ZS8A 4E41D 4ODUB 5MENB 2MCPL 4F15B 2UZIL 4F7MB 1JUFA 4ZOAA 5ESVA 1BFVL 1H8OA 3H3PH 4WFGD 5HDBE 4PB9H 4DN4H 4P3WA 3T2QA 3SJVA 2DLFH 5DQ9B 1LEIB 1U8KB 2CR3A 3AAZB 2NY2C 5DUPH 4QHMA 3BI9X 4P9HC 1OCWH 4M93B 2OS7A 3HE6C 3IRZA 1U6AL 1ACZA 1ORSB 4U1MA 5ERWA 5JDJA 2V7HA 1C8PA 5C0IB 1TNNA 4YHPA 1ROWA 2OR7A 12E8L 5BQ7A 5JIKA 3AY4A 2Q20A 1YMME 3U82B 4H0GA 1HZHH 4BJLA 4PJ5E 3B8YA 2KPNA 4P46B 1XGPB 3BQUA 1RUKL 3U9PL 4GXVL 3KPSD 4TPRL 3U7YL 5EOTA 4JFEE 4Q6YA 3ZHLA 1CR9L 2VRAA 2VXUH 3BXNA 1CLZH 4M6ML 4NCC2 1U8PA 3OX8A 4E41B 2DLIA 3JWOL 4FXLA 1ZHBB 3QG7L 2X9XA 2GCYA 3GGWB 3W39A 3BD5A 1T3FB 4HK0A 1H3UA 5ITBH 3ARVA 4P9HL 1TENA 4NKMB 3WNNA 5GHWH 1FIEA 3QFJD 1RIVH 4JVPA 3SPVA 4JY6B 2EH8L 4U0RB 1GZQB 1NGZB 3CLFL 3AB0B 1KJ3H 1OPGH 3RRQA 4LAQL 3FAWA 5E4EB 1A6UH 5HYJA 1I7RA 3LHPL 2PW2B 3BPLC 3FQUA 1FFQA 3IFPB 1QKZH 1Y6KR 1CICC 2RJMA 1EZVY 5KS9F 1U58B 5EUKA 1VERA 4Z7VF 1YJDC 2OZ4A 3LS4L 4LSSH 3TVMD 4A6YH 3IDMB 1FVDB 3ZKMC 4JANB 4KJYA 4TULH 4R4ND 1WBZA 2MMXA 4K07A 4OLUL 5GS2H 4M7ZC 2AS5M 4AK1A 5T5FH 4I18C 3T3MF 3KPSB 2BVEA 4J4PC 3O6ML 2RIKA 5DEFA 4D9QD 5GS0L 4HGWA 4RMRA 2BNQE 1E4KC 4LRNL 3WSQL 4N5EC 5E2UH 1Y6MR 3TO4A 3W9DB 1T21B 4PJIB 4JRYA 1EGJH 3SGDI 2Y36L 4CRPA 4LRIA 1VEMA 2OSLA 5GGSB 4E5XB 2I60L 5INCA 5J13C 4NC2B 4AM0B 4MAUL 2ARJA 1RZ7H 4OZGB 3TPUA 4YBLB 4P99A 5HGDB 3WL9A 3PGCB 3QCUL 5CZKA 4O2CB 2PYEA 5GJTL 1AD0B 1AXSA 3SKMB 4LSUH 4L3EE 5L8KB 4LFHD 5BS0A 2ZUWA 4CU6A 4R0LB 2C7UB 3RTQA 2G5RA 4EUPB 2CKBH 4Y4FD 5CIPH 3WLWC 4HMCA 2DL2A 3BP4A 1JN6A 4LGPB 1P1ZB 4LGSB 5KVEL 5FO9A 4NIKB 1IAKA 3H7BA 5EUOE 4KUZH 3TVMB 5HVGB 5EC1B 4OD2B 1X5KA 1HSAA 4MX7A 4XXCC 1YEKH 2VL5B 5DJ2A 5EU3A 4LDLB 2V2XB 3IF1A 1WSST 2JCCA 3HZKA 4BUGA 5IHUH 1RQ5A 2W60A 3OAUL 4UINL 1H8SA 1JGEB 4QRQA 3SGKC 3MV11 4X5WA 5EZOL 4MQ7A 1TZIB 1PKQE 1FV1B 1PKOA 5JQHC 3UYRH 4LHUA 3MSPA 2VXVL 4HFUH 4NBXB 4WFFE 5CKAA 5FDWB 5KW9H 1QBAA 5D93B 5T33L 4KTEH 4Z7WB 3BD4A 3DETC 4DKAA 4W6WB 2EKJA 5J12B 5DMGD 1J0IA 2M8XA 4PRHA 3E8UH 3LN4A 5CJXA 4NRXA 5J6HB 1G0DA 1JTPA 3IFOA 3BISA 3VMOA 3M07A 2VB5A 4ZS7L 2C3HA 4X9IA 4Y4FB 3P77B 3VWKA 5KOVC 4W6XB 4DJMA 1T0NA 2NY7H 3HC4L 5F88B 4KDTA 4QF1B 1OB1B 4HUWA 5C0RL 4U1KB 4X5XA 3WE6B 4P57B 3VXME 4PJ8A 1R3JA 5AZ2L 2HFEA 2IADB 2VN7A 1Q9WB 5EPMA 2F54D 4JRXA 5ALCL 3L1OL 4TSCH 4OQTL 2EXYC 25C8L 4LL9A 4JFOB 4MWFA 4M4RA 5CD3A 2AJSL 2VTFA 1AO7E 1ERNA 1JGLL 4JAMB 5GJSH 2DKSA 3FFDB 5E8NA 5CBEB 5BZWA 4PRIA 4L3CB 1GGCH 3P9LB 3RVUC 2XI9A 5FM5M 2UUDK 3FB6A 1FGNL 1QLFA 1X7QA 4RGNE 4DVBA 4X6CF 4U3XA 5EZLB 5D1XB 4ZPVB 2MPAH 4GT7A 4LSPL 1DL7H 4OCLC 2VR5A 1PG7W 4PJFB 4RWHA 3TNMB 1S7QB 1P4IL 4CADB 4JFXB 3MACH 3RWGB 4PB0H 3EZJB 1TZGL 2IPUG 4GW4A 4HJGB 3QDHA 5IQ9B 3MUZ1 4FP8H 4ODXB 4FMKA 2APVA 1KN4H 5ESQA 3WKML 5C09E 3LQAC 1SYSB 2XNAB 4YZFE 3UTZB 2PO6C 4HMEA 3HCVA 4LASH 5DI8B 2LVCA 3MRJB 1N3NA 2H2PC 1X4YA 2X4RA 4H8WC 4UOW1 3VRLE 1DEEA 4XP6L 1AJ7H 2P48B 4NN6C 3V6FB 1S9XB 3ZZ1A 2JB5L 3WD5L 2CR6A 1GPOL 2NY3D 1QEWA 2W9LA 5JHDE 3UJIH 3VJ6A 4TN9A 5DK0B 5AUMB 5T1KA 1MLBA 3LD8B 3NABL 3ULUC 3QEGL 4YBQD 2YA1A 2XY2A 3ROOA 4UTAL 1TZHB 2CD0A 4KMTH 3RU8H 1G7MA 4RMWA 5D1QD 5DJXB 3RL2A 2XKNB 1M71A 2BVYA 3OKDA 4M8QA 1CFQA 1BFOA 1T1XB 1U8NA 4YJZL 2JJTA 1G6RB 2IG2L 3H0TB 3DX7A 5LAXA 1AIFB 1ZVHA 3EJZD 1JHKL 1QFWM 4G6FB 3WJJC 1EO7A 1FIGL 1QFUL 3REVB 2J6EH 4HAFA 4AEIL 2DQUH 1A6WL 1A5FH 4R9HA 4PJEB 4XC1H 4FZEH 5GGVH 1INQA 1MCRA 2EIEA 4MVBD 2NCMA 2IH3B 1J1PL 5SWSD 1QR4A 4G9DB 1RUPH 5AAWA 4X80L 2ICES 1F3DH 5GRVK 3QZWB 1JJUA 4QRUB 3MCKA 2F19L 2WK2A 3EYFA 4HS6A 3ULUL 1MFNA 3F7VB 4EI5D 2G5BB 1YEGH 1GGTA 3KGRA 1MHCB 3TN0C 2NY3B 3WNPA 1N5YL 3HTLX 3QISA 3NFPB 1CFSA 3DRQB 3P11L 3S36L 5E6IA 3ZYOA 3IDGA 3HZYA 5GZOC 3P30L 3RGVB 2HVKA 4LPYA 1E0OB 2QHRL 4MS8D 4WUUA 4JPIB 3ARED 1S5HB 3VXSE 3BZDA 2BSTA 1CLCA 4P5MA 3Q3GB 5IEHA 5IVZB 1AI1H 1JWMB 3P4LA 4IHOB 5TE7H 4LNRB 5D7JB 1H3XA 3U0WL 4NQEE 2XKUA 5C8JA 5JDSB 1YN7B 1LO3H 4M7LL 1H15A 4NRYB 3CMOL 3G6JB 3QQ3A 4BQCA 1DQDH 2A9MH 2Z92A 5E08L 2ESVE 3S3JA 5JPNB 2ZCHH 4ACPA 2ADJA 5FM5O 1AFVL 1JZ6A 3DUUA 2K3TA 4ERSH 3QO1A 4MNGA 4A2MA 5FUOH 1H9VA 4PJHA 5C0BD 4G9FE 4EI5B 1N6UA 3UTSE 1BLNA 1MCOL 4XGZA 5DD6B 3ULUE 2DF3A 1T1YA 5A3ID 3GSOA 2APTA 4M6AA 4HXBH 4EUPH 4KMLB 1U0QA 3L3DA 5DQDL 1DJSA 1FGVL 3LEYL 3BPNC 5FF6B 1ULVA 2BP3A 1DE4A 5F7YC 5JIPA 4N0CD 1HQ4A 5F9OL 2D9QB 2ICWB 2ENSA 3VH8A 3TH2T 1H3PL 3K2UH 3RVTC 1J1XL 3RDTC 4XNMA 4HT1L 3ZKXC 4HLZG 3QAZB 4R2GC 5JW5A 4OI7A 1FYTD 4IOFC 4EDWL 4JDVA 3DHMA 1A7OL 5E5MB 4P59H 3NBNA 4AIZA 4DK6A 1T20A 4AEFA 4NUJA 3O8XC 3G6AB 3RKPA 2C3VA 3SE9L 5I66B 3GMPA 5F1SA 4ZAKD 2R2CA 3EGSB 1MRDL 2Q8AL 1MUJA 4BM7A 3QUXA 4XCEA 5C0BB 5T1LA 4ZDHA 3O3UN 5F7UA 1XF2A 5CJ8A 1EPFA 1K4DA 1U3ZA 1WIUA 1CGSH 3QCTH 4G42B 3WIHH 3SDDC 3QEQE 5IB5B 5C0DB 1U3YA 2ID5A 5K9KA 3A6CL 3BGMB 4FQXC 4KVCH 1ES0B 3K4DA 2YZ8A 4LAJH 5ILTH 32C2A 1LE5B 3SN6N 1X6NA 4KDWA 3RHWF 3SJVD 4LCWA 4M48L 4NO3A 5I8CA 4PLNC 4WNQB 3O81A 1PLGL 2R1YA 3L7FA 3LS5H 1QRND 3CC5B 4PY8I 2YA2A 1YEFL 4N8CH 3JVGA 5BRZA 3MLVH 2HVJA 2JLLA 3VFGH 3JTTA 1SY6H 4I48A 3MV7E 3EYOB 3UJTH 1BBJB 3ZDZE 4E42A 2QQNL 1Z3GL 4Z6AT 5K59E 2MOVA 1TJIH 1A4JB 3QNYB 4PREA 4X6DE 4XPGL 3RWHA 3VXTA 4JM2C 4Z7UF 1TVHB 4Z95H 4W6YB 2P8PA 5DHXB 1AHWA 5A16A 5F44A 2QADD 1RUQH 1EBPA 4ZAKB 4RFEA 1NGQH 4O02H 3F7YB 1MFCH 2VOTA 4Y5VC 2P44B 1DQQA 3SGJC 3MREA 3BQUD 2ZOKB 5TFSH 5FGRA 1INEL 3DBXA 1J0JA 5KN5A 3T4YB 4EDXA 4RCAA 1YN6B 1IFHL 4N0UB 4X8XA 5HPMA 4E0RB 4FZ8H 4HPYL 4ZFFA 4QKXB 3ILQD 3BYTA 4V1DE 1NUNB 5MEPA 1JUFB 3NIGF 1WITA 5ESVB 3SQOH 1OM3L 3WS6A 3STBA 4CMHC 5IFHL 5CGYC 4QGTA 3LY6A 3SJVB 3BKYH 2Q76A 4JHZA 3UDWC 3MJ6A 5DHYA 5CJOH 2EE9A 3L9RA 4QHMB 3S96A 5HYJD 3G04A 5IGXH 1ZA3B 3V4UH 3R06A 5JW4N 2AJXL 4U1MB 5ERWB 2IGFH 1F3DJ 2V7HB 3CK0H 4YHPB 1NGYA 2QADB 5BQ7B 1PEWA 5IMLA 3ZE1E 1JRHI 3OR7A 4KQ4L 3VI3F 2HT2D 2IEPA 1VADA 1G7HA 4M3JA 3L5WA 3G08B 3BQUB 4DWHA 3LKQA 4GKZA 1P2CA 1U8QA 4OM0L 5EOTB 2YK1H 2QQQA 3NCBB 4OLVH 5IB4A 3BXNB 2VDLL 1L7IH 2W65A 3JWDL 1U8PB 5I73C 3OX8B 3TO4D 2CXGA 3HC3H 5EC2A 3NIDE 4JRYD 4POZC 2GCYB 4HK0B 4KXZH 4ZXBC 5D4QA 3SPVB 4ELMF 1UH3A 4DQOH 1I9RH 5DGQA 3P0YL 4JZOA 2D0FA 2PYED 3C6LA 4WY7L 2C3WA 3OF6A 1Y0LA 5HYJB 4Y16C 3RTQD 3SDCD 1SBBA 4HS8L 4JFFE 3FQUB 4YFLF 3QWOB 3O9WC 1I85A 1NMBL 5GGTL 2GJZA 4UQ3A 1TFHA 5EUKB 3NZHL 4FQLL 4JM2F 3MZGB 1A6TB 4DVRH 4TQEL 4FQJL 5HHOD 4OLWH 1P7KA 3FONA 4KJYB 4UDTA 3V8OA 2J8OA 1WBZB 2FHCA 2NY1D 4NN5C 4NM8H 1HI6B 4XC3L 2AAVA 1HE7A 1IBGH 5DEFB 2O61A 2DRUA 4HGWB 5B38A 2G9HA 3UEZA 1PVHA 4XVSL 1QD0A 2ICEA 1YYMH 3TO4B 1X5IA 2G2RA 4JRYB 1F4YH 4LHUD 1WICA 1E4XI 3QO0A 5HYIA 3H3PL 2OSLB 3CLEH 3NH7H 3D1MC 1JTOA 5INCB 4JG1H 1NCWH 3O2DA 2ARJB 4PB9L 5KAQF 2P8MA 3KPOA 3TPUB 1Z0MA 3WL9B 2PNDA 2X40A 3CFCH 1S3KL 2L7UA 2PYEB 2UY7A 4PRHD 1AXSB 5DUPL 3CX5K 5CP7A 4I77H 5DFVD 4LU5H 1T7ZA 2VDKH 3RTQB 3SDCB 4UZGA 3INUH 2M1KA 3DX6A 3QQ9D 3VWKD 3BP4B 4P49A 5FO9B 2YKLL 3Q5YA 3D85A 4PJ8D 1HSAB 5DJ2B 3ZTJH 2NY1B 2RAMA 4OFYA 3DXAE 1AP2A 1AR1C 2F5AL 2FLBT 2BERA 3IF1B 3HZKB 4FQ1H 1ZANL 4O58H 3LZFL 2FX9H 4MXQD 1LMKA 2W60B 4JY5H 2Y06L 4KKCD 2VXUL 1E28A 4MJIA 3IU4H 4X5WB 1AY1L 5KSUA 2BY1A 3GFUA 3QUZA 5BJTA 1W2KT 4LHUB 3TFKC 3JUYA 5ITBL 1ACYH 2COQA 3SKOA 1YA5A 5JPMA 3GBMH 3L5XH 1P6FA 1RIVL 3QIUC 1L4IA 3ZT7A 3VGEA 3HI6H 5BMFH 1G7LA 1NC2A 4PRHB 3LN4B 1KJ3L 1OPGL 1QSFA 1H5BC 3IFOB 1CDIA 1A6UL 3WFBH 4N0RA 2PCPA 4G6KH 3HUJF 2E9BA 4ZNEA 5CZXD 1QKZL 4NO2B 2CLRA 4BKLA 3VWKB 3QIBC 3N1FC 4OI8A 1JI1A 2DIJA 5L88H 5LQBL 1GSMA 4GAGH 4HUWB 1CXEA 4X5XB 4JDZA 4G8GE 4LSSL 4A6YL 4PJ8B 1R3JB 2ARWA 2YD9A 2K7PA 2Z9TA 3RJQB 2HFEB 4JRXB 3T77A 2W0LA 3SGDH 1G7QA 5B3JE 2VUYA 4MWFB 4U7MA 2LU7A 4L8BB 1MWAA 1U2CA 3MFGB 5E8NB 5DUBA 1MCIA 5BZWB 3FB7B 5E2UL 4LP5A 1T6WA 3FB6B 4XPTH 1QLFB 1X7QB 2RHEA 4K8RH 4DVBB 2IMNA 3IJYA 3D0LA 4IRJC 1FZJA 4IRSC 3CVIH 3K3QA 1IILE 2WBKA 7CGTA 2NX5A 3OGCA 4LSQL 3MYJA 1T7XA 5BOZG 1BJ1H 1UKSA 4GBXA 1B0GA 4GW4B 3WNMA 2CKBL 4JKLA 5LXGL 3BGFC 1BOGA 2WQRA 4YX2L 5FM8A 5ESQB 2VO5A 3T0EE 4NBYB 5TH2A 1OTTC 1SQ2N 4YHKH 3HCVB 4XPBL 4OAWB 3RIAK 4C56A 4PFEA 2YPLA 1N3NB 2X4RB 1DEEB 2XRAH 4FQ2L 2HYMA 4IS6B 5TE4L 3TYGL 4F9LC 5DEGA 5DJCA 2Y72A 4HCRH 5CLTA 4S1RH 3IVKA 1CE1H 1XCQB 3QXDA 3MO1A 1QEWB 3QDMA 2EXWD 2NW2A 3FB5A 4PJAA 4P5TA 3SE3A 3VJ6B 5E6ID 5C0ND 3MOAL 1MLBB 1FNAA 3KPTA 4JGUA 3UYRL 4F33A 4Y19E 4QWWC 3ROOB 4RMTA 1G7MB 5KW9L 5DEZA 1IQWL 1FG2A 2HAZA 3OKDB 4J1UA 2V5MA 4M8QB 4KTEL 1CFQB 1LE9A 1VFBA 4OKDA 1BFOB 1A6VL 5CSZA 4ZO6A 4OI9A 5I15H 5LAXB 3WUWA 5IT2L 1ZT1A 2AXGB 3K46A 1A7RL 1FNGA 1AD9A 3EO1B 4KJPC 1V3JA 5EBLA 2YHGA 3H9SD 3UZVB 1INQB 1YZZA 5KSBB 1KJ2H 3W0WE 4NZRL 3UTTE 3H42H 5E9DD 3LEVH 1MCHA 5FYJU 3P4NA 3DV4A 3L3HA 3SKUD 4TSCL 1B0WA 3K8MA 3MCKB 1KTLA 4DKDC 2HTLD 1G7JB 4HS6B 3NIFE 1F00I 5CS7A 3GRWH 1S5IH 4GRMB 3CVHA 4MYWB 3EYQD 1EAPB 4X9BA 1GGCL 2FO4B 2I24N 4J3TA 4QTHA 1N6VA 1CFSB 5E6IB 3IDGB 3PIQA 2AK1H 5D6CA 3L5JA 2RGSA 2MPAL 1DL7L 2J3SA 4WUUB 1B0RA 2OZ4H 3WHE0 1ZGLM 2BSTB 3EOTH 5IEHB 1X9QA 2AABH 3BO8A 5IG7A 3LB6C 3MACL 1H15B 2PW1A 4FQIL 5FUCE 3QQ3B 4X7CC 3TBVA 4QRRE 3WFHA 2Z92B 2VIRA 3H9SB 2HH0H 2HT3D 2V2TB 1J8HA 5K93A 1KN4L 3GSUB 5E9DB 4JEGB 1JZ8A 4KKBD 3ARGC 2ADJB 2WQ8A 2YPKB 3IS0X 4JN1L 3DUUB 3F62A 4BYHA 3CSGA 3QO1B 4MNGB 2VDRH 4RGMC 4O4YH 4FFZL 4NC1C 4YDJA 3CSYA 4PJHB 3BMVA 1BLNB 5KVDL 5T1LD 1AJ7L 1CDHA 3NFSH 5GRJL 1X6LA 4ZO8A 4QHLB 4K3GA 2HLAA 3CU1A 1JNLH 2VDNH 3UJIL 5T5NF 3IAGC 3L3DB 5E24E 1F45A 3I3BA 3HKFA 3QNZA 4S2SA 4KMTL 3RU8L 2VR4A 4L4TD 4TOYH 4NQTA 3OJDA 4WHCA 4BQ9A 5E4EC 5T1MA 2F53E 3FL7A 4OGXL 2BDNH 4NQSA 1KTKE 3W81A 3VH8B 1FORH 5ICZA 1N7MH 1KV3A 5BRZD 2OX5A 1DBBH 2VQUA 4XNMB 2DQUL 4LCUA 1RK0A 5JW5B 4PJXA 5D9SB 4XC1L 1TXKA 1OW0A 3P9MA 4P2YA 5E95B 4JDVB 5GGVL 3GMNA 4RFNC 4NQCA 2N7BA 1YECH 4AIZB 1T20B 5ANMA 5MENE 3Q1SH 1RUPL 3GMPB 3TBYB 4Z0XB 2A2QT 4DFHA 3ULVC 1MUJB 1GOHA 3IDJA 4XCEB 5T1LB 4ZDHB 1XF2B 1YEGL 3MOBH 4NHCL 1K4DB 4U49A 2EEAA 3Q6FA 1Q9LA 2BOBA 1V3LA 3OL2A 1BM3H 5K9KB 1HWGB 4L4TB 1LGVA 4GG6A 3MRQA 4H25A 1BJ1J 32C2B 1SEQH 1A22B 2R29H 2VXSH 4NO3B 5I8CB 2VC2L 3VXRD 2R1YB 3L7FB 5C3LD 3K81A 5BRZB 1LO3L 2HVJB 3BH8A 5C2BH 4I48B 5J89A 4YPGA 5I9QC 1CT8A 4EEEA 2A9ML 4E42B 1BQHG 1WIPA 3QXUA 4JJ5A 1MCPH 3NCYP 4PREB 3RWHB 3TZVA 3RY4A 4LK4A 3KVQA 3LN5B 5A16B 1R5WB 2OTPA 4O9HH 5C08A 2P5WA 3EO9L 2WLYA 3ELAT 4ERSL 4RFEB 1VPOH 3CUPA 1NAKL 3V95A 4PGDA 1DQQB 4J7RA 1WWBX 5T3ZH 3DBXB 5IEKA 1JGDA 4RNRA 3CXHK 5KN5B 4EDXB 2EYSA 5HPMB 1DANU 1EMTL 4ZFFB 4TNWF 4WHDA 5LGHH 5MEPB 1TETH 2ZCKH 1HHGA 3O4LE 5F6IC 1QRKA 2Y5TA 3OG6B 3FKUS 3DMMA 4QRTA 1MF2H 1Z9SA 2XTLA 2CJUH 3FO2B 3VXRB 1HK6A 2Q76B 5DHYB 3C6LD 3S96B 2W9DH 3OF6D 1YPZA 4QXWA 3G04B 2JIXA 5SX5K 1QSEA 4XB7A 3R06B 3RA7H 2IAMC 3KHOA 1WF5A 3FQWA 3JUZA 5CINL 4P59L 1NGYB 3OMZA 3SDAD 5GGRY 5FUZH 4P3CH 4U1GC 5IMLB 1F5WA 4HIIB 3TWCH 3MX0A 1VADB 4BA8A 1G7HB 1KPVA 2LU4A 2O5YL 3L5WB 1FZOA 3ULVF 4LSVH 3LKQB 4GKZB 1Z9MA 1P2CB 1WZ1L 1U8QB 4LDEB 3CXDH 3IFLH 4OZGE 3S98A 1GHFH 1CG9A 5JHLH 5JXEA 1CGSL 3BW9A 2W65B 2WP3O 2XT1B 3WIHL 4PY7A 2BXYA 5EC2B 3V5DA 4OD1L 4JPWL 4JB9H 1F8TL 4KVCL 3ZTNL 5E8EA 5ILTL 1RHFA 1UM5L 2FIRT 2GAZA 4NFBA 5CGMA 3SDXA 3U2SA 2OR8A 4JZOB 1VFUA 1OGTB 4TSAL 5HI3D 2Y07H 4HPOH 2WWKO 3C6LB 2X1XR 4N8CL 5IBTH 2D4FA 3MLVL 2DLEA 1PSKH 3MUGB 1RIHH 4QXGH 1Y0LB 3VFGL 1SY6L 3HE7C 2OXGA 2FHBA 4UUJA 3S3SA 5FYLD 4XP5H 3C6SA 1G9NL 2FECI 1TIUA 3GSVA 1TJIL 2GJZB 4ALAL 4GUPA 3QI9A 2YBRA 4Z95L 1EHNA 3MNZB 4U3CA 5GGVY 2Q87A 4CL7A 1B88A 1P7KB 1RUQL 4OV6F 4O51A 4UDTB 4LHJB 4JFZH 1NGQL 1YNLH 1I3VA 5ICXA 3ZDYE 4BFIA 4NDMA 2Q8BH 4LNVA 3H2WA 4K23H 1IC7L 5B4MD 4KKNA 1HNFA 5TFSL 4PIRF 2O61B 4TVPD 2EDKA 4Z7WE 5B38B 1D9KA 4QXTA 2G9HB 1I8LA 5JMRA 2ICEB 2FSEA 4OGAC 4BZ2L 1UT9A 4FZ8L 2G2RB 2OJEB 3QUZD 3SQOL 2XA8H 3QO0B 1CXIA 2R69H 1UB5B 1IAII 3UPRA 2DJUA 3NTCH 1UH2A 3LKSA 1F6AB 2EKSB 2P8MB 3KPOB 4HWUA 1T7YA 4ETQA 4WI9A 3OZ9L 4G7VH 5CJOL 2XQYK 4GRLA 3S88H 4NNYA 1QSFD 5CP7B 3RPIA 4U6XA 3MBEA 3G5YA 1GOGA 1JRHH 4PRBA 1FFPA 4D0BA 5IGXL 3DX6B 4M7KL 5I6XB 4MD4B 4N9GA 2IGFL 2GJJA 4AH2A 3CK0L 4XRCA 3D85B 4YHYB 2FZ3A 2H9GA 2F58H 5AEAA 3NCFB 1YY8A 5AZEH 2AEIT 4LLVA 4OF0A 1ZLWH 4PJFE 3GDBA 1OGAA 3WIFA 3FO1A 5I75B 1G6RL 1DLFL 4KHXH 4RX4A 5KS9A 2Z35B 4P2RA 2RCSL 2Y6SC 4MJIB 4KUCF 5GZND 3UO1L 4Z7VA 4JGMA 4OUUA 3HC3L 5DJ6A 35C8L 3OJMB 4RZCB 4GW1A 1KULA 3QUZB 2HTKC 2WNGA 5D7JC 4OZIB 1WT5C 4HK3N 3T8XA 3VXPB 5D72L 4JFDA 5DR5H 3MROB 1XIWC 2VQ1A 4DQOL 2BSRA 2BHZA 3IDYB 2NX5D 2E9JA 1VKXA 2E9WA 2DQDH 1QSFB 4GBXD 1FSKB 4ONGL 2ADIA 4BKLB 2CLRB 4XI5C 4KK8D 1ETZA 3H3BC 3ARFD 3RFZC 4JDZB 5D96B 4DVRL 4MCZA 4OLWL 2VR9A 2XTJB 5H37H 1FO0H 3T77B 5CJ5A 1P7QA 5C6TH 2DOCA 2YPLD 3PWPA 2EDLA 2WBJC 4NM8L 2P43B 5E2TH 1E4XH 1K6QL 4P5KA 5CBAA 1MWAB 4NN7B 5IB3A 2JJVA 2X4SA 5DUBB 3TBTA 3DRTB 1KG0A 3VGDA 3QDMD 2MKWA 5F71A 3MXVH 2LABA 4X9FA 4OKVA 5FIEA 1M7DB 3OB0H 3D0LB 3NH7L 4PJEE 4LEOA 1PJ9A 3C2SA 1KCKA 1WISA 5GGUB 4JHWL 3OHXA 4JRWA 2NX5B 3RVXD 2UVFA 3OBAA 1CLOH 3MYJB 4KRPD 43C9B 2P24A 5I1DA 4HIJB 4RA3A 1XF1A 3ARSA 4Q7DA 4LU5L 4GBXB 2VDKL 3G5ZB 2BRQA 3AU1A 1EXUB 3INUL 3FN0L 2UUDH 4I0PC 1A0QH 2O5XH 5HVFB 3PWJA 4X99A 1F97A 2MQ0A 4JFQA 4WJ5A 5DRWB 3VXQA 3ARFB 5IFJB 5TH2B 3KLHD 5LCVL 3A67L 5HI4C 2GTWA 4GRWH 5I1AA 4M1DH 4ZFOA 1HEZA 1XH3B 4UQ2A 2YPLB 4PRDA 4M6NH 2E7MA 1LNUA 3SOBH 1CXHA 4FQ1L 1DFBH 4O58L 4YE4H 2FX9L 1T1WB 2V5YA 1I7ZB 4PY8J 4F7TA 5DEGB 4JY5L 1IGTA 5DJCB 5EG6C 3IVKB 4GAFB 3QXDB 1EHXA 3QDMB 4IRZH 2NW2B 4PJAB 1JPTH 3FB5B 1UFUA 1V5JA 4F8TA 1UVQA 5IK3A 3G6JE 3QDGA 4J6RL 4F33B 1RJLA 2VKWA 3RQ3A 5T1DL 4XBEL 5DO2D 1EH9A 3O2VH 4YC2C 3AGVA 1UH4A 3ARXA 3I02B 1UZ6E 2GHWB 4DKEH 1FG2B 3LEXA 4J1UB 2APXA 1BAFL 2CLZA 4WFED 2JK5A 4I18A 4KRPB 4UU9A 4JZNB 5CSZB 4K8RC 4XCNB 3MV9A 1X5YA 4EBQL 2IQAA 1ZT1B 1N0XH 1FNGB 4G6KL 1AD9B 2FNBA 4QRPD 4BH7A 1RIUH 3S37X 4X6CA 3TPKA 2XFXA 3BN9D 4WTZG 1J8HD 3LV3A 1FCCA 3RWDA 3DV4B 3L3HB 4XMKH 5F89B 1NBVH 4XTRD 1XZ0A 4HF5H 3D18A 1KTLB 4LOUD 3VFSA 1QBMH 1EEYB 3CVHB 1PG7H 3AMKA 3P3YA 4I2XA 3OPZH 4UNTA 3TCXA 3QWRD 3KR3H 1MFAH 1WAAA 1CF8H 4K8RL 3PIQB 4XPAH 3W11C 4M8VA 1INDH 1NPUA 4F9PC 1KC5L 1B0RB 1H3GA 5DD1H 4IJ3B 4K3DH 2Z31A 2WP3T 5DYOA 2NR6C 2ED7A 3IB4A 4D0DA 4DN3H 3BO8B 3U0PA 5IG7B 2RFXA 3VI4E 2YS4A 3BHBA 4UB0H 5TDNA 2H8PA 5KTEL 2YRZA 3SGKA 1J12A 4QRPB 3F7PC 3C08H 1KJVA 5C0BE 2LTQC 1MRCH 3EW3B 2VIRB 2ZOLA 4U0QB 2YWZA 3I6GA 1J8HB 2NLJA 1GJIA 2R0WL 4WRLA 2Y1VA 4YDKH 4FQCH 4PGEA 1QSZA 4ZYKB 4TRPH 4PTUA 3BRDA 4KK9D 4P2QA 1N6QH 1OP5K 4XH2B 4YDJB 3CSYB 2XRAL 3RUGF 2NXZB 3MRLA 3PGFH 1K9TA 1R3IH 1GC1H 4DOHE 1A7PH 1CE1L 2NY5H 3BOVA 2X4NA 2HLAB 5FYLH 4D9RD 3J7HA 1F58L 3FOMA 2X41A 3VG9C 3QNZB 1T89A 3MRNA 3L6FA 1EERB 4PGCB 1ZT4A 3OJDB 4JVUA 5T1MB 1SEBB 1MCFA 3FQNA 3SO3C 4NQSB 5D71H 1TNMA 5ICZB 5I15L 2DQFA 2V6HA 1VENA 4YHNA 3WYRA 1ZEAH 3TESA 5F70A 5IWLA 1E27A 2PXYD 3LKRA 3TV3L 4AL8H 3DTXB 3GJEA 4PJXB 3B5TA 3P9MB 4NKIH 3TZVD 3V9FA 3GMNB 3M45A 3H42L 2APWA 4N0UE 5D7SH 3L3IA 5ANMB 5C08D 2P5WD 1P4LA 4EVNA 3BE1H 3GKWH 4G80A 3W5MA 5K9JH 5IB1A 2VLRA 3JWNC 4YDVA 5JNYA 4S0TD 3VFUA 3SJVE 1S5IL 3LPGA 3LPFA 5IROC 2O5ZH 5LKNA 1SM3L 1Q9LB 1HYRC 1QFWH 1Q94A 4KAQH 2BOBB 4HWBA 4K71B 4FN0A 5I8KH 3NA4A 4RIRA 3EO0A 4AEHL 4GG6B 3MRQB 2OZ4L 2VLLB 4D3CH 3EOTL 4KROD 3DMMD 2KL6A 4TUJA 2AABL 3OSKA 2DTMH 2NY4D 1ITCA 3BH8B 2BFVL 2PXYB 1MWAH 4ISVA 1KEMH 3N50A 4YPGB 2OL3A 1NLBH 2JIXD 2VDMH 4JJ5B 1JPGA 2HH0L 5KANG 5DD5H 3TZVB 2GT9A 1LP9F 4X8JA 1XR9A 2X1PA 5C08B 3S4SA 2P5WB 1EEUA 1NEZA 1QO3B 5CEZD 2VDRL 3CUPB 5FYJD 4PGDB 2JKXA 2G75A 3C5ZA 3WJJA 1YEEL 3VE0A 1Q0YH 1IJ9A 1F4XH 4OLYH 4I13B 1JGDB 4RNRB 5IEKB 5JXED 3DYPA 1R5IA 3EOBA 2VDNL 2EYSB 4NT6A 5IHZA 3EDKA 1PX3A 2A6JA 3PL6A 4ZTPH 3S5LA 4AJ0A 5HYJE 3BYYA 4KV5E 3V5HB 1HHGB 4XP9H 5E4IA 3TBWA 2FIKA 2Y5TB 3DMMB 2ORBH 1UM6L 4KKLD 2BDNL 2C9AA 3VGAB 3HI5L 2NY4B 4ODTH 1N7ML 1NCBH 4L4VD 1I1YA 5ETUB 4WW1A 1DBBL 2NYYD 4KDTC 4M62H 1RI8A 1YPZB 4NKOA 2JIXB 2B4CH 1OTUC 2XZCH 1QNZH 4ENEC 5EOCH 4FFYH 3SCMC 3X3FH 3FQWB 5C1MB 3QUYA 5K9QG 1K2DB 1U8IA 2NY6C 3Q1SL 4JRYE 4R96A 1FAKT 4C4KO 3QJHA 5LBSL 1IC5H 3ZE1F 2YD1A 1KPVB 2IPKA 1UCTA 5DD3L 4LEXH 2VZ1A 3B9EA 3MOBL 5CHNB 4UT6L 2VXTH 1CG9B 5F3HA 1D9KD 3TIDA 3BW9B 2PYEE 4TYUA 3P4MA 4Z7UA 1L7TL 1A1MB 4PY7B 1FL3A 1V3MA 3V5DB 3RWJA 4LCIL 4FXKA 2BVPB 2IFGA 2EDJA 5E8EB 5F9WC 2GAZB 4QT5B 1OSPL 1SEQL 3CFEA 3GNMH 4LVOC 3SDXB 3ZMRA 3U2SB 2R29L 2VXSL 5FV1L 1YMHB 4U1HA 4HWZA 1HIML 3GMQA 4G6MH 3O4OC 1YMMD 1UENA 4J3OC 4JO2H 4EUPG 4JQVC 5ID0B 4U1JA 3DX9A 5C2BL 4RBPH 2IANA 4UUJB 5I19H 1O0VA 2JCCE 5F7EH 3C6SB 3GSVB 5JOPD 4PBVC 1EUTA 3CMGA 4GUPB 3QI9B 2YBRB 4RRPG 4FS0A 5IJKC 1IAMA 4O51B 2YD4A 1VPOL 2A74B 3LKNA 5ICXB 3PNWA 4BFIB 2IH1A 4NDMB 1OGAD 5E8OB 1F90L 2HT4D 1D9KB 3PHOA 3EYUH 5IFAH 4QXTB 2VUOA 4JHBA 4PRHE 2EC9T 1WWWX 4PUBH 2HP4A 5LGHL 2E7LC 4QTIH 3S35H 4ZD3H 2ZCKL 2FEEL 2JJTC 3UPRB 3LKSB 1WZMA 1IKFH 4JFDD 3EFDH 1OAQL 4B50A 1I1AD 4ETQB 4LFHG 5HYFA 5EB9A 3CNKA 1JZ7A 1BVKA 1YMMB 4GRLB 4HKBA 4JQXA 4JRXE 4NNYB 3D0VA 5CGTA 3RPIB 1WFTA 3V2AR 4U6XB 2BJMH 3G5YB 4PRBB 2EDNA 1FFPB 4ZS6C 3P4OB 1UWGH 1K8IA 4FFWD 3SDDA 3RA7L 1G7IA 4UT9H 4N9GB 1P9MC 4FQXA 4PRIE 4JKPL 4GKOA 4UMGA 3A0OA 3UPAA 3VCLA 4ELMA 1S7VA 2FZ3B 2H9GB 4ZUUB 2C26A 1MCJA 1VB9A 1YY8B 3TWCL 1M7IA 4MNHA 2X42A 1VGEH 2W0FB 3PWPD 4LSVL 4LLVB 2NY2D 1OGAB 3WIFB 3CFBA 3IFLL 4WCYH 1HHHA 1R24A 1GHFL 3V4PH 1AGDB 5JHLL 3HE6D 1P84J 1MCNA 4GH7B 3U36A 5J56B 4Z7VB 4G3YH 2UY6A 4JM2A 4OUUB 4GW1B 1DSFH 1G9ML 4GLRI 1JHTA 1BWMA 1PQZB 1IZKA 3IDUA 3T8XB 2BMKA 5I17A 4JFDB 5ADPH 2VQ1B 4PGJA 4Y5VA 2EE6A 1VKXB 1FZKA 2Y07L 1NJ9B 1F13A 1N2RA 4CDGC 3EBAA 4QXGL 4Z77B 1C5DA 4GW5A 5FA3A 2ADIB 3RAJL 5FA4A 1MJ8H 4LVHB 1NCTA 1GOFA 1ETZB 2O93L 5GS0D 4QXUH 4KZDL 4MCZB 4HIHB 1YNTA 5E94A 4JFZL 3UDWA 1P7QB 1YNLL 3I6KA 3PWPB 4I3RL 3M17A 2YPVL 4WFFD 1RJZA 4K23L 4RMUA 4P5KB 1A6PA 3WN5C 2OP4H 5IB3B 4Y2OA 2X4SB 1TDQA 3QUMA 3TBTB 3HE6B 1JF6A 1HXMA 1KG0B 3C9NB 1CICD 1EUUA 4A2LA 1DBMH 5J06A 3I50L 4OKVB 1RD6A 3QDGD 2XA8L 3VFTA 2R69L 3ZKMD 4MJ5A 5FV2A 2R56H 4LEOB 4M43L 3OHXB 5KSBE 5IM7A 3VXMD 4Q9CA 4J4PD 3BUYA 2H32A 2P24B 3MV9D 5I1DB 5F1NA 3PXHA 5FCSH 5KBNC 2VL4A 2XZQH 1JGUL 4ZG1A 4N5ED 3AU1B 2PF6A 1BZ9A 2WIIA 4D8PB 4H0IA 3PWJB 4X99B 4JFQB 4WJ5B 3SY0A 3VXQB 1CI5A 1QVOA 2MHAA 3QUXC 5E2VL 2NZ9C 4LKCB 2F58L 2GTWB 5I1AB 4ZFOB 3FOLA 4PRDB 5AZEL 2QJDA 1LNUB 4WUUE 4JFPA 3QYCA 1U3HA 3HUJA 1AE6L 4OTXH 4Y16A 3BPLB 1RFDH 4KZEL 1IGTB 4QHKJ 4KHXL 3O9WA 1CICB 1S78C 1FVEA 3WLWD 4CU7A 1N0LA 4JO1H 1UACH 1UVQB 4O2EB 5IK3B 3VFWB 4KKAC 3QDGB 1RJLB 3BP7A 4Y5XC 1OTSC 1CVRA 4Q58C 5EOQL 3H9SE 4HGKC 5TQ2H 5E6ZA 3AS1A 3LEXB 4EN3C 4M7ZB 1OQOA 1V3KA 1BP3B 2CLZB 5C09D 2JK5B 4I18B 4UU9B 1UCBH 3MV9B 2KBGA 2BY0A 4MNGE 4BQBA 1GZPB 5MP6H 2IQAB 5MI0B 5BVJB 1LO5B 4WI4A 1NFKA 4IMLA 1AHWC 4PJHE 4X6CB 4YAQA 4LIQH 2AK4A 1AXIB 4TNWK 2EIBA 4XWGH 4LMQE 4BFEA 3QEUA 4UDUA 5IVNA 3T0XA 2BVOA 5J13B 3ROLA 3LV3B 2EDWA 3RWDB 2D2OA 5DLML 3OWEA 4Z7NE 1XZ0B 4YFLI 1FNLA 1MEXL 5DZNA 4H88H 3DETD 3WFZA 1UM4L 3D18B 5C6TL 1E4XL 1IC4H 4YHZH 4ZPTB 3AXLA 2FJFA 2VH5H 1N4XH 4LCYA 1OLLA 4YUEH 3HNSH 4I2XB 4OZHF 3WS6C 4C4KT 3BRFA 2FATL 1S7UA 3MXVL 3N1QC 3ZTJG 1WJ3A 2Z4QB 3ME0A 2CPCA 1I9IH 1K4CA 5J8OA 3WIIH 2EXYD 4TNVF 1JYXA 1T5WA 5DYOB 4D0DB 3ZYJA 4H20H 3U0PB 3KPQA 3V7AG 5I2IB 5IKCA 2RFXB 3V52H 3UCRA 2APFA 3BHBB 4OCRH 5TDNB 2H8PB 3QIWA 2FBJH 2ADGA 4HQQH 4HFWA 3RVUD 5KSAC 4L9LC 1A0QL 3B5HA 4QYOA 4L1HA 2O5XL 2ZOLB 4IOIA 5AWNH 3U7AA 1SVZA 3HNTH 3I6GB 4RDQF 2H3NA 2CUHA 3OAYH 1KENH 1NBYA 4PGEB 3QIUA 3QBTB 3CX5J 4M1DL 3QH3A 1BPVA 1VSCA 4PTUB 1U3JA 4P2QB 1EGJA 4M6NL 3QUKB 1HQRA 3SOBL 2F15A 4YE4L 2VLRD 3MRLB 5BVPL 1BD2A 4LCWE 1JP5A 1WTLA 2X5PA 2YXMA 4WTZA 4NQED 4XNQA 1DQLL 1JPTL 3U30C 5BRZE 4OSUH 2X6MA 1A7BA 2D7PA 5CMAA 1F11A 4NUGH 1KCUL 1IM9A 3CFDA 2WV3A 3FOMB 4I3GA 2PO6D 3O2VL 3MRNB 3L6FB 4ETYA 1ZT4B 5L2JA 3QXAA 4DKEL 2J8UF 3FQNB 1WV7T 3RPKA 4I3SL 5LVEA 3DSFH 3N1GC 3O3EA 2DQFB 4YHNB 1S7RB 1FNSH 2VAAA 2VDQL 4OM1H 1E27B 4MMZC 1N0XL 3LKRB 2W92A 1RIUL 4GKNB 4G9FD 3UTSD 4LLYA 1PYWA 3GJEB 5HXMA 3IETA 4WVRA 3ULUD 3GSWA 4AY0A 4IRSA 5HHQA 3L3IB 1EO8L 4NZUL 1M4KA 1P4LB 3M8OH 4EVNB 4R90H 1EVTC 1I8IA 3D2UD 4G80B 4XHQA 5I8EA 2KKQA 5IB1B 2VLRB 2WIMA 4YDVB 5JNYB 5F72S 3GMOA 3QNXA 5D2NC 1EJOL 1PG7L 4UNVA 3VXRE 1KCSH 1RHHA 3HMXH 4NQEB 3I3EA 1DBJH 5JUEL 1Q94B 3T4AA 1DUZA 1MFAL 3TH4T 4O00A 1AQDA 1CF8L 2DDQH 4MLSA 3RNKA 4RIRB 4Z0BH 3EO0B 1INDL 2QBWA 1NDGA 1E6OL 1GC1C 5DD1L 2DQTH 3BKJH 2NY5C 4K3DL 5GRVL 2AQ2A 4TUJB 1YYLH 2R0LH 1I1RA 3QQ4A 1S7XA 2DWDA 2XV6B 1UADC 4F9LA 4NN6B 2QKIA 4LQFH 4UB0L 3TN0D 4KY1H 4ISVB 4OGZA 4Y1AA 2OL3B 3C08L 2Y7QA 3UTSB 5B21A 3CDFA 1FAIH 1VACA 5GZOD 1MRCL 4RWYL 2ATPA 2GT9B 2P8LA 2V2WA 4JR9H 4LSRL 3VA2C 1D5MA 3VXNA 4F57H 2CUMA 2EO1A 4X8JB 3MUY1 4YDKL 3UZEA 4FQCL 1SJHA 4DK3A 1IGCH 3QEQD 3S8WA 1F3JA 1NEZB 4NO5A 3D2UB 4TRPL 2BZDA 3O2DL 2VAJA 3C2AL 2J88H 1RUMH 2G75B 1NFDF 3C5ZB 3O6LL 3PGFL 2EIZA 3VE0B 4KHTH 3KAAA 4HHAB 1A7NH 1CD1A 3EOBB 4NT6B 5DRZA 3MNWA 1N26A 3KPLA 1XT5A 5FYLL 2A6JB 2FX8H 3PL6B 3S5LB 3MV7D 3Q6GH 2MQ3A 4MD5A 5T3XH 3OKMA 3FQXA 3TBWB 2FIKB 2J8HA 4LARH 3SKJL 1J86A 3OAZK 1CGTA 1T22A 4NNPH 4N1CA 3KPRA 4WW1B 3TN0B 1WZKA 1ZEAL 4NKOB 4WU5A 4YR6A 4NWUH 4MZ3A 3GUTA 3U7WH 2ZG2A 4NKIL 4BELD 1ZV5A 1TLKA 5D7SL 3QEQB 1U8IB 1A4KB 2D31B 4V1DD 2YSSB 4R96B 5HYEA 3QJHB 1QUNA 4PJIF 5D7LA 3QCVH 5K9JL 1XEDA 2IPKB 3RVTD 1XF4A 5F9JA 5F21B 1T03H 3RDTD 3GKZA 1CLYH 4K2UH 5BOPA 4HXAH 3LKOA 4OZGF 2O5ZL 5F3HB 4R2GD 5SX5H 5KVGH 2OJZL 3P4MB 4Z7UB 4IOFD 1FL3B 3VA6A 4J23A 5I8KL 1OF2A 3MV7B 4FXKB 5EA0L 3ARGA 2HG5B 1OT1A 1BZ7B 3O8XD 5FYLE 3U9UA 1ZE3C 2J6EA 1CGYA 4F7CA 3HRZA 4D3CL 3C8HA 4YO0A 1MREL 2HN7A 1OAUH 3V6OA 2BK8A 3R0MA 2DTML 4U1HB 4HWZB 3GMQB 3RI5F 3MGOA 3VXUA 1P5UA 3W2DH 1KEGL 1MWAL 2IANB 4JFHD 4HJ0C 1NLBL 2VDML 3SDDD 3N06B 1PY9A 3IJHB 2Q1EA 2JJSA 5DD5L 5JW3L 1BECA 4FQXD 3BPNB 1QBLH 4MJIE 5DQJA 5IHBA 3MRRA 5DRXA 3MLRH 4BZ1H 1J88A 5I1JH 4OZIE 3GBNH 3LKNB 2B4CC 3PNWB 2IH1B 5BO1L 5DJ0A 2D4DA 4P5TC 2B5IC 2QHLA 3U4AA 1RSFA 1Q0YL 2XZAL 3ZKXB 1F4XL 2W1NA 3PHOB 4JQIH 4R2GB 2F9BT 2ZUQB 2X4UA 3TJEH 3TM6A 4U1NB 4LHUG 2OM5A 1QSFE 4JM2D 3DGCR 1JE6A 4YGVA 5HHVH 4XVTL 4ZTPL 3EFFB 3O8XB 2H6PA 4B7LA 4ZNEE 1D6VL 4XP9L 3NN8A 4RMVA 43CAA 4I9WE 1L0QA 3QULB 2DQGH 5FM4A 4EI6A 4ODTL 3UZQA 1BVKB 3MJ9A 1C08A 2XTJE 3KG5A 4HKBB 2JELH 4JCMA 4NNXA 2YD5A 1MIMH 5F7DA 2Q3AA 4M62L 3GM8A 5JLZB 2H2SC 3QDJA 3SDDB 4L1DA 1K8IB 1G7IB 1QNZL 5HHMB 2ZJSL 2OK0H 5EOCL 4FFYL 3X3FL 4FQXB 1KGCE 4G6JL 4NGHH 5CGYD 3VCLB 4ELMB 1Y18A 3S35X 2AXHA 2JF1A 4PLKC 3BEWB 2VDOH 3LMJH 1IC5L 4YBQC 5I0ZA 3EZ8A 4MNHB 5AYUH 5D1QC 5FHAH 1XR8A 3SBWA 3CFBB 2CKNA 2VXTL 1R24B 2NX5E 1RZJH 4RRPA 1QFHA 1A3RH 2HRLA 4JM2B 3EUUA 1A14H 3LDBC 1KLUA 3PP4H 4GS7C 1JHTB 2VSCA 1PAMA 1CQKA 2BMKB 5I17B 3JTSB 1P7HL 2CIIA 3GNML 4Y5VB 5E1HB 3VGGA 3V5KB 3QPXL 5FDYA 1FZKB 5H94B 2OTWA 1TJHL 1YNKH 4JO2L 4C56E 2LAAA 1FZMA 2FGWL 2YPLE 5D70H 3ARBC 3TCLA 1C5DB 1SVCP 4GW5B 1K3IA 3EJJX 4JPVH 1D5IH 4ZUSB 1BVLA 4POZD 5FA4B 3ARPA 3F6LA 5DFWH 4HWBH 3Q5OA 4ZXBD 4CMHB 3QDME 4PJAE 2CDFA 2X4QA 1R5VA 2NXZC 5GISL 1YNTB 2N1KA 4X0KA 1MCSA 3LSOA 3PGDB 3I6KB 3M17B 2EEBA 3BDBA 1RJZB 3AREC 4H8WH 4DZBA 2WAHA 3PABA 4K7PL 4TUOA 3B3IA 3FJTA 5I1KH 4Y16D 1UWXH 3QUMB 4W68A 1XCTA 4PLJC 1X3DA 3EYUL 5IFAL 3AM8C 3O9WD 2IAMA 4HEPG 5DVKA 1B90A 4AMKH 2R2BA 5HYSA 3WXVH 4PUBL 4O5LH 1GXEA 3JV4A 4QTIL 4ZD3L 3VFTB 1JBJA 4MJ5B 4UV4H 4K9EC 1BWWA 5INDA 3RWFA 1IKFL 1VGKA 3EFDL 3CU7A 1FLRH 4LSTH 4G8GD 2DWEB 2FR4A 3BUYB 2H32B 2AERT 4OCMC 5DC0A 3SKNB 4P4RA 5F1NB 1BFSA 2EDYA 2OMBA 5I73B 1BZ9B 2C1OA 1UWGL 1PKQA 2ARJQ 4MDIB 1KIRA 4K94H 3SY0B 4J3WA 4ZXBB 5A2IH 1QVOB 3MLZH 2MHAB 3VG0L 1J05B 3UBXA 2E7HA 1R0AH 3FOLB 2V17H 1Q38A 4GLRH 3RVWC 4MA1C 2Y23A 3NCEB 2ZP0T 4JFPB 4N0CC 3IDIB 1RUAH 3HUJB 4Y16B 1LO0H 4WCYL 2AGJH 4WFEE 3V4PL 1DQJA 3O3BA 3O9WB 2L0DA 1FVEB 2BX5A 4M6OH 1MNUH 4K55A 4G3YL 4YPJA 5TE6H 1DSFL 1RMFH 1T7WA 4R4BA 2IC2A 1JPFA 3BP7B 4M61A 5CJQH 3ET9F 3DIFA 1PZ5A 5ADPL 1JF1B 3HG1A 4LHQB 4NN5B 2FECL 1J8HE 2WLZA 2WMPA 1AR1D 3NCMA 4RAUA 5DTFA 3BDYH 3I9GH 4F3FA 1UA6H 1ZLUH 3SQBA 4IMLB 1VA9A 4X9GA 4YAQB 4ZQKA 2AK4B 5F1KC 3MLUH 3U4EB 4OGYL 1CTOA 1MJ8L 1GH7A 4KK6C 3TFKD 5D7IA 1T5XA 2BVOB 4QO1A 4R7NB 3ROLB 2VNCA 3KHQA 1CYGA 3BSZH 2PYFA 3HPLA 3EDJA 3DV6A 1BVZA 2DTSA 3EYVA 1FL6A 2XQBL 1IAIL 3AXLB 4JM4H 2FJFB 4M7JH 3VWJC 4LCYB 3GI9L 4B7IA 4XBPB 5IIEA 3FO0H 3QIBD 1DBML 1M1SA 1RZGA 2DIAA 4UAOC 5DT1H 2DI7A 5J1SC 2XA3A 1SMOA 2EZ0C 5HY9A 4Z18A 3KS0H 4XBGA 1K4CB 4S1SH 1DQMH 4PJXE 2IQ9H 3VH8G 4PGZA 3UTPE 1T5WB 3W0WD 3NVQA 4NQCE 3GMMA 4FNLL 3KPQB 5ANME 5IKCB 1AR2A 5F6HJ 1KPUA 4A6YB 1SBSH 2ZSVA 5C0FA 2C4FT 2XZQL 3QIWB 4HFWB 3O45A 4Q0XH 4QYOB 1IGMH 4GQPH 4IOIB 3E2HB 1WT5A 3FQTA 2H3NB 1UXWA 4IRJD 4UIKH 2Q7YA 3WO4C 4IRSD 3R8BB 3QIUB 1XIWA 1I1FA 1JHLL 1FVCA 4NO0A 3QH3B 3TJHD 5DJ8A 4OUOA 5MHSD 1DN0A 3KWWB 3RY6A 1HQRB 4GG6E 1Z0NA 1BD2B 4OTXL 1OHQA 5FB8A 2MTPA 1RFDL 1DDHA 2YD6A 5JZ7C 2PN5A 4HW6A 1A6ZA 3AUVA 5CMAB 1U9KA 2C1PA 2D3VA 2OLDA 3VFOA 5J11C 1IM9B 4PBWD 3CFDB 1UJ3C 3KLAA 3D5OF 1OTTD 5TGBA 1C5CH 2HJKA 4GMTH 5ELIA 3QXAB 2WBJA 4ZSOA 1IEBA 2YD3A 3QP3A 5L7XL 4B41A 3EYSH 5CEZL 1HSBA 3BP5A 4NC0B 5C08E 3O3EB 1CFNA 2P5WE 3GB7A 2VABA 2VAAB 5MP6L 5E0QA 1B3JA 2CDGA 2CO7B 1UG9A 2Z93A 4X7EC 1Q72H 1PYWB 3UBXI 1ZHNA 3IETB 4XWGL 2K1MA 1FBIH 4HIXH 4QWWD 4DCQB 4IRJB 4Y8AA 1FC2D 4V2CB 4IRSB 5J1AA 5HHQB 2J5LC 3FFCA 3HC0A 2ERJC 4Q97A 1U8JA 1I8IB 1I8LC 4KTYA 1EDQA 2F53D 4MZ2A 4YHZL 1F02I 3GMOB 1YUHA 2VH5L 3QNXB 4JE4B 1N4XL 4I0PA 1RHHB 4KJPD 3HNSL 4YUEL 5KOMC 3F8UB 1IGIL 3T4AB 1DUZB 3BGFB 1KOAA 2IWGA 2XWTA 4FXGA 1YPZE 2X1WL 1OT2A 1C16A 1NDGB 1C12A 1I9IL 2EYTB 2CXKA 4GRLC 4PJDF 4FQHA 2W9EL 1L9MA 4F80A 3WIIL 1VESA 3MBEC 2PUQT 3RUGA 1S9YB 3QQ4B 1S7XB 2I9TA 4H20L 4GAYA 3V52L 4JO4H 1U42A 3KPRD 5CEZE 2QKIB 4HKXA 4B5EA 4LLQA 4LDOB 3LIZH 2FBJL 4UNUA 2Y7QB 4KRMB 2ZWLT 1C1EH 4KI5C 3QR2A 3ARUA 5AWNL 2CLVA 2P8LB 2V2WB 3HNTL 3VXNB 1D5MB 3UJJH 1KENL 1SJHB 2X4OA 4RMQA 4ZO7A 4L5FH 1F3JB 5JIHA 4NO5B 5CWSA 2ATKB 3BKCH 1UYWH 1JYNA 2BNUB 1WZLA 3LB6D 4DGIL 2F53B 2EIZB 5F9AC 1FE8H 3GO1H 3SDXE 1JMZA 2B1HH 1HINH 5F8QC 4OZFA 1CD1B 1D5XA 4F2MA 3MNWB 1ZHLA 3KPLB 5DFVC 4OF5A 4NUGL 2UVEA 3P2TA 2PTVA 4MD5B 1MFEL 4UV7H 3OKMB 3FQXB 3QT2A 3PV7A 4IOSD 4JN2A 3MV8A 5SWZA 1NGPH 2CO6B 3FAXA 1D7FA 5I1CL 1T22B 3DSFL 5GGRB 4C83A 4PRPA 5BXFB 2FJHA 3KPRB 3VXUD 4LVHC 1FNSL 2HLFC 4OM1L 1MCWM 2B0SH 4WU5B 4G6AD 4YR6B 3STZA 3DSNA 3GUTB 2QL1A 5HI5C 1I8KA 2KDGA 2VDPL 4F9PA 4CVXA 5EZIH 1ZKAA 4HCRA 1X5FA 4G7YL 1W0VA 4CJ1A 2FGZA 4RISL 5E2WH 5D7LB 1SYVA 3O4LD 4P2CG 4EQ3A 1XF4B 5B38G 5F9JB 5KVFH 1NUDA 2AKRA 3KJ6H 3LKOB 4XT1C 3TBSA 3X13A 1DBJL 3KS0J 1LP9A 4ZUTA 1OF2B 1G7PA 3ARGB 4NJ9H 4EJ1C 4PR5A 1QA9B 3U9UB 4F7CB 5JOPE 2DQTL 3HRZB 1YQ2A 4ZTOH 3BKJL 4RGMB 2HN7B 1BQLH 1BFTA 1YYLL 2R0LL 5DC4B 3WJLA 2XACC 1KJ2A 1FRGL 2VWEC 4X6EB 3MGOB 4PJGF 3VXUB 4LQFL 2WANA 1VFAA 4KY1L 3O41A 1HDMA 3AMLA 1LD9A 1E4JA 1FAIL 1OGAE 2QQKH 4XAWH 2MQCA 2EDXA 1AGFA 4JR9L 4P2RE 4F57L 4KI5F 4YHMH 4OQ1A 3GRWA 1KTDA 1EEZA 4Z7VE 5DQJB 4CKVX 5E99L 3MRRB 5DRXB 3BAEH 1HHJA 3O4LB 4JPKL 5DJ0B 1RUML 4JFDE 1S7TA 3T3ME 1V7MH 2D03H 3SGEI 5HGGS 4P0DA 1A7NL 3DYOA 1MVUA 2CDEA 3WDJA 4ORZC 5CSGA 4YGVB 4RFNB 1I3RA 4PPTA 3Q6GL 4TSBH 2H6PB 3KJ4B 3VFPA 4HD9A 3DURA 4I5BA 1TPXC 43CAB 1J8KA 2YEZA 5MI0C 4NWTH 4ZFOL 4I4WB 4YHIB 2YD8A 4EI6B 2R9HC 1C08B 2E27H 4NNPL 1OAKH 5C6WH 4NNXB 3N1MC 5IROA 5F7DB 3PWPE 2MFNA 3DGGA 3FT4A 3QDJB 1KIQA 4JKWA 4M3KB 4C58B 1NKRA 4YQXL 4Z7OF 1NCCH 3U7WL 2AJVH 3VFNA 4IDJL 2I07B 4UTBH 1YJDL 1ZLWK 2NMSA 1Y18B 3NPSC 2DYPA 2XIDA 3HB3C 1XF3A 4TNVK 2XXCB 5I71B 3NCJH 1IGJB 4AEEA 1XR8B 1T03L 5TF0A 4X83A 1CDGA 1G0YR 5I9QB 4HXAL 3QHFL 1X5JA 4YK4C 5DZOA 3LKPA 2IAMD 1B4JL 1NGXA 3ILPA 4KU1A 1BJMA 1AQKH 2Z31C 4QCIB 1KLUB 4HEME 3RKDC 3MRBA 1I8MA 3F7QA 4KJQC 2DMCA 1XMWA 4Z9KB 4YBHA 2R4RH 2ZUVA 4NFDA 3IXAA 4ZFGL 1RURH 5GS1C 4GAJL 4HULB 2OTWB 3PXJA 3D3VA 1CBVH 5D1XD 1FZMB 3W2DL 4KUCD 2BVQB 4ESKA 3UC0H 2R8SL 1KB5A 3UPCA 1MY5A 1MOEA 2DD8H 5F1IA 2BRRH 5D2LF 5DHVA 3QA3A 5F6IB 5IQ7H 5BW7C 1QBLL 2CDFB 2X4QB 1R5VB 5L6YH 1DLHA 2Z0BA 2A77H 3MRMB 3QDGE 4BZ1L 4X0KB 5I1JL 3LSOB 1J5OH 1FH5H 4LKXB 3FTGA 4HBCH 4OIBA 1GGBH 4DZBB 3PABB 4TUOB 2D0GA 3HE7D 1FFOA 3OB0K 4R26H 1XCTB 4JQIL 2WUBH 4KWUA 1ZA6A 2IAMB 1H3TA 1T89C 3L3KB 2R2BB 3MV9E 3SCMA 3NACH 2GQHA 3JV4B 4MHHI 1RVFH 4RFOH 4X6CE 4U1GB 1TQBC 3M1BA 1MRFL 1S9KC 5INDB 3CCHA 3RWFB 3C8DA 1RZJC 5IWLC 2N7AA 3MJ8B 3DVGA 2DQGL 5KSBF 2HWZH 3WUWG 2JELL 4P4RB 4XNYL 1YC8A 1MIML 1J7VR 1U36A 1XGQA 1CWVA 1NANI 4OGAD 5TQ0H 3MFFA 2C1OB 3U0TB 1HYSD 4WHYH 2OK0L 1KIRB 4I2XE 3IAQA 1U93B 1CZ8H 4NGHL 3T08A 3UBXB 4H5SA 4G6FD 1WAAE 3B9KA 1X4ZA 1FFRA 3GIZH 3Q2CA 3LMJL 1RPQA 4DUWA 4AT6A 3OXRA 4OLXH 5CILH 5FHAL 4QHUB 4JQVA 3IDNA 1D5ZB 4XMLL 3HE7B 5IBLC 4Q2ZA 3BIAX 5CJBA 3O3BB 4YWGL 3P0GB 1RZJL 2ZUUA 1KCVL 1AGCA 5IJKA 3PP4L 4NJAL 1MCBA 1HCFX 1JPFB 4M61B 4OCNC 3WFCH 5HHPA 3DIFB 4MB4A 1KXTB 3V7MA 3D39A 5MERA 2VXQL 5ESAB 3D25A 3WFDH 1A9BA 4RAUB 2QSCL 3U83A 5EORH 5LGKA 3RGVD 3ZSSA 1YNKL 1CDCA 3EOAB 4F3FB 5EU6A 4P2QE 3RX5A 5D70L 2Y6SD 5FYKH 1MHHA 3K1DA 1EAJA 1D5IL 2ZG3A 4ZQKB 2C5DC 2HTKD 3MMEA 2E7LA 4HWBL 3PQYD 5D7JD 5D7IB 1T5XB 3N0PB 3D48R 4YFEA 4KVNH 5J57B 2FO1A 2W38A 3LQAL 1W72A 3C5ZC 1XIWD 3MCLL 3O6KH 5DJZB 2PYFB 4NO0D 3HPLB 3TT1H 3DV6B 4YFDB 4XZUA 1K85A 2FB4H 1A9EA 4H8WL 4K94C 1FL6B 3LRSA 4C55A 3PL6C 1T0PB 3T0BA 1UEYA 4P4KA 4Y4HC 2VLKA 1DZBA 4XI5D 5IIEB 5J6GA 4AMKL 1ZSDA 1RZGB 3HMWH 1P9MA 3KNBA 2OL3L 1VDGA 4QLRA 5HJ3A 1TJGH 1N64L 4UV4L 2PETA 4XBGB 1BEYH 1UWEH 2WBJD 4XNUH 3GMMB 4LSTL 4QY8A 1ZTXH 4RAVA 1NC4A 3KXFA 1KPUB 3OKEB 4F58L 5C0FB 4LCCC 4PYHA 3H7LA 3O45B 3QUYC 4MA8H 5I1IH 2VLRE 1CL7I 2WM0A 1K3ZA 1HHIA 1EHLL 4PS4H 3PQYB 3H3KA 2QQLH 4K94L 3FQTB 3PDGA 1UXWB 1KXQE 4NHUA 4LPCA 2Q7YB 3MLZL 3EAKA 5IW1A 1XIWB 3FFCD 1I1FB 1FVCB 4NO0B 3T2PA 3A6BH 5DJ8B 2ITDA 4JDTH 1A1OA 1DN0B 4MAYC 3ULVH 1D6EB 1U8MA 3HZVB 3RI5K 4XAKE 3BDXA 5FB8B 3MJ9H 2AGJL 5C0GA 3MLWH 1DDHB 2EDHA 2NNAA 1T2QH 2DJ4A 5E00A 1KELH 3G5XA 1MNUL 5JXAH 1GRWA 3IYLW 1A6ZB 4WEBH 5TE6L 2C1PB 3VFOB 5C92A 3KLAB 3PWUA 5HI4D 4FOMA 5TGBB 2MCPH 5JOEA 2HRPL 2UZIH 1LHZA 2WBJB 4ZSOB 1IEBB 2PTTA 3WN5A 2IFFH 1HSBB 3BP5B 2MCG1 2BSSA 3SDAC 2VABB 4OZHA 3I9GL 3K2MC 3DO7B 4U33A 1UA6L 2CDGB 2Z93B 1QHOA 5AYQA 3SDYL 4G5ZH 3MLUL 1ZHNB 2AJ3A 1MJ7L 3VMPA 5JQ6H 5FK9A 4M5YL 3JZ7A 1ORQA 3TYFA 3F5WA 3MRKA 1I3GH 3FFCB 3HC0B 3LVEA 4NPYA 2A0LC 3PG2A 2ZUQC 4K8RD 2H45A 5I18H 1MSPA 4UI2A 1X5GA 4M7JL 3MRDA 4JM4L 1YUHB 5I16A 3BESR 1P84K 1PBYA 4I0PB 3U9PH 3NFNB 4FG6C 4LP4A 5DT1L 1R3HA 4WI2A 1IGYA 2VLJA 3LRHA 5FOBA 1CR9H 2ENYA 2XWTB 4FXGB 2YMXH 4M6MH 2X2YA 5EULV 4TTDC 3JWOH 3HS0A 4Z76A 3QG7H 4FFVC 4CN6A 3G6DL 1DQML 4JQXC 4FQHB 4XXDA 4M02A 2IQ9L 3MV8D 3DJ9A 2PR4H 3RUGB 2FDBP 3C5JA 3BVNB 1MAMH 1O7SA 4GAYB 3VRJA 1GYAA 2W59A 4RGOH 1SBSL 2LV4A 4HKXB 3UYPA 2Q3ZA 4YXLH 1FO0A 1ZWIA 3CLFH 2P47B 3T3PF 4OCWL 5TPWH 2X89A 3KPPA 3LHPH 4DOHB 2NTSP 3W11D 5AD0A 2CLVB 4Y5XA 3P40A 1CGVA 4YC2B 3RZCC 3TLRA 2J8UA 4Z7UE 1OL0A 1U8OA 4EN3A 3REWA 2NR6D 5CWSB 4J3UA 5C71A 2B20A 4MDJB 1YEJH 4HUXA 1DQTA 3OKNB 3PE9A 5EN2A 1GIGH 3O6MH 4OZFB 1D5XB 4F2MB 1ZHLB 3MODL 3DROB 4LRNH 3NA9H 2IANE 3IKCA 1JIBA 3QWQB 1NCDH 4NQDA 4OFDA 3ARYA 2DIBA 2Y36H 1U8LA 2F8VA 2OMNA 4JN2B 4GMTL 3MV8B 3UMTA 1ZS8B 4YIQA 4C83B 4WO4C 1V7NH 3S34H 4PRPB 3C87A 2CGRL 2FJHB 4JREB 3VMNA 1MFBH 3QCUH 1LEIA 1AXTL 5GJTH 3STZB 5I0DA 2QR0A 1DBAH 1Q72L 5B39G 2Q86A 4WUKH 1FBIL 1OWWA 4HIXL 6CGTA 2QLVB 4PJ7F 1ZT7A 4CVXB 1CK0H 2X9YA 2WINA 3VFRA 1G84A 5GSVA 3FHAA 1H3VA 3OAZH 1SYVB 3VI3E 3U1SH 2CK2A 4ZOBA 2AKRB 4P46A 1CCZA 4HZLA 1FFNA 1VEOA 5KSAA 3K4AA 2NY0C 4L9LA 2LTQB 3C8KA 3OJ2C 5JR1H 3I2CH 5D6DC 1CFVL 2X70A 4ZUTB 3OAUH 3SEPA 4JFHE 4U1IA 5EZOH 4PR5B 5E8DL 4E41A 3HAEA 4ONOA 1OD9A 2VJXA 2YD2A 5HHME 2VXVH 4W4OC 4RBPK 1NFDA 2FCBA 4ELME 5CCKL 1KJ2B 1ZOXA 5T33H 3E3QC 4JO4L 3W39B 3TP4A 4QNPE 1AGEA 1GZQA 3LIZL 3KYKL 2CSPA 5CEXA 3QUML 1LD9B 1UZ8A 4ZS7H 1C1EL 1AGFB 3VG9B 3GI8L 3UJJL 1KTDB 3O0RH 5E8PA 1EEZB 4GQ9H 4URTB 5GXBB 5BS0D 4L5FL 1I7RB 1U3HC 4YHLL 3SO3B 4JLRA 5F7NC 5C0RH 4XNXL 1HHJB 1UYWL 3GK8H 4GO6B 4OZIF 5F7WC 3ZKSD 4OQTH 25C8H 1S7TB 2YUVA 4NQVA 2R1WA 3GO1L 3BZ4A 2B1HL 2Q6WA 3KPSA 2CRMA 3B4NA 1RZFL 1HINL 3ARWA 5CFHA 3HA0A 1MVUB 2ZUXA 2CDEB 2UV3A 1I3RB 4PJIA 1FGNH 2D0HA 4PTTA 4UV7L 4HAGA 3VFPB 3DURB 1C7SA 4I5BB 3ZKQD 1X5ZA 1EO5A 1CGXA 4LSPH 5GGSA 3QFJA 4CGTA 5D2NA 2BOCA 4NSKA 3TNNA 2UWEF 4E9LA 1P4IH 1VFOA 3MRGA 2B0SL 1OOAA 3GSXA 3DGGB 1KIQB 5DMJB 3QHZH 4DN4L 3VFNB 2Y4SA 2DLFL 4Z7QF 4RAHA 5EZIL 3T2NH 4B53A 5BS0B 4CUCA 1OCWL 1XF3B 2CRIA 3CH8A 4GMSH 4MA3A 4U4BA 2CH8A 2D7OA 5EC1A 4PG9A 2VZ3A 3BX7C 1TITA 3G9VA 4OBRA 2VL5A 1KYOJ 4APQC 1JN6B 5KVFL 2QSVA 2R39A 1BF2A 1IAKB 3H7BB 5GRUH 4P48A 3LKPB 4MX7B 3AFLA